ELF( 4N4 ( l"l""BBPX!"\\@0 6QQ O @@( @0 fH!@P@Q?H3}Р -LX/Pc*e@bcmain() returnedc   ! X(@@T @@ 0/ccT (/// P--Nxd@b@-@PL00S @0080 0 0 0ᜌ ЍXbBB>P/00S 000/XbtdA-@MpQyP @ލ0s BPP x0 00㳠`ᶔV x h勩@ ᫏ 0R(0R WfOoB>edA>\ 4S/0!8 00 (   !/@bd d$d@-뺳XhP|-0 !!X0T0P0H000, !  !&>.>@bd d$dG-bM0SpPpP7P x8ЍG趒 k@T fxPdx r  P ePP 00 B4R  04!@a0C0 jT bj@ jP@ j7xP 3xP nxP P CjaxP|\xPlWxPP xPx 8奨$ 0@ d?>>d>I>L>O>R>@-<@6xPw$0xP*x@ sT>>>@-l00: S?T 88S!~J0Yĺ@ 00 Bc@B@-0@0PS@!@/ 4Sʀ0! 0    !B? SO,0 !! H)D'<$8Խ0T[ctd-@bd d$d>> >@B > P00  /$@$0P  000/dPd<0 P0/S/0CQ/cs@-A0S<`P`sP. sP, sP P0000 8~CPЍp@躵xpsP`h@0: SR P0RЍp@M@P8P0Ѝpb$ >+ >2 >p@Xb9 >c` @ @O-M[`&pP{ ?WMM޶!7GR  Ept~P00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0弸o36rP L "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<$1)0C$1_0!10C0PU0S 9#9S  @P :$1I)0C*$1,_1,!p1c001 1 @P :|5*$10C$1}_ 1 @P :$1Du*0C$1o_0! 10C01 @ P:$1t*0C$1\_0! 10C01 @ P:$1t*0C$1I_0! 10C01 @ P:$1lt*0C$16_0! 10C01 @ Ps:$1*0C$1$_1! 10C11 @ Pa:$1)0C$1_P#Hq㰃 uHW#H#Hx#xHp#pH$p`3`` \3!XT3 0C 0p 0H! 0I 0I H": H": Ht: H\: H0p09 H 0p0 :HXp!sI!p0 ?H<!L$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xA, 1I0II010! ,1,! (1(!h$~)B! 1"wLF Ѝ? >@T > 0 DSBOctdᆳb$ >0cAiPb)i?dlc`0 >G >@chccTcccc c c@4cHc\c*e BzBcԍbc@b(b $b @bp @- @0 ~PЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ #rTTU   ,0PP<0P 008o@P`\  0<0 0^*0 00 \S 0 >O-0`(Pp V@ nP VPPP00  xP 0 0txP PP0 0@wPp  p@?P > > >G- @3`Pd1.0\\$p0PfGpU' 0SI 00P(0P pW4 pGW=f/pq 0<0 06003/EP000( 0 0# wP  wP8S P7P f/>q$0}P`  `Ѝ >WEV > >A-` 0pd 0@h 0Pl0`S X, P I/ 0V 048<S Q PU nP0 R P  0`PU0 0 0` 04 8 <0<0(UPXá R  $  (3/O-@M`Pp 8g\(0P  P0<0((S 2<0T0Q00 0 0@4pWH08(`S,P 0@P P00 PPX0  80@@!b30X0yP㰉,  0 0)0#@P 8E0<Ѝ谁30 0yP[ 1   0 0v P9XP 0J0 D<U 00 < P @@bcx@D c  >@-@p,M `P[(G@0(`S00,PP 00S00 0|!000gE,Ѝ sd@-0@-@nP0 0 000@p@-0M`Pr@|P00 0 0000 0`P 0Ѝp@ȥ(P]0(@400800@00D00H00L00P0@r0 00 0P[[00T0  0 0(00< ,00a0Ѝp >' >) >       N >+,00 SP/o/cA-P0@Q`0p$ 7/0 V0`08$ A#8/p@-0@P0` 6/05`8 p@#8/p@-h0P@ TT0pH00 S /o" p@Sptcbc` s@-`Pq`0@0eƤ qqPB 00,R P, 305/PP Ѝp@ `0 SqP {\0@X0Ѝp@ @0R Ѝp\ >v >@x >ctcb` @-@^P/o@"S$5cp@-`PL^@Pp  E$00Spp p@:$5cp@-P`^@PpIFU  ' p@"  $5cL0 H0R/p@-P4^@Pp&U p@ c` $5cp@-P<p^@,l^P  Tp p@$5cp@-P<[^@,W^P Tp p@$5c@-@F^P @ $5cP0 L0R/p@-P`84^@Pp /op@"c` $5c80 40R/@-@ ^P @c` $5c0 0R/A- ^PP 003/X@  ` 08#8A/`` 0 8/㼶 Ao0 0c` $5cp@-]P]@Pp0 0`6/,P0``6/0 0P5/,p0`p@/$5c0 0R/p@-]P]U@ 0$ 0`6/3>$ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/c` $5cp@-df]PTb]U@ $ ``06/Tp0`$ p@/$5c/p@-0 P T@``06/0 ``6/`0p@ /p@-P@o@0 T000S 0d00h00p0x0h0x0p@M S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` c( A-0PST@ Sq o Bu 00 `0*b6/`P vo  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@ > >@bp@-P0 ` T@003/U U 0r  p 003/p >@-00 c Ѝ 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dA-0`@TP Vp V h00 3/P0T00 T0 `@4/A0T0 `@3 >|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~נ >@-@00 S @0 4P@oЍc@-0 00  0 0 0ЍA-PS@`p a P PA詡W    P 圡UA`J >k >p@-P`AnP0|P@0@ǡSP'`00 P00   90 0pJ >bA-p`U[PP 0S  W000V0000 @1 #W  R0 W00S 0$2V  R0 0#V00S0 At5cb@-@[0P Rl T0@0@000@0#3T  R0 0#T00S0 @@L5cb@-@Z0P Rh T0000  "!0"T00S0 T  R @%5cb@-@Z0P Rh T0 0 000 02 #T  R0 T00S0@ 5cb 0o/xc/0@-0M P@ 0XP 000 \Ѝ0(2 p@-0@Tp@t ℠㘫$0dP 5/0 dP5/00 0p@xc >A-(MPm@D1P<妠40100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍA905p`WV xxp Pd( U0 0@0 0X(Ѝxc >cb >pA5 >02 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d@-@;A-0@TANA⼟0P`dp 7/U zUA肯sUoU U 0dP5/og0dP 5/0 4P5/ xc >p@-0@TxP\AxpPP0 4P5/ 0 4P5/P- +)xc >C-1M@TiARЍpb0` dP5/ 0dP5/P pPP p d09/0 49/ 0 49/ 0 49/PU ֮ԮҮ0 dP5/0?<#xc >A-1@T PP0` dp7/ 0dp7/ 圮嚮奮㝱0dp 7/0 4P5/ ㌱0 4P5/ 0 4P5/Ptxc* >O-,1P@`(儭,偭0~4{0p,(04NL W O@P0 C H(? D(H @[P0A 2 (ݭ ,ڭ0׭4ԭOT/xc0S@- S S@@XBP >0 @o/c@-ʹ@PЍG-@Ђ2PRp`0CRdh2R 3C7CR0 0 $ G,2RW 3C7CR008#8S800 05 &5004004 0(0L00P0  , Q  !% b ,R!X , % , h0l0& d  '!00 !11  0P008#8S308#8S0x`0 pH5 p(`8p<B500500``5008#8Ss308#8SmSW HdHdx > >  >@-@`6jPh @%`0`` 0X 0P0` P00Y04 4^PhЍp >b >0m,bh? ? @-j땳@-j@ၳ00: S/wc >b00@o/c` @-\@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gy2RS 3C7CR008#8S800 04 &41414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011,P008#8S308#8S0x`0 pD4 h(`8p<>4151``5008#8Sy308#8SsSW HdHd >> >@-@`4iP@d `0`` 0X 0P0` P00X04 4\PfЍp0>b8>0m,XbpC C @- iv@-i@j0 0R/  Yc` 0>xbp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f@-@/4/@-@/@-@/@-@/@-@/@-@/@-@/A-PpX`Ā0@ 2/ p 0S0@0 @0000@A-P M@`ᮛ0 0 0  p7/0P   p*7/0P  R Ѝ "( p7/ P\ 000 00@001 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd  3+|000040J> 0 0000Ȅ 8/0$@0\0` (?p>>>>>|c > 0 /|c/$ R/P//C-p0MS *P`  7 @dP 001Q0000!T0    *40 00 d6/00@PPЍ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0"" //@- "co0>@-@ 00 S@@cQA-P@@@DT@ 0S 0S`T p` 00  `T@T@A-@fP@Z廙`0p0```p0P0 PT0x Ph0X P@04 PA7><>cM xM >M M @-f@A@-f@@-f@ |0 0@-sf0 0@r0 0@l0P/fc@-<0@TP [0 0 @Sc0P/QJcp@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  ppcRW SW 0o/c///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S @ިP0T00S,0upG-M`e@P2`0pU봂嵘XP@ @0* Rp "Sk pd2d P00 000!h8" p-PP0~0$~P(0SHP㰑0SKP 1@ȧP 1@P h1@帧P H1@尧@10S h ,00h0 01@0b0!TdЍ0!p P_ a` P0p 0P0qw 0* R t0@sP S T0@cX>cS ` >bS Z>O S O b bb,>bW \W @-e//G-s@dVʀ 0! $"0""   !P 0x P0S P0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y ḧ ϧ 㺪0S Ƨ 㱪P0p P ,0S -0S (05#0x ᏧᦧP0p P Q 0R(0l0 S$00 S YX0S`P\ d$0PX0 0 0?cS? 0!D d08 0   !G?@bd d$dcbgfffp@-T0P@0`0\00`X0`0s X 0\00p,c'@-@0m?P @-0 @o/c//0000/QR R / /@-MP`@pT0 P0 S0 P @0S*0 TQ 0R @Ѝҩ`@VUUU'800: S/@-@@"c// 0!< 04 0 (   !/@bd d$dO-`@P o{x0pS㘀|P xPW PL t0S 0S ʌb P00 0SӀ0.X01 S5p,`P< [ p0S7Zy0S2W 1x0: SR1!0?Ac4:>Sڀ t@pS9PipX c 0&h0W00 S00S Z W  0k|0S+ p0 |PŏX 'Sd d C 00PECBE 0 0C|0`  0 pX0 < ЍO P0 Ѝ>cbgfff:>Q@-Mpb`@ pD奕=4P == = p10: SRZ e0s(ROL@  1٤@  1ӤP0P0P 00P0@S 0@L 0@E 0@>|0x 0t00 0@QP <@00R=Ѝ>>^ ^ c^ _ ` Pblf#b@-@-@<0 @02=b@-7@-0@P1 ㅝp00200 |p0000 0000000000 bp000 Ѝ0\ P/0 !8 00 (  , !/@bd d$dp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000>>>0 @o/c@-):@P0%@-s@-P`.a@帔P0F.0 P05/PP Ѝp@e#У p0@#] )ƣ H0@)S dP,05/Ѝp@>>`@ >b c @-//s@-P``P@ 10: S)Q00唣呣@ 0P|+ 0@00D00<@H00L00P0叼0P |啢0|0Ѝp00!00he0 P,Ѝp@cDf )>c e |e de S>t>@-匣P@-冣o@- 00* R | S冣Q@ B` HА000* R Syc` >@-@啣p@-C9!: ^SpP3 @4T004 0040606L00L0pp @bb0l4/@-@, B$0 0Z?(nЍdf >G-P0 VPU0p`@T qp YXC!Q0S@p EX@P \QH=Hm{@ϋ m@@c>>>A-` f`V@lPp@T 0Q`H0E{먋 W@Sv cG-`0000@p0PU t0(60\ (0S Z00P, @\@ "cP/0@-M@P 0 P @  0g@Ѝ00@-M@P 0 P @  0g@Ѝ0@-P0M000@R4`pO0S0 P@ 00 0`0f@0 0@P@mЍbtcT e0@-M@P 0 ]P@  0f@Ѝ0@-@0 HP @  f@pЍ P@- R c0/cp@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !pc@bd d$dp@-HP0PSp P@ `6/0  0p@/cp@-x`0SplPP@00C00SP 0 `6/T 000pp@PpcbG-pP`P@ P" P PV `FPE⫎@P P #P`墎T00Y0S<4啎 `@后9>7>=>?>/@-0,\ @T 4/Ѝc00S/ R//c00S/ R//cp@-@P. J[.0p@80/c 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/bA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 bq q 0  )?)/ 0  )?)/^/@-@q dQ0P0Cq 8 q (q ߐ>>>>>@-H M@68ѐ @F000 0H Ѝ>r 0@- 0@ ,MPr           0 040$0eHP 000 wL,Ѝ00bq /0/!//A-pQ`.0  P@ x0E+P Hpp`@tT:80*0 5'J b@dM>@->@->///1/8#81/1/  R/ R/ 0s S40@o//0@3S0/@b/>p@-@0PT3/>p`S0p@8/4$$#   p@/>>>Q0 Q Q // >>> >O-P`$M 0 3/$Ѝ03/@yQ  0R $Π  M3/0 0Sp00 `"R 3/ 0A0CS000 3/00u00d0 0Q 0 3/$C H! 3/(!0AYS-000(c0C S#0x   03/ 03/@ 0t3/W  0\3/0 L3/W0A CRS 000 0R(3/07  1 2/0 30 r#03/ $:$(0". `: S0P3/$&0$ 0$3/0 0 &6z R'zppF0$03/60S 6&0S Z0  |3/03/ Z0Hp083/$O8 OS   F0$03/5t0S W0  3/   0 3/W? 0t3/0t3/0pd凰Jq" W  'pS 03/ GR03/0pW03/0S3/ '$0W$ 0FL0G$80 0C2/$01?3 ?3!?#;00 2/@ 0q0 00s00$* "0 : 0#$90"?  :$#: `0H#0$"<407S0 S0s03/ 03/ 03/ 03/0x0s0n0|i$3 l0$2 \0$0LD, R$03/ᴡ$03/t  03/03/0t3/W6 0t0q$0 3/$($0 :/0 oPq0 3/200$($0 %:/ $8$&$p0 7/0N1$> >0$>$>$>H&>>>$>$>$>$>$>$>>$>$>$>$>>$>/%> $>%>-$> %>@%>$%> %>0%>2%>z%>%>%>%>%>%>%>%>%>%>%>%>%>%>%>%>"%>'&>9&> ?L&>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O⟊- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//@- @/0/@-@/@-@/@-@/@- @/$0/A-`@P (pW A/ ,pW0  `//p@-@$0P`P 4@!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S op@4@b ,00,0/0 R,00,0/@bp@-(0c0@ TPUp@bp@-2@02 P<0#0P20C22S Upp@  p@-\0!C !2 Q02(0$! 巊 (0$!p@@bR/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/@b -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R D7?P 0=S0@V20V 0  SR0T=Sp'p dLP@ YL  KP   P Ѝ *>7@- 0@P P0P R S*j @ Ѝ0@-@0 }P K >oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0PN@ @0 4/@TP @> 4/@G8HMc1 !0R$04$0/|b/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ̌bccp@-AQ+ 0S R[ xhN0_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0$00pB@寂cAi!iLb*>1?/ //0 ?1@o/̌b//0/////?  22//-P/6b N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: Nԍb؍b܍bb1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  @(00(0/O- R\bY I* b$\" kin_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0@bH00S/@-@0  "!$0p03/0 !!hcc03 /0@-$@4 K< 4 @ 8 L < @ 0 < /p@-P$@4 K40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0p<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@60` J1017800|` !.pW 0000 0 00 `L<`划0@0 0S101ߍ@b@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  XŻB101101w 0\! 6 SSO-0`@p0M 46CSЍO/t 6000 0$0L0 0C0C004pЍt!pppV 0  Z 0cQ  .J J<!PP)1\Z 0  PP P0  0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C @bb02/0 $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S p@-0ZCU lPC^   LL& &p/p@bpP 0@- @ |M l Q \\ QQSH0t S50  !0 @|Ѝ0@b0!R 10/cp@-@P jdPp c0 S   Yd0@-4 0S$ @ cbO-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#  } t c40  !0 P}|ЍV@@ 0 ;/P t D40 !0 P$@|ЍO[V@bІbc*>^ \  "O- p`0F   0 00p(`$  0,!% 0    0p(`$  0!% 0  ,  0p(`$  0, !0`%$  *  0 00p(`  0!% 0 9   0p,(`$ u0$,00 '!$ 0 B   0p(`$ ]$0p,(`$ H# 0 L  ,    H 0!0 S   0 00p,(`$ 3 0 !0_  0 00p,(`$  0 !0m  0 00p,(`$  $ 0 !z 0  0p,(`  $ $ 0 ! 0  0p,(` 4 0 ! 0$  0p,(` < 0 ! $ 0  0p,(` D 0 !0  0 00p,(`$ H 0 !0  0 00p,(`$ L 0 !0  0 00p,(`$ r 0 '!0  0 00p,(`$ [  0P!0@0 0 0p,(`$  @E <Ѝ*>b8 $m2 hc @bcG-`pMP `  @jF000P00p 0@R 0 p0 00 00000 0 ?o2P0S0 SЍS0hcc A-xM@P`` p2FP0HB0X 00 000000xЍbC-0|MT@T 0S P`p` FH@B0X 00 000000|Ѝ-cG-锐xMZ- @P`` pE \HHYHB0X 00 000000{xЍdp@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/ cc@- @p03/c@-@0 @T  0 !! x@<b+>A- ! 1M03/j0P `X@P pX0 Ju T@X|c@@@ K9@p`p07b /0Z~]0pL p400$p00 Ѝ܀bcdM>cpcb@bb/@- 40@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00P 0S#020 0xP 0S"020 0kP 0S"010 0^P 0S|"010 0Q Pd 0Sh d0G Pf 0Sj @0= Ph 0Sl 03 Pj 0SnЍ0(Poq!000l0 Pn0Phj`!0@00e0 Pfh0!000cX0Pdf!0:0a,0Pbd 000_0P 0800Pp 0800P@ 070|0P 070+>td+>+>+>+> ,>,>,>,>,>$,>*>2,>+>+>+>,>,>!,>,,>/,>9,>@-H00S<00Sr0 00000wtЍcc00/G-Sp@` A S5 S11P0 @D`Fp@03/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0`cdccO- 0@4`lTD r0PhqX pYG  X ЍR:B Z: PN Y  L\!TWX D p(p W*Y )  p 0S p    0@pWr P@ \ @-0QBQ*   P0 x/B,>A-Pp4`@^P 0Pp 0<0`@P00 (@0 0,0 @b4^G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 07P  `FP@VU0,00,0000,000000/O-0p `0 W W W Ѝ@04"0 S )4S 0"4PS| V1d0 ЍO/ @D P T*P0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!*0 0 A3A3C?o20 0` @ `FJ0V @DP T*0Z*IY! 0CY!08 0 07 @ `FJ w .wdM>=,>cz,>G-@Pp @ЍTCЍb2"0S@NF0j0O-@M<`N@N;@5TpP3:T#3p0 s?oZ20S 0 hPH 801P;0; 0 X0=Ѝ`@ 0 SPTv0 0 0Q0 R0S 000 R!>S>0 jJDV:FQ: 0 bdM>,>p@-PN@N@ 0 p@0dM>b@-0 PS@0S 0#G-p`@00hTЍ PZe 0 UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 Ѝ@bO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0 H`P0``>0 BB6*a"*UbY 50 0  0 P PE 0H0 H B @bO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T SAP%@4 P @[H0@@ 4:S P%0:0PD0@S A Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xPA-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R f= (0+0  VPV0P00 0 uЍ R H= *0VPV0P00  0 | u$ R .= (0+0 VPV0P0 0 0,>(->^->->//C-M`@APT#LVt,'@Rt0'4NtUF/$ 2?0Rr 岟LQ PPPL P `1|pQ t 000<0 t cЍCtЍ->->->cc$c(c,ccc->C-HCM`PNAT~ЍCtRn  "Ÿp"0*P*P l. (qD3SY;P 0S(D;X!\1pP H T0( 0,t( t s tWT3=WGT3tT3@tT3  tt1!0S 1*B0S0 1F@T1-0pW0p!(q`1 0(0s(}t G R$$utT3 lt!1@TT0 0 0 0  xW pYU  tЍ@t 4Lt6>bd.>,>7>7>7>&7>w7>7>7>7>7>AXV6>h.>E7>R7>^7>k7>*7>`A`A4clcjB7>7>C-`a@P\@@P03/sTDc03/0L30HP3,G?b07@x@40C 00zN0  00lN0  00dN+0  00\NH0  00TNe0  00LN0  00DN0  000f 00Ma?0  00Mgoj0 `M04L ЍC @r ЍCRsc@b88>9> P-`@P p!c pЗ!P  R $LpL 4D` 4/!`@S`!W , ,`! !oDЍ@bqReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! w!oDЍN  0O   ! "`"Рo7E>E>E>E>E>,F>F>F>jE>C- @`p(P  0S 00PAP 00(0Snp(Q 00(0L0 Ѝ@0?  0 L0 00S 0 qt #'  p$`FF>s@-@ \ \P`t  ' 00 `$PЍp@-1@``QPM R' $ pz? 0    !Jn060Dn$0W0>n40(x08n080L000nЍ@b`F>O-@D@M0Ps3/03/10100S  !0 0Co 00嫲Š4041 @T 00 04/P7[ 0n`S5 L0  m@0 v V%* Q ( R 0R6BS 20000St _&00 0(00,008<0 N`1000 :S0L0L - 0Q0 1 ,212:+*B*R8 L>; T S3 RLDLOoB@ 0 s P 4(S$ [009{m 0S00&R ! R &R h!h R \A@X1T@@@(0 0P0( 0S H  R [ (0L0Ѝ0 9mt %0 Z0o Z ZA``PzO@0 g0 Tm 0(0^ 0Y ( Xc@b\D>cbdG>G>G>O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 P/ t m%0 [0 0a`Pzo`0 ?g0 l 0 0 0t M%0 0 0$  00@4@>0  P0 @TL@0* R @TЍ@bcG>O-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ?oT20S00 ?oT20S00 nc@bd d$dG>00P (031000Co//,b@b!:!P/ 0 00S/@0. 04S/Q0 /0,b @-$C.@-$O-0@|Pc0*4S/0S0 0 /000/c*4S/@-0@03/0BN0cQ(QT0\0 )Q/R0 S,0@0D0//S/0H0cQ@-@ (4S80BNX03/00)4S0<03/0)4cp@-@0Do A("(RP p$$Ph$! ,$" \%R 8Ang00CS0p0 p@ cg,bcc@-@|0T0S$D 0SXϴ 0S@@<0QD$   D$ @@DD,b@;cc0 04Ē Q884/0H4S/[,bcT H$R [@-@@8P 084 $ 00c 4c,bb@A-P @`pTQ 0 "A2P 0`PR  V`p@V0A31003@b0P/@- R   B B  P^^ $ B$ , Q R!! B B!!,bP/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  ,b0S@0S//0O-P` @P\Q pQ00ЁU00SE R㴑; Ѝ ^^p1Q@` Wp0U0 WU0 `` 0!&Q0 !SL   0E&  @T00 ЍO/QᤠT ``  U [  R`` `!& 1!L0L  o@,bccG-1pS@0!R00R0P  \  \ 1!1`V0`0ó?0`QP 0  ^ ` 0S 0PR" S 5YY 0S 0h0hS 1S 0h   PU0S0`000I>,bp@-0PPdL4S N@l $60L0V L0?4`003/03/+!pc,bcp@-`PP:@²<@1t[TP_X[_P`\003/`003/03/`\T4PX4P__p;cccp@-D@[PX_0``003/03/`X4P_pccO-Ph4dpQLP4Q9 @䀟䠟fU*%*1Qh \ : 0010?0@03/@0Phj%!1PLP L0]뚟@03/@Zcc I>/O-p64M@00U6PH4S 0 9 0` Tz]0 01000X0000S 6T =0P0 +60$00$ 0(01,0(010Sp P p y9pV, 0S%J>O-@4M` v TU2T 2x4ST B>0PS0 4pp0V :ᝰW @T]p&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% 7P <00  TJ[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sj0(4S   0x W4Ѝ,b@b0c;cO-@p@P` 67PP`<` 奯  *60Q000  ԰ @03/00 3/03/Ư  0P4 0?PUP'S 0h<0;OT00  S  S80d5 ,0L42 S0`5,bcc`0@-0@D0PSM%PЍ00 0(P &40 U0*0 d@O-@po(T:c003/OW$ZZVUP!N`$5ᔠ?`U0 0C06P @0  <@0Hv 00?@03/003/J`,bccA-p@`P)$4$*$00S(DF0@00V@U($<01S  2# R$60X 0S(H$HJ$J@L W000 ,b00 p@- 0$@0P000Sp`H4S d0)$4$1H P4fh5hE000D40@@DDpc,b?J>O-`MlP@\0I 0000 T : 0 S:0SMቮЍO$jjf V `!vP@ p$5?pT*. , 0 5 ᚯ7뚯R0 <%0    dK0  R!* Jp +4S 0,03/0+4Ѝ;ccO-^PPE@p댐匠ZT:O  `fV`!P@ $5?0CT*0 GQ!803/@ZcO-@p$M`!ḭ'<01S 01 0  000Y' ^'v00100PqW X [  G E5P H勭 <WP 0 忭PἭ$Ѝ @00@0 00 0孭0皿  w뚿$,$$0 !R3 0?  PX4P $B <P 0 @00@0 00 0n0皏   8뚏P R0lœ\l% 0S 00 L[c0 @  0pRc 0 )Mc;ccfJ>J>0 #!R/080/@bcs@-@P) %60c4`P 8Ԭ0 00< Ѝp@;cO-q3Sa100@-4S[0,4T倁勰U !0 PU ,$$#2$$0 SQ8 0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$  2/03/00  !!000T(4xDT U0-40-4|D Ѝ|03/VBn@b,bbcc10 P0  044-4/@b@- 4@S 0 4cP $0T V0(4 0@0/,bc@-$a  y^ @ 0 4$(4@T R0D4 p000 00S 000D40P0D4A$TPp,tq0000'0$4$0!*10 ,$020 0 Ѝc@;cc@-@ 0 4 p@-@Pp 4S u0 4'7P Pp 1T 0(4p1q*2h$T嬫 0S0Q D$,$ ,$ B  B R @@TQD$h0 0TɫX0x$R x$p@ 4]DPD$,bc@;ccc@b@c@-@P@7G-`xdPd垫G@@@ @pW0S   别YQ @T0,03/03/YP`ᶫP o.kV(p0t0aU4 (0C4 040C4 0 @IX;c,bc0c@-@(P0c@J>O-0P 0UM0 0@p0 0 0   P@`PkتҪPUЍ0    0* 0 100R `0A  S + + 1 L4` 0 0 V'! B!! ! R 0Y0 0 皟  *0뚟ɪ 0  0 5  B    S 00 ";cc,bp@-P",c@@@ <e@噪p;cp@-P",R@@@ <T@刪p;cp@-@p@rp@pI>;cG-0X`TL4 90?003/03/@`pP 0` S@03/@@@00?003/cc0' 70/cO-xBMgV<*dZʀ 0! $@"08"0"   !֩&j aw0W:Q<03/,03/03/ 0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0c@bd d$d;cc,bhcp@-PPP@}$F@0S0?@003/0p@/c,bc@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-4TD,M`w|T0 0=$4  !0S2 $ ,P$ a&20PYp ah  0000# `ˁ \ $4P$ _` V (P ^b<03/03/03/2 x嘧Ћ唗P  )5? T唇\딇(P@`(5? `X唇 "0S70977'3C?6C0C#:%. "&0#2>0#6!' 7MD h@p1q $4!*$010y,$020 0@,Q,1 00C0@@ @@}X1 0000 @@Q0 0 000@@ @@@dX+0P000@@ @@WX |<0,ЍO/@b,bc;c;cK>;K>c]K>K>c dK>8c@;cccL>| @chb0c` c,!cc5L>@0!S@0d4 S00h4 S$0;00;010?/c dp@-0`S0@LT!* Sp0PT S`0dUP0SHP,y_$EOR0?pcWL>L>@-!01; 00? 000$,bO-~0PP04 N_p~R@p R R1!ěd`V Ѝ|!t1d弋Ld!\1h帋PV[#0$ ! \ /FVfF<R0 R  ^ P -$%/("(VR#  U뚿HXhF /JZjFL> dcL> !:!/ .,bA- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p dc !i!!G-`@0匀pB00>0>0PT0?0?0000?$:aP(K^$5?[%J܍bb)M>O-@ᨐ娀zT:00ЍO/ 06Sx`1`!-P$5?PT:0?L0 HS @03/003/ Jc,b0$4 /,b0  ")//0 !Р!/0 ! !/p@-PM0P# @,`~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍp:cʈcb002'0 S#3/c 0P/ch0qp/@-^2P p< 0BS B 00:cbO-@2@BM<03/ sr $R0S0  "S  & P[ЍO@q[/`Ph 0Se 2@[tЍOz[iP;0Q@p1į0 00S\>0p00 I06SP1AS[ 0 G0:0 0 0 0@KLM>M>M>cd-N>M>dM>hM>M> N>M>*N>M>M> N>s@-0P `R0  @P1 00 @Ѝpx0d03/00 `40P0  @P4000400040@@8N>cb/0 'G-p `P /'~M0@:0$@P $'U 00<0 0@0$000 0 00@D@D //C-H0M00p0s\00LP@0` 0%&x00@`@UЍ ~0 00 Z̰d bdM>A- t:\0P0>0\ @X0`@Dp@ u00 L0000L0DN>dM> bO-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJdYЍdM>cNN>0/ᜒb0/d0/dT0@-@0 @RS ,0 Ѝ0000dbl0P/0 S/@- ^@LS:0 0CS(0 Sdl0P/0 S/@- ^@LS:0 0CS(0 Sd @->]0 0@qN>p@-P]X0@T 5]T 0PE0%VE$ @p0S 0ES:@@p@-@P0Ppp@0/᠒bp@-@P0 Rpp@0/᠒b@-@P 000T0X0\0`0d0h0l0p00Pt|x0 aXO>@-@[X@O-P@M800Y*Ѝ0 S+ 0R'`! pd+P ! ` Y+P !  N+P 0p` S @0P#/////|/x/t/p/l/h/d/`/\/X/@-PYL/H/N>%O>/O>7O>AO>FO>LO>TO>\O>dO>rO>O>O>O>O>O>O>O>*O>0 8< 0/P0  T0S0CT0/ 0S/0C 0/M 0@ 0S*0 0S*Ѝ/A-\0S"`0PSp`?X@ 0*A @TX 0`@0VD0W @@0@-\@M0SP P 8 00  JOЍ0@ Ѝ0d4P>@-@`0 | 00 0H0 S 0HP 0p0040P@BP L Z6 YЍp;P>hn!p@-@P0ˠt00t0 Xp0S0p@#Wp@-`D @@?\P0⯠! 0PQS0  @ Pp@00S   0 /0W0UG-p@`00⌠PY0 S<80  Z7   3<80S.8倀+00W00⨠<KPP+ O20W@@8`<000T00x0W 0P0x000↠W P8008000VW002X00C0 80<80W00b00 03/0XCiVdP>p@-P @@ 0R8` 0x0 0  M00C0 80<800S80 0808W80 080p@0W00Sp%Pp0p@0/dp@-@P4`V0ҟx0Vxpp@0L00L0/L0CQL/80/W8 @0 |Q 0d0#/@- | R |080H^|   @\H@^ RQ @p@-@P00xL00Lp@0⯟p@-@P00i0p@0⠟p@-P@`0Z0Sp@0⒟800800Up@-P@0`03/0Sp800800Up@-@HP|U020C0S0P8ՑP@wUUp4P>P>A-@`@00S>l00%S P= S< SC S? 00 03/l<VU6Sn0m o48KU IUzpS qS00 03/n;U6Soqnp2p Ww03/pP 8008080@Q P80 PP8 <203/P00 03/1U6Sb1pG Wdp\ `0R0C?o20S0`0W P8008080@x :RP P  80  x %Ry R P Px0)Sy0SP80080808  PD0S0CPD0PT D0S TP0 Ts0SLTo`rpXTs`pGs 0R8TQ>Q>vQ>P>P>b4P>P> Q>?Q>JQ>`Q>xQ>P>40: -$M00  (  0 0$Ѝ/'C-$M`P@p  00$0 pJ0 0@ P0 S <'P J0 00@{$Ѝ'Q>@-4@$MJPp`  0040 000`0 @@p[$Ѝp@- M@P`  00@0< 0  ` 00@= Ѝp`'@-@ M , (* 4  0   @" ЍA-(M@p @`Pk Z00&4#0D0 :00 0L00H0`00p$`(Ѝ-$M(000 ,0 $Ѝ@-,MPp` @1 U00$4#0@0 :00 0H00D0@00p$@,Ѝ@-@PP E0P0O-4,MD(,00C#    D1P100@00a0q$00 09 0 0`P@PU,ЍP|P P0U  RTP E P!0  ` P  YpV Wp0PE\q@ `A-@p0`᳜P0P0tPP P0t0p0`t0S0ԜA-P@4`pVd0⊜T# T) T@t`@H P 0 S08 @TVA0⣜00S 3/|@T S\0Td0Sp!@8 0  S   8 d  @@@ P 0Sdp`0WQ Q QG-@@P(M`0d0Sl0Si8 00 03/XYR?0A`0\SA(LR$40X3/p(Ѝ0-@ 80 ;808ppp  0/xz 0p l0  l80Pp;80夐 Pd P0 d00 03/<R0d080p 0ⵛd0S p0Y0d  R 003/p&00 03/Qd0S60(S3@00D0 00 R0B0CS$000 03/,Q0$0 p0mw_0d00<00<0H00H0P#pQ0▛`D0Sp 0CD00M80P0 0d! \00,0||pPL0$0L0!0D @P D0S0CD0pp00 03/fQ00 03/d]Qd0S ?0A0 0S 3/080 Q>Q>bR>(P>:R>UR>bxR>i!R>R>O-q@`P\ d0P0C?o2?3\0S0v`` V)`0S&0ƚ U0d0SpP P 0 P0⧚p W|0Pt0Pl0Pd0P\0PT0`/0@ 1/0000q Q4P>P P P P P >/0( 1/00004P>P@- P P P P (<00 010000ꀖ4P>00/00/G-@00x0S G0h|PU @p 0R,L0S)80k&  80! P(P  0I 0P80 @00 03/FPPx00x0t00t01Q R00 8080;80 @P0S  RT0`F6T00bV0 0 03/ HP`0000 }c0?o `cR> S>p@-@P4`V0⦙x0VCxp0ܙx0Spp@`p@-@P|0⍙0P 0™p@It  t Pp@0⶙p@-@@`P0p<0 0⩙KP0 0T000 0T0@ 00C08080;80  @0 1T"T <08 0<0d0 0S00L 0L0d0S0S80@;8080 p@0nS 0@0nPd0S0^p@0000@@G-L @p@R` P0S P1`SRL0003/<0\ 0<00` d008 80@   # 880   080p R   080PP9 0U0 0$3/#O|(788080 ! R"  R R 00 03/8ANP 3/N#0ݘe0♘ 0Ԙ\0␘Y U 0@0 03/NVD@00N<0 0ⳘQp Z 0j[&hS>VS>S>S>A-0@S 3/`0XP00P0Pt0US0Np 0t003/ 0t00y t0 00!/@!b00#p 0t00Z U R00 0JppLO0AׅbgfffS>A-@Pp@@ @`0SЍ S`P@ 00 0X q@- ^ @/$0/p@-`P#P@ $@T @P 6pp@-@#PPp$0Spp@p@-8@P᧗@Tp0U @dp@-M@PM $0HS 00 03/M$00$PU !R00 03/M0^0 @P` 066 99000000PЍp@ET> U>5U> HdA-P@`h0C10 @B1d0S10\0` 0C 1800030A0k lA!i0C1plAq `Cq00 03/@fM00000 03/d XMT>EU>iU>O-MU>p@-P`t@TpALPd`s@U>C-`p䑟`0S Ѝ @@PX  008  @P 0SM$0SJ(0 0S0@S $(8> P? D?O 0B F $:dP 9_(0e%O 0 O 0B  $= 0PQ PU !0_AeOO 0  NNp0P06D00@0L LNDN<NQU>U>U>U>U>MbV>V>&V>8V>U>U>V>p@-P`@`0Sp 0P 80 @   R @R 8   N@:V>A-@p`00Sd0SA3/p@ l0!#B@ T_ Q@+P\ `Q ` T\@|Q@tQ< D0SD 0C\QD01TQ8008080@0 0Q @80 ( @Q00 03/4K8008080&8 # P D0S P0CD0@PUT @@|PlPLP@00 03/lL@U @KV>V>nV>V>V>WV>V>W>%W>W>V>V>V>)W>@-@`pP4P VPS@0 0L0 J Ѝ@W>FW>@000  00T0/@-0@0j0L 0$1@ @<00 /3$0S8$0@-`@0P p 0! 000 |J2Pz220 @J0 $J Ѝ@l1 Ѝ谒bdW>W>W>A-@$ P0<` pc&/9  0 000H0P 0 (iJ0d09ЍyW>A-$ @0 `<Pᒃ(p 90ἁC 0 $000 BJ10S |!L 00 0 p'$L0$0D1L R 0#3!0 #31P0 J80d0Ѝ0 8 0 8  `\ Q  C40l0@0d 40 0 d0Q 0 TI0 l d<I8"값bW>T[cX>Mbb6X>!UX>X>p@-P7@8p@m\0O-$ $M h0Դ@ 0 `0 pP<   0 00 IW800S 00L00 I<}K 0 0SC80d0%t0S 3/ 0 $ _020 \:/Y L0  0 pY `8$Ѝ000L00 XI0d08x0S 3/}? 0 ,03/ ,0 3/<〓 ,03/0   C$   0'I|2 Zi 00P` XI @T04/80 00 07~0 I0I Q(0 H 儀 0 8/(X0 000 0C00 ` :/H0 lH0I Q(0 PH 0 `6/(Q10 H0`0\, 00S 0 df^ ,03/ ,0,3/ W H  0B$ dl  XHC704값bX>X>Y>"Y>TY>XW>Y>Y>Y>Y>Y>2Z>CZ>gZ>p@-RP@ ` R R0 <oH8RJd /p@0d070Z>Z>p@-`@ 08P ^P Up] { 0< P 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dA-p0@PW@0`@0Lp0 h0 GwP0 0_/@P0d0A80帀 00 0 00 0X00\0 P040h00$0P 0e/A값bZ> [>O-M0`\L 01 N[>m[>x>[>\ O- $ h0,M `0 p0P<0@08010030 ; 008 | Fu50Su80\ 4 0\ 89/t0SY0 $ _02\0 9/d0SO 0L $0000 0 P0 0 00 00 07 $000 0? P$0% @+0H00 pF%mF0d0%0l040\@ 84/ \f,P,Ѝ3/0040\ 89/ [80|!L0Sl!0 0!!0 T!!1t0S 3/0 $ _02\ 08/ $0000 0s p P 0 S0 8   #8  @000`0 S8 00 0 $dE0d0Pa0 8E0d0(값b\>4\>bMb̵%Y\>\>\> \>A-@ Mp0HP   ` 0 4   ,  ,  P _PPP0H00PP080PP0p N`( 0P`D Ѝ\>!,~!!|! 0R://p@-P2@+`'P08 P3p@0iA-`Pp@l0S 05PPLDzExEvEm4>Pg00 b\>p@-P(@ P@ TEpd\>@-`@0P PH`@G`0\ LS Q 0DHP08 X0 S\>\>!]>(]>/]>b!d5]>M]>|!8@- (@0000$7cX@- Hz@P 0 0uP000$7cG-Q@M G0a@D{P 0!0dT` 0A]p 0V PR 0@0 P 0Q @  P00GЍ]>]>O-p`M_PPP3p@0Dh0lJ 40@ 0 s 0S 03S 50 * 0ES$ PPl0 , &R8  8 n  H  R 0@SP0,0S[l0 P0m0P3T0t0X0|0\00`0n0L@dh0000H PPR8s0 0000 00  00@ 000000000R 0 0SS ST 000900000:000000000 00040 P 00P4P 1000 L0$t%RPPP%* vH0S  4@0000000L @rЍP3/Pf ],0SdY0000000:00L~FK]>]>(5 !@j>00S 0L0Sp //O-qMp P\00C(0w!0`p$0pG3 3100 0P0(0UЍQP\0S(W`0S$pd0S @ 0`@@D@H@3`@P0D@h0$ 40L0P0uN00SH0㴒 +_0 (@0*8G0 4"<42@00`0 0 @@B@F@0P0a0 8< 0 4 Z*" S0!@*1@C00*0@,0001000 0 @R3 4940 8<  ,4 (0` $B04, 000, Q>00  1|V *+0S` @ $@+ $4"49#9V0@0$0 S00W0S  T u*  P)  P @W00!@bU ]>'$Qj>!@-@@A-`@P0P p YE0 ;0 ʋpP0V )Bp X幋 R00 D B0́0l|yXj>bdddA-@aP |0 R p T T X0T 1 00AA0A $7cUU UP/p@-Q@P D0S L Dpt>t>R/0@o/A-p@P`0M\0S @P 0S `?A0up@-P`  @0EPP\TAAA}4NPw0p 00s @ S/Q@-@ P}DN0 @00^ C 0 0 lDЍu>u>A-@P@P`0d00`0C\SD4P 0Ɗp.A+A(App0 P\CP\p@PWA803/@u>u>u>u>u>u>Q @-D/u>A-`(M0Pp 00 P40 040@k0 0|0 0@P 00 D0@(Ѝ"WCav>!ԣ!pw>0 8< 0///O-P`4L1@ 0#PP3p1 !)0   0 pWW,AZ0L0Rr SY; ЍX!hy>y>0@-,MP@ 508 00  L  @ 00,Ѝ00up@-LA0PH1 8 !t.80080kp@-,M@p` PG00@0P "0D0  #0H0 $000 00Lp `!P@,Ѝ0u0@-,M@P K08 00  0 00 L$P&,Ѝ00up@-(MP@` p[008D#L:8 00   0 0`B(ЍpA-@`T@P000S3 S  p}X X& 8W0LA0000P 0X00080 080BdB0 ^PA@gBH0 SH10H1H0S40940y>y>z>z>z>p@-@@0PhQpP`0U0$00p@Xp@-@P@0?Xp@0XA-l0@P~0pSSn0@0SLx0SIypWF|`.P^1 0n00Sx0Sy0S|`PD0 0n00Sx0Sy0S|@P)00( 0bi!@-@`Pp<<0$M((0 00WЍ6cA-@p F`0@PlP L18 \9@L VS(0 0`0[Ѝ6c@-T0( P@"6 0<zH1 (0$ 4cR$0L1@6cp@-T@P0`S 0S 000 0n 000S 0S000 0_ 0008~70Sp Rp00  Q0S0$00$~p@@- 00 0 Ѝ0@-P$0M 0 0 BЍ0蔮! !@-(0 06003Ѝ䔮! !G-P @P  }P0 bbH0$ H08<06000000 0(0T000$0@!A-(M@Pp `DB00@00>00 0<0T000 @0L@p"`$(Ѝ0uA-(M@P @p`eC00'4#0D0pT%0:00 000 000L0@"$p(Ѝ0us@- 0@P La@0P40   H0b",4b4#04!400 S0S000Ѝpp@-M@ 0La Px0K?4X0 X 8  !0 X0<0 00 0  0ߍpxz>0@-LM4 $Pd@ 00 @0LnЍ0 @@00@0LI N@-S\ 0000L Ѝ0 0L i NC-P0,M p` @P 0 P 0S! Ġ"Č  Ƞ,ȠH p `  P ,Ѝp@-0P(M ``P @P 0` }P 0S $!$("( P   (Ѝp0@-,M@P VS00$ Q>4PT6 1Q0 P00P"0pԀ(80 pH00PN0S A0$0(<@ D0 pl0<PtcP@0cS400Ѝ Q?;00u Rz>G-(M` Lq@0 P?`aL0V SH1H 0㩜H1  PP P PU Vq(Ѝ-PP80L;L  0PIPX 0 S 000P ~P0S $!$ ("(R  $(  R%;0 0!$+PX!T1808 080 QT1 0P1$ (0d0,0000pH1 0H180080    ^P;L  0P 0 |z>{>O-$MP LA0* 0R80 080f<#@0Z$Ѝ@ $PJ'4@pd#dD0[h0030#P00S&h+8 4 )  ``&  0  0R0pR@P0 W0 0 0+&*(0'4a `0p0 0D040PT`Xp\L0hP@  b!0uO-$ `p@<<4!44Md@H 4  `d0@d/P2 MF0ZL00 T0P `40LPp#4"48#8S yz P [ah5 50Z00 ^00pX`pPN0 4d#d5h&hV`` hFh` &4_0X0``P30F c `$0 ,($0S*/o\" RL\  LRࠑ (0L岠RR 3 ##@000 0000 `00z Ѝ R R pRoXQ 'Q(0RRR 0<0㑓#K0RA#ᰐ 0 S` S ,0A(Y X, Q   $0 0C$0Q X<0RR!K0R0C1#0S y P YC0X00 ^0 0pX`pKP0 $4"4P"8#R#hB#< _0 0X``5P0 0 p 0 ᰠ`FV 岠 RpC; 00 00 p0l 0%Y Y 0 \Zp@pG\ \ 0`F7N L&j4"48#8 S㴸͑ f040 g04i 00000"20 00 0@0k 03 0Q<<< 50lp tx| 0uRCs@-0@ CR 00  P0`P0S L140  Ѝp0 h0C1Q   L!4  l(,"$l$" A0C 4"40O-MPO30 F0@pᰣ)@K0R0La8@@ @\?W Z2C7CW"0CWX?WE 0 0 0p,TP@B0 0 0p?c|GrGWpp>W >W >W0d` @00@PL140 0$#$  @h>W ?@oT<>34ߍ$>W >W Y?C0CWT ?=W =W@P`PU V 0 @0d0@Pf g0@0C10 0d0@Pgf0UVJ@ύP?3Q#QQPPG@=W^@D`80 @P4 0 @PN0dp0 0@P80S  "L !$ $l("(          ;W ;C?CWG 0W ߍO;W@PM@ 4"4e xE0d0& c@pd c@d@!cpdcc ccccdx>c(c c<dy>@ D{> C5y> y>^y>{>0u{> N eR0 d00D H D k0j0  d@Dpm0 0 0)@P40-pt`P  eqR0d00 d@k01#n 6:00 00p000 0L@P+[ t dpEK GR0D00K0?0M0:00 01D@00 00@P6$#$("( 0BS 3y,r5t`Ps  eR0d00d@pk0h26:00 0L2 000L0@P 04$#$("( R@ K $@t,px  F0,0:02 @ 00004@P0 $4"48#8RS#00@ӑ;@$ 00@P$0 ,0F0,00 30:03 0000 @OPi 0 S0 <   0@<0;0 9Q080"0$h8@@0  d0&@P 0S  s$  G m$:$ F 0L 0  D@P:   B# D# F@K@#0 @ 0 L@P #   B# ls@P T*04#!A 0 (Q(0(Q)  +!Q0Y    +!Q"00;000 @@ 0000;;>0>0@0@00 >J?000 0<< S0 00)S@}7 0EC0D00J0:D@0  (0LM@Pe+ *00C8#833##Yfkm 00 10000h0n43i0g 43oj0# b 4303000 p-000@ }0| 8< ~ ,4 (0 $"000 000 0(0000ߍOp0GS W Q )0GS0*QQA9!31  ߍOCQAQ@RQ +QQ 0AS8 y20AH 8#8# 8d: W 5/QQ AQ B0ASRQ <@ d00:0@  d0p@Po0W?00o000:0<0d @P W  RߍOg+QQ QQAA;!31 A AQ A eX0 d0d@4"46: ,00  0 0 [H u0S<0 8< 0/O-P`gL0@ V PP5p"1 !)0   0pW}_tJ0Kz 0zS> M I l Ѝ!(|>T|>p@-La(MH0S4@LH1P@0H1 500<0\ 000P0 @@(Ѝp꠆p@-LQ0`H1  @PH1`0 X73H1@0H180 .80080,p|>@-H1  @PH1`0 3H1@0H1|>@- 0tdp@-@0@PH1h@`0H1QpP`0U0$00p@RIp@-@P@0yrIp@0ylIG-@P@n80P0p0Sn00Sx0$Sy0S80 00 03/\/80<80`l0~0pSn00SFx0SCy`V|p/P0 0'`n00Sx01Sy0SO`V }/0)y800800by9(^`P` %U20y800800Oy`|>}>bi!(}>@-@`Pp<<0$M('(0 00IHЍ6cC-@ Fp0@`MPP P L18 P9@@ WS00 00pKЍ6c@-h0( d@"6 0PH1 L1800S (0$ 4cR$0L1@e6c@-`MtP pT@QT 10'*"*0*00(00,00 $0$00Ѝ(|>p@-|0( x@"6 0dLa80 80000$00p@QP5P p@vH6cO-PL,MxQPH1p0H1 `Hn@PP`D  ,1 1%%H0j `S7d1 00 0`0 PP)`0 hl0Pd0\ ` 0X 0x10T P`$4"49#9003H10H1n,Ѝ p%0 0X0P00`0 0 Ppz`P`VSP N@-LP4 D@  \\ @@ @00L09Ѝp@@ @ 00L0pC-`@pLMP0 00 000Y0 (0 0P XLЍ0S!04"408#80S 0?0S 0Č 4,48#800SQ\Q00 $>4"48#80@- 00 0e Ѝh}>C-@P@@0$M,sc 0`yGЍ6cX p@-`P0 & P<\@P P  0p@Gp6cA-P`p%0Mx>@PЍP L180 0040 00000pG6c0@-P$0M 0 0 @xЍ0!!@-(0 06001xЍ!!p@-@Pj X`14L180X00X0pO-,DTM$ F0@ px|)0@4RLaP83W 0CWg37W@ B27WE  0 HP@  0 \3\0S00@TЍ QTЍO 0S0`2X0 \0@ ~@P80 TЍOH0S0 ; 00@0 l@P0S(0$00# p" ppS40xx0   00H000 IP0S(0$00 t|pZ H0S=0  `00000 (@P\( $ 0000S0q 0&?00\0L     0 @[   0 k-@P H1 0S H1@P@0H1@`0H1@<@:@8 @66cvd|>pO-4"48#80C-1@SP\Mo< 0|0p`\Ѝ4 00000L(0P P00/ $4"48#8 0 L P< 0@00 005:5 020,30(40$10VWSQ! p`) 0p` #$+4"8  n> C"X!\1, P!(00 T!4 x!2L0^?0n/ P00p`| J0# 0(0,0002 00 L(0$ OP`_ Pr+0So 000SV Si ,0p`b 201 483 00LP<0'6#$+4" H1 0`=P0 (00 00 0( P0S"+0, 4"40 8#8S0 48L1 80 P-  {P&wP#   3/P p}> N ~>C-$M`p@P ⨁n X409400000Sv S  A! )A @ R 70LQ0100P 0X00080 0800+h+40 PP ^Pa+U< U< \hl!<# Q ! \10X10P1T!+x1S \A+Q V++p+U L \0\6wPL@+$ЍH0 SH10H1r(~>d~>T~>~>`!!~>G-PLap0@P<?PQ$0U S @ @L @PP@  P@@ T 880P P800Y .P.PP 080P0@-3@PdM *QL)dЍ0  00R( 0   0*),>?>Q>p@-P!@0PS ?!600#Q0SP(0?0` ; S00,0|0YZ2Xl0%XS40T10P3/P1'4 X3P@-,X3@  T1P03/X3;X3O-Mp؃@13`Ѝ?0P X3` t0P ` 0 p$1$@ WJX0P0/ @ h ) B$ H$  ))`, 0徲4 #(08 <#T! P2/P! A< "`P!V0p@@0un>A-P1l@P`0$S PDP&V*&@8pV4 !$&@TA &>>>>O-(`p}T@[[00P1P*0yP1P1{p c 4(d,t"< 402X#  p3`S002ձ02ű@202(0HPD4T103/Ll0Q0X&T& HD@&,r(00lb>>C>> >>%>@-@P@?G-pPW`@(  8 @D (,$D00PT`H00#AD  (,W00 02X3  D (0p, 0 Q0000P0S202t4S P10  W0 202 0< 0u4S P10  0S2<2X3@20202X3 0<2X30 0 2022<20RoSx40x4oT1P03/GoG-p@RooP1PP1x$0 S 0!R*F Pd0P_POP08 [o#PCob4"p@-R_@^o|#Rp@od0|3T-p@-R_@Mo#Rp@od03T@-@`Pp<<0$M(`(0 00>Ѝ6cG-DbDRp f0`Q(G@PpT P| `3d#0x X3A> S9`a WVpA00p 0 0.BpP7`X03 P1nx3SVP1 RR'o,00 4(`P!,-%PP1n0V0U0S P! 0S ``0x3P1oV Ѝ1 06  #:: 0PPkh$PcLP \ 0$`p6cE>l">ŀ>ހ>p@-L(0H@P#04X3 @t3$0S$@p@p6c@-`MtPp'@$T 10'*"*0*00(00,00 $0$00Ѝ>p@-PP@$00$000P1 0P$P L$`0P1 V`p@09SYS! 0C023 0t,QqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`n,>g>11@@p@-l0( h@"6 0TX300$00p@{PeP p@=6cG-@l`2PY P1ЍG< D0T`0"R0L0Sl rem0 00000 R!##Y 0S<00L0S,3d00!C'ЍGymlq 0 P1 2P *0& P1*$qP R  qqq|3  d00|C0Km00 2@0S *"*$0S 0S$00P1 lx40Cx4+m<ЍG<lb!>ā>ځ>݁>C>">>>>́>h"b>p@-PT1P @0`3/P P P1 $T1 0P3/T1 0P3/P` P PP10S p( L6/@00;000000 e66P1 p>>p@-M@ PP *l0B8#8S 00܍p:< 8000tP!Q     8@-M` PpP`-*0B8#8S) ' Q#P1 0,00@400300r2T10P3/P1 4 P1` ߍ-`0uL>@-@8  t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0|$@p@-T1@0P3/PPX3VP <%T1PP03/pX30;X3X>O-MpP`@ HQk 0xdT10 VP1 P1& P1  |cc$"% PE $ p`:%P:gi wP1  E L5LpP<$ PG~L0$0,($  `j0P 0 $Ѝc moP0Q Q P\ P d ` |$PtQL1S 8t/0T | | $L1  b$0P!00P16n #?0 X3<X3n?0 X3@0X3X3|w #2 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ |6> #W?0D0Y?ⰰX3@0 D ?x0t# D h | B$W tL1$V  04+$0)$'$t#C>>/"/"(><>>>l>>>)>^>>>ȃ>ʃ>><>M>l>C-@P@@0$M,;c 0`A:Ѝ6cX p@-`P0 & P<$@P P  0p@{:p6c0@-P$0M 0 0 4kЍ0"l"@-(0 0600%kЍ"l"O-@03, 6P 0M`8<X3 2U p 1CU 1U  0 P*;`2U^ 2U0 0 0 BPq 0pS{ x  Sl*0Si <0 00000 00,0 :601 00:60 0j0X0P0S`  啙` 4BB ,00 4(PPV` 8`P P1+iP1 @ PP1ciT !ЍЍOЍOЍO 0000100000` 080,041 P0`` `6cvdndQ""A-`0MX@p `P\ $0HP 40 000p0`09Ѝlb6cR/00S  00s  @o///A-Pp`!P1l0@,0d02\0!40T10P3/P1j ]. P1AT,>@@0uO-pr@ 0 c`PZtlP/1 !)0   0 PUR8 \hT1P 03/  c 7  ] 꿄1  W , hA 7F}7|TU /0|4]mG⼴ !h0P!0P!0 Ѝ ">>@-T1@0P3/P VT1P03/p@-PT1@0P3/Pv00=pH0   " ""   00H00D000h0T>p@-2RP0@`2 R R0L00QP0 $ <06#p@ /0L00P0h>>p@-P@`Pp0D0$ 202<06# 2/p@ , 0    , /  A, 0/ @  /$ O-@pDMPh0 `00<0 $0f [H 0 \0p 0+ t0S 3/0 $ _02\ 0:/ E3@ a`4@l7P 43@ @47P40!0d R2  R00p + 3\ $ h0<` $00(0 000c& 010,00S 29 200( 0 P <  0"Ͻp 2< 0R2<0,, 0C0CC(2 p 2( t x@0'x00 S0!< 80 S( 2@ ŠĠt0S 3/$0 (_0 $2\ 0 >>Ć>͆>b̵%>3>>K>Y>f>A-$ 0<`Pc&@pF 0S 0q00 .m 0 0S0L01 c 0 00X0'<0PX ` Ѝ000 00 Zx0S 3/ oP 2  0 B  p@07/8(0< ,0(000,4000 04 @ 0000CS00ӝڰ2 p>>>p@-@P0 h  pR/ 0 0Rs00#/ 00 0/Q@-@  <>I>Q@-@  0U>^>A-@PsD0S0$D0 $`p8 RS1 < `V< < 08 R0< X X <00<00 R p0h>A-0@p 1SD R$8 < #" R0Q `PXp%d`00PP]d 0A; 0X dp@-@ _P0 R p   @-0@\`\P 0A0 00p@@ 0 @0c HBЍp<>d 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-  MP@&0 `00 00 0@ Ѝp荈>d=" 0/@-@  08 0(0!3R@-b /@b@-@<P$80080<0A-`OPDP@$p80SU 0Aop0 0ATMP <00Q@Q<00P vP oA-80@SP <0S$p`<0S<` 0$S8P<  @< 00A-P@h003/P` P PCA.h003/pW h003/O-0P`0$@T p p 4 ЍO  0S0 00 0S     0R <0X2)QA    Q!PX < P 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    PP X 0R{ R\ ` $ @` ꑈ>a dp@-@P`1 0B 04@0 0pp@(0`0S 3/  0 pp@dp@-@P 0<X00X 0@0 00S` p@*00X0S0X  0@ 0 0 04S 0 0 00 R0S 0=@Sp@A-`P@0pSP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <AA-@p`$0<00P P h0 03/<0P0 A-@`帀>A-P`0 @T\pNh0 03/D@A-@P`<Q p0S 0SA0 0R 0X00S0  h0 03/ Q\00 00x@-@ a@  00C 0/G-p@P" U  U  U 0  0C 00 0AG*$ <08#  + ꀃ , `` 0`0 0 U  U#  U0 03/0$8 RV < #"0$0@-@0 0S80S0,XA- @Dp<1`00 ,1T0= 1T> 1PT 2C7CT4c0,Y^8 R<0Q$ R (0S @t T``@$pV80S@<04#P zP -8cξ3A 2A4Ap@-Pb @`0T@ 0 <0S 3/@P 00C 06pC-M`@P`@P40S W ipᴀPl_00pp%`|xp `d0p>M P 0@ @dP0ЍCЍ9>b@"d;>0S"M"?"h>T@- D@P 0P0008cp@-@ 0P CS <0S 3/p@C-@P 1MSX03/<_4`0S  _x< R% 0$8 Q pk&@0 00@PL P! ЍC \0OTK_ R00 < ,_ ЍC$Ѝdd>d^"G-@p`+0$8 R4%$ 00S 0SAx 0a 0  0; 0q P\ 0, 0S < 0 <  0  80S 0: 0<05#0  0*P 0  P)3 0R S  P 0BS@S06PAQ{L>>4@- $@0008cO-@P$80S Ѝ<p0S P ;`80 00 00 0C P>0Sg*@-@@0@Q00. >0,! ,1Q 0 @<bMb@-  2 05S=00 a`09#80 8802 0<<0A-@`P%p<`3  AG-`@n PP@  ,p0S S8 @r@ D1. 尓 ,/ 408p<003/3 3@ 0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0d NEFXPi'TDA-pP`||@PP 028(00,0?S40003/U3 PPBdG-p`P@PP 0,00202?Sb40003/,3 PPdO-M M`0P @0&pP00S80005/,Px '000$0度dRS00X2PZ< :  R+00d [fd R  PWW Qd R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ą{p 0p0p00S ۍ ЍOOWp[*Wۍ Ѝ@tP t:p0pGWpX18PLHD@W>4> >9>">O>^>4>s>>>>O-,@4MP p\ p\80S<0 2S0$8Q D R< #" R*T03/80 S%d0S 3/ $`80SGfP>\ R00 < }(s\ J0$<``00SQ  00  `00 00 00U<`V =<00`  <0 0Q Q<0` 0 d>d="Ɋ>p@-P@`[ PU\p0S \P0 P/ 0 /p@-@P[@\pp@-@`P[0 @T[p0S \@ Pp@-P1 P#UDP30 P0 0 00(005$ @,08,0P 4<p>@-@4<@D@-@ g[,A=0S->p@-@P 00P`U[a6[H[Ap@A- a@TpUʀ 0! $ 0    !≼ 0  @ 0! T0t l   ! 00 0h0 03/@T \p P @bd d$dZ:[/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp =,0帢,<zpsL!DH1003/X#-  Ѝ_?0Q R 0h100100100 0-/@@@3>a>G-@p`NzE$0>tx"t"ϋ>؋>bq"I>m"G-`Q04@B P1J_pC RIZO1 Q PRH R\qPUPQPRPZG -$1Q PU G  $1Q 0U ( 0S  Qڼ V0PJO`C RUZ\Z@Z4UDDPUn>r>k>>Ȍ>p>ʌ>Ҍ>s>v>@-o@-MPih0`@5 Tp@@d00@0 000`EP Ѝ@ЍHA܌>{"p@-@PL`VX 0S 000 P0H0P0@@H@p@XA-@`LpP=X 0S Q H 0 0 00@kXU eXPX0S U ]XU X}XP @ XG-`PLp@X0P 0B@0S79X,]P,(0 ၆i(0 Pɸ x \?tWWW~oP PU (@-$0\@[A-@tpW0 03/`$PYWV 0A嗸b0   Q @-0 03/P0S/A-P(MsM@P@(Ѝ0`P0$0(0 `0 03/$0 (0 q?00008 ԅ0P; p 0 `p*08/0S)0=0 888/P< 8!幅P r? 8 娅P 待(<03/ 403/囅;M>p@-P@$0 (0 勅垅(<03/400 43/zp@M"@-d}P0.X X%,à1 0")!0 <"#1o\Q @"@ɔMbbCT[c'>@-PM@P   010 @0PЍ6$p@-P0@$0 3/D`V 1SSpp@-PM@P`P 701@0T@9C>H0 @@0P  0( 0 0 PЍp@-PM@P  w< @0PЍ0@-P(@TM hTЍ0P `$0 010408020@0P$0202>2p@-(0PPM  `PЍp00@S SQ 0R0@`P  +0T1008020 @0iTP`   P0@b>>@-(@00 3/ 40S 3/00 3/00 2/p@-$0@ `8P8P08<0,4p P 1 `PU$09$0P@-@t`MU0 03/$0PPy99$0 VU W$09$00<0S 3/ P0p03/7/PPl 0 4pW  7/PP <(0 n03/(0 /PP(0 $0 /8PUQPP(0$0$0 O(0 $0 P $0 P PU8P0S pp 0 0S $0p p00 00 P PU$09$0*U$0 9$0Ѝ@aUW Ѝ@Ѝ詍>č>ۍ>>>,>=>k"A-@`,L UPpDPU  0R0H0 0 XP6U03/TX6  0SO $0 P   UTP@P UBA-@PT   @ `840D 4p P `84O-`0.40$M 03*@@R  $Ѝ![z [ [ 0  3"[ [ 0 S,  P P9 0 40 0 0@R TP P)TPA  0RT @?4  k h e2!!1 0\1 Tl04  0QPP 0@j EG?0 0B0P[ 9 6P P @P +P@  %P[@pk[ 0 x 6 _ PP   0@40  0400P} 4 0 0P 0  0Pf 0P 0B ! YSV@ / RoP><>l>>>>>,>M>>a>>>->C-0@Pp`P*0)  I ,0J)00S V  ` VL` 02" ) /  ЍC \>>$ X0R/0p@-)00+P@*0,,)JoNOPKVPp(!ɐ>C-OopPd`【TMBP  &0 1@iP 0?4/`V<?oU20S 00TЍC'O-`dMp0pV Q ;T.;P"PP@P 5020t!(SL0LpU`10W ,PDHpP0G S<<000 0``\P7 R00,`0 e0@0`P0 YUV 0UpC00 0 X dЍ4 80 P6`2r>A-XMpP`6@P*U@p 0PN0P TBPq402t0PSd020H0$P@P(00 <T 80U`C00 05 XЍ2@>@-$00$00 00  0@PT P P$00$0Ѝp P$00$0%>0S,0 0TP P0 3/ `PP, PP [ ꠆B>m>A-@00PP I 0004P<0P0<00 03/pP` H1 j`0p`0<0<,0S脑>>@-000 00>Ѝ@-1 0 1ЍA-@04pP0 3/$`Q\@    0 03/P t `P X 00018  1\1\1 Q004`V 6/P`    @T :0   03/t yPp`P궑>Α>P>>Mb>>0S/pp@-0@4PQ 0# WPL`0S 04A0P30PU*<p b>0S/p@-0@4P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ@P@@@0 P0`HC-Pp`"Q P 1  0{ Ѝ@P@@@0 oP0`HC-@P`pQ P 3  0U Ѝ@P@0 HP0 P ` GC-@P`#pQ P !3  0- Ѝ]@P@0  P0 P ` G@-0000  0Ѝp@-0@4P; 0# p@@p@-0@4P, 0# p@1G-p0(0S PE@P EP` F@ `⼠P O0S40(0 3/0000@00 Pp@-P0(0Sp@`O 0R000 Q0 (03/4OEp@E@-0(0Sx@Cp@-@`OPUO0 p@,0/0 3/Pp@-0@Q4Pp ` 2/P D$ @p 0`( "4`#/0S 0\/@-48 \$ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0( xMP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00}@P8p0 }P (0 X\000h0(00(``X0d`射@P(0 00 0o} DP@P (0 Y} <03/ 403/xЍD rZp@- P@@@4?`;QpC-@(0TMPp`p( P  ᅽ< Y<00010481`1d`@0(0 00p0 0 P 2"0 2"P TЍ8 0b0?o0cS2   ( (0` 1011SP 5 010 80t0@0uP P  $ 01(0 080@`cP 0  rr2 6$O-0@PTp` P `!008S00 R"@ 00 0|0 L@P 00  0| ( Ѝ 280 000 0W|@P 0e|0 #@T W|0 0 0S|N|멄 pG-@(0PMPp`p@ ?0 S㣤030#$ 0 P  ዼ011 @0P-P  |< Y<00010481`1d`@0(0 00p0 0 P 2"0 2" P PЍ8 0b0?o0cS2   ( (0` 1011SP , 01|0 @0oP P   01(0 080@`]P 0  2222 6$O-0@Xp`P P `!008S00 R" 700 0{0 2P00 0t{ Ѝ 280 0000P{P 0^{0  Z P{0 00L{G{t`21BP31 a1/G-0xM01S`P`1 @o (0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0z@P;p@0 zP (P0o\0@0`0d0040(0D00h0(00X0@P(0 00 @0z@ @C-TM`PP p 0 X100  @0,@P$ U PE_oYRPU 0XP PP  ι(0 080@P@P  0 D @TЍ   6$6$2 2 W>e>p@- P40 S" 3/P@000S@  3/@P\0 4`V  @6/P@p 2/03/aO-pMp\1堠@Z 0100P4` V  6/P <03/H1S< p4`P   ߍD1S R0Ԑd1(0    p xwVp@  p 0P0 0 3/W +(0 `-21 1\1Q00S  40S- 3/PVQ < PԐd V T*W```F0 VPW 0 :03/[VX [ 0  PgPI040S=   3/P>HX1000 R0L!00V,a`NP)d1S Se! 0 Ԑ 05h1h1S 0 !t P000 \1Q00S 0 4PU 5/P 03/꜒>>Ӓ>>'$>P>g>>}>>>Ó>O-頠\1@Z!0P4` MV 6/Pp DR 03/(0L ` 000 ``00*8/PD00`80 8/PF9p 00wP8`0 wP p00000\90308(0p 00DP(0 00 0w f->PP (0 nw <03/ 0403/X pߍ>x|SPp`< !4 4tp00P  'P " (1pS  PXp(0o1S\1Q0Z0 S 04pW 7/Pp2 7夐8#t200( 0   0p*@7/pP008p@0 7/pP6p 0@0vpP@0 vP ,0 0@000(60 01(000wpP(0 00 @0v@ 0` (pP 012000 0SpP00 3/pP0 0p  H6-`1 k 00PpP VWa & 06$0(0 Q N  003pP 0   pP$08$0(0         Ho48#|2婒\1Y0 3/(p\@=PUpP (0u "v@ <03/ 403/W p0 `0 n0 c0 0 0 R0Zp ѠБ[0 [00 !00s1 z Y xX h0S T[ H W8 4W0A(u$spP .9=h(1S 0 Pt000ᴡ S<#0 0 R XX :1S* 1S' 0!`Pt161`!A?;`V)      '. !R尰R ,  [0 " !(   尀|V000꜒> r>$> >*>a>E>Ԕ>>>>#>)>/>5>ۓ>>=>S>U> >n>>>A-P`@v $0 DS P9 PJ0 0(0 `L rPaH TXX p[1q#3!?A1c L\1`06 SQ 6 `'``La H`oP  r{ 6Hv `'q`` HLaiP`d T_XX[ p[V<0q#3( ?A1c\1L!4L1$>gfff><>p@-$`P`@0  p7 `l2 Xp-Pt)Hu%@v!8w`0xya |  pH!R0BS2lp ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yzad>C-dM@d p(P 702P{P*00$0`80 ` 0 0 `h0&hS `Pbe(0P 0T(0 p8P0`UdЍ40S04P0<0P(0P@-0000000Ѝ䒖>C-oo@PpdԐTMbP  ឳ(0@010$0 )0 1P( 0 U 0 pTЍ0 1X<UG'p@-PMP`@P cL0 @001`?oT20S (0$0 00PЍp2W@-$0\M@8 0$0(0 0 03/(0P( P $0 R0$0a PPPE_oR_0[\Ѝ(0 P :021$0;H0RP,000 03/ `lP0`(0$0Q pn |P0SQ0 03/T .P$00 P Ͳ20H0 02PP$08$00@-TM@PP ᳲ010 P@0TЍ02p@-(0P@ ,Pp$0 SP000pEP pO-P @`pC(0  PdW@ 0 @Pp\ C Ѝ0 `@0 0 qP 0 00@00S (00  002@q00 0q`0 @P00 0qO-P `p@1C$0 0 03/P p@ aC Ѝ(0  PdW@ 0 Y@Pp\ 0 `L@0 0 yqP 0 0000S (00  00@sq00 0nq`0 @P00 0`qі>C-P@(TM@>R`>:pBP  ᣱ$0@ #0 01020D@@0@P P Ꮁ$0` $0!01020d`@0@P P y&0160 @0@BTЍ@A-@M@! `PpqB$0 1pA?!0@P !0E@P 1 4Bߍ0 >@>!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@- $O-P@vP)m_ B01naV!no1SK>BsU~o p\`ݢVnYAv~A[$p+P pPW B$00厗A[ P̢1 sPC-MPppQ@101U 0|10p!]?lv 0t$0`Ap19l!GM 0v~>a 0~u5v 0l mcAn010ȁ1ԁo @001$ F40 00\` V10㨁 t1_>0>""@">""@-@pP1haq嫕1p Q V  0 !1 0 @ oPU:h0  \cpҲ.W 100@,UQ>>ۗ>Mb>>A-PL@L`m@P0n`A@s@- 1`QPp@pp000#@0R'Ѝpm_@RP 82<"0820 <"0@0P0t0L`000 01no%1010s 10CS1nvd@b"p@-pPW@moe@P P2""N0 0 @pPP0P0 P1@"p@-p@3PmoA@P#@ @@(0 @0 @1o@pT"A-@`$0@PAm E UPm@U 101L@UPA101A-pp@`PoL!?R01 AA-p@`@D0L!mϠQ  p 00$PP? @ЍA舕0 $0+ "PP 0Sp0 0000l 00 0?1S$0P0<0$8 0ႠЍA?Y(>J>P>b"p@-@0P$ mo ?$1S1p@? 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d (0 R 0 0040/ddO-P(pdP`@\p!RWㅡ& W5 @ P`p1S0 0@0 A\'0S0S  @ T  F R 0 00qT 0 T 0S 0S0S 0Sp|>d>Ҙ>>@-0@S f0l S 01 0000S>@*  Q Q  0dPA-S@`p0 100PU0S0 8/00PQU0S0 8/P|>dPp@-P`0@0 P`00 R @p 4@0@ 1Sp R  R ,      0|>dd,>@-@ R 040 @d@-^ 0@/$0a(!"$a$"  b"!4b4#0/p@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Qp/o"0#?S Rppp,b Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 Pdbhbk>/@- @q <Q 0(Aq 莙>>>0@-4M@P 000(00 0 0    , 0 0EP 000 W4Ѝ0"O-4M`@2`2020k 00 P0 5/0P  P 5/P zrZ pp 0< h9/P\0 ! U0>0 4 9/0 4 ;/Y  Un 40 3/[  Ue^ 0 !0 < 8/ሁ PE(_CSeN(/C#b?0ETCP%r@1P  P C 000!(00 01P0 0 P00㵱P0 000 P (00 000>00㡱Pw  ;0 0|0 04Ѝ>~^dbpb>0Aљ>>@>Mb=>>"@К>@ؚ>d"/O-`0A3vᣁᣒᣣLP \[ \  P @P@ PD  \ # ZK0/d@-D 0S 40@/0S d>@- D0Q d@/Q 0d+>0/dA- @0PS ` p 403/0dU00 A/ R 0Q000dQ>N  0O   ! "`"Рo@-%~>@-!륛>p@-@P᝗PpH0. `@@@Dᩋ$0厎 p@0减dM>b00! $0 /@bd 0(0S 0@o/d@0 !!/@-0 !@@-0 !@p@-Px@x(P $0dP$0 ,0KO R0(r,04S00!pd˛>"@bp@-@p  PPPDUT ʀ0 ! 0$ 040p>d0$/dG-`0p$0PUG|U !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pf10, TP2/@bd @- 0 ! 0^ Q    D $ 10@S@@@d@bL@-0DPO@bp@-$0D0P !;3p@bG-@`po  P00TS\ 0 !HP10,p1,a(0 ℑ41 0 , >d@b@-@[o  Pl ,00DQSQ @0@!,1!,0,q@d>" $0 0!0 00 /@bd d$d,0P 0 Q>0//d@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S {dQ>P0@-  d@/  R 0cdt>@-P`@`0000  p 07/PPXG0Lq 2/y/, 0 4 8 < @ D H L Pn  P   O R0 P P@ Ѝ@0,0 0@ Ѝ@Eꘜ>>d">>0@- !" 0 !0@- ! 0 !`QO-RrpxPGx`q<@U@Tp  G210@ 010$n  P `U pT X Ѝ@U   0 @[X ≐@0 4P0ڬ 2/p[>@bp@-P @@@@m  P`@p0/dA-`1@P0_SL b0 _SL0_S Ip0 _S I0_SO 021   0 0Q000S$ S"A^d&>Y>A-|0 `pR_V0@00C{ 0@@_V=Pp @dG-1xPPxp@ \W 0GSD ,0S 0 0 @0p,0Y`0,0 B0  W30# W _YOO@A$ 5Y0 ` _YOpq _YN @d>>>>,"d"G-0`@i0 p R, * 0 R& _TC _TP@PQP$B@  A0P% _T Fd0@-@, _S= Bd( 0 _S!Cd( 0 _S! FdA-PH0_PB`@@@Ap0S  Ad( 0 _S!OdO-00Y @b_[pLpq0 CX_[ `I`aPPp0Z 0 @Z V O  @  d@bJ>I>p@-@@0SpP"0 PpA-`PZ8` `p00p D1@ v0P   8/P Ѝ0t B| x0Q  6CQ@ 6Ao0, N 0AoXb{>p@4%`A@-P 0|!SF &BS &SG `ЍpH!S0Sk  P(A 0SkA1  P@`p2 0@0  0P` ` 6/P@0 \` 6/ z|0` 3/0Szk\@\0 0SrkD@D0 0@  p@`AȗbbЗbXbЖbbbb/!/!`!//` `! /!b! b!(b!3b!;b1/c 8!0/c#c4 4#1/!9b!Ab!Ib!Rb!Zb@-`Pn@P0@00 p0 7/0P +P d`6/0d` 6/ Ѝ@ꚞ>b>>@-Po 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dA-Qp@ 0d`6/0 `P0d 8/0 48/V00V*U03S 0`4P 5/ P0d 8/ PV`!U0#02bbA-0p@ 0dP5/`P Pd08/0 48/V00V*U03S w0`4P 5/ P0d 8/MPV`!U0#02bp@-D00@ !0 4P5/0 , !pbp@-T0@創04P 5/0 00dp@/b@0A-\!\Q\a0@0i  PD p8d $p[ W`0 00`0 00`0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/0`0ЍA輄dbdP1bǞ>""7@-0Â"6 @FC$0S0 XPV0@T :@@Dd0 0S B @DT Ѝ0bQY'A-pP@`0!0 48/0dp0 7/0 dp7/0 !!b@Bp@-8 0403/8 0d`6/pA-0` Pdp@403/ ;7/0 4P5/P0@ `dp403/ ;A/@-8@/48/@-8@/@-8@/@-8@/@-8@/@-8@/@-8@/A-@`hO-00 0B ( 00Cp 0 00S 0F0  0G V0 S] 0J$00 3,000  0 C 0壐 000 000p4$00S0@0@0000$0@A QIP QFJPPBEQRH P<Ѝ@03/d03/400 P4 L0 0R0@ 0R0?ZaPT (Q <0 3/ R 40(3/0$ 0:>T[c$tbcxb> >dM>A-PM@0 00 ". `6/`P # 001! 0@0P $ 0 dp7/T1 R `   P ,Ѝ@(0@8p<0$0:0 080 S@   1H0D 0S0009Qd  z000040I> 0 0000 8/0 @00 W,$N>g>i>pbL#>d> ݟ> 0S/@-@ 0S/@-@ @0S 0CS/A-@M`pP ZT1 00000 @P@܍ 1P: h0R1ʖQ001  d $0` pX@y000040@ 0Q Sp@-@P  Pp/C-MP  p`P): @0 0( 80<  S@ ʜS0H|0D 8  Zy40 00T 5/00 @00Ѝp@-0PS @  00C0 0S0 0P*;(Q $ <03/ R 403/p@;>$p@-@R 0 0R 0R pR 0Rp/00   ,000 0H00 4P5/ @o_W@@W@AW@EW@- o ϜDH R< o    @03/Ѝtb@-0 4 0@/@-0d @/40P 0S/0S<0//d0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LT \\LXp` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPLITP,Z`N `Y  \ pXp B`\  ::0:0 & SC-M`pz@p0000 00 P0 5/PP \ЍCpH2傏@   p@Wd  P ("( 0 00 00$ (0,0 0S3 0Un"0" n2U]"L" ]2L2PUP*00 PPp008/P  1 000:88/P H)>0:! \P!: \P<: R? p@ P 0j=0:* 00 Ѝ(>:>dP>{>>Р>P#O-0`SP@ Z-0S* jcp   P00Z0000 ЍpQ3# 0Kc  P  0 p@SHG-paPP@::S0YL M"L"8 R P"c  P  d0(S  D  "O-@ P4 pჟ0  Q ` !PU h{0pW㋰   Ѝb  P  '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0oP t1 R8 8  01Pjy> 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dhh@- 0(0C*s` Ѝ1pP0d0 @0 L~`P 0SQ \Q0 ,Xm`P,pWQ KQ0<00D00 87 H0R/ R0 0SH01H0WH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 hX2H02,00@008000@@0 0S%40040dA-@2PVD`q@pWA40@00S 80S0p 0sBPh 80S80S808   YpDKXDD< :RD01 "0D20LML q @50@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0 d+>p@-h2@4Pld 5/`Ph”l0d`d 06/@Kh2ld 4`6/h”0ldd p@/'p@-P`!@֣PPFP jXႺ fp"R h2l`6/0p2pA-P`p@0h20prx$0`|h?0  0 8/ P ЍA+0hp2(Pl5/ +h2d 4Pl5/4Rh”d 0dpl07/h2d 4pl7/h”0d dpl7/h2d 4Pl5/1h”d 0dPl05/h2d 4Pl5/PGh2d 4pl7/h”h1d dp0l7/h2d 4pl7/h”0d dpl7/h=dph l7/h2H 4pl7/h1 dpl7/0 P h2p"lP5/0p2gܹ0P  PX4 ⠟Ѝf>h>'&>>#p@-P@_  P=Pp00pp/@-0*T00@/@-0 T00@///@- $00@/$00/@-@$00 3/$0@0//@-@$0 03/hs@->0`@ P  B` 0ŒQΌ Q @0T00 P05/P  0 Ѝp>p@-0P L00T0@4`X 6/TX0d` 6/p@ݡ>O-,M埯x @ d0SS0 p(а d0S ,ЍS CS 0C$0P)(0``03/PA 0PP0  (0`P  p>,#>p@-@$0 03/$003/` $00) 3/ $003/P$0 03/ HxF$0 03/\>XP$003/Pp}4PUp3/$0 0 N'p@-0P`@ 0 0T @ ` BT0 0p@/0@-@  T A-0@@q`PU P Pg0 !kf R00 C1bf$003/P00P$003/0P RR 00`(d0 U T0X 4P5/T0 dPX5/Pb,>6>/O-@,M1 !dQ Bd0S1 TX00 P0 5/pP L1,ЍOd0T 0C?odP2X5/x d0SS0p谟d0S -,ЍS CS 0C0(P` 0pPP3/p0p 0 0 $卝a h p00 po h00A>b )#t>'#'#p@- R 0@P5/00 ap \p@-@9dP8 5/0dP 5/p@ F@-@@s@-@00 P0 5/PP \"00Ѝp000(` 6/ 0000{>G-`0 p9d":/d0":/0"d:/`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z :Z 5pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z oZ jpWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/.`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < 000(0"(>>p@-@ከ dP05/pp@-@}0 4P5/0 0p@-P`m@`0000 p 0 7/P + Ѝ@$ R`0p<SH8008080(040,0 Ѝ@S 0 00$0ۢ>> >H#H#E#tE#@-@?P 0SW  P0<00 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dA-@`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-P帧 0 3&*?=0 `p?x0@xp x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X080/@-0d$ @/0> Q/0b>D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PE^U AWb>> 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-P@`U$ {V  P0UP0p U /0S  \@t x0dP 5/0dP 5/@p&>p@-@`TP TFV  P @ph@@p@-@P0d` 6/0d` 6/( d`\06/T00T0app@-@Pt`\00\0dP( 5/p@N@-@$X @00@00X0@s^ep@-@`UP\00\0d`( 6/p@/Q G-@P?10 d`?06/4 d`16/18 d`6/@0` ``` `@h08`SlPU>>b(>O-0@4P, 5/0P( 4`6/P ]PX0S   P0_ X080S X040X0@0@(_ X0D U  X`@0p8 ē0p 0< 4:/04< ;/ 0 'X0D00 4p7/p@0p  p<0 1 / T  P+@0 0S'0D0@ 0< 48/04< 9/04< :/2$p 4 < (p,pDpD0S80SP040pT  P @0@(Z P b@P :PX0Sk  `  X0D P0 X040X0@0@(2V\P \PJV "P` XpH X` `0HH0@0@% V H0S+`P + Y'0L,0@ L09/`F0`F\L0 L 0D 9/VX0d`$ 6/@>C-4MP(@P0, y0P 0 P05/pP ^ gp4Ѝ0"-P I0P P5/kS  PNh2h2ltp0S  P<;PP`d0hP`O(p 2P0vP "0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`10P,0LPt(? @(0d!`(0P(0(0  (0  (0 (0, `(0,P(00P(04 (0 ` ⇌0@00 000l00p0 0P00$0,S  PP0$00$00 ɒPZ|P0P (P .>C>AE> R#]> N,L>@A>J#DA>I#ˤ>TbѤ>p0\ ?R"0/A-P` VPp@P 00S lp:P U@ X0@0X0@i`VX00 @@d4cdp@-lP VP`A@l`PUX0 U0 X00\0`0Bp0X0d4cA-L@`#lpPA@ \0S@&d4cA-@L PU `80lpph0d4c>p@-@p`lPp@X0 @-\0@S ` 0\00s00`R`0(0C#p@   t X /dd0S/p@-`d`@Plh0 0!T0$LH @   !p@d@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-P@dP\0 0T ?S5Y@02 03/Ppp@b>d P0 P!ڠ 0@ S0/P P t`S /d/`/\/X/T/P/L/H/ /</8/4/>>9>L>d>>>ɥ>>>>m>L>^>-3@-@@-pS@ 04MS 2 03/Dc2 0 3/00 P `V 0 0d0S e00 00004Ѝ 0B S020S' 0S P000  00 0203/0 000820S 0SP0002 03/203/ 0S P0000 000 0S2 0 3/} d0Sq n 00 0$0Sf2 03/2 0  R05"105%pR0 0f d0 `Sb pdp\t0 0l ?0XP 203/PJ cFd>˦>b>>>bզ>p@-@@`lP&- 0 dXb>A-p`lP@1W 1W 0W$ @d1W# 1C7CW2 03/P0 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0000000 @d4cA @A A(@>bdQ @-/>0( o( /d@-@abd >)>:>0d#=>p@-@PởP " " " #p@r@-忛op@-P_@PpC-4M`pᛟK?0S,0APT( 0S 0s S$Q0 0$1 0(1@0z008 0$ЍЎ$@T4Ѝ(5$m#p@-@`aPLND@00000 81Ppp@>>p@-P@E01S8 p@ R $ R $ p0>@-,0D ,@ 04/01/@-,D@0\ 0@/A-pP0AT <1S 0,03/@-0AT0S $P @SG-`P@0<   P@Dp0AC0STW0l0l 0LPPpW@DT >000XT0D 1 015ЍX>Y>^>p@- 0PQ@ `M ` 8%U < 0 ܍p腨>>G-p`@ V@0s5 S20s/ PPE_oRP! Q {P P Q rPP Q iPP Q `PPY U @`FPY P 9/P@-@60@00/X0 @-r(/ᚨ>@-%<1 S̚b>@-(0 `MS$@(0X001T PЍX L D ARF:@ PA,,00@@D  BD H0H0L {M wN sO oL0P  Bi(0  c _(000Q?0@  Q T RC G NX00X00S 0,p P 5/PP H 0 D  pP 05/PP 0  2/$,>>p@-(0 `SX@ 01S 0S P X00X001S 0H  2/ 0,  2/p@X  D  BQ:@ Q0>A-pX0@`P  h^0 p 07/P  0L0Q0CL  QL P R*P0Ѝ7>p@-X0@ P ;00p@/\>@-pX0@P` \*T0S L   0p p07/PT$T Ѝ胩>>թ>p@-X0@P 8T0S( 0 $ 2/0T0p>!>O-p`@M 0SP㸐 0S5 0  P 5/PP,7P UPU0E U0#3S\ P  00;/PP$  0S@XЍ 0 @ 2/$p0S 0 S @X 0  @ 2/, 0  2/$pJ>A-@`(Pp 0S `p0S 0 ` 2/,p 0 ` 2/$pG-`p(@ 0SPp㸀0S%  0   P 05/PP,p 0!PP$p 0S$4@WЍ0S$4 0S ,0G'T 0,@  2/A-@P$(`4p 0SP,p0S 0  2/PPp@-@P`Up6/PP Q(Pp@s@-@@N@-@h 0 01 0!0!!01(!10!0(1A-@PUP@`Py Pqu O-0p"SMSS ЍD/0C@ S00S0S00001I0S000S 0 0,P5/1 0 0,P5/P`1 0 00,9/P V 1BP0 !0011P0`!BP001UV0S 0 0,P5/ 0P 0,`6/1TQ 0 0,P5/ 0P 0,`6/1TQk0Sh 1S& 0s01! 0 0,P5/1T 0 0a,P5/1SG 0SD0SA0S S<P: 0 0,P5/PPP 0pRP3U_&W\p"P  0 0,P5/\ 0 00,9/P0S 0 0,P5/` Q0`PP S:1S 1 0 0,8/11 0 00,9/! 0V1 01 0 000,9/!0U100C/    0 0,P5/aPV@? 0 Sb C C/`011B/X0`1 aP 0 0,P5/P000@000 000000 0 00,8/00000P 0,   ,03/P:8   ,03/PX0C/ẖX [0S 0 00,8/0S0PPSPPP0S2 0S 0 00,8/0 000@0 00 8 000 ,8/00S 0Y0P00 0 RU 0S3 0S 0 00,8/0=@0@000 0<0 0 00,9/ 0 00,8/ᴚP0`0  R S @S7 0 00,8/00S0_1>  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/Pj>  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( o8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0X P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0pn`X d,0B"3/P @2@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 00>>@-@M. }} 010K/0  $!(! 111 1014!, p1>  ލz#A-P+  Q'R R@`0S(1$!0aVKO0S AlhhՋV XP`V ,y$#0 S(0 o k@T`\\0SI崓0 A0S S||9t6 0SP0S X.p0S\Q 4$0"0 0 0 0 0  0  0@ 0 0  0  0  0  pAwXp 0S<Q 0(A$pQ 0AQ ,pŪ>֪>>+>:><>p>> >f>i>l>>~>>>>>>>>ū>˫>٫>>>>&>1>W>>>>>լ>>>>>>>+>0>6>@>J>T>_>i>>ˬ>Ь>>O-P@pa$!0r0C?o20S (!0r0C?o20SPA Q> P;P8 Q5 P2W10S 侒M R(HpW h@h -0041@041CC/0Bp Y `W ,$pW꘭>̚b>>>> 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q `P 1S PᅎP(㕀 0Sp>p@-@ 0P` P@HTppA-`PRX4S@ @Tt@Pp@-0@@ ThPPP T[PP PT0P4p踄%@-@TPTu0P4C-@Q4MT4P 0p`  8/P Z4ЍT4  0   p  09/@PE |CPT4 0  2/0 , 9/@ TT4 0  2/>>A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-Mpᯑ@\p PT P <ЍO 0(0  RC> 0800P 5/P  @ 8$D0<4>`P2嬢42 4HVG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4}0Py )P30 P)0X4Ѝ>#> >#%#(>%%D%|% %% %4%\%%%0%@%%D%%%J>i> 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0>A-`pᄐBT PQ@Pp@-b@0 P PpPP  0 22D 0(1S5Q  "4%>b@-@ 0 2p@-`P6@P  P p@x 0t(0 +PP p@0T1x0p0p0L1l0P1`YP0P PGP@Q0T102p@Ĥ#> إ##>%%%> 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`቏|4S@ P߃@Ptp@- 0 R\0S 0 000P00 Ѝ\>p@-P`00S PpU@t 0  twPP xQ t0x4< 0pPxxQ txTPld%O-M`p-@` tP  P ЍOg 0A(P0000h0 00S0404РE>L00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 ##>>>P##\> #b&>#0>> 0R R ?R//p@-IZ1S @sqPp$Q p0@-01 0P Ѝ0>p@-@T=X PS0@  ``\6/0  ET-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 ET=X \S`PA0@  5/p@0  E>O-@M`V 0 SV0 SV0 S b \PV Z @00 0 0R5Ѝ0S0`pX d0`\h0Pl0UtT=S3: 8t #8;/T=X \S< x 0`;/X=p`T=S00> 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPp:U@a 0L#^P$  RPP $x0$=1S 0"P( P0 "DT-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PU"S  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0Bߍ~PU$Q $]lu%??>#E>>G-`@MPh:@ X P G@匿 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}x 0\ R`l0P xW G > P  01?>D#>#> >&>/ 0P/Q/ᬛb@-@ً R`0S0`Qd\0@-@ŋT0$0-p@-@PH2Sp$0SpH20$(\003/$@-@$003/$@$A-p`ᗋ@Pp 00%0x10HXB¾0$0ptt =``2S?S⮾0$03/00S $ѧA9w4?#b ##A-@P0S},$\ 0H"$L?w$Qb@a}f`cd3cUtUUĈ@[c##@-@@ ddH0 60S @-@,(0 x@0@/`cdbp@-@X & R@@PA@ 000S H@ p dbdp@-@TT0 60SP<0p@8h0l,F ppp ? ddp@-\@ RPP Q.ᔆ5S0(0(000C0pp講bb@-@P S /0PP0100cS0`0e@QN@H@,d x0S ^At;NC SЍp講b ddA-P`0@S"%0S 600@0$c@-0@0$0 00@0$V@-@@p@-@P0P03/0p@0 Ip@-@P0P03/0p@0 < P00/000/P0S00/00/P0S 0S8020////@-0 $ B^\\^\^p 0 /G-P@0弑4p X0IbS 0 $0SP0$0W$0\0S000 0 0  1P" P"0,0$0S 0R*10$0P003/0S PZ kP  媀(0S V0@@0$(0$ 3/V 00$S@`D◴oob` ⑴W 000$0 0S0SGBXX0S pp@-@DP$.qP 00$0S0$0003/l$p@YA-p 000 ,`lPPP0 @$2100 P 00 $0(P.<X0  0  Ѝ@-2>  0 Ѝ@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ@-8 "  Ѝ@- <  0 Ѝ@-<  0 Ѝ@-MpP`J@P   ,0 ` P00 0 Ѝ! @-`P1@P  00 00 00 000~Ѝp@-`P@P  n (0P00 0 fЍp! A-`pP@P  T80 p `00 00 0(00IЍ! A-`pP@P  780 p `00 00 0(00,Ѝ@-  ! Ѝ"7@-P@P Ѝ00  $0CQ RR!Q Q @-pP`@P@ Ѝ0P @ 0P 40 @P +00A-`PL,( p0@0 `OT Ѝ< @-,00@ 7P@IJb??7@-@@0 4@- CRS<0S'⺯RH?@-@P 000@-@PP0S0S @-@0P 0S @7@-P @ P 0St 0S Ѝ0s@-PSЍp@` @ P P 0S St 0SЍp0  R0 0S00/ SA-`p Pc0 @P Z@@@-0@0$0 !0@0$O-@~I0HDpF`B0 80E0PtG0@AdZ R \ Z  $0Q \/ Z Z Z Z Z Z Zt R lZx R XZp R D ЍOZ Ѝ(?0?HHI0t P H/0@@0H @0H( 00ЍG_?w???p@-`Q@ Pp P $ ܔ ޯp??p@-P` ͔@ pƔ0I"RP Q 00#E@-, $ @,# !4T[cbMb? A-p 0` P0 ?@P 2 @P0 0X@Ѝ @#A-@0P 40`CV^^p`W ^^PU\@p@-P04@Pp0S0 p0SSQ QS Up DQp@-@00$!srPP00$pp@-@00$0 0P 0P!00$p@-0@0$0 !0@0$p@-@00$z0 rsP P0 0 00$p@-@00$c0 0S00  0@$O-p8@PU`P. Z P ໓PP 0$0 \=BP 00ਓ@P R yU R4^R R^[ 0 R   R,    00@^(r@  ^ "$ ?O-MP,MUPPqPU 2P7@sP0`x',ЍO,8D8rP7U87P02TP 0+080P0T0 007 PPZ `p 0 pPP f`V0  7VP 0T0S0!4R P` 00CS`( PQUؒ`0 `P )[Ȓ`0S0!4R T`0 PRY 0Ly 0 P8  僪 P0P#30 0PP[)  ᓒPp80弇 08P 2 0bB 08- P 08tU Hx8 q080Pd8k8R_[,Ѝ)?O?@-`QPp@MЍ@ :P 0S Ѝ@M0Sp@-`0P$@0s S@@T00 @0$pp@-P@0$00C00p@$G-$ p`PPP-0000@0PP4P8`p $ $ @04A04B04 04 0S004 04``V5 bP0`V3\0S  0N΅ P P R'4ЍcpQ  1Ad0P J. pv @ 0೤``0X*V`$\ @!< R 1 0$    AQ     A-@P 80SP0P`2PP 0KTP 0D`Q d>0`0tP 7xP 2pP -A)8'8rPU8C- @PM[vT pe`0S40$ 0 1  0$RЍd0Y 8v MA eP H彦Q 8带嵦``0S0` 00*??(?A-pXPQ0P` AT \Q ` Rxs `PU0 X  AT  R@- 0 \ 0$ 0 4D\\\\\\  ? @-| dO-`P"@0pM⇐TWd/,b[@P`  S0   00P 5/PP+0qp08P0 5/PP0 PP  3PP PP02PPG +<0 3/40 3/ ,+P Q$' P$P!: P:  PQ(0(0(0$X00C080@  c^00 0PЍ@t80X@  O^00 0Y$b| dO-q0MPS@8` \⨑@Z@T N8@> 0 `6PP0 PnЍ*@T( 00@ 0PP 0 @ 0@ P@PR  U@ 0dP0000S   0 >0 R 00[S @$b$| d4b@-@ 0t0  Q$$((0   @@    0R  0| d$b4b@-000^40 8@ R2400C” \  @-00 : ЍP/l0p@-PP/@P U =0@pP(PPp@-Ph@1 01  hp@D A-0SL@D`ɏ0P%@ 4@p `\30  pG-D@` \M S UPE S_oRU(p (DPޥ 0S0S 03/0(0S 3/'X 3SP03/3SD03S0OGN?bG-@` pD 0SPT%P pp@G-@` Dp$0S0 00PT%P @A-PD@p3SD030 A U(` B 3 U U BU0S0A/4=IP u OU?G-@pDM` PD03SB3S?0EUS;U%  !P M 'U D03S&SU# 0P0200 4Ѝ 0P0 S*40$03/ ?`$?0D 30p@-\3@<0Sp@8PU P/p@-`@PsD03S0 0p@/pp@-`@P sD03S0 0p@/pp@-D`3Sp0BRS@pRP >P P< ᜤTpp@0,0Spp@/?O-0M@DP00Z pD`3S0 $0R  ЍO ( 0R$E8 $0R*PU 0S000000C0UZ0 3[ 3ֶ 0ᓉ(0 03/0P   "  XP(P 0 SD00 03/$m 00 0h$'Xep@-`_OP +`Up000/A-P00S A/@`pD?4Pl00S0 0S `H0S 0 03/~0S ϖoO-0D@P 0`S\ p(0/00apsZ  sS  s M M 0 r Z  =D0OP WD03S00S 3/Dq3@033 @/O-@$MD03S `$Ѝ3P@  00S1DPc`/ßXQ. V00 S$ 0 02 0000@0?Pp D,`b Ԥ`Ds3/`P 0 `V` D 0V:` D& p@0S  (  Pn` p@0S  , PU`$0V:5@050 0S `E%?( 0 03/00y` p4cpDpܠ,c 0V:`d#0cL[00SF?oD 23O=!2`00o$97`c$?`$b?3?G-Dp`P $J@P(Gb520 0,P00nGA-D`P/@P(pAF5 2nAD0%/D0/D(/D(/D0\/D3//D0/D0/A-P?0`D20@2bReK K  } y u:p `:3  Dp$Dp߈(v0 /(33$,$ dC-DP@(`p <&;1X`01(p⸕01e01003& D`(021垟 2|1|!2x1202D0\d1`0 0 00 2S " " 0SS0380ScV0 0 P08/ 0 Px ЍC'd8P`P f Ѝl$L$ $t $h$$$\$,Xe]?@$H?A-oD@T\ 3SY 3PS\b(pV 5@ V 3S 80S;3S80003/pD0\rD`P  0pD`P $0003~ }{yw_J3S  K?0D0VXeA-PMoU`D@(cVpcPcpJc-00S0  S/8bO-`$o\0SfP U\0 E2#<@T `0S0 Pd Qh 0 Bh `QhpWdჇdp`p?p@-nP@0/0>pG-pn0\`V3 @ P0Z/  DP 0SQ0EHK 0\ $P (C P (>P (9' 0S P O-\0$MP 0.0S 0`S 000/@/0T$$00 uP A  @\0 D2#<Q 0 @ 0 0S@p0 \D⚃#88 $ !R!  0㚃#<P \0S 03/ 00#"0 0:Pu03 2pt 1 0  0Q 070S  h0㚃#7 R7+ ] 0  p0  0  p(@  "  [0㚃#< 0㚃#<0S  L  B  K P#  @ 0 0S_0( ,0R PN $k( Vj-0SC$Ѝ0㚃#0p1 pW20    0<    p ppWp0GS  Q 0 @00 P  P  0㓊(7<0]Y0-0?? ?)???h?Rp@-@p@ kRPp`[( U:,PU 0 ,0$j( :Vp@ 0000PC-\Mp`'m@PX`P00v⢠ 0S 0 CRS G0G G0G $pP 0S EX\( 0U 0S^ 00CSZT5$ $p07pp 0 0&pS  W   !R00.0700j%0' 2p103 *0"60#X02pSIڤ$ W 00Q    |jWBh$P (+ P (&P (!X 0GH0\030 0 8 0/o20"S R 01 0"000 #0X !! R0R!0GHL3\0@0 00CS R  B. 0" 0C&0$C4'0( qP$ jP0S$jP x$Pp 00S \ks(坄(嚄 (啄 $}( $U0,0001 0(0$00@0 05P00S  0 CRSa0 <@P6 78Qd}A^DQAD W0\0  P  0W00S 0.0-00 PT\Ѝ???*???)4-$2?H?Y?n????T2$???p@-@~kP0 $\00$p@|`V 0p@-P`fk@^PPP P$P  0ۃ0$0 :,(UpQ@-@ ̞ Q Ǟ)?4? 0S$0]S(0S/GS(0S 0SS@-  /O-M`Pk@`0P⒞ ( ,t0@0D048< p 0  ႞ 0 " P, 5R0CS S<00 0 00 S 0s!$ 0P ЍO P R0 R Y 4R0S S0CS  t4  VCS P$S p  44  F0t0 0S$0]S(0SA?W?bmL?C$$H$4F$H$F$H$I$(5:$??@-@ MP  0T T LgЍ H`R @ 0R0C 0`P垙 $04$pG 0S Ho0 3/?RRG-`@P P9(p,0@00X\40X0\0,i_ 0G/000/000/A-`@ MP(p0P PP[GP<0S0<00S,P/ Ѝ80S ^PP 0001380<0S P0<0080U@0H 0P1 00@ L0 PGq: P00PP#T @ P PP`0( 0 1000000P0TP T0SPPP R0P0LP sLJ0L0H0H0}<0PaT.TPP@bDB$ `p@-P@(`i000P0S @0S D0P(X0,D0囙p@A-`@(PJ0D R P@0,D0僙<0S0C,p<0 8X0< 3R800B<08o000bp00 0AX}RT0S PTTPP 0P0LP L0L0HoH@bC-p @R`00@ ЍRP0 0e  0@C@-00  ЍG-@ P0SP- (`P,0'4pWDy P Pl03400@0 000 PTP@4p՘ЍP@bO-@PP0MS: (px0-4`V,Dx)0400 @0<0X0@0\0008008#80T 0T#PP UЍ8儙4`@X`\`,⏘PPPC$+?0/@-&g@Ep@-@PgP  $     p@lK$@-0PQ@M 0Q 680Q 0Q 000P  @dЍ vP`SP <0 0 p,07/UpUDiU@nU@[c##$0 0!0 00 /@bd d$dʀ0$R/ @-0^ "G @P Q H0Q -1CQ0 /@-:10/ W@ WQ@-@ :04Sh=  LPh=0h=h=9h=0h=X$G- M`p P@c 01 0SđS: 018#(!#( 0 R R0S 0: 0@ T Ѝ@-?f0 $2@-@8fT0 04-A-@`-fPzo1DT" l=S et偖 h0 $P lUGm@1A8.A0  h= l? d@-:! Q \ \ !R0100  ЍO-MpePp0@000000 0 0h]04官0 PBP  d]`سծP|T]PFm, 0 #P8`<G0#`4 0 X#P+ 0 8#P" h=0h=h=0h= 0!  Ph= 0h=h=;"Ql0l=02$@Z00 0/@2`1081 aaAa"@|.@2 b04"0 ("!(@0"T0$14Ѝ8 h0"Q+ P(Ssl0 h=0h=p:txl0Q`4P\p! Q +\A兘 LЍO@S IU 0C#pTtXx\0T,P;@Q  @t0 S 0t0x0 @d=S @p00t0 0x0`=t0d=l=Sd < T\??4? dL?O$bMb|U$,??????@-@ 0 PЍ: Q/@-<0DT 0 !0  !@b0@- ! 0 !7@-P@ U H :(000U J(00C0 Ѝ0 dG-P@0pS` 0S坔00h=0h=,2S h=0h=,2S0P #.P0C ,2 204` 00PX0PG dl?0/C-h=@`M 8! P(!14  "R. S>4h-<0.p XS ,h-PP Q 4+aU h=`   0 a,Rߍ ,h-: p $`  vUߍC=?G-@P` LpTT-0GR8`-!d=Q?:h= F h=P<h= < h= h=0S/:!P `0 0@a0 Gc>]P T< 030p 0S 030G???bQZ$p@-@Z1Qp+ 0 / d0 @-  @/00Q/@-0 @/@-c 0 @-@cT00-A-P@`pP Vx`@P V@P @UA-Ppb,`@001$pP W0S  PP R10PSSU SA@-MpPb`@,P啕0 N` /T00000 0}`P 000010040 0800S 3/00S 10S$0 '0CS 0c4`8`(0S S0 ЍS PS0000010001 0C0S B1 0(0R4 `&\V 0S 3/P8a `p0S 0R S 0Q+Qer0000PЍ@a 0 SR 00SRR`Q:40078%0 0 %0  `P 0FSa@ B Ѝ@%0S80 080 0 P  Ѝ@00 0P D00S 0P  x0 p W00`Su 0CS|000 0P  0P  0P  0P   0P   0P  P000 0P~  Pv00Sw 0CS|00Sp 0CSH2n1 (0RjRjlmP`i M000 0PC  0P;|  0P3  x0P+  p0P#   h0P   `0P  XP 000 O0P p &@=|:70R- 0 POP?????"?Y?5?v??????G? ??#?Z?@-@P p 0S$00CS (0SSPS@-M$@\ ( Ƞ,Ƞ 0EPЍ7@-0PS @ P P2 " 0  P   Ѝ0@ Ѝ0!@-`@V Pp1WT0P 00$0%`b0 P   Ѝ@ Ѝ@-@\ (8#800 PЍO-P4`0U@DHp@B 0  ЍO/@N  0IJ <00D`@0000I?o2K3H01]00|0帐弰`PȀpP 0 0<P  ЍOa ЍbUSBCR@-@  0S   Ѝ@P t0BS00U  Ѝ@=000S 000 vP ЍS  \00 00S 0 @U U0Q 0 Ѝ@,0S \U 6_p0@cS`6 0$式0 0CS000000[00U R0 04  \[04]8^<SU0[025S0^0 B0A@ 840_ C <#$` #(#2\ ^0,!S0B 000S  U ^` 0 0sU ^`  0 02U t^`x ` Ѝ@pg^ <ڐ?|??USBUSBUSBS???'??F?v????7@-0PS @00x0Ps 6i0S!0 00 2 02  h P   Ѝ0@' Ѝ0C-Pc, Q(@ 0 ЍC/@ 1 N Rp|p帐开  S  4 ! c,G 0! 2"  P  ЍC Ѝ@-R@ M 0S  Ѝ@0PT# 0CS0U U Ѝ@q 000S 000 PЍS  2[00 00S 0 U U 0Q 0Ѝ@~0S [00S 0& 000xx00  U U0 0 P 0_ R10S 7S  /o" 0Ax0S {y0  U N]00apS`N 0ԍvUp =]`A ȍjU 1]`5 弍0 0U !]`% |嬍0 0}U ]` @圍Ѝ@ ] w?|???F?`???@-@0S010@-=00 000EЍI@-0  Ѝ?//A-P u@80p49808 E0`0X0 0P0 0H0`@$0<0,000E0Hp0``800xt$dt$s$@x$$0S8$0^@-P0$M@\UC0S\8Q  \Lo Q0@PP T0 `(@L \XpD7/0S S0d0$Ѝ@&=8p(`@pLPX@D4/$Ѝ@?s$u$S0R030# d0 =C-`1p$MP@@` V000d0$ЍC< UE00D0`2010H 0C S0 0R  (@Ll@ @@ D4/$Ѝ\ u008?u$^? Q/C-p`M5PP4@0p@P0h0J 40E  8P 9Ѝa< `p0!N&P 0AG& 0A&0 003S$080@(0800,p0P4ZKx>p@-0@0P[10SZU - U p00 00P00p000p@- MPd0`@00@00 00`PD,00$ 0@`K Ѝphu>?0LP Ѝ ,0RP 0S ?!@-P`@)0P  0 00,     `0Ѝp@A-p@` P %(@ p@P ({ pW< &("(A-`@pPP 0  00@@ 0 % (`@P (E`V<Ѝ@&s@-P@`* |D0  R= 080#80C?o2S  cD03  Y R@0 D0  R= 080#80S0S [m@P @0  0L0 0nЍp@V p@-@ PKPp PUYt4@0~$  & ~@0  { p@ɟ @'G-`RMpY@唌/Q 2 W00H000(00 ,0L0d0TH ` @ $ P0P T HƌЍ  Pm0 00>bE0@080 S 00S 10S 20S$ᣌ (0P   0 SR0 R2R1M`P l #h#YXL偉!8X@9`0 4@@@@A-pPj`@P00P `4VGP  'H #   @-7 @  @G-@(`0P00 0SH L2H0L2 ЍGBT pTL2H@0L2z  P @TЍ %\P0 #  Q0"Z-.R0W30B00@p P/O-peMP[X@G`  0(00,00 0$02P @001 00 0P0@0@``  $0 PX,,0P P 0 S,010,0`00SP ` E Y00S 1`P eߍO=c0S 00S! 10S 10STP@ 0 Q0S0  S`S1   0$PM*080V 9UzW=0 |Yeߍ P 8P<@>@D@@@;@@X@@&@v@@-@@0`A( @0CR@Pp0@M@0 (; (0T Ѝ@-1@00  4P  0S$@oЍt@@-Pp@@0` T@D T hv0 0 0 h Ѝ@v000 F Ѝ @-8@0,00Q #^  P/0@-M@PuP Ѝ000  00  P0-Pp@-0P( 0CR@00(0 0(0 C40pp@-000 P  Ѝ@@-@8 P@0  0 P V! Ѝ@@p@-P`hFvo@P 0 0 0 i 0$ k0/ 0$  0$ m0/ 0$  0$ 0/ 0$ hp@/v@-p@PT` 0$ R00@DR0S hv0 0 0 h Ѝ@v00 Ѝ@-0   Ѝ@@@-P`PVP@<׉p xډ hP  H Ѝ@聉0(00,00 0$0<q P`@p00 SPP 0 Ѝ@hp0S8  =P Ug0 | Ѝ@0P \  0 SR0 R2R1P@@@@e@Q@s@-`@PD P (0  0` P Ѝp@@-@ `@p@-Pg`@ "P00P `FaVP  ` $ # " pO-P@GpP0 HL2H0L200Y HO SHbVL2H0L2p:!H00H0 XP+!H0[0H0 00 `V BP/s@-P`Ѝp@-0#00 P  Ѝ@@-00Q@00  0 Ѝ@-@0  0  Ѝ@-@P?@0`0 #R0 0 05 @ ЍpG-` MPT@奇@ b` |Ch0(00`,00 0 IP T@ -001 00 5P S@     GP SHw   ?P0P q  0 SR0 R2R1`~_00H000 `P K85QW0 0X00\l0\ D ЍG4@6@<@O@@@6@@@@$@p@@O-`Mp@5P005PP HL2H0L2%  % ЍO505HXWP    ((R  $WP\  PZ   PXL2H0L25 0500\008 #8d%@-@M`pT DP00000R !X0<BP hr0 0 0 hЍ@r000RЍP/@-000 P  Ѝ@p@-P0( R@0(;Pp0< ` <<pp\@-@hr0 0 0 h@rs@-@P`MTЍp@ D0 4  000ЍpC-(p@`CPP W ; ЍW@000000  @0PP0P0W0S@  ;@- @0@PЍ@-0@ 0 0@PЍp@-PQ`00R@ R 0@BT@ l0R JR\ 0ׂP00p Q@7 @BF@-0 0 0uЍ@-  0kЍ@-0 0 0aЍp@-@PpXL _Pp$z <PUp@7.'G-pb MRP@⛅ ច 000(00 ,0<p P@ $ 00P H9 Ѝ PP m 0 0000PF0@0`S2P0S 00S 10S 20S0P    R 0S0 ĵ1 ĥPR 0S2 ĵc0.080 P 0K<@@@@A-Pn@pHP00P `5VTL ,   &/.p@-PQ@T T |0@DT@ T0T QD 0B⧁PpQ@7@BFG-p0@00PKPH3rPL2 0HL2iP ЍGbV0L2V HV XP  TP L2HP0L2?? 1  Y!  00 `Ѝ&*P/@-0$00 uP  Ѝl@G-@00`P@(p 0h 0&hPS@*Oo0XB%XA  BWpS  `P&d%T`P 0 ( oT 0    @-( PO:K0Kb@-P@`pP  0@0@DF  0p`@ Ѝs@-P`@P0@ D0FI T  "@@ @ AOCO R= 080#8S S S 0D P 4Ѝp@ @}LЍpD@A-p`@4X@@P0 P@0 @00`0  @VЍ! C-p@MP`V4Y@@0 @j0 0 0c0 h@\Y T凁@Ѝ`Foo0b0@  R`V00 Y@@- 40$a S00@60 PS!P `0P% 40 PPS 00 s 0P0 pSc  0P0 @S Ѝ@Qb"@-P@x@-@hn0 0 0 h@nO-M@ pP` @` ( RЍO 0@ BD0P40#0 @R03`1:0D00`B @0?VPЍj& R000Ƞ40# 0^ @@R::P ,ˠ 0 0 Q0  Q0`B @D@0C-`MPD0@00L0P   T_PP H劀Ѝ0H00PL2 0L2H000 0 AbVp0L2pV HU000000 * CRP L2H0L200t00Q - 2W0A00`Pp j@O-`K,MpwNPc  &000 (00` P,0 $ P - Hេ,Ѝ0 0$0D0 @0 tPm~@0p< 0 0S;9@00C2@0S<K000 P^L0?SSK0?SP4|@0@p pT0 p0 <00P010 p봡9Z3 9 p X000P    0B?o 2 00S0@^00S 10S1R00S2R5p4 00pB0 S-  10p20 S  0p"0 S@  v10p d``0 p L0 *)@ aZpl0 0 )@ Q 0 p0 p)@Cp0 p 9H0 p 00 \p  '0p ,8000 PI ER00܅ p0 pS꤅ 0p0 S p \<00 Sy 0p~0 S@i <0pZRp Ĕ 0p嶡e0 SP 0 x 0pT 0 00S>  40pC0 S@.   0p30 S XA40 |0 4w40 14 0l0 4g&B 0 4p( `40pS+0   T0 p< KH0 p B0 p(0p  300 0 \  (H0pp  $02 p0Sq0  0p1 0Sl0 Pp1:040 $P @J011pW0H#40H40 0p@0 0 040J0@0 ;0 2@0 10  @0 <00wH  hIP \ k|@ @  L@ @bVUUU"`N@`7@ U0o@@-Pp@ P㰑@`800`Y0 H0 `I0 ` J0 E`@0 !nt40 0 0 < <  K"40 0 0 < < @0 00 !;@00 ?  ?f?P P Ѝ0 4J T@0*@ 1L  >;5@0:@005@0:a.*aUP/@-000 P  Ѝ@0@-MP@hPX0 00 A1#P  P 0 |Ѝ0@G-P` C@P 0   pW@-@hTj0 0 0 h@^jG-P`@ pPxx T0l!\|ЍG0 $0( ?( (!00@007c *0J8#8 S 0C 0S90Q"' Q/o"3 QRA000@ P0@  0*   |@0 0S8#8@TPЍRB0 0?@@-@P @&A-Pp0(`0CV ,@  @00Veڰ!0{Ѝ1V04@00T@3 S0!H00 00$#$S  ,!S S A/o,0"<,& R!0%0P 00 0($(̠ ((   $($L @0 0 0FR5 9 P  0 0@ņņ3@ @K@p@-MP@`#PP0 00 `A1P P 0BX{Ѝp@}@C-p@``PIPE$     0 PP    0PH  {P Ѝ$[X (@@-@@  `p0PP 0S SL0  Ѝ@ ЍO-@p@pP *p&iI1 @=P` Bz<`@0  QV Ѝ!@I; 0@1`P BDX@@-@@@ @Ѝ0 P@oO-0` 0?   `P `3Y 0 p ` pW 0 0S  S  t+p) i" b ^ 0?   `P 0S  P $GF`&8 $& & 08`b  0\ A0  >0 20(0 PJ80G9 0: 0; 0< 0= 0< 80?9 0: 0; 0< 0= 04 @@@p@Y@@@@@@@C-@4`Y @P0 @pP VBAFx @ Ѝx0#-5  0 @P 0 <@RBA)x Ik("(@A-4X@ p0 Pz`P [BA xЍ I\0#-5  0 `]P  WBAw< @p@-@AP*A jA#@< ?( A]AA p@U?p@-@j@0P``` 1 ++U **p@ <@-00Q 6 0Q ui p@-@GPOPp@00SD0  R= 080#8S0!23 $3Pp@0# 0 0SD0  R= 080#80C?o2S+ *+D0V ` [P R@  . 0 0S0  S(  p@CH@p@-@20 00 P4 T8 G, FQ.pO-@PUM`pPPhB/HP.@ L.@0㰀`B_HTPPS \L20L2\H兿|XH`@0  j fp  a W0!$005P!aB!$  $ Lp` ,F0 B (>0!0$0PT `!]BAv ,Uߍ` 041H0 0b[V4 8!0H PHpW @P/@-0$00 7P  Ѝ\@p@-Ph@d1 01  hp@ ds@-`P@0   Č \@D\0 Ѝp@ L(00"(tЍpp@-0@( ARP0#( ;R< b?-< B4 0ppp@-P@Pp@0pD0  R= 080#8Spp@tA-@`pPP 0  0PpP<@P  -ЍG-` R MpC@v~w w 000(00 ,0< ` @ $ 00P Hw Ѝ P m  000$E00d0@0剿03200 S 00S 10S 20Sv v0P    R 0S0 ĵ1 ĥR 0S2 ĵ0208 0b P,@000,@( @ @: @07@-@P0P Ѝ00 BPs@-`@P P  =  0` P }Ѝpp@-@PPp   _Pp >PUp@9'@-@P`pP 0P0 ЍU  @    0  00@-@pP``P =  0p` Ѝs@-`@B 0P .@0 a qZ0  iP% N ]F U> M6 FU  PЍp( aPP @-@P`pT@  @ $0  p     ЍC-@PPs@0     ЍCP H[L2H0L2啼 0 009HEb pV L2H0L2y 0  *= > SY  C 00 `V  EP L2H0L2P   Ѝ$0 0!0 00 /@bd d$d@-0 ,0@/@-0\ @/@-00l@ 4/Ѝ@-0 4@4/@-0d @/A-Pp@`T d08/< S   S Co    / 0 /ᰞb0~  ꔻ0~  λͻ$@- ? .:cp@-t0P#0\?.0@ 0 0$1(10  000 pp@:chp@- T?P@.T1S `#AP 0 p@0/p:chp@- T?P@c.T1S `AP 0 p@ 0/p:chp@- T?P@E.T1S `@P 0 p@40/p:cA-(0P#0?'.T1S@@P0/`oPh`F $a0tp000-191910919!03/0 Q$1UP!`0 !6/$10C$1 10 1A#:c@-@@孺8 e@-@ P`  ^@80U C0VH0qЍp @0110   ~8@-<0DT 0 !x0  !@b0@- !i 0 !G-H1@pT`(A- $0S)h0L3/# h03/h0P03/00S "YZ 0 00++R4S0000 1 PtPh0L\3/ PUl0  83/00 (P05/ЍGT[c dbcIA-@p`h P(0000p`h0$0Pl00L p0A2=0$T$|$ @p@-@P0d %S 050pp@-@`P0d &S 0U60pU 0h00l00p0p q$$$!@ B/o P" RA-@pP* @& !!P_P`P 0 R(?M(?00??C S0cVS@@@-@l0D 3/ l003/h0D3/Ph003/8-|M 0V|Ѝp@-D1@S@00tP919!03/03/D1SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p091D1S91P0 0CS910919!03/610616!0p@/A-P`>0pH@@ CP1S T!R 3/0T10@ 0 0 0FC`~>P 0/5'0*5Pͮ叿P UP ; 0 4~⑸p dc(!@ 60D31Q0@   D91/p@-@x`tP03/D1 0CSp03/ 0 3/p@d^`V 03/Pp@-@tPD!0R@  3/D1S 03/0 03/=!03/0  03/=!0 3/D1Se;11S/6!Q0061210/-!R $!$10(!21//0| 00Q  Q  BQ6!0 210/-!R $!$10(!21/6! 6!6!061 ltG-@ |?p(,*PP` T1S`Ѝ=P  0$` 06/p` 0  p`ܑ TE 1TV 1T0CT 1 C T 1?A3c0:c\t]t@{t Hd߀ @1@Xt@1(@jt@mt1(Mb?1S/,!t       000 l0/p@-@P,10,1@1  `t`0d 0 `0d 0D!@0 0910BRS91091R91@09109!t3/P1Sp3/0T1pp@- ?`~)P0@ @003/T1S <P 0@0Sp:cG-`0p#0?Q)T1S@;P D(pZ  SPP⨏ZȀ F0P * 61p061 Y ( A6p61P061 $0( S S00@ 0990`1S@1Sp8@/80OτB 003A1+ \R? 6!@  6! i R6!@ =!@!051( `1RgS61>!0gD!0ETPR;1v011,1 ,10,1,1 ,10,1D!0R3003/08v/!Rs /1AoR6!=!@ 6!6!6!  S61>!061$0 0!1B8:cbO-0 pLM?B(@P`LЍ0  1S :P P0 `pP 0hP0 n0`@0Sp̠L1S 3/P on`>0T1x`0d 0h0S В0 ` dQShP0 h00&091@1 91091D1S91P0 0CS91091t9! 03/0 3/3圴V? # !Ѵ0@=K,!D0t0 D0@00$ )$ $ ($ $06$00`1C|1810<1l1D1¶ᬷ1 1181 01,10,1 `P0  03/`P3 0@00S-*eSw Rh00SZ=9 R = ?A3c2#d S 0"#!0 "#1R 3~?4 M:cd!@MbHd d+bbAp@-0 P"6 0?0'T1Sp@9P ?1S YU,1 ,10 Vp ,10,1S,1 ,10,10:cp@-@P @̳p8 eO-T!R 9P 1!PR 1! A(0q 01pBR0  R<" 0"  @V`0@S @DWb A!  BR!V:,!K ,! ,!9! 9!D!R:9! 9!90@`FSAV    R<1! 0 D03/p,! ,! ,!0@`S @D` BR9!@t4/,! ,! ,! 0!R p 0q3a 4A4qA!@ 0 2/@!  /! /! .!R .! $   h0A ЍO Ѝ谞bbD$0S/&O-T1S @8P tPI03/0`S E ЍD1 SPf03/c8!03/03/`D1 S 0S @0V 3/1q0 R 03/ Q  $ P\ˠˠ \ Q  D!R0 ,!Le `V03/03/`j0Sf0S`Vk3/0A  3/8!0 3/;!03/ < @010;0a>03/ 0p3/ 03/03/P0,,0 3/03/0P 01 03/1Sa S`0 3/1@S` 03/g Q"@ dc #@' @t %X"@5#@O#@b$%$$4$(!@`#@ %i#@d"@t"@~"@"@"@-#@"@"@"@,"@"@!@G"@!@"@P"@I#@%0@-@PM0  0 00 Ѝ0p@-HP0S p`@EP 0ST00p d@-30 0 t3/p@-3@tP 03/03/p@-3@]G-p@ `APCQR dU010! A-P@` 0$ pE\:d X0 A\ ^G- P$`(p,00 N\:c AY Y@0 G V @ AT/C-@P@@0$M,i c 0`o}Ѝ$:cP p@-PH0 & @4R  P t1  0p@}p$:c@-@xPt`$0M\p6 P t1 0040 000p`00}Ѝ$:cG-p0P 6 0`0 x0@U  Z40 0 0Z~Ѝ0 00:/p $:cvd@-@( $0$$"6 0@|$:c@-@`Pp<<0$M((0 00{Ѝ$:c@-@dP`p$0MH`P t1 (0 00Ѝ$:c0@-P$0M 0 0 ƭЍ0%%@-(0 0600㷭Ѝ%%@-@E2 1R0@-80( 4@"6 0 t$p@$:cA-pP`@&2^ T 0pA/@-2@⛆s@-P` 2AT 0( `4/@P cЍpvd#@@-o/@-p@-1@R_t1z9 /0#!  0D E!1 0`10\10X1tdQ 1Q adQ \dZdXd8  EP"1(0`1!,0\100X1401L01P0; 'X0X XPHc@p(ЍA(Ѝ#@#@($@b$@v$@$@$@%%< %$@T%p@-P@Ro៪Q۪pp@-tA@ P0 w9@Pp%t1/G-R@ၪ`PST1S `P `᮪z'44`0P1QY 0 &`0 &VPᵃJ9Y9yLz`G=b$@$@$@p@-@R_y7T1!0CST1Svalp@yp@e0S$00A-@0SQ*p`\PHP @0@Pp`/~π0 S@<@P/pHG-@P[ P`0\q\ B Ƞ,Ƞ\)\&001~S9,- !. `0F! QS0 p#0! `1#0 PP R*,Y Y*( #3^ `0~S  `  B("( R 0R VO-PP`(; ` 0p0(pp@,`0<0060 `<`H`8` Q4 *0 $0$000C09/P`P 00 S_``p W 0S!C P& A- Ġ! P`1qȠ@#@3^ Q0C8#8S00W0S Q@~P /p@-@P_p|~ ^\^0p0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000@P,00AP@(0 $000$  @<0 P '1_DЍ0t%@A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 ta9<l=D=St  >.0 ,^9l=hml]衆%@%@O-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P DRaT-X=\R6 l 0;/ 0P4xV&@@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+sXT-X=\R0P  5/x0PX0 ``<T=X \S4 h `08/ 0 `蠆-&@T&@000 ͓0\S㎝∯p@-Ph@ M1 01  hp@MG-@}`Ju1吀011S #S3P11011S ]PP 10CS1^ᑧP@bp@-@mPG 10CS11^p@z=  @-0=X T=\`S4 @0h /D A-@P`}X= 0\8/  D=SspWJ`<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/x&@p@-]p@1-P X`= S-<]=0=0>03p &@&@ 0!< 04 0 (   !/@bd d$dO-`@P0ȠY p3 Ȫ L\ +P U s0 0 @ T0 Ѝ&@\ P/0 !8 00 (  , !/@bd d$dp@-@P T⪚9S 9S 404 0@a 0 (,p@1%bgfff6%D=S/p@-@=P0C==0CS=>3;3p@hCA-=PS`p @PVD=S@ 0r '=@S蠆A-@p !P`P  0P Q- 0T  \_Ѝ0A S  ,_ 0  '@)'@@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  I_0d 9S 0Q Q   Ѝ0  DP%@G-0Q@pP0MQ 0ЍQ z 4=3/|7S (Wh70?0?h70?|7S 0 0@a 0 (|7S H/ox""0 \%  R # *(0}^q !(B^'@bgfff6%A@-`M MP@P#EP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q X3P2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp '0SSp E /  ("( E @=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 00J'H0QN0 pN0N0%*:iFA-όp` 0P@sP 0 `kP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S* S S@@S@@n R 3 t0Y X@Ѝp@ S S@ S@S@@@Ѝpt'@O-@dM@=S D=Sd?`< $0T=0=S >S3;3dЍ9S9 YU 0S990090C9R0 05 p 0 P 4 0 03/039Sb.030@]  vaP303TW ?9SPSU PU 0S000000C0As R0(P 0 S30 03/噒pP[2 0 古yt PPo\"(0傿)0Rd-! "G\ʔG 0 bD9Sㆍ P0S ` P 0!:> *00! 820a08/ᠾ(0"0D100 0>00KC19- S) 101/0< 208w(0 501=0$0P( `!0 [/d=  P 0 H00YXZ Z!0  b 0   0 PD10=   =0C== S-,0>>0>pXe̡'@p@-0=@S 3/`D]U'm PP `V|$[pT=X \S2 d 0``6/T=X \S4 h ``(06/ P N'@C-CdMpL 3` <3`0 dЍP尡 RU`@ 7+0D?o2P0S Pۡᙄ  $V00P`@UHPˡDH3@<30G-MMpG@ l$PPnW`T$A0Vk  V7* V  V @-R au$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  S$0 Ř0 ۍЍ \ R\P@-R 6  -2$ P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!v0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0uP Pl P9S9  09b sPP [@ VF x9i*F%?- S/@-@pP`,M 2 @#"0 G,ЍC-3@@DM >  H=S  CR})9 N L)"" FPP> ?PP@ [0 l U CE#@PU0@0 `P3@ > Ud=;d=DЍSP-1R >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#\k@$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> AP=0 .:^^XW3XR=3 ,=3/@]G  O-@P@MX,=3/`P0@= $U>?oH-2R0S 9l&89d=0d=9S00`P  ?;< ?5989H-R%9" ;Sږo%#}> p ;V("( ;t0} 0"0 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332 YT=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  - ?!@Q UH=S 0 `Ѝ  H=S ?  00C0S00[2ӕ Q1ڮ۾=-  P  PV `DVT-X \R0 ` 003/ i1YV<`T-X \R" D 003/T=X \S4 0h `9/= [0=<7(@Z%@  -%3t%@2D Ib@8 1'@(@(@p@-P`X4P@@MT @:gp0p@-@2@=Sp>PS 0CS>02tSp@>S 0CS>02p@0UH=S >S R(@C-PpM"P@ `@P NЍ1Y0CYD1Ye 1Y 9 - 09 |94P@4 =#@=S M\1Y7 1Y . l@P#@= S7 9S    @y S 4 ᤢ4P@3@ @N0 @0 0]P@P4P@3@ UH=S@2iii9iO-@=@SdM ]"P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0JP L0 U  T-X=`R" D 0p\7/=-0C==0=1 ak& T-X R$ H 00\3/00` (0P㖯) 0X*7BHU= 0.`3 ;3B& T-X R$ H 00\3/<0 0` 0 P▯= 0)BU= 0.73 ;3 T-X=\R  0P5/` 0p`1,)S { S  BS T=X \S=4 8h `P#85/= l3  d=0S $P #0=00 S0"( F0=T=X S2 0d ` 2 9S8t$8W9Sp02"' `P' W0 .0< p0pTp(p320@@00` P! (Tǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК $P 3 "*8S00C87' L< 0cX(LQᘋ9_ 8⪵P 0/)` V%0 c ~ pQp  y0H(མ=[8%)0S= -JZ%8S=0= O0F&>=~)0 S$IBb[Pp SW P P P T⼄ lPV\PXP )W n`` pQ 0 /Ⲣp0G'བྷ=[#)08BS~= -JZh#BS=0= 0H(>=nf S0 0 042<#_0CSy0d=0d=9S9Sm `43/acd=0d=_H=S >Sh"PS 0>P9SMd=09`S 4Q`PEUP#8뎄 U >^pP>Pm? 0$ 0 0$ px?&00 02` S08#82́ 000H-Q0R RH RI xR  0> hP``:g>  L0>YP 1>#F&V   01  ?& 22?2 ?"LP0C.>2>2?5?# R #.D2d(@(@(@Xe(@bx d )@)@+)@L)@`)@)@)@l%@)@O- @ $MP( O $Ѝ] G OT=`X S2 d `P0\5/T=X \S4 h `Pp85/0D=0P0D=U_}0 4[P  "PXB  YKw bO0 00 SO0HeGQ R)HO0SH=10S"l?O0H=0 000P0 0d1!,2# 0L='O( 0(=v pO0H=0dp0 0 1!ᤆ2# 0H-P=R0&SS+ 00x0  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=?H=S% %S0B NH=嬥嬕S L}d\:9"a0@ghNPd:9ȏ"a@h 0$N   )+4),|04p@04\r0404043099!= 0 _P Q:0㠠 0I10S S2 ԊO베YH08 >PG0  SBQQ Q"< 1?0:H=S0 d=  0 !P0 d0מ0d= d-H-R' R RB d-Pt#Qb?d= d#Qژ0d=T3)Q8<9 9<9< (S:SP/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0T 0 Pe 0SbڴyX > 2 t=2(x=6=⾀ᰀ?DPᨌc44=4!8=141:1:141=1=1=1 =R@p1X 0>9/  )>pL1a  8 >p0T8 p@-@pP3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002JG`rp: ]0@000y%x%L%x%8y%8{%%x%p.@@-@4S@/G-3PA@,p0 <300 U SHbVH93<3Ø> - 2X>00`V  uP 3<300 UHGO-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \pP `,P@-@P@n@uO-@RrM0 (`6/03\`"B06/0 (`6/,0#3/6n0S` 0 (:/03\"0:/(0 :/ׯ 0@0C  4 3/ 1Q 110 0 B0 A B0  P B B 4 S R R0C("(00 0C0R0ց\"0C0;/0 SP 0 0 AH9Ѝ.@@-l3@S 4S 3/P OJ0l3.@l3S/ 4@-S@3/0l3A-@P`,T1pT 0CT? 0CT  ֖@1TP @30300Sp@ [@P3A0@S AS SP3@03l3S  ᖖ4P@3@ 2iiX@-@T-0@ p@-@(4S 3/P7Z؈&∠p//O-@`pM<0@P( 0 08DPE/0 S .@%%X%|%4}%n/@V/@%D%0%@%p@-<@P):pp@-/@4P P]p@-DA-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0-E03 \P05/2 ,P5/2P,` 6/ `A P@U! A P03\` &N6/0 `xp0 ` VA6HA$P@ 4A0P,A#P|/@/@/@v%v%/@/@/@#/@O-P \h ( ` ,@,4/ R@ Wd7W0 0 ,P5/0D(0@0O-p\h@R`C$x102c000 0Z PPP Ѝ00$10P t0S 3/0 \$8/ V ,0,3/" t0S 3/0 \$9/ V ,0,3/U d0@ [,PU Pb/@\0O-0Q05ph`  @^ |03/}V0 ,:/p +40\8:/  hP l0 [ $0\p 7/0 ,P,5/t0S 3/0 \$:/ gV0 ,,:/t0S 3/0 $\;/ QV ,0,3/I YʠZZ Zp0 PP Zp0 P t0S 3/0\ $:/0\ :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/0P , :/P P t0S 3/0\ $:/0\ :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/0P , :/P Y ЍY;5 t0S 3/_0 2$\ 0 ?0@;0@O-\0@hp@&PP`3  | P |0 ,,;/,0 ,;/*0 ,;/0 ,;/$ 0 ,;/"$ <"0 , ;/"( 8"0 ,$;/3- [ p  34 8\ 0 08/0 ,8/2 420,8/", 4"0 ,8/$0 0$00 ,`6/$04$0p  34 8\`  0 06/-00-03 0 3F%`3 p +40\@84/ SV O8$ 0 0 0G-P`hp,|03/8 R@ <0@@T@R (00S0@ T`  l@ XT@ DN@@L@p +\0x!40\8G/R0@r0@{0@0@ 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-@` 0p@*P$P\ 0T @0<< 0 0 0 00 0h0 03/0@0@0@O-\0`pQh@P t0S 3/ 0\$;/ @Rp +40\8;/}5R0 ,8/p +4 0\88/ $RWx0S 3/ OV(0,0000/@-@0\ |hA-`px$Pt$@*X0VP`|`hp*<`**`$]$萶%0 RT   RH  | R< |  R0  X R$ X T R T $"T%ܪ%% >%đ!@-@ 0Q !@\0@00A-` P@0S P 0q@P P"Pp@-P@"p@p@-0`@hP\ P 0 \00 ,@,4/p)P 0 0 0 0h0 03/P 00 0pp@-@Pb*p@0,S$G-P 10!Up0 0$C! $C1`(,J*T 0 S0 (ЍG0 PЍ!PP  0 P  0$PUPbMb0@O-@MphP*l!`P ߍO*EP' \0W%p᬴4$0"Z:@<0 R80S@p<0( R(p)TPP40 080SOʇߍ]!80S<0(Qt0S 3/0 \p$7/ P0 ,p,7/p<00St0S 3/0 \$9/ P0 ,,9/<0 R@ 8 R(0S@0 #&$p1 YL <0S( 0 W&P m)0"%h) < D&P Z)<00 Rp  *  P)`u 0 <<&P 0 h=5)<002)-)<00  t0S 3/_02 \$0:/ PX0\ :/0\ :/0 ,:/XP<000 ,:/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 03<3$Ѝ 4à@  P ^8pP pP#8 MMbb̵%A-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`v& 00 0%PP 0S  0  0` "Q08 "U P 0,D  p@\1@\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/@-2 \#1@0/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@@$0PL pl Ѝ1@@-P`p@@$0PL p‰ Ѝ1@p@-@P0 \`6/L 0 \`6/LU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&k 0!d!0    !0Gu@bd d$db7@-@ &^0202020 DR2|0@4S0000 2S " " Ѝ0@4%%`%X%v%v%@-@@ &@菇@-&Pp@-@P&2020p@-@4@SS&އ 0@b@-@&@/@-00  Ѝ1@@-@8Đ<0\ @/@-84< ,@4/@-00 v Ѝ1@G-p@d尐PV㬀ʀ 0! $ 0    !&⪇ 0!d!0    !0G@bd d$db7@-@&^ 0202x02p0p DR2h0"0000 32S " -" Ѝ0@[8%%%%v%v%@-@ &@ӆ@-&7Pp@-@P&a2020p@-@&& 0@]b@-@a&@d/p@-@DP0`,0Sp$5//p@-@Q P`I00T0 0 00DPSʁ@p0C0Q/ P /P  /C-.04@5 01D`00pP$M lP/0. $4"4H#8#8SA # SS $#0CS0S1 #S- CS" BS(  S @$@9$Ѝ S @q"S ʤ"S ST00 S x"S(T(@#h 4T90{@TT D" 8C8Sm  SF  BSb  S  S0ST@#  S  S+  S0S T @# T@#0 Sʤ!T 1 #S@0ST@#d 0 00S*T*@#4 >@I2,pS$~0 $09/I2PS$^~@0,@5UiPh  T 0@0T00Ņ0{@0YP8tY9ƕqJ1@  2@1@K2@1@1@1@2@22@U2@jB2@@-0 0`( "4`#/0s@-@Ph0p2(`l 6/h2 4l0Ѝp@/0P/0?0/ D00H(/0@-#20$A?0R  $$D 0 QH$ /0/0 0H00S00 A-0TP@0 `p 0 (T0Q 0000A @-#@R 2S00H0\ @A-@P` p 0  0 0 0 0 ؎P(8S_0 A0 ɎO-`$MHpS00H@ H㲎(8SZ@2W<7 0SPX 000 S0 ~Z0%ZZeZ Pp0PE000C0j 00((0R0 0(8S0Y   (8S00R2(`Z 0 V @0W   P @(8S W0000  Q0 20  0p0Pp0 p,p(`L0P$ЍG-D0p唨Z b@` 0X0T0X?  4XP 0  `(`( 0Q 000( 0Q 000(8Sf  0 `202P0̍ 0 Ǎ(8SO0( Q0000 㳍$Ѝ0s@-@_U| 4h @0 400(`p2l6/h@0d` l6/Ѝp@}|A-@0MxWe` PČ T $"d% P ʿ/BPA  BP@0Ѝ %P3 @ %P *BP PQ% @ PU $8UQP 40 8 0Q l$\`$0ЍAU0$8U84PLQ\ 0h0p2(` l6/0hd` l6/0h0p2(` l6/h0d`0h0p2(` l6/h 4p_Syep@ye}G-D0P唨Z w@p 0X0T0X?  X` 0  p(u`( 0Q 000( 0Q 000(8S  02`020QX0 ` 0 I(8S0( Q0000 50h0p2(`l 6/hlP0 d`6/$P|Ѝ0yO-D0MP.008S .04005 XpX00p 00X`@ 04T 07 00000 %(8Sw 0`0000 Hى(0P 000(ȕ \Ġ0 000 ‰\0 `0.\0 ᵉ("2Q0 0(8Sv40(8S-0(8S$"0 ,0(@C`p0 ⇉0((<RC0A@@-S>  pBFP`@0Sq@P*w0T*01S`w <(@ <80A0(P徒1 0p@-0DT 000?P  @-D00000 T ?P A-D0`p<0P@@BT0A#6T@1@T@V:YPOV  00(P异1 0`0`Fv@80@vG-0T` 0 \p@` 0P ( Q0000 (8SvsP /<0P 0S0 0 0  0 ˇ R X0<( <8T08( 880s00aR1 AG-@ស [vHhP<V P $P10CSp!p16W000$0xL0@ " GuvP 1 21Pb%D H(R/ $ pxO-M0P唨Z @ 80@ S 0S S@33P0@Ѝ`P@  YT`yP@&0X 00S :"; p&pP 0Xp 0 0  B/o"   $(8S00(8PS0(8S 0 0Y Y Y 2\@ 0@0$KP@Ou$82TP080s0S +@W u<80$ذ", (88S000 4,48#8? \0 0R0  0$ S$ $0 ` S$ $0 X $0S`PwtK4@O-D0,MPQ `RT 0H00S00a\0s 0 Y((2R\0X@0X00 @0 0H00(:~#:0<0p 00`@pQq0X 00 000(00!\0J (8S0(8Sp0p(8S0(8S0 020(`#20&a?0R  1$F$00 \0 @ 0\0`00`00 00$0 0ׂ(8S_0( Q0000 Â,Ѝ 008$ 0cP ᘂ:#:K 0呂 0PW\$ fZ WQJ 0$00\1 00J (8S0(8Sp0p 0(8S0(8S0 0(`0020#20&a?0R  1$F $00W\0$ @ 0\00~p0 (Q ! Z0G-D0.TP@`P pP 000`pX 00 0 0 sP Op<80a.0 PSP.PS  (X&000㘙 PP PP!D+ `pIp&"0H pP)XV`` $n)00 ,Ѝ 0 ,0p$ʀPb2,2 [0 4P/ ( Q0000 SP ( Q0000 @P ( oQ0000 + PPPQ)nV Ӏ025( P 0U000E00140(8S 0 0 P?UV⯄0(8Sr2 Q,0ۀk4<P0eH$a X P81S0h0 (Pp2l5/h1dP l5/G0Pdh0 (p2l8/h dl08/y.Y\ Uh (p2l9/h1d l9/U k(h (p2l8/h dP0l5/dxPhP (p2l8/h d0l8/dxhP (Pp2l5/h0dP l5/ :P Y)( VP   `h` (p2l9/h2dl2 0 0  9/h` (pp2l7/h4 dp0l7/h` (pp2l7/h4( dp0l7/h` (pp2l7/h dp2l7/z0hp` (plp29/h d0l9/$04yb'yN@ @h ` p2l (:/h 04 dl:/h` (`p2l6/!qhdP1@ l5/,8 04<:0PhP (`p2l6/h0H d`l:6/hP (`p2l6/h8P d`l6/whP (Pp2l5/h0H dPl5/0 P$8wHPU$#0 0d000hP(L(0(Pp2l5/h 4 dP1l5/0t2}4@t%|4@4@4@4@4@4@05@@5@s@-t2S P@hP (`p2l6/h d`P0l6/hP (Pp2l5/h0dP l5/Ѝp@A-P@hP (`p2l6/h2d`pl~ 06/hP (`p2l6/h4 d`0l6/hP (`p2l6/h4( d`0l6/P8S hP (Pp2l5/hP(0dPl0 5/LXUMPphpp2(`l 6/h@0 d`l6/`!whpp2(pl 7/hP0 dpl7/2w0P8L8Ѝs@-%@L8PS0L8P0h0p2(`l 6/h d`l06/2vЍpA-@P$ omXUP M2S 0h0 (pp2l7/h2 pdPl 05/@+mЍ@P/ 0\R/@-@ 0^   \R@-@0U. V? # 05Ѝ@"@5@A-PQ+ t@pT'P P  `0d #\0 @P 0t000 # Ѝ@5@5@5@A5@ 0`( "4`#/p@-PϠ ,@ / p0@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ05@@- y Ѝ@- q ЍO-M@p0 (P $   `0 S p  .( ߍ      0 (i @0p@-@MP `{  @ @@ @@ D }zw t. T  P܍p@-  Ѝ@-@ ЍO-MHR@`L @. B?<00p (008 <040,0$08 @L 2!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@ ߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@T Pߍ_00 X ( S 0 N 0 p$008,0040< O @L I8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@ q  .   ܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lq @@!H!P!X !,0( $ OZ`@ h$(,.`h @dߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.` @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPn\0 P0h0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@00V@0 00W`V 0  @0 4 iF0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

H0 0<00@-P@M  H 2@  Ѝ0O-yM00 00P0x0S0pCU0D0y 0` $00(00$0 , 0 00`0@0 000x  0F| 40F0 000E4  P 2  pX0 XP$0 E80P |2  pX 0dE XаP(0 ,0$0` 0 0@0050 0800x  0<0| 0F00 $TP (P ZP l1 > pX<0 PX⌰P $EE0 ,0#0E0(0`0$0@ 0 0000 0x  840<| 00 E P | JPpW@@#x0S0S @PdD0SSU0SS Pxyߍ6@8@<6P P /@-P/=9@A-@pP0SUA@0A` `FV`! 0PE@G-@P`0S 0X  P @0PEp pGWp! 0%H0ppGWp!P @`FVO-PDM %  !  !  ! "+P%PP0#0P%PP! PP0!0#$0P 00#$, 0+<0 0"00 0#0@0+(0 0"0#,00 "`@ 0,p@,`P` @`&! @@$$p +! p p' p' , ,,0, '00#0#0#0# P(`pP!!@!P P%`#, p'p@$@ `! @$0#0#4(#0% (8,%p# p'p,$ !$@8(& @$+  4!() ,, 0,  , " " $* * 4 P< . , 0 0#!.(P%P%+0# 00$ 00#0#08000#0#0 00 ,,0#,0# 00DЍt!t1G-P@  P@@P਀` ᩐPP`pP0 `0 pQ@! P A, @.p  q)1 0` p%RPPR$BpP@P@PB! ,"0 @ @  說UUUU3333-$M  $ЍO-RM  RO R p pG pP` 1"A0 `TT0000h`ᄡ0V,`0 0`T0 ` S@F0@ S 0`` P   YߍpV \ s:@UUUUp@-8@8P`\p 1001UUUUO-R`M R. R P P& Pp"Aq j TT00 0F[`N`0   T  WЍP[Q 5s:@O-EMP@PC 2 00`$00r(0 0,00 0000 0 0`pG0( 0 V000000 0 >0  >2  >2  >2     aEߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/P pQP 0 }p0 PUpPU l0 `T]000L -0S 40  LP @@2@@<6@@@@@@@@O-Mc?0 @p0< 00 S0 #0S0\  0SP `>K0C00 <,p 003/  0<3/00 \00V 0(0,0 !" 000 03/0@0 4/ 03/ 0 3/@@00p0  l02"  P aP y0 9%0 000  $/0S !&.LPP &> 0S !&> &>ş 0S " &> P0p0 59/5 0S !%tP p5 0S !P5<< $ş45 0S " 5 ֟P0p0 49/4 0S !$P 4 0S !|4dd ⯟Lğ`4 0S " @40( ⠟P0p0 49/4 0S !#JP 3 0S !3 ytß3 0S " l3XP jP0p0 83?9/?0 0S !? P ?0 0S !?0 C?0 0S " ?0 6P0tB0&.088/&.P &>, Q /&>P&.200!08/!P 1 !1P&.00x!0x8/`!DP H1P0 !01ܞP&.00!08/ P 0 Þ 0⽞P&.00? 0@4/? LlP ?0X8 ⤞$ ?0 ➞PߍPJ@L@0O@<6?O@8J@_pJ@HO@ 0A-aHM0 @1P4/@ #@@P @0 cx@ 0`00 !p7/@ 1+Pp @0 qb@0pp0 `X0 6/ `P 0, ?M`HЍXO@I@<6O@XP@p@-`@pMPM P L`a R D@Tᑧh pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\08M 00 00 P W 8Ѝp@-t @Ḷ0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-`p0MMPStX@pP `╥0 (`(0喦7 `⒦ `⎦`ަ N F7 (`VIM0bP l7 (o⿦ G '7 (#h `S0 `0T7 `P`⠦p 0b"!4b4# 0(0 7  (p0h 0p0` Mߍ#7 (&v ( `F O-M0@, ? R$0(@0 0$0 0p t 07 0001  E0Pppn0ERt  7`EPS0婠@k0C?o200U 00 Q @7 t0 4 t# t0P  U0Q00pp0 Q@0  7 t0@ 4 t0@7 P@@R tRY@0Z_0S0}$ЍMQ@[@\@V\@p@-l@P み  y,ap0@-,M@P4\0 x %  000Z?i,Ѝ0ch]@ 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dG-pP`4AVT ؈, LaT@! ]PU,QP N  R0 0  0H< 002  <,QЍG0! R U!VV0 S|Q0!V&R! 1?0|8|Q|]b@b@Xb@b@Kc@C-@p/TK2 0iP>05/cw^ 0o`000S P0? p /00p W`0S1001^n80 Sd001c00N8fF0S00d0Q00@Sg/1!p11S4H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 S01 1S  0310@0xj.1S(01 ЍCbXe_c@b@,b0b dc@&0.R  "-" R   wP/P/////|0R 0\ R\ !L/P x7S0S/Hb@Xb@O-`@u_Pw>0S4 0!qpx0Sli@TP P W $ 00Sp4b~d@xd@d@d@p@-`@%PP0p@ .00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;d@Ob@O-@0`pTM 0<^0 S wqw>0S9+ 3 a0 Tp7  0  Tp7  0 Tp7  0 Sp7 0 SY YpPP0S] (RDTX 2 0PT TЍ\I0X0 S0   0P 0p Sp7  0 Sp7  0 Sp7  0 Sp7 0 S0 0RʻP 70A  `P( 0 S0 `` vSp7  0 nSp7  0 fSp7  0 ^Sp7 0 VSpmd@@B00 S   P 01А/Xb@G-P@PX"B-\8 Q2 +Q  Q/ QwⴀXa` 0 S&100SP6 P Q$u?0XPpQ0Q Q 00 P PWP2q?0^ PP00p |p  ppWQX" 0S `P48S|74XS h0|w7h78 TI:J4`Vh78h74e@J0000 000/s@-@d ^1 R S00#0 0S0:1D!0CR 0 D10D1! 0!0 0 0 00 0%00n\0D1S 0S00 000 R 0D10CD1! 0  R0Ѝp0!0 0  ̝e@e@΀\Q: / AA!  ////p@-@8 MQ1P 00#!" 0 0000 `0V :3/P 1 p 0L 10 18003/@ :808003/000<0 Ѝpf@ f@\k@G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::\k@ d&&&&0S4 ]( QQ  HT/f@ d0S< bAI0!RR    4A>!/f@ dP0P// dQG-@p ڐ1 0  $10$1Ѝt`PXQ1L(10(1<1P1 .0 Y ,X  p7岠`7 1  0 `W p71 ! `80S0S% `03/P1 H!A0 베,10,1W11!1P10o0 8003/ 0`R ᤚ0 9/P  120!S 0! t I0v W㲠`0`4!S 4!j 4 W0f c0000 g@ df@!g@g@p@-@P:3/:3/p@-@:3/:@/G-8p(MW$51@P` ᴐᲠ*F0 0#!"! 0 03/P1 0 00R0000 101(Ѝ \0R 1 <  101 :(ЍG/f@h@h@C-`@ 1RP~P1US^1 E0 0x1 000P Ѝ08 R< 0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*g@P  N# 0 3/P g@\k@Mi@i@C-Pp(0`S!R$  X 0@ c0 0R@@@N@80S*gPU 00 0@ Ѝ (0 S*!R ,  $03/Pi@\k@/A-`P@HM p&40%V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p ?*P`Ѝ(j@@-0<S !  0 b Ѝ0Lj@<q@-@ bP0@00j@/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` F%ЍpG-R@P<M0 % ` 1 01(ppG0G  0] P 80R  $Ѝ"^$"P//O-@<`IMP 101p    5 000 S0 0>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  >0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍv@r@A-@` P  ,00,0 UV]S]P%w@O-P1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  +>0 "IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #v@r@p@-  0 "000e $zP$\ 1 >  0 &0C   0SH Q1S=Y 00 0 0S9x 0 $0MP 0 FP 1 $ 4:0P H:(= G CP 00[0Z0S  "P   V%PPl 0p000[|7S0E00S0S !R 0<<0ppW9p090& 05 !# #^  #P  R\ Qʐ! +0 00 p' l000101p0S5 SE 1S 0 0D; 0Sp10p180080|7S00S2S14+ * 00?B D10D10 q7/00` 00(0 0pP \P 0`00 01 |78*`S,0X 1 8*0 Z000 03  0  T P1 90R?C0C?0000`zX0@0. h71 H)00}?B '$00$0101Xx8S1 (00Q?B 000 00 0 2S1 ("00Q?B 0 a6/ 2" 0 S!-0002021 Hg9!= 0xS!-00C02021  HQ9!= 0bPQ1Sz 3/w1  H;9P1 8M HQ 0SH1L1 P10CP1S0 900S000000 0P0101? 0t 0S0t0`0S*[`P0`  H0S0S0S0S0SXGWI0 0Sp S SLX R00 4(04$0$04S[ `Y (0 0C4!<0V0` 20 %S ! ( 04  C00010100`00$00 붡0 ,0$0 00SG XZ0^40倀04X ! Z ߽P   ٽP 00#@ Z,0S 101Z000P40  0@004th0 0 0040a6/4XZ S  03  CH10H1EHqW1 H[6 nb*L10L11S 3/0SL1H100PHP1X7S  H66 I1S 3/ S  H%60 709000000 0Spp0p 000O-S@Pp`MD #0So Sl 00 |7S7S  40040T@S PS- 1S ?-Cp BP000BSh S] S70CS40040500CS 1 ?/0=>C( 0C0L00L0"h7|7S2S 0J S1 4?D/Gr0=>C!0CL00L0S 40040Ѝ, Th0d0252 5$YX0Zp0S1 =.Gr0;C!0CD00D00J S*1 >(.Gr0=>C!0CL00L00SS  2St *St 0S ! -00 P00P0SPn xl00phQ1 =-Gr0=>C!0CL00L0zx7S 0450!0P0C2X00Z0Q1 <,Gr0=>C!0CeL00L0Wx7S0X0Q1 <0,Gr0=>C!0CML00L0?0`0H5Q0[0 1 0; \H00H0Q  04 8 <+S0S JP |~0S! 8+0Gr:!H00H0l0S1 \:*Gr0C>C!0CD00D0 R1 *Gr9!H00H0X VY1  D*Gr9!T00T0YQ xQ 1  )GrX9!X00X0A=P:1  )Gr9!d10d1xU !/ ) W101<00<0101|7hWSPm2Sj U   ⋹Pd d57![0R 1  @4[ 71w. h7R7!66h7[071?%0#  1  @3 ?w>0S)  45?|Q 2  yP5`0S ;!0:1h7 0 000T0"08U l7 ?l78l70 000T0"5   P! T P 0`P00 0P  ᢲx8Xh'* 13/?S PT0- d∲|wW 7S 40040  0 RY/1 5%0N>C 0CD00D0BP*1 @5P%0=>C 0CL00L0P 2P P00S ! $04 zH00H0lZ1 4$0C 0C-`00`0x8Up W - pPU 1  T2 0 00 00 1 p2"0U>C 0CW   P   -P0P a6/1 HR  ,2<"0=>C, 0CL00L0㸑qἡ  @W2 0 xph:S  0 3/P1  B 000|7S0 a86/h7 1A &00Y>B l00l0|7S0 a6/xYE1S h 00]>B Jꯂ@w@|@`|@|@|@|@|@|@|@}@:}@}@}@}@}@~@p~@~@P~@~@w@~@|@~@@Q@@z@@w@~@@@@@@@S|@k}@t}@}@}@xb'|@J@u@@À@@@ @PPI@Cx@@ 0 C  ! 00 B000 0|Q4px0p 0S0HP! 00C0\!00 0- B00000S 0GSX 1 !O00]>B 0S ! !0 0M B|7 "S ! "00m Bo7S ! h"00} BHW W㐑D  2I/Cp BU0000x8U,  PP` 2 020000P ,.1#  T1H3V P 0 0, a06/r2 `x8U f #00=B ],P^ #(00=B o bP  $>00=B h00h0H(4  T0` Z7S.W) W7,P "0,0Z 1$  T0 0 x8U<10<1h00h0 1 3/P  ,弯0 a6/1 |5I/Cp B000Q7S 13/Y 0S! %0J?B y000|7Sp x0p |7D&S ! h&00 X7WS 000x8U   PP 2 020a6/1&  T#0  6 0S }2 !7WSZ 1d'  T0 0 x8 U<10<1h00h013/V 1 3/O1S 7w/C BOd00d0|7S?0 a 86/7 W00(000 0 I(S1 t8d(Gr0=>C!0C)L00L0x )P 1S 8(Gr0y>C!0Cp00p00S"0 $0000 0" 0A S*1 X9H)Gr0=>C!0CL00L000S0 S  S   0Q 0S"1 9)Gr0N>C! 0CD00D02S0 S P P$0 0$0 00S! p*0Gr:!H00H0Y1 :*Gr0 >C-B 0 a6/000  C !0pp$W,1 > pM.C B0L 4P 8P <S 0C?o020\3bqE0p01D/ d? ,B>C B借! 0?Q.C\ W1/ ?p/C00Z 1/ ?E.C*0A@0P ! ;F.C0 G  00 Q 0  1p :I.C B.D<08 q8 <0 HXB i pG p  1D*R D: >CK.B  C !0pp$W,1; 9 pM.C B0L 4P 8P <S 0C?o020\3bqE0p01`) h9 O.B>C BLL00cWF01 441)  T7-0 00S8C0FD CA@8,P !0,0,01S  T-0 Sh8C0,T 0( a6/ox00x0]00 /Ph7 1S  T,0 S7C0Y0( a6/C|00|01000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 0P 0004P $04020|7S7S 400400LS1 464&Gr0=>C!0CL00L0꺁xXX 1  Tf,50W 0 0tx8U<10<1h00h0 ᐕ 0\Q<1 h5T%Gr0N>C! 0CD00D0LP*1 4$Gr0=>C!0CL00L02P  P P0Z   P0S! X$0GrX4!mH00H0_0ḡἑ  1  T+30W  0 0x8 U<10<1|00|013/;X㺯ᴒN  pH 202-wh7Q / ? 67Qh7 !, h7R7!66h71  T+Ÿ h0WR 0 0    Ÿ   13/20276h7'0R40040 0CS1 1!0=>C0 0CL00L00q001 01ϰP400401  TL+0 ^|7S S 40040 1 3/x8U 0q00101 㜰P400401  T+0 +|7S S 40040o 1 3/hx8Ue pa@À@@@ @1|@]@'|@@S|@xb|@@Pk}@t}@@0|@@|@M|@0@e@@ -0@-@PM0 0$ P* 0Ѝ0@Ѝ/Ȃ@A-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0庩!GR # 岩D1"022222220 " 8,⣩" ZN⟩292S988-#87 0C2c70r0Q   ⇩0   04Q   |0PP0C03254b@A-P L0R8pL `@|'R"](R# #0 83/G?G/ @0?@D00Q0000L00 900 R  1001H0O-`qF尡MT9 0 Yd (  Ŕ00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0!GR # 0S/S10C1ߍ(0 ܨ 0" R 0Q   Ш0   0" R 4Q   ¨ UP0pG@b@@-1CMS@CߍP` T@P p  `P 0,E0Q    R,!0R 1ŁU@p@-2@SP 0aS 0 6/p@03A0AS@-@e g/C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍCU7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@RSPPa4VA  MPP` 8. 0000000Q<<0S 0 0000' P00' 䩧 0R ࠧ000U @ TPDVOxc n⊧  - xW;_o`/R χ166S1 000P U0!01S 1`TP5TЍCTЍC"1S 2SPP  `P !ZR !ā B:TP2괁X SPP  `P 2 01 SP0} pl 0"P1UP0UQ  `(0PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/@Ʉ@8B'@5'n@0|7S2S/004 S00R  0 u0000/A- MPpR%@zR`Pl0$`S9 BS` BS!? S* SU  S `Y$02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C Vo@`U0"0t"]0h7=$`B000i;0d 0k SL 000Xt@@@*-O⪎0pⲐWC嶠C u Ƥ@0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0 8  (凤03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R< 7 ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  %x7 ?op2X  0RQ ÑVP P6P   Q A0 S -؃@%@EO@O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO% ?Q0 00 0p0PPM.x0@FS00>Q >Q F0Q0 0CS@4PP/|>Q7S|'R h7   ㈎0>Q $ QL >Q>|ЍOh>W0.|ЍO.=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8"NPPH<0 SPo;XK=0S|7S=xh  >oPYp:3/0= 8PP <0S0#0$" 0#0 㮍< XV > PP 3S>ñ:3/V H4U< ' > ` `PPXqs`~!Rj8MPP8Q|7SxH⯪ 9P 1P|Ѝ 9 5 @P DQCA!*R;8MPP80SS*0|7S-9 iR B0<PP" @P>0CS|7S < @P 80S& < |'R R0<座P  < @P 81#3/ @8 f |7S PpP P !,MPP x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> LPP 8Mx7 ?o2x`QQ 6P  x@Q @A0 S |Q x0@`P|V` x01@0S S2 Q_P|Xe 8f03A0AS7SP U|7S cP 13/P]!R8z.LPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4SPP 03/P Z0U 03/!R8KPP  8 m 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(Riii@i9ii:ii8i8i(7io?@@) :'Ʉ@@@@Ą@* *@b@@Wc@@b d$did! 8KPPj8` V#=0 Ί h9x! 8Ŋ7S (#8 9! 8LPHx 8  0BS !R r39S0S0 p Q ARQz0W8@ ጊ  R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0SD@pX0 0CR00h'4PS4400Rh7JPP 0 0H᎞-HAP h7~N#2000@000S@@T`' 0PP0T0 TjKPP  > 0S p7  h7 ; h7h7 ; h7N50000> 0 @ 卤h7P:: x41($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S|j|ЍO^0 00 0p0cPP- |ЍOHLHP   03/P|ЍOSꔥ唅唵Yʀ 0! $%0    ! @aRa/#J6PPWa/W 0!4&0 !    !0G-@M,00 `p@(0#00a0$  @<0P@dP0(0(0 0Q@<0$  a,@.dP<  t@Ѝ@^@A- 8MP4/ ! A0     P,`p$0 0 a,(P @4 d0P! @   '.$00 0 ap,(P@4 c0P P#!X0X@XP R T:8Ѝ4 (03/4 dj'@Pb8 etkBkB@C-MP 0`p` @0 0 00 l00P 0@ 0 _?o2P@@T0PЍC-p@P`M(` ӜX0  bj0 000000X00m_ЍO-QM0|MЍObQGR0 0P0p 0p;/o0"/6$R ʀ  !Ā .! 0 @!( , $@TR$@lU 1l #T   $`Q)  S  @*Q PP R$@M @(@@ P R$@iN@xP R$@@,@ ASXx( T(Q@, c@$ ,@Tu \ P,@$ ( x(Ri. Q - Q UWX H0將/0$6 3D <t20!R0 o` BB!$ PN 0O 7!Gq "|'- "bt x  ћD!(/( ɛ# 4)%)M/ )6! 0`2$,(p0/0H0E  0<0@ aP| <400 00!@0 $ 0,(p<0aPe <0 00@!0 $ 0,(p<0aPP < 00@!0 $ 0,(p<0aP<> 0 00@!(0 $ 0,(p<0kaP'w> 00@!30 $ 0,(p<0WaP 0N@?P!$ ,(p @P<0@ CaP  A\Ѝ@i'@Pbh'G@cc@-@]POp@-@`PUp0S00`00C0  `=-@-0 0Y aЍ Ѝ/_@p@-PP Ul.U`9@P X:0000 ( -;@P@pd@@.C-1P@`p x8圀QH 0x8 S Ved0 G Ѝ V0 lgGꛆ@@-1P@` x8pQ0Gp 0hx8S 0 fG Ѝ@U ř0 hG Ѝ蜆@@@-1@  0@ iG껆@O-1020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍANJ@b@\k@ ) @0) 8408008,08089!= 01/z'z'4'y'y'2 029 0/202/@-80000#Q0Sl78l7 .0 0 ( ( #- x Ѝ1@-@ h70  (0(0Rh7=h7l78l7@܊@@p@-@P83/p@d@-P` PQ7V3xw- w> G" !@ Br 00# B1  r @0@ GG?0@ Q  Ѝ7SD10A@ @@.@9@A-`P8p3/@P\00\0  s@-P8 `3/@P\00\0. 1 0  Ҕx ͔00x822x80!H0003/090020T100PЍpx@\k@A-P`8p3/@P\00\0  x8 0 0x822x822x⑔x80!x8 99p@-@P`;Z@tpp@-P@P xG Gi1S 3/pA-P@p`000 Q M I0?0?x80101 M? 061071 N? (Q 4 $Q 0 0 ,1SA/@-P ` pk@P 00 0t ЍA-|7PSS` h7M @ iN@p0 R0S P@xHМA-|7`SSp@ h7] P i^P0S TAT20 R0S P@xH⠜0S i V1Sp1 0H0  0#PℜAЍ|ꔋ@A-pymPK|7 `S 0 xHi~T |7SS @P ZO@1 \  0!R000ԋ@C-P@@@`pAT ݐ  ᛙP01S*P1 240 $0&1 Ѝ@@G-`X  pR 0S R@kOoB@PU @ XP 0R01 S  R 0S RDP0 P0T@`C-p`@P -P@T Ѝ0S P⮛1 0t B0    AT  P0S P @M@S@A-P@U, pX&P ЍA0S0S i V1S1 qP0 !f 0!sP ЍAЍd@@-@xP 0x8i <P 10<8HP+0H8p@-|7@SP yn089,86xxXP 0 022220000990{w>018|'R 13/p褌@A-1@`  y^|7S118889,8  PPp (# x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGQ √ARꤌ@֌@@-@xQ `P P P 1  r<10<1Ѝp`+1 fh'0HH <<8 8 0 >Qh7U i^` P > h70h7Ѝp@4b܊@@ҍ@O-M80i~ 0<0p`P  0@P 83/@P\00\0 x8 0 0x822x822(7x8 991* h7' 000p 01X'r /@1 q? X 000 0SR 00S PZ R 00 q{ 07 0⻏0 0 00峏0?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4n$Q0 0h0 XЍO20 [ 0Ѝ@xb@T@C-`@y PP$ ⾙08pS% 4(Y" U a !Q V T  `@P1 :0@0C 0%- ЍU` Z@t@A-2@P !m00C02021 0  `2Pq 02HQWP,RP ,PP82P52P22PA0SH1L1`P10CP1$21S 3/Ď@G-Pp ```  0V x 'G   @T 0V `婗  9/@@ }'A-x2!@0SP` 2 L9|QI0S1 $2Su :0S 3/"<2< "!0!-200C0w>0SX? $~Q A1 b0 lY0Sp7  |7S 1 4 &HE2-~Q A1 :0 10S1  &h76h7p7  1 t h767h7V @ A Ap@ @A@^@@@@@O-P`|7MSS00 0 ppp 1 p 0% 0W  A@ЍO   @T 00Ѝ0W p|7S2  0S 4"|0 0P000x8S} 0 0C8C80Q Ro P1S: 00! 00 00HP 0SH1L100P10CP10H1S 0 R B0 Y 1 p 0 g1P 0Q113/0Sʐ1  0 X ] 2S 0 ᬑ9/000`)Sʐ1\  X 0$ 9' < LS@\t@~@b@Ȑ@ @@C-2@SP`M !Ⰰ8#8X 0 q7/ЍC`< p 92<2<! !000w>0SB p!,20S 2 hkCWAⲂ0 ؁P 1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 0 GP202~0001 0 7S 1  th76h7? 1 m P eh776h7rpq@;@ތ@@@|@>@@D@q@@ݑ@A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 4 0BAP00Qp@ C@p@-PiN@ @P`xhޔVxHp 0^ 022220000990?p@@^@@-!]0!@S001 Ł<>HP1a 000Z.  yGn j070$8@1}p`Uwh,884X aP10XQ 00% E 0 Ei~  FE A 0' 08' jn P6D'@7<7f(Wox8 p  p'    H ( < ) x8 k ЍԌ@Ф'@0|' A-pʀjPBhQ` 0ES  B2U U U ,U UPPH$H@6pWpx@'x@@@p*0000>0h'0S0000@/p@-P@ s000 0t u"    @v w 0  " @x 0S @@pԒ@A-0 0S@P p `*|7S00 0Պ  ъ ͊003213030 0⾊  ⺊   㲊  ⮊ 긒@t0/C-@`M)PP000k Ѝp0 `ݐ0=0 H02 |7S0000(001011 j `ݾ0T A   W00L7SPP7HWLW0P7@@-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1H0S "N)RԒ@O-0LM S< P@ 8h7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8 >0 060000H  0C FR{(@P000 Vڸ dq4)0Y000040  B    004@]4@Th .)U 0      $D"$  (00 #RH L0S0P  {,@P000> 40H   CW0C00000 (0`0(00 0|7S000 0 >  80 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8 d 81081 8 Ⰸ > ⬈x 0 08⢈  ➈ >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: Lg$`Y  t)P`PPe' I(0 0W 0 010 1 00 0 0 I0, 0', 00(0080$0`0000 S0 000((0C'0 8000000C001!0110/1!LЍP`B+Y0 S  04)+P 4/+@,+@[80[ 0 00徠SX (ݼ,@\k@@@@@@ٓ@@Ó@O-A-h7*Pp`T 00x 00 000S R  |00 00 ` 0 L0`0 00 $0`0000@ @0 00 00 0@9`09#40@D@dQd Ì@Xh7@U xx hӆ0S R H @Ɔ0 0 00P 0  0幆P0 00  0宆P0000@ @0 0䟆0 00 0商@9S09@#40DDAdQd <v萔@@@@@@Ĕ@ݔ@@@@@ @ @@-@ m &@O-P1$M`pPT P0`0  1B6[55@P000 $ЍL Hᏼq[0 )0 00 0C0(0 QHLPP  K)@P H BQ B0 00 `(0 0(0@0 1011011 `U 0D00L7S@P7HG0LGP7.,@?t@O-`Q$M º1@p 0`0  p9YA⠎PW9  W W W 1S 0 000@z0WW W1v W 0 }GPP 0尀00(0202uhtk5PP000 @ qx8?0 00|7h'S000  0 ;0xG  x'00R_000圧    M? 0#40坹 00#300ᓹ 00P#3@0  6! |7S   0 0X w>0S h'0 p  0j000   J0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0uPP0 = S  岀崠 85 0,⦄Y 1  00:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00y0  , R :01 N 0D0@001 PW|'R  93Grq穸 0 H1 0100L7SPP7HWX0P7080LW2z@$Ѝ 0 PP 0ᰀ00(0101u|8S>HHPP |7h'S000 (  0/  p' ; W00  . x ؃G lwh'0  4 R  O0Q  ṃ0 00 0C0(0%3iPP3 h'00  0  ;X00  岀0  " 101G%0h'0  4 R 0C0(0p 101#RH L0S0P  &PPꗕ@@0@@3P@xb@֕@A-`p"@P 00(0K0P 000pB  >p@-`P"@P 0; 0(0 `  'pG-!=⼠p7p# 50`G@- PP1S  0 000Ѝ n0/ |'hR    0  + h  ؂0 pw0S 00000   0-0  00|'RE00 0 ! h7   h72h7 Y0Sl7 00@10 @( #RH LQP  %PPg    N  0 00H   CR0C00(0p 0(00㲀0L  H D북?꜖@Ӗ@O-@fMP|7h'S000 0 0  ;0h7  9)+ S09h7  h72h7|7S{hgpe_ !PUP0!2!   # 90 9G9S!  p L 90 96PSH(Q PU ˶Q0CS*e1 S`0 `!  0劀 ``` 0 Ⱑ PH!ශh75h71 |  008 S0R 0C00 S 0S00Ѝ0`@X@@-`T1P!pR@MX1\!^0 X1\!1S m200 @E@a1 0 -Ѝ@$. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 =0 4`3V1Ѝ@/Ѝ藗@Ǘ@@-0@ /2S/p@-@Pa0 6/p@m 06 08880 8077090(10101/* * '0''@-:@0S 3/ :S@0/p@-`@0SP0P    00T ,P1S 01pp\b8 d @P0/8 dP 0!/8 d@-@ س0@8@\b0 R  ˳\bX@p@-<@P0S,d@T kP@p\bz@ Qp@-0@P PS l媳`0FUp@P壳 B^R <坳`0FUp$喳0吳ꃘ@@@@C-1@pg 4!1000$Z4xX倇X0d4`FV`|7S S 0 8C:0S 3/ Ѝ0 a6/  K|7S S 0 a6/x3V0|'R/I032+ D3Q' h7  {1  h7C 2 P@ qWX  @@-0@M 60b1c2d3eI{J|K}L~S|7SV 9 h7 "w>0l!1@ABp7h4 D2! i  j9k9 0 g9!01"\0Y|7S!=0S* 9'w>0 02 9i9 00/\0n>|7S 93/1  |7T S499Ѝ@+x829009h72h7Ѝ @@\bp7/p@-@f_rp@p7/G-`Pp㬁嬑Mw@WAL WO WO10@|'RN 5) 6) 7) 8)099!  089 079(!%069059000N9 O)PQ R   00 opWPx8S  19ЍGl 08 @\ X 00D 0590690790890Ѝ踠b@0@@h@؛@<@@-h7#1 @  |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@\@O-pM`0`  Pa|0@0 00P 000 0_o`@>RPPU!R:"R :"R:0ЍC-MP 0`p` @%|0 0 00  00P 0 0@>?o2P0S R0 Ѝ0O-DM ,00`pA(0a0$  @<0PBPJ00<0$   a ,(BP900<0$   a ,(BP)0'0000㨐$ 00a,( < wBP0$0h0@00 00a,( @< bBP   ⩮DЍ@4' bD'@G-SP Lo `0@4p8à St# 00000SW f0` 01`P1 0XX`0 d`lЍ@0@T@AJ0^0P0᳐0Y:0 bV@@-  0 @!  Q3  4y000 P1#9P00T0XX耖C@BC-P`尀p0@ A0 x0S HP `0` 00  Ѝ bP d@O-P@0MP00p1W;*0S`0 S00qp0少  A$0 x[! HP p0PQ`1P  0 WPP0p 0 0\Ѝ[ <"P 1 0CЍO譭 b(bP d@@O-@0pM00P@`Py 0SP S P S0P0܁ R@*00Q:0S  P 0 ≐00)  0LW 0  Da A ቐ 0R 0 x0S0 P 0PF0S" P PP 5@G.G_PJ!0Rd# X@Ѝ` `V벰 0( bP d@(b5@<@S@k@[@@-@p@@- 4,4 8 #8! Ѝ䍠@p@-@0M SЍp@P` 00 0Ѝp薠@-$M840, (  0 $ЍD>c@-`plM@P@ !0 0  ( 0  P0000C0 p0!0>40 0C0000 0d@S2 001 00@0&嵛H0L 0 H0L lЍ8 e dD>cO-0HADM  0@ 00PqPpl0!   0 0 0,P(p$  `?0  0 0 40P,P(p$  `? 4 d @ 0   80P,P(p$ @`? 0DЍ裠@=cD>c'O-\F,MPp C0 0 0 N0d#dh&hV *10 0 0 <,ЍO0 0S 0S*4PP 0 0 0 ,ЍO00C0Fs3P 0 0 0 00C0000`P' 0S S S/ 0$ 0 0$ 3"0ZT$S Ϛ(0, 0 (0, ښ< P 哠P  /,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S J2v @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S u"@ [ @00I004 0 004 T30 R S 580< 0 80< d 0S P`0 0D jPc 00@0D 0 @0D !0S 0CSQ00N0 0S0꽮004 0 004 3 Ү70 R S 80< 0 80<  ᾮ 0SP`0 0 Ხ P 00Ù@0D 0 @0D Ι0SSSD>c=c>c@0p@-00@4S 3P1 00'R0 0S0SthP 000 01S0H00``<2u@ap p=c>c  BR/ $R/ #/0 0S/d@-P@1S `pv 0 @1j @Tr  Ѝ0S 0CS0@q 0S0 0S;00 : @=cl e@-M 801S@J R  R 0=c@-@7 D0Q  0TS   }@* =c03!"/@b03" /@bL@o/!4! #4! B#4!0 P/60S/p@-@P ;b!>000pp@-@`ᆭP~@P ᡭpP/p@-@PP p@-@P @-@ 00p@-@P:p@oQeO-$M`@P FpP 0$ЍT@ @ ` X0@00S @T D k00S 000S00 0T 00y50P` ` @Z 0 [0 Th50P0T a50P ` 0  00`0/G-pP@0`P gT 4 06 S H0S 4 R30  |PP@P8 0x00PPH099SZv 05 0u6 06'`SH0Y 0S 0C @ Q*  " L(@,0/@- 0MP30pppe`h1@T @DTာ 03  !,0 , @ 0 Ѝ@ 0#000S2 0,0-ypV 03  !,00,0 03  P,00,0,0 0 (VЍ@` dH(0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@r|`pP1hSl l0p rADr0P1p00`0101S0@@Uq` d@-60!0 0 0ZЍ@-@Td$,d,lH,l $.` G-@phRhb@M#0 p00 @@0A10A 坉]>  啉 E.F? 勉 0`p!+0 000,`(p$@ @@ @;0 000!T1000 004,`(p$@ @ @; 0!:0 0040@,`(p$@ @@ @:0 400'㸐!=0  0080@,`(p$@@ @`:0 400MP!0 80@,`(p$@ @ @P`:@Ѝ@` d(,bp@-P0@0T@0S 0CS d ` R 0\0X 0S @T @DTp@,b` dp@-`PΪ0@TB2S D0CS  Rd ` R H000S\0X 0S H@T D@DTͪp@,b0S 00P0#///0  S /0C\ B /@-邪 @d0S0CSR$!@蛪 Q \@D R 10S 0C` dp@-P@  _0!S <S21p@-@ ]@Ft d@-@B =00t d@-@ z\@,p(0@s2p@-3P @$2S  D0CS@p\ T T h T \ d\ ` T X T$pH0S D0C/,b80S/@-3`A0ASM;,pPBT D@DTЍ@%00S%^0 00$P0 R00 0 0003/ᵩPBH@Ѝp@-M@`ᦩPBT D@DT©Ѝp@00Sᵩ0S 3/0000M 끩PH@@-@$1@Qzp@-@P 47p001Pp0S 0Sp` d@ p@- @P8@P@5p@P@ dA-pHQ`P000N@PЍ0 p 000!>00H `P ћP` o1S0 d o1@0H` oA0, o(10(1` d1i d0@-@MvPPEUP xЍ0@!>00 T ( P0@PS   (10C(1{Ѝ0 d2i` dC-0@SM 3/> 0p3  tcP 00ЍCꚨ`P00S0CSUVᬨV VY     P `RPVU0S 0Ct d` dp@-@,0P `0,0EWt x0Rx0t 1x0 0S  0 00u >000/p@` dt dO-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y ZP 30Sڸ0003Zʀ !  , ! p !D3@3 <34300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0Sh24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0P 0# 2 :U0```i10S 0CS- 03 7 pP,00,0. W-+P0S  P 0S0S  S '    R# !,  Jp3S0St00XYV 0S fPO 03/K0c@bd d$d` dt dO-<PQtM p!< R$ 35Q +X@ 0W@DlW<<W26,<,,0 S00<Q 3C5CQX U   ;W +W !BW-`S R R   `E  @ TW" h;W 0 @G[ 0o@ o0S P o!>d6"00 `0i0 0  00R 0`pBT D@DT ጦ1`tЍh:W 0 00 RVd  00 S^ H@ Zh0 @Z 0Ao| @=o3 P 6oP 2o U0|0 X{ 0  tЍO|00000 $@Pk 6060X`\00` z;``` 9W 6C 0CW 80S8W1CWf 80 S`8W0ST 0j| lt80AT @DT @8@(WW00W0S( T1`@ 0S0Z @0DW0S00}0SZ|00SX喣Tꀠ0Z0SX,7,'WW| T$700 `0 0 `0pPeTz3@P7`o 0| 000?893 !>8e-l000000 EVP600 0 0廞 P3TEy& SM0050SE%SB00|  `3  3  00 < 03 P F`P )T Y 0}@,0   3 PY0 `Y 4TE0t01x0@t010S ؀SS P0؀ NV EP0P0Yd0P0 PY`0`V `000d0尳 !0S` 0S ` ` Y%00 0 -`3 !0S P 0ST  XR0009<2 2 `@Y> `h0S 0S000PS 0 ENPsZ V`[ 1 /``` W003 P R0``0@Q 0S0|`W| l  l 0Q R0`1 0`ii ii io@ i_@iii@%iߖo?i@'i` d@oi֠@@!i#i"it dc08 P R/ !  /` d !  ` d) d} d0 dO- MP@Dp  `0@0j@@P2y1@T @DTO ᔣT100# Ѝ!>00  0 0 `P H03SH0BT D@DT$ nT 0Y00C?o20S. 0S+ 7fP@ TT 10@0L0S H@ 03@@P 0  480S 3/@P ` d0Q&@- 0@R0S b$",0S R \00S 0CS  #  Q0/` dp@-`P 0@0L0`0D00@0 0<0(080,040D00040,000@p (|(P( (((( (@-@@ֆ0O-,M,00S@(`@P 0 0 0T1"T00XS%X@P  00 ")a! 1 00 $a$" 1040  0l pP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80EP0$0$0Y C *,ЍY 0 PP  ' 0P0P0@pKIV @D`Pp) V`[P 0p0(0 4p*4 0Ằ 0q%p0x p 0c8##4 Ib4#00 1 00 [% 0 p0 0`p@`A-`p(@P P PU@0 PT C-0@SPP @A0S`Დ;pp0 p0 @4"40 0 %W  0   0 @ 0C$0 P00 R0("( ,00#,0 Ѝ 0 p 0~ 7@-0P 4!4 8A#81C $ P,000000! R ݑ0  0U  Ѝ0 0`( "4`#/03" /@b@-8@g000P@P0Sh dA-@MlPlpP@@ @0 |D` P0@@ @P oЍ菡@b d 0!< 04 0 (   !/@bd d$d\ P/0 !8 0 0 (  , !/@bd d$dA-P`@0p P~ 0~0  ~?;$2020S A赈4b4(0p@-S/@@`፠P0SP \0P 0Pd0 1@០p0@ 0R/!&   U 0R/!&   UO-0PXQ p`H ($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 A-P@T0S(;'P` (`p0W  '`pV (0@@-pDMW,8`P@P& 4  `T<00004 0000R40   000 ! PU%DЍ0S/8p@-P@Tp0S 8`0P H R@O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `XD%XpD%DH$H00!1P03@@1!P\\ Q \\\ P0S 0S0 d0S&A- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Ap&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QP@P 000S  ?R0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Yp7p d0bG-(p0@0SP,``M く ROd0" 0 0  0 P" P c  iP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0pDP 0 ⧐P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PSXM70S/30SU 0` R@( RK 8r R R S 0S0C00匀XC1#212(0 00p08wpP P1XЍs0S 0CS # 000P d0  n 1 ကe 60 0,P.<0+0SQ 0006l0S (000L00  00!0bPd /P /0` d@bA-p(`@pPL0S   !R, 00! hP 8p~0SP  Gc0S0 A0 dl e0S/@-40@0006 (01@ d@-0SЍwS !>00 000080Ѝ8M@- <0b",4b4#  #$  #(  #< SЍ@p@-@0M SЍp@P` 4"48 #8005Ѝp譡@nQi< cbK7Q 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # BjPpEp@-40 R@  000 ?  GЍ@-40@ R  000 ( u 0ЍX0 0&-$M840, (  0b$Ѝ dC-M 0P`` @tcxp0 P 00 00 0 0@&?o2P0S B~Q ЍܡbC-PMp@ 0` Ec`0 P  00 000 0@%?o2P0SP @TP@P T@P0ЍT u>cܡbO- @p`0SDM!  0 ,@P 0(p$  `) 0儓!0 ,@0 040`(p$  `) 0 0 0'! 0 ,@0@ 0 84`0`(p$ )0 400!2 00 ,@0@ 0 80`(p$ s)0 0 0!#0 ,@0@ 0 84p0`(p$ ])0 0 0!/0 4,@ 0@ 0 80`(p$ F)0 0 0!1 0;0 4,@0@ 0 80`(p$ .)0 400!h10H00< ,@0  0 80`(p$ )0400 0 0!N0 ,@0@ 0 80`(p$ ( 0400 0 0YP!  0 ,@8 0`(p$ P( XP~<120@0TE DЍ蘣@ܡbN(O(N(>c d\(>c>cp@-P .}@lh 0S Q 0P @@@040p@Pp@ }0>cܡbb0 ! dO-P|M@0010pC5#21 2 P 0S `|5 V#2!12 W|Ѝ 00婘<` s_050Z РJZ]Z  <$(PZ  R` 30 Z DJZ@ មZ| YX\ !>00 ( P0 $<M0 0P 0PY7  ူQ _30Z РJZ hZ" |' Y Ԡ  R R  H < [ V Ԡ  "P (5VY2`ZؠJ   # ܐYr ؠIZ <|Y5  Z   <{W`0C `P 5`P 0"00 0SG0 d 4"40C(4"<00 0000 (0 B 0C(00 B|_B0P,0,00  q!B pP0$#$("(BM0 0C00000PP  S Y  YZ#DSS  S R 0  :_0 00 IY ʙs aR R000 <@bh d` d d@- -04 K,0?A`"b8"#b ЍQMbO-p`PLM @ K *p`K0(p)`t#tx'xpGW U_ 0$ 0 0$ jE$W$0S 0 3SH0L0S\@P LE= 0$ 0 0$ HLЍ00C0P T%(0, 0 (0, 00000C00(Sfd090! !0h$0CSR0PD40؆#W 00S00 R0S 004 0 004 P݁0 0 0 %PP0S@Pk   0Q ,HH(00<30#0S  $3/ s20S 0  堁H0L 0 H0L 00啁80< 0 80< 00! !嗁lKW}004 0 004 020S 0  mP0T 0 P0T 00 1 0S W0 Cr 00p@P # ,Z( %   R # 0 0PK0S #W  R1  0S R 0$,00 00(000(000P 0S  p`P  80L8 ⊒8P (#< d@@ܡb dС@>cM(@bp@-0P@܀1 01  p@ dC-ᶐ`$M\@P 400   0 P LЍ PP XXp^@ @&1 ;p]W ЍC/ T)TX%XU d4"4` 8#8R* 1CS0RH0@0!PU:pWPX0\p JU:H @D P *0X0\T 0 @TtЍC`0d 0S S :\R@0D 0 @0D ]`Pdp03/@b>cb0N(X@ܡb d0 h\ 0SQ HP/P %/QS  1//X@@@- 4Loܡb dO-QpP00P B0 0 0 02"0`0S 0XA0C?o20S  0R:!R\2S2 HB0 0 0  ЍO  `P 4"4!8 #80CS@@0SV:V`!P U[èaPU@0 P(P2(X2 hT 0`P(Q1 01  0kXP00 0 X0 XZ[ 8 #0 0 000 040000 0 0 000PP 6v dܡb@-$M840, (  0)$Ѝ>cC-MP@p 0` \`0 00  00P 0 0@ ?o2P@@TPQPPhЍbG-M 0P` @p\`0 00  P 0 0 p@N?o2P0S  0000 0P00Ѝb0O-`,Ml@s ,0 ~X0\ 0 X0\ ~ ,ЍOP 0S~(1,!0 (1,!~0 ` ,Ѝ!>00 `$`02~0 00P2~~0 0 0 ~0 0$#$ (0"(DRD PP }P0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00! 0 S0!0m X +~X0\ 0 X0\ 6~U, 11~@ @ ~H L0 [H L ` d d` ~U` 0 ` ~U 7X (X0P H0@`}0 @0 0 }@>c>cb@-!>@tPM `0@@}p0 0P}ЍL000}>cO-=|Mm) @P=|ЍO_PfX } 1$!0 1$!},=D@0S S } 1$!0 1$!}Dn|}0 0 0 }D0 <   DPe}0 0 0 0SsP@0@S Q}0 0 0 @ATD} 0$ 0 0$ 0TRPPD 0S.}0 0 0 ;`( "$`$"",R a(!"4a4##<S3 D1, @000@S S }0 0 0 3 :0S kP 4"48#8T|(0, 0 (0, eD(S|0 0 0 X Q0(0 C\D D0;00 0000P(0DP 0D0|1!0 1!40SPDG 00001S0`0 RP0D0U 00400S D0 @p0,P0$800010C 0 0STz 90S@s 0d>PPm  dO0D0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z fE0d00e070S| $0S @E 0S [@@D 0h0<d0P0<0Z.@0 TG0|0 0 0 | 0R*+Z 4 '0P $0Y$0J* '0$0@K@ hYZd0P00$0  Y Ẑ$0Sh00000@@@T@hLP LY @ f$E0d00e0,0Sx 0SJ Zz 0R: hcYbd_0PJ0   WY z0000,0= rhLP@i L BYYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ fD0d00e00 0S 80h0 0:P )0S $H @HW000d 0 X 000 fD0d00e00 0S  hXҏd0P0  ďR@T 20S@0@A@@$0pV201S 0CS# 2SD0CK ŏ00SG =PizX0\ 0 X0\ K W T  X (  (  J #G0  R  Q W7 h W4 ` W1 X W. R+ H0S D0CS@p#@10S (0DS 0 0szX0\ 0 X0\ zPW004 S Q000S D_ PD0S 000010Yzp0t 0 p0t dz,0 @0<01# 0D3/l e>c` d8 ec@b j(Hb)4bc@-@e @l e A-p#@PP0S PP 0 0100a10 `0 0 0BT0 0V *0HHQ0C00 @-@0ST 00 d 0 / d@-P(0dp`LM @ @ 0 qP@  0 gP@;PP"   0 (02,0(0TP@ `"0  ````(X0 ((@0LЍp@-0P@Iw1 01  p@Rw>c03!"/@b03" /@bp@-@`P@P kpd00S @-ہ P3<8 #8!R "00 /8b dP/N0P7@- Ѝ0P @R R3 0 00P0S0A-`Q00pPg8'#TgT%%< @P@VP\XRX001S 0CS W @#RP 0h dA-@M`p  XP @P%0 R@ 00S,UP' ( @!>00 0@@PPePP 00eu@ЍHP wP(@/UPI1@P ^P00 ;A-@ PRp   tP 0SR`.P1P 000\ Q S0 0!0;0? 0!A-PS@` @pPl0 A/4@v8!< 8!<v>chP/A-p`0PPQPEU `f @ T T@ @T@  S0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴSu0 0 0 u(,Ѝ0000 000000#![< 0C 0((04"<00 00000@  ,0@0,0VP *0C SURju0 0 0 uu0 0 0 7PUgPP(RMu0 0 0 XuV7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0+P 0( 000@ V xPt0 0 0 t000:, ,0@ 0,0 00800`P@>c8 eO-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00tx0| 0 x0| t0S( =00!>,00000408000S 0 0S 0 0R i5$T@PnK@Pi,ePP,0 0b m_t0 p0 0 it`(C0S004 3SH0L RP0/TP  0 0C000000<@0 @Q(0P 0(0Q000$#$ 8$#, kH0 00@V0g0 00P0010k0R ``P[s0 p0 0 s3P 0LP [ps0 0 0 s@0000 0^PTp @z0qS>q(0[     Y Zs0 0 0 s0 sR 0 W [U PR LaP dZ`s0 p0 0 s@0`0X0` sR 0 PP3 P 0^PTG@P H0S Ypcs0 0 0 nsAP@0D 0@040 D 0  PW0p/T!@PY`@s0 0 0 Jsp`0H4PS0@0D L`0@00 @000D 0ppW 0P0X    J0  #RV  3Q 0S# tPP Xr014!0 014!s1P80S t80,3/PP t/0 0t  AP* [ 0S% (PP 00SPP ,0 ,00,000' 0 , 0S 3 Vr0 0 0 r(PW `v 0RX Li$PЍ 0S80S W `w80,3/`Pr `p0 0 00S Ugr0 0 0 hU6 3 lUXr@1D!0 @1D!Y0  8UKr@1D!0 @1D!Vr P @4"4D 8#8Q ( %0%<#*T1r@1D!0 @1D!<0 0 ` @0DPHP`P/ 0P+0S( 0#p# 30S  tP3#3 1`00t0GȒq0 0 0 qWpMpp3 20S ( ,0@0,0 (4"4 8,P#8S G04X 0R0  {q0 0 0 H1P00,0 @  (,0@0,0 3  10S |10S (,00,00 ,0 0 0  /P%3  10S 00S ( ,00,0  (VPP((Q Utq0 0 0 %qtU (0   0, Pp>c8 e>cc@b@c dO- Pp0`@DM!  0 @ 0,P(p$  ) 0!0 0 040,P(p$  0 400!'>o@0 0 80,P(p$ ` @PFDЍ dƦ@p@-@`M0P0@@ @0 xdP  <@@T 0200 R00C1 2"Ѝp@ݦ@b db@- FPBA@dA-@70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PA db@bdO-Mp 4"4 $,$8("( H#8! CQD0Gl0 0 0 FCSC 00 Z V`Q "(?AT0&l0 4化 0 4l y`PEl0 0 0 l8f Ѝ R:Fl0 0 0 lP R\ \ @ 嘕0`R l0 0 0 lh2 Q 0 p" 0 崡10T01A0000W2SS}$ϼ@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !Rl0 0 0 l0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  m!( !! B! RA10C100C0k80< 0 80< k x 9!AQ ڴ! Q Ƞ,Ƞ B!7 RQ  p x! B!  B WZe 0R ` ``d1S B0 0}1`p[ |0R  B   B * ` D axX0- 嶀 q0(t"|p   0 ! 0 1C00S,00V(`8 ;k0 0 0 Fk-00  (x    0>c ddd-//-/-/@-@-@-p00d0@ ` P d0 (00  0 W(0 0S( Ѝ1M  @-}@@-}@p@-@P0S 0S 0Pp0Pp*P pd!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ], 0  02# |0R0@l@ ETjh0l 0 h0p0l t 0Sp0 t Yj3d dС@8(>c-/ 0!< 04 0 (   !/@bd d$d\ P/0 !8 0 0 (  , !/@bd d$dp@-@P<`{0{.pl edp@-P`@1pp@-P`@3pp@-P@Jpp@-@`P2000p dA-P@p`0`0S ~S 0S/@0S@00@f1@pe0A-S@@pr0`0S ~S 0S/@H~PE0P d0  0S `~1@=0V~0@0pe 0O-PplADM!0 (p0 00,$  P`  0!0 (p0 040,$  P` 0 400!d0(p`p00@ 0 080,$ p @`  DЍO@d)dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 ~ꌥ@:(d@-p`( PSQMp $ @020P PUd (0F0S* 10H   CR30C0000Tr 0(00(0 0 () $   R  h 00` 08 PЍ#RH L0S0P  h@SASC 0 #RH L R    @P+ 0( R($!, $!$ 0S(0DS 00 0 0`P0 09h0 0 0 Dh7P(P PP8 e>cG-@P`p1U0 S8@00S# ~S! 0S/@0S00 @S9@ 0  %`@pU00001@pe ds@-aPU0@ QPd B% / P !P d0R0;;d0ЍpU   Ѝp@3P P\P d0R00\d    %  0`( "4`#/@- 4"4!04"41@- AE Ѝ 0<P   /  "Ap0060J R0 w Su 0 hPm xi p@Tg $ d13$0(40D1;S3`1 80S X00 00D 080  0" 70P00SJ S0703`P2T"0P22 T"`@ 0!0CS103/XQ, ` R 2000Cp!0C,0, 2R , ^0 SQ h!\00CS !0$< Co\P  P0 PQ t0CS,20l1\0h1V0CP C\|4!$Rx:+Ru, R0C HQ L!0CSڤ10C(q0``F`1x!0| x!!| 1!`1!0CS0X110C10    BR901! Va0 BR1011 01RMh0S (dҧ@ dd@0b\bd@"@@,bHbd8bbDbH?8bxb4b|b cd@,dr@(d00SH00S$0btpᑵPtN \P 0 tt$@pt 0R00S 0@oP @{_1!0 1!_ }Co$4RX00D0 080 0 0h}P `AT_1!0 1!__@` 000dB_X2\"0 X2\"8Pc20ZPy0Sv0 0Sq* Pm0B @S0Vg<0`r !$!01_1!0 10! 00 0 00/ _0S `0S !  @ 0l1\0h1)  1R ;.0CS 0\P1T!0P1>/T!6040^;[0 0 0 \o=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ So[h1l!0 h1l![hP 0Q/ 0;`80  BR0!0CSlx[0 0 0 [\0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS 1[p1t!0 p1t!<[U0404 (0pC"[x!| x!!| !'[,0SC H!R 0L0CS86A 01R8y1 03/ W91X0C10 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS908P(50-!10CS0X1B10C11W0#4 500( 50C01 0S 1  Q 40?0 0; % 0S 0;841 0S 31V!0R1$ S *s_Z1!0 1!jZ$0$ 10101\1S$05\150 0 !$10BS$!% < uS <0 W0P00J  0S0 B; S1 00S220 0S010;0 0;E821ph21d1 "PFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S h0 h0 0w0 04 S0 0P0000  h# "00S!>6 l 9&00090 S   hKk(dDb,dz@bbb,bHbd@-0  0'S(P L@`Y1!0 1!kY$0 L(d 0`( "4`#/ 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d@-@0:0@p@-P!T1PB1AP \kX1+8T@1D01@ xSx0 S 0]; S0Ҳ;pR@,@bO-0M@S 0 S/p`V 0S?(<(PFP p( !R `0d  Sp3p# RppWO^hPPC D0S0S0S ᙍ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4400P4%4158 400P8%8150<01@00D00S_ P0Se P.P%p0'T00Sg 0 0C1!4!R4!480P00L00T000(00 :0Py  10S00(|! (  0B00  00!0CS41a-V`!;p00\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 P0;00UA(0SP kUP!<30PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSPP8P90%pwHp30 @P&QR P0S0S0S0s  `41S`PpU1S\PE80P H0Q8S80P H0 8(@0D S8D!00C S:08P0 RP 8P0STP 41R1'!0!0S01Q441q0\=0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP18 0;V PF03 PE UV0k80<P Po0H00(000S4 )P08%P, Y( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 005`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#"Ѝ1 @a0 40K0 _0  W `4000:80U040<3 U00S0U0S- 0 0 0 2UpP 4 00S<07`bmU024"0 024"xU p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PHg0QAQQ0 3SH L0SP0\ 00<  0CU4 00 @0000 Z 0 S 0 0$00 ($ QbT g0 Pe갢bdbR@xb4b|b@bdbb)n@8 e@8b,dbb(d$@T0 0 0 0 80TpP@ t4 00S$0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RH+g8 32 Q pQ   AQ U 0 BRU RZ ȡRTX"\ X"\]T ( @0% 00   V  `1 & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1S004 0 004 S`P 0R 0!S S{ 8pP *0;t4040` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S> l   '8P0S 040Q: Q6 @ Q1J0 A\-Pap / /0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRppbbp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/@- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R b1M  0MX @p@-PUp@`z0P 4 )n0Pp`d  H Q1Q44!r010p@xbp@-PUp@`[0P 4 \W[0Pp`d  H Q1Q44![010p@xb@-0 *cd 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d@-@0  :0p@-T0@00SDP@c kT$3Sp0p@!M8 e4 e¨@xbp/)@- @8)A-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S 00PP   ( d 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S0SPT0(4L 0$ 0 0$ d 00!/dA-p`埦PUAئ@T P P (L0 0 0 (L~0:0aPl ed@-@01S001d0SfC-0`S,M(P@%Pt!0@ S 0\q\1 00 DLS<10S UA 0 Sp< ( 0R*T ,Ѝ & 0T0!  00VP6@ 00dSP`00S H00@ C3SR p0/ᴨ@x@*d۽@D!) d0S,4! x!/@-@0M <01,0 00 0R0Ѝ")x@d@-( (0 ;NЍ!)dP Q Q@\ \2SQ Q @00P1Q0 Q(000S@080P1/xb dG-P0S`(A``"0R^ !QOd2S01q 1O@T@!A0S(UXA``2SN ̐ H/P<dBT@pp 0;PA`TV pt00KT *0Dg&0 T1GYh"R l2S0傴Pp2S<0h2S lBT@GPpBT<@xbb@ cp@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS >G     82tЍUxbT#)d@-0S6& ЍS6&\Ө@0b? S /A-@P(pT0`8@ TL3K@D0S@D0S~@DV x0|  0T@ D%X0 P1XVL 0   @T8A%815Anxb c0S0 S(00 b/ R /0SA-0`S0MUPSPQ 2q0@S0@?oR20S@Z P0@S PaQL L0 000 0冿P  0 00TP! Q U0`0@S010@Sʲ0TT#T1X%XS !0P90D0Ѝ  10CSa0Tw00000090P4 W R0( @Q+ Q 0p00 0娽P00S @0G3WS "!>20 2 0 $080  ɽW 0/ጥ@dD!) d:(p@-0P@(I1 01  (p@IdA-8pP(`@I1!01@@(A Id 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B Q=0C=8d@-@P 10;@0:P@/< 04 \3\# ,@bH)O-m0@SM S( /`P@$00#.0#A0@.H>@$00#|5" 0 00 PU `0S l*P  *PP8d%@-0@ 0@00 00@@J$$00S@ Ѝ$@ d8d%O-4b@=PS)Q'Qm0S S8 > t00#.0#8.> p00#`! p\V 1  xQ65F1!0 1!@F 9 W00;f1S 0 0A0 0g!P00@0@00=0= F1!0 1!F ЍO-0R:E1 01F 0SH 0 A SS0!\ 0 8d%Hb(d dA-P`ATAAp@O-Q<]BP0T 0 P0T hBPT1X! 1C1S01S01S0# 01S ;S6B0 0 0 AB01;S"P!T11T10P1000110H1;S0;0103/-_l eb!)d(d,@bp@-@Q倜0  p@蹜8P ;` S0 D1 B00R *PT11XC1S014cR :Ax0| 0 x0| A<|AX0\ 0 X0\ A0000l e(d,dPb@-@aM50  Ѝ@m`pcP HQA`0d 0 `0d A;S6S00 (  1( 1S D  B0R#*Ah0l 0 h0l A00  B !  'x01T01eAp0t 0 p0t pA<l e(d,dbp@-@P͛0  p@`P 01; S !R D0D00CR:001"l e,db@-T@埛KH 04004 000ћ@0l eb,db!dx0 R   R-  R   R   R-  R/  / b /Pbbgfff@-3@0 B!dha)p@-@TPR0==09#9S p@臛~P 000l e@-@886`4@10S-//A-P@apk61`P1!`; C("(R1S00 111; SQ0A?0bC-MP00`0p0 0` @# P  0`  00 000 0@?o2P0S R0 ЍO-M0l4@3`r®XVP 0 S0  J@DT0V0 00p020@3嘚@`T0V2|p3˚+0 S0 00(0 00001NP -(e 0@D00S Se [030#X0S -(P 3垚 ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U(!  (@0 ( !( 0 `d (t0T0l Sh pq xy!&^? 0|10  @Ja0 0( 0Z(0 8( 0S(0 @ D  H d L 1P0 0T00S0+0X \00U(,  (@0 ( !( d0 x ` ( t00 lqh  p &'T0S^0yx1&^? 0|10P0  @J0 0( 0(0 8( 00 K =00Hs }@ @bl e-$M840, (  0L$Ѝ(d7@-PQ@ PP OJ R #P Ѝ000@-MBc0 Ӵ0P (P W PU 00 00!0 0M@P5vЍ Ѝ@@dO-GMp!Z`@D1LR @Gߍ RP@ S @  R!JoQ 婒[ PR 00 0@K 00!L> 004p0,`(p008P$@ @040> 00!$0 0,`(p008P$@@ @"040= 00!+0 0,`(p008P$@@ @X= 00!/04 0,`(p008P$@@ @= 00!?0 40,`(p008P$@@ @040< 00!P0 0,`(p008P$@ @ 040L< 00!Y0 0,`(p008P$@@ @| 0 !c04 0,`(p0H08P$@ @@ @d0 400!h0 0,`(p0T08P$@ @@ @L0(04; 00!p000T ,P$@@ @60 (00 !:H0z0$0T 0,P @ @! 040: 00Dʟ!0 0,`(p008P$@ @ <: 00 ɟ!0 40,`(p008P$@ @0409 00!0 0,`(p008P$@@ @0409 00!0 0,`(p008P$@@ @040(9 00!0 0,`(p008P$@@ @0408 00ȟ!0 0,`(p008P$@ @040x8 00dȟ!0 0,`(p008P$@ @|0408 00ȟ!0 0,`(p008P$@ @d0 400!00 < 0,`(p008P$@ @@ @M040d7 00!0 0,`(p008P$@@ @6040 7 00!0 0,`(p008P$@@ @0406 00!0 0,`(p008P$@@ @040\6 00 !0 0,`(p008P$@ @0 400 0 0,`(p008P$@@ @040H5 00!05 0I?0,`(p008P$@ @0404 00ğ!K? 0,`(p008P$@ @0404 00!M?0 0,`(p008P$@@ @w04004 00!= 0 0,`(p008P$@@ @_0403 00!S? 0 0,`(p008P$@@ @G040x3 00!V? 0 0,`(p008P$@@ @/0403 00!Y?0 0,`(p008P$@@ @0402 00!>0 0,`(p008P$@@ @0 400!_?0 0,`(p0P08P$@ @@ @0(02 00!=0D000P ,P$@@ @0(01 00!b? 000P ,P$@@ @080\1 00 !D0 40,`(p0H0 010 f1 SRBA60 0 0 60;0`1f 0@ @P a @@P T0S7@S=0f1 c(dbG-PU@ p@`R000S S @ ᫮@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; m@P p@-@T P0`SfpSf=pp@-@T P0`S=0S:=ppA-0`SPζ̶@p0Sö9@@+0S ;2XR* 0R 001000@0៶᜶ᚶx7@A-`@pP000S S/@X=2D>4c  彪@>Pl ed0S p@-P_@5@p/0S) A-@P`pLT0S1@ 0 `1 &!#00a!0 `10#`11<1/A-@0S `pTP 0S @XZ=@0S p@-@`1P ,p/A-@`300p0S 0S 1;10;0PPlPQ01 1PPQ7PH0PP [0 1Sx01dhbG-p0M0@`0S6@ЍZP V V @|  @  .`Y`r Yt3HX@P 0R000@P0S@+S; @P@T 21TA @P@T t2TA @P@T (2TA }@P@T 1TA1HXg00 0S;   ; 0= S00 000`0`S0e00d10200q0 000CD1 P@@1T#3=P012|=T0814X0v\r1 l0 1pp|00t00 p x0200002020K1111*@ t@b{@b@-;@SS8#8S TS0 T @0;@0;;S0(P ; S Q 00?0 S0P 0PD00  P $00  P bbb;SYp@-0@(P0 Qp@$@P ip0S p@-P-@p/0S/p@-P@p@p@-0S@ `@Pi@P <@pO-QM⸀ 0S S4 Ѝd1p`1`\1@X1P 0` 0 0 00  00P 00 0 0Y0?o2P0S0S*  BR 0p0`0@0S`` S`V WpS0 0SPP/CjRP#US@@Ӗ/CjR@#THb4bDb@b@bbbb@-0@". /@ ꜩ@p@-@\41P!P301108480pp@-@\41P! 00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0 $b b;S/0H @-0@0@Tw (k0S w d@"dpb @A-;@S0;)`! AR80;p4Q~ H0  C PPPw 00!0C,2#41000ЍA0404Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m 60!aq?A3c 2#!0C01' A t14X6' $A$A! T@T(#3#  p0p [(1!20  0 [@ @0`FB` d1 #<S01R4!41$Ѝ 0` 0  Y0 0$ЍOMb̫gfffA-p@`{P  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   "d#dx@,$d#d#dO-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 DP- 4P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   "d#dx@"d#d#dO-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000"d#dx@#d#d$d#dO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:"dx@\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /"dp@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>0`0"#0 0 /0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` 垃@|pG M @I(PU@T D0D 0?8c|ÃЍ 0@0$@l e,$dbgfff%dbdO- S@Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0S' pW* '078!800$0#1S<0P%1P%PDЍ00ax@p@-@P!t `0D0034 0 0 %0 0%0p"dp@-@Pt `080034 0 n0 f%0 0%0p"dp@-@`?PPpP 0V 0 10 V& :p0% 8 4 &#&#(    % ( %    % (0 @10(0D`04`06% 36 3(00000%0(0% 0 000%0e 00#2%0(0@10(0RO-@PlM3 $00 8%P !  ( %qp P$ 0`@  KPP 8<% 0 ! ! % 0 0`48(0@$00$0lЍX  u %`0!&bPP` 8<DT0 4D0%0 010102%000(0C-MP 0`p` @=0 0 00  00P 0 0@?o2P0S00D DSS  S00 Ѝbb@-@ 101H00H0101p00p0101000 20 2000800 u$00 o"d`)bb40!( ( "P @@ /-//-/-/@-$0$ H' 0(营b<%d-$M840, (  0( ș$Ѝ<%d@-9@@-9@@-@Ƨħ-ۗ1M/ ⳾A-P0p`0@P& d0 0  0 8 0◿PP@啧哧(&004 0 004 (&ᶾЍ<%d@-@(0((0M @Xl@-@0S 0S <剝P0 0  0 UP <%d0bb-/ 0!< 04 0 (   !/@bd d$dQA A-P,p@`1|10 00S S S ,00S @$!,0( "(0P x@(&0 0 0 (*&|3 40 0S 0 @P/<%db\ P/0 !8 0 0 (  , !/@bd d$dA-@pP` T@PoA-@`pP @`p@-@P<`70吚7lKpl e<%dp@-P`@=pp@-P`@1pp@-P@'pp@-@`P101 000p d1S/I"ꐥb) 0O-@`pRDM! 0   0p,@(`$   0! 0   4p0,@(`$  400 '! 0  8p0,@(`$ @ 0 !' 0  8p4@0,@(`$ @ 4  0 !1 0  8p0,@(`$ @u 0 !; 0   8p4`0,@(`$ @_ 4 0 ! 0 M  8p0,@(`$ E 0!` UP 0  8p40,@(`$ P/DЍO7@b<%dd)$)\ 0 \ /OwG-DhM (`$0 0 0 ($ 0Sp * 00çP  00 Qp%p *T&7W (o$0 0 0 (z$hЍ  啥P p 0S 4"4 8T"T#8X%XU (I$0 0 0 (T$ /S A0  PP !> 12! P0 P $00S"(P,PHpWh P 0Xp  L0RP L0 Qp%p :W 00USx 2c8 Ⰳ&0 N3YT⼄&04` 0L 0uvp 0(P\j #(0, 0 (0, y$^P2!0$0孙PP4(#80< 0 80< (#"$TPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX o# 0$ 0 0$ (z# 0 PP P<%dS@@-0S0SP0!0@SP R \`0  0 0 00堗Ѝ 0ח0ꌥ@)<%d:(A-0`0P@"Xp X/@0S  N0S  ᄳ@ЍV0dS*@PN@P0S S @d0Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B B 0 0 0 5B 0 0 0 @>Q Q Q$B !B B B `fdN@Q@O-M @0(`PPopPX T60SH60S  0F00V  <8P 1  Q+ZE 8$(0 8$(Pߍ0P0@`0 >h P9hP 0S!00S 450S  .'%0C*0S 40S  .&0$0W00*DPC 0$ 0 0$ |40P2 0 R 0S ,40S 0  $0*  r0P0! 30S .&0  #0)x30S 0  X#0NВ@0S ,30S 0  } #0^z00@ S1 Ko0-P [20Sy  00 ]"0nZ0 ((CTTPL20S 0  E,"0)P@ R" 1050 00S  10SC  .7&0  5"0!0C00_)-0+0000UP[?DD5rK410SSjr ᜘ f    0086lBύd`0p0 0,P hP8r<0Bύ1娑`bb@`fdTb@b@?c(b)O-PM'U@50S xx50E00(0 00(;V(UM p0( ㌔(E˔0/S0V@PF ( p((0K0:00p\(`)2P440P,0( HDP PPPH0 p,&PHU! 840S .p^% Pp0c(0/S0@PЍ/PPL 0`00:00pPW |1000p+P( :0,PR0 <0L30 P0#1 PEP0: S |!  |!  V )V `F|!V.`2xtPp0PW+pTjPP 0P` n+UbD200S F  R"`F|1V,`  [ w|1 000n 000f 000^ 000V 000N 000F 000>1!0 1!60!  ! . 000& 000 000 000 000Tb@bV@XbY@O-(POM@PEhlP |1 00U0 8$(0 8$(|1 0 00  h0'S(ږ@P 8$(0 8$(|1 0 00 @00000 0S0% %` * D0ޘP D0 Q`%` *tA(@V   庖@P 0 0`0: 0P,0 >0S 0P. `#,00 0P&`(8,(0 (8,(V0儝B?! !]X2 0HS%@=0S 0p. #0B. #20 02&0SN,0H S00,H|1X1800S h0|00 R0  0DP 0 Qg:Y ,<0dPPW { 000;[3 00/U] 8$(0 8$(ḕq|1 000  0040004 0$0[ 0$. [. 8(0 8( (0,0[(0, |1 80<0[80<㬘PPP @ 0 R 0 3SH0L0S 0 ᪗`P0@`UP@0 R0  H0❗P H 0Q:00S U  G88<(0 88 4<($$0 4 $$LT#|1 @0D0@0D[ U%|1X0p t p tCP Kfx | x |vK|1 000U084(0 084(W(80S U8 UP 0P0S0%0 * L0#P L0 QF: 000S 70P(`gP*0S00S# (G0S[ ŐPP 0  3S H0L RPp\0p0pG4pGWy(00$0$ 4"4 8#80(00C(0pC0S0CS `p0<000SW 00S S6 `$0 SW`` W  0⨐| rP  b0S|8( _P`$0 S 00CSd50 0T%0CS00<5PP 0S `B i 0S  0R`%` *  P0^`P P0 Q``V 0W 0 P XW(00C R  RQ p H0 \ ?^R(00CSГ\HQ RS8000S4 P4 80 ISp G0 Rʈ 0pG00Sp3```-P{p`dp8`pᵏPPn lX(( S (N0S0  R R )02s0 (0p0b}88<(0 88x4<(|$0x4 |$(Z0嶐<(0 0 ?o2R0S (Pp"`'10pWT 0 09 ~G40W0/'p P0P$0XDHX$0S5 Bk0'08 X`p00S(0S `4$0P0$0``P P P  0 40S PHX DH   0q0W 0 ~G pp<`U0X`fd@Tb@b@z@~@b@pe8d 00@008p4,P(`$  0406 00!6 0? 00@008p,P(`$ 04086 00!?0 0@008p,P(`$ ܲ0 400!5̵ ?00@ 008p,P(`$ ò 0400 0 0!L5 ?00@008p,P(`$ 媲 0400 0 0!4 ?00@008p,P(`$ 呲0400 0 0!4 ?00@008p,P(`$ x0 0,4? 0 0@008p4P,P(`$ ` 0403 00!3 ? 00@008p,P(`$ G0 400 `!;0 0@008p,P(`$ . 040,3 00A! 0 0@008p,P(`$ 0402 00 !0 0@8p,P(`$ 0〲40 0 00!<2 B>00@008p,P(`$ 040 0 0 0!1 C>00@008p,P(`$ ͱ0401 00!0 0@008p,P(`$ 嵱0400 0 0D! 0 0@008p,P(`$ 圱0400 0 0!00@ EN @0@8p,P(`$ 傱C qgwg0@D0Xg\ XD[LЍ萮@l)bb\)bb\bbbbTbв@@?cb`fd8*p@-P @lIgh 0S Q0P@@@040p@xgPsgp@ 0@?cb̥bG-S@`p 0 0 0 0  0 0 0 |X 'R 3SH0L0S(㖍@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0⎏P 0 Q% *HQ :  8$(0 8$(E Ѝ0 #0C?o231 ZP (MQMa⤉  #RH L0S0P  0@ 0 0 0 o0H   C/R00C00000T  10S q? }0( 0 (  /R 3SH0L0S0@P  [ [(`)p0, 0 `1 01  (Hz`fd@bХbhfdTb@O-0p'S(,`(㵌@P  P [ P [P  0 ЍO@ЍOmЍ@-0  p`fdC-0@4Mt02`PPQ7P(RreV 00SS*4ЍC f f 1`1 VP Z0S   4Ѝ Ņ@P 400   0 gP ᵅe@T;eP XXᣅ@e ះeXT 40 X`0d 0S S :H0$U0*` B 004 0 004 `Pd03/@b@?c)`fdO-ppP70S . 0'0000"`1堷S 0 q;`ǟhp`Lp DdxH\TPD 0P   0lP 0 4 X0006`  ఍1咃P ~H U  0T 0HP0 >>0PD60Sh  .0D&0000  0_! 0R 1_Z 5% 0  P 0 >PBt50S  .R0t%0000 NT0L00 M0[0UTP mP  P! c4 6X0004`  ఍1 P t6_1hS 0 l_H0U  ~HP :0 =Pl _1S 0 P_CP 3(0,0<,0`P0 dp p-0* 81$ <=40$0 00}~~0S`P L X=V PX=$3`U FpKY @V;;P $0S(P[ 0SX0S `HP H0S 0S P<pPԀ p=H0S 0S  P*P H)0S  0P (h0s0 0000s0 000d0 8Q00 00 _P 10S000d0 00ޭ[ Z 0Xw W jUl4^u2SD0CSXX H0W40+$bTb@|fd@;Db+xfd4@bc@@8dojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi $@ixcO-pFMP`BTD@DTU  2SD0CS5UWPP0S0 00SpH@T D@DM PU v` Y` `$4RPPQ <Q H0S D0CUP PP8b80S/A-3`A0ASHM pBPT,D@D?HЍ00S1^P0 000S+!ZP' 00000S .` X 00 00h0{2EP6PH@T D@DT0c@bTb%@b@-@4@A-HM`rpBPT쀟D@D6n|1S  00 0HЍ00S"OE00S .`  ` 0/0000QPOH@T D@DTTbL@@-@|1@XcQDp@-@P P |oppp@-`MPMM49K b0@0L0`0D00@0 0<0(080,040D00040,000b@pC*8C*B*B* E*A*DA*tA*p@-P@'c0@`0W9WMM Kp@Ml e0008C00 0/p@- @Pt!>00000pp@-@P f00000000p@-@ M Ѝp@-@[MPsMPp@-@0Q$MG 'R`l P'RXx("($( 0t0 v 0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@裍PAQ R000CS1@0@A-`pP@&2SD0CS+EXN 40GSDV`#0F0F bP@  \P: V< 010#S0 8 Io` o\Q\ X ^ QPQ `P H0S D0CS #S S %S000 00 00 00 00 00000V0S  ]0000ԥbܥbQRI p@-`@M 0 C^.^ P?R1 ޥ 000 C0PU'X 2X X XX !`0 0<000k KP`ЍpA ER PPC/C-40@SMM  S|1 0 0 0|1 00 0Mߍ R@D  Q *40S $0 MߍC S S #3R l40S `$09|1 0 0; 8T$ M`P2 p R3̍a```0(1,11 0``1P l30S p#0 |10 0(0 S@#2q12D PP `r  2P<2034P09P 20S 0"  XU uPPP20S `"07l $20S 00"00000000 00000000S  /JP1010 (1,1P /P \10S t0 / Xe 3"p'qr O41PU ~_EUjX X⤴0X 4P⮴Xմ408 0000 0S 0|T P0 D00S T P0Pa 6yQDLTbZ@@@ƶ@@b@@@o@pe8dtO-TMx@T$ (p $ $($ Q/o"  U R Z  "T  R $ RPTЍ Rb&R_Q R rd  S`R``V` RO RL r2d`i@ R= R: r7Q R r``V` QR V   "Z  R V PR`Q R R R R rd   PR R R r d   00PR R `Vr  6/0 0$0S 03/P [_ V2S0S:0S70S4 ``V`0S0/ R, R) R&S0S0S 0S `V.Z^ V `S0S0s $0  FP S 0SG-(@`P`,pPM00````& R,0S0く RF 0S 0S 0s 0RkP' (00 0 P" (00%0PЍ0 04"4P8#8 S0#03 00 0 P 40 X 40 X 0S. P0S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 06lA-00MS6@S0S0S 0Ss 0SQ`p 0S PI(0`00L0S/P;h1NDPP5 0S3 R0 r-d0 P0S>  ⳾!> 000S0 HP,d0)1P U  PP 0@0Ѝ R S 0S0S0S d0HP 00`b|@0SE0@-@8P<$MP 0S$ 0R qqPqP0S0S0s!.0  qP $Ѝ0 PS0S ,0 @@q/8qO-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  iP! R R R R  WP0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 BPP 0SK 0SH0sEd0 0S0S0S0S090sX3#21208S- 00$`0D0 ` 0 X0P 0 Q S R `6CP I*0S0S0s0S0sY v!>7l0` x0(0t 00` 0dP 0S10 0 P_04 @4帐3@ EQx ADUI0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +i 00000S 0`( "4`4# :000[ H' PU1P iP P1P0P`b@b (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 0$k!0Ѝ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50꨸@Ap@-@08M S8Ѝp@uP`.p 4"48 #8008Ѝp貸@ 0 /b׋>@- '@(㜠8)-KCB]z<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00fdG-@Q M`@pI YF 0S BP`0d 0 `0d /@P Ѝ  0mPP 4@@ W pm mPA0 0 0 A@ H\-PH0S |1 X0\0X0\0S1 0S.0s+ N 0 mPP-TA  0S# UQ H0Q SppW |1 X0\0X0\m00AR@T fdO-7|M#2p夠1 20Z800004SH000[\0# 0S P F@P@ @\04 6PP\`VH0F40@P= 3PAP4l0\00C?o20S F@PP Z@[V `VS 0S0S0S 0SG  ^&5dpT5r\oCP(1PL0 T @PEL0 @OI  ?PP ZoE<5 #2!12|ЍPP`Z@\W 0S0S0S 0S PT ( >PP(0p0p4P0`UA_E0 0pUV: 4 8>PA40 R=`0\3d 00h0S/ 0 \>P), \>P#0 ,0R030S `0 8$0 P```0s 0@0PQU A_EV 0S8=`=Y 0YXpf0p\ P0P 0  0S0s0s 0@0P0s Sؘ0@0PҘ0@0PD 0RJS 0S 0<0s0 X 0<< <R6R[ | r5h! 1Q4 R pX`02=0SX0W08`0"p`r0s 0@0P}SzRXy R QRX  #  RN 8`$0P$0GpR ZP@n@bxfd8bbP P/Q|1 00/Xbp@-@PL0@ 8Pk P H@jpp@Xbp@-d0,`P( 0 0@M 0  0"` `/P P!PP d0!3d04"4 6Ѝp(0 @-HL H H < fdC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H :xP0H000H00@@bd d$dfd10SYp@-HMPH <0sHЍp$P 0 R0 $1aUH@, TP=PH @L00PLP ;P ,$5P @ -PP ,$&P @T0U0L0 -/ꔊmuHfd0-C-U 00,(000 H( $;P H; (00$0 3U0  $ v;P$ (0R< $ ($f;P H;(0 0$0 D3 H( V;P$ (0RH0@( D0\0*b<,0 <,H0S |1 000U H0@04`000Q `20S6 00``3'H`3`b; `;0H ZP葟 <,0 <,U (X 7X 0 Y(P 0  R k<,0 <,vQl@0HPX H0S |1 X0\0X0\K@0D 0 @0D C80< 0 80< NH0S |1 H0L0H0LZ ,H0L 0 H0L 7U JUR@?c]@i@fds@@\bgd-$M840, (  0g]$Ѝfd@-(0@ R+`p 08hP3T( PPQQ0SgPU@h0 000 3SH L0SP0\ 0 1i@ ЍP< 0CU* 0hPO-LM ( A[ =@0`p0<\ P000`,p($@ @@ @0) 0< 0 @04`0,p($@ @@ @ 'X< 0 04 0 08`0,p($@@ @< 00!0 008`40,p($@@ @Ԏ; 00!0 4008`0,p($@@ @彎 040\; 00!#0 008`0,p($@@ @妎ʟ*0@ \ 040: 00!20 008`0,p($@@ @剎040: 00!<0 008`0,p($@@ @r040<: 00!I0 008`0,p($@@ @[9 00!V04 008`0,p($@@ @D0409 00!`0 008`0,p($@@ @-04049 00!o0 008`0,p($@@ @040|0 00!00< 008`0,p($@@ @040x8 00!0 008`0,p($@@ @(8 00!0 008`4p0,p($@@ @Ѝ0407 00ǟ!0 008`0,p($@ @帍040t7 00`ǟ!0 008`0,p($@ @堍0407 00ǟ!0 008`0,p($@ @刍0406 00Ɵ!0 008`0,p($@ @p#040`6 00!0 008`0,p($@@ @Y&0 400!5000< 008`0,p($@ @ @@0405 00!0 008`0,p($@@ @)X5 00!B? 008`40,p($@@ @0 400!4 0>0008`0,p($@ @ @'0404 00!E?0 008`0,p($@@ @040<4 00!I?0 008`0,p($@@ @Ɍ0 400!>0D 008`0,p($@ @@ @富0 (00!`3D0O?0 $00,` @ @喌0 (00!3D$0R?0 00,` @ @~0 (00!2DB0>0 00,`$@ @ @h040`2 0V?0 008`0,p($@@ @P0402 0Z?0 008`0,p($@@ @80401 00^_!0 8`0,p($@@ @P! `0P K@@@!0CC10@ T0 !0^'6'#6V@Wd0LЍ R  RR  CB! ,0*?c@`b\bXbPb bHbDb@b(   f PJ0 0 0 |1 0 00 0;9)0 9)R @ =02F?! !2S28(0 8({8(0 8(0'S(f0 `R g0 0 0 r|1 0 00 1 R  RQ Q$Q Q  \| R\ |40 0 0 ?|1 0$0 0$ fy0'S(6fP _ p #00! !0(  eP <,0 <, 0` 4P 0 0 0 4 P Q4 PL40P0:0 00S1|1 000P8:pWP p0 0 0 @0D 0 @0D |1 80<080< a99LD00H00 \0 $0Da$0pSB pph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ T0 0 0 #x $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,^.P C0 0 0 @` 8#(#Q@;( <C.P $0R (0R(0, 0(080 , 0< 800 < a ((@004 0 004 [P "0 00(00bP _0 3SH0L RP0H0 0AaT _P (@(@@42P@TL000S;  U+ . LP. 0#0;P00|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  3\ + P" $P|;<3x0S00C0xP唀R P|P;V1q V8 00V41%P 80 000 0 00PVR V 00VჁ#W<`p`%P kV39V0 SRx03V\0 R000&V0 R|0@*@`b@-@0PS`pM%P7 a,0 00000(000Ѝp@-P`x%@P J [P %@p@-@PF@%G-hMP pሠj@P0S( 0#$0 @@@0 0P @ P +P@9hЍRsZ l0S @( @0 ,0" r!.$  ,00( $@QP@@hQ`P H0 L+@dQ@tQZ 0(<$0G- pMS@P  )S *@B pGWP P @9pd@4pcP P*0+`0G<S000 000 0 00k@Pi@P9WgWl;pGWp0  R0@pЍ d0R88d0k A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R55+0 @@0 0@P d0R55 Ph@P A0:Ph@P A0 $P9 h@P ,$m A 0h@`@`T #@P 8@`0`0000( 0CS0 PhP#`PP  O)P =0'3Sб51000S@7 0R;0S8@T5#@1PhPP0  R00sh700 hhP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s p[b P(  `V 3S100 $]"PpW0 $ P 0S 0 000V $ڶP p4 hPr408 0<0spbfD\ (P` P  "PRpWO V 0S ⥶P p 5XpTP04P ht!P`5X00 *-0Eg@PN0S S Sd04M d044Hd044Dg@P7IWW > 40SKW$f#0GS##pc`V S19@ 38`8p40 00@=0 0 pG=g' !4gt# qڭ @(0`0(000 @0R] TQ 0# 3SH L0SP0\ 0p<[ LP M0 P`0d 0 `0d u< 0CS00S  00 卭P 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T p`0d 0 `0d zP ` @0S 0S0S0 00T0 `0 0 ^-P@7Pp+0S A`0 0 0 J5X0\ 0 X0\ @<0S 00(  变< X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0/PP`0D0H0%0Sx1S800X 0Sx1S %P D`@V<KPP `0d 0 `0d m0P?o20T00S |1 P0T0P0TD0S`dp H PwؖPl H0Rhtp H P^ܐpPT H0RP3{Uyh d00l 0p 0q  ȗ>ⰐJύd0"P^ Ԑ[  Jύt0"oᩒ#YL 50S .d D5`%3 1`00>Xu(`0d 0 `0d 3V |1 X0\0X0\Y1P@ DL P@ Dg `P T`0d 0 `0d P 'QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P08JP T`PH00U@P  Up3\3:$R*PX&D0S J U0X x0S 0SX x0S\^ \0S L0(0@ 1P>LPpm0 @<P@0S~R px<,0 <,U@ T0<<0 |1 0003S RZ0 0 0 eT |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN <1 0R00S  @ P @ ND<I<0PJ"[ "0%UߍT@PUPe\c X ( ,0 <"  W hP0 0 0 (P@bZ@TbTb{@gdbb(b8 efd$" 0@/D0Q0*$ PP,P0<1 0.GYW=0S RG n0P 0P @ $(  $@ 1,PP0 3  10S (10S @ ,000,0D0 00 "p_mS Qr0 0 0 }P U*Qc0 0 0 nTt |1 h0l0h0lk00S p0(0 0 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0IP@#s7`0d 0 `0d 0@0 pL@PWTp0t 0 p0t 0 0048900(0@0(0l4 000$0( 0S0 NP 0X    @P 80HP  80  00J04!< 8Q#8<000,0 pA00 0400(4"<$ 00 NPu @0 0S @  ( 0Tx0| 0 x0| _T |1 p0t0p0t,WPpP @0$ ( 00/ 0$ D000@ p@PELV0 0 0 &V |1 X0\0X0\APP/80< S001R  ! @0pS001P0/03" /@bQ/C-@M u0(pP ᅅ`Po T0P4`呍@0!Q8P=A` A0P4`8@-Ѝb@B(0s/@-@$XL@8 K0(0?cO-2J?cO-LMp`4SPP=  0R@%@ * $0KP $0 Q@%@ *<(T0Cp 8$(0 8$({4E0 R 00S0 P0S S ;IULЍ3 00 0 0 0SL2$  P0d#d{IhB&hTz   -P' 0$ $0S!  00 0 0  PV 00 0J W0$0 00CS 0 @(0s y 1 !0#30(0 r@0 4R0 ^Q80P R0SZ=9 R =?@3c2#V:`@`r0So\ I@P 00 0 0$`0CS 0PIX@`fd@?cbMbG-0Pp M0@H`P 00 05h@P700. 0 00@(0 p˂ "2S0@0B00 @ #P ‚0S   <H ЍY(0$0k`Z?c ?+1ip@-@P(H(P p@H?cp@-@P(~H@ HTp?c@-@<oHP @T00 \@H?c\H?cH?cP@- P $^IGIPJI?cA-p` Pk@P700 0 CP{@@-@0)H00P &xHi?c 0O-Ppl@DM! 0 0 ,($P PP Pp`</k 0! 0    <40,($P P Pk 0!L '@0  <40,($P P P@kDЍ@l?+p:+P P0S  (R0\0 /|10 /|10/|10/0  HdA-`M 0 0屁 0P@Tp~OD)% Ѝ|10S 0>CS00P00%U?0T000PAT ~ODTl ebL+Pdpe b@-4 R0R 0 0+ Ѝ,bN+0S%p@-PX0\ @06S P `9G6S000c0#06E1G00C0p/@-0@0,M`S6S 6Q0C?o20S '1,Ѝ@cG@0 P pt0\ 00 00P p$pQJGFF|1+`bp@-0PM@\`P ^(0(S00 mF 000 |0 00@X0<8@400 `4 L@eQPЍp0  @`容꘸@C-1q圑1!M0嫀#2a12d1P@TAOD23"`&abЍXAHo0s! 7o0@0P PPa@TP U@TP0s o0@0P000xP0 0 bl e@bbL+xdxfdG-|1P`p M0G S!2S D0CS@  R   ` Ra R H0@T X pH  0  0 0 3 e@T pЍ 00 03 S #212 00 0BBT D@DT ^3"(00S O@ 000$H@@@b0@-M 2 E00000 0|0c00@P d TP0L $0< Ѝ0@b@cPdxdHAP+T@Ld^@bL+L+p@-P@0@0d000?00:<0?00 0400S 40S3 !0 0p0ub0p@-P P@`U0 @@@D@H @Pp@0Sl G-@`qQ@ R HQD0PP @DY1`QC 0 0 0 P -01 0S@0@H0C Q+Q! H R  : 0L S L0`S@A 0 0 0 H0S P pH R , 7H0S /@ b`fd@Q|Q/P/G)p@-@P lp@SJ*0@-@PP0$M @D|1 03/PD$Ѝ0p@-0 M @`=PD|1 0@4/@DU =T06 Ѝpp@-0@SP M 00S&P  xP0@o Ѝp`P 0U P Ds=0P 4   H Rk=h=0P/@- Hk@^0@-|1@PH2`PM 0CPi 0Po 7C0CPVP 0P00PЍ1PC '7C 0CPB 0P0  PP  4`PP 6(06 06$0Xp\00p lp,p*D<1P 0P,0S0pW 0W p20'u?0040 0S0$8 ȋ0-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$PCVeCx00Cx0,Ѝ PP 0 `O-G-0`@M0P 0`SI0U00 0  0 P0/ `p . 0  J`0S"a00S40GS (S %SPP 4P|1 ` 00 0 V 0V ЍGSЍ言dN@t@O-pMM`P0<0@P Y" 60S P .`C. ?%00 0` pUؾC 0 0 0 f 0R 0BP 0 Q8kX E<(尾 8$(0 8$(廾Mߍ0,`00 PP,0S 40S  .$0O0@0+S Y D40S 8$n  JuP 40S #<R?耝X" 5 000SႡ 30Sv  .J50t#00h P P RP! 0 X 540"  $C  Pm .t 2lhd00d|P\20S&  .Z@"000 `P Z5_o5 RRPUJ⢛6[06" 0\ 6X0V0 =)PᲆU0 1崀00Ȁ@00 d00I06X 6 5 ⽡PP0X 0/o" R Y Z06)B?0PSX[ X 5 G6[06 060\ 6X00 0306Y 06(Tb@`fd@@40GS #S 5S S 00/S S S/O-0MȐS `p( H⭆5PS: PP@P@P 0PU[:0;Ѝ0W 0 0S0V<002101@0` 0(00WPP00d YXpp Pk p0,p20 Y (0 0(0000@Q0@00 A0B❚ p4(4( :00r000Y0ppH V |1 000|1 000A峼P4T$0 P4T$徼H9zl1p 04 0 0$00 $0 P H9=fv14p0,00 0 H0,DZP 00S  .p p0 օjP 5p(0  pp0(00 00@…0q@0Ap 5 B o8 e`fdTb@A-0 p003A0AS@`vPE%DP 0  P` Ѝ@-P  TQ+ 0Cotn "0( 嫲p0, -D1@ P0ppSp00p'0S032@ D% [ 00n  0S X50 0000 000``S`0`&0S032@0@ `b@`fdTb@@@d  .ꠀdG-0P8M ` .  0 0=8Ѝ`ġ R008ЍG#D 03 X)|q@  `P AT X8ЍGKT 6.`  0 0 sP 0`` 00``0@0@0S p. `` `0 pY 0d |1 00P 0D @as80  ;@@bdt@Tb@bMbhu+dp@-@D FPPp@ p@ ꨀdO-@Mp`,PP- 0S # Rp @` .pp0P. L  "0}\X XD P20S "nl, 80 00$ 0( 0  0R p0;P p0 QfP FMA嫷 8$(0 8$(嶷, Ѝ0S00S |10S .@`!@0PTa凷L!XH10   卷 0R  0:P 0 QP F az R 50 00Sa  l00S .@d0X5 C0`FL @0U`0 003^Tb@@`fd@-/1 @-$01019/|@/-/-/-$M840, (  0)$Ѝ䬀d@-@77-@-p0`0d 0@0S P(00   0i4(0 O0S(`@N77ζ(0, 0 (0, ٶ Ѝ1M  Nd@-@-ʵ@-80@0SP 㗯00@/b@-O-/p@-@4P(Dpl ed@-@NA-0SP00S1P~S 0@S0`TPP0S 0S0s 0pS 0S 0S 0S@+ 0P 0 1Ppe`b-/ 0!< 04 0 (   !/@bd d$d0O-LM 0X1`0SP ~SN 0PS/@?0S@;00100@P0#212 0$p4∀0 p 80@P 0P0 Q S R` N  #2!12LЍ ?P @1@pe`b@bO- Ppl0|ADM!  0 @ 0,(p$  P`'Z 0! 0  40,(p$  P`Z 04 00!0   0 0 80,(p$ `Y 0!0x @  0 0 84P0,(p$ @`Y 匼850DЍ@dd)+dO-PcP4MI0 0 0 S 30,QpP0@ 0M 64Ѝ0SD0S S?0S0S0S0S  #P-0S0S0S0S  P0s. 0 0 0  (0Q0 0 0 @TW P 0 0CCP PWp8P 0 弴0 0 0 Ǵ0  寴 0$ 0 0$ 庴;Y 5@場P0T 0S P0T 嫴gU` @PsITp |1" 0"e0 ͧ꬀dfd0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0⓿P Q AoҨ `0 0 0H 尻Ѝ@0(p0p/۽@d*x@O-M0(000406#@21,2`000S c 0 P  PP0016 pPPp00:S0P 00S 5@P7@0P0 0 i0H   C'Rk(0C00(00T 0p(0(0(00$080(00 0<0040000 80PS4Q [H$0000`00040c<4w 04000:S80 Rx BRu:(p03 804@P ( 0壶 804@P#RH L0S0P  (Y4@ $P I4/0s08 80 `  ( y00:S80S |U-U#BP1101;0S P44<2, 2 "12ЍdŸE|Q E Q<E|1Q- R|1000000000000000000000101}0  u000m000e000]000U000M4@倲0040004N@b`b`fd@@dp@-`1@P M R8@ 0 0 3P@R9@ 0S/@0S@ 53 Ѝp7@-Q@T0 QP   F Ѝ0P tGP0S)T   Ѝ0@@iTdTT Ѝ0@1k@DT\ Ѝ0@\ Ѝ0@ A-Pp$NH00 00000@P& dVʀ0! 0     !0 0L@Ph(@P Ѝ0Pp0 㥪 {@bd d$d bbds@-@P` 0R0%0 * 04P  0Q0%0 *@S @刱0 0 0 哱x R ! Ѝp@`p0 0 0 { 0ⴤ@fd@ z؀d@-@@" " @-0@S00S SS000C0S@  0BP0S0@@0S0S0S R @-01/؀dp@-@PTQ @P 0S  00S`P pS 000CSp8D#L0@0p@-0@S8M  .60 00h0S 00S0T#TX%XU `P S 8Ѝp 000CS0P05@@-@(*P P @0S00S 8#S000CS/@-|1`S   0 08p0,`(P$ R 0!'> 4   0 08p0,`(P$ R 4 0!0 !'>   0 08p0,`(P$ R 4 0 ! 0 1  8p0,`(P$ R 0!t 9@ 0  8p4P0,`(P$ @RP$0DЍO螈L@dbb<%dd)+d0SWG-0`SMP@ 0@S>PD PP 10SЍU8 0 Sp* ( 0R*Tk 0+T 1!00 PU100!L4<@ЍV0dS*@PB@P0S S @d0C0CV a?V0|0.2Vh 1CVQ^ Q^ Q00`0V0 SBp (V@  T 0S p0S1 dЍp0L@p0S1 0     R+#  0S  0R0S7 P-x"ex7e 0$0Q Q Q0 S0 P 0$000zd:c}fU`cvtUp@- @s ` ?o2R0S@ P(|@P|0(S  P@p 0d:cC-xM dp|sx0P @0@T@0S7@ rP H@Ѝ`2@0S@X g#@0S `@ ᓶ@P ,@ RS0STQ S0#S@1@!  }@ @Pd:cp@- s@P$ P0S `#  H`Xp` Q(J(`,0000x0pd:c`cPp@- @r@P P00pd:cTA- Dr@PP `0SPU PကxP,p p0 PP(P}p PP  HQpnhp Q(ܝ(a00x0[00 Pd:c`c+A-@P`pI, ⊶$H p0S (:pP ~/ rAo`c7@-@H IP 00 0   t0$|`"T僸 @e0 )P3 Ѝ0@@@@p@-@ DlP`䣄0 U{EHp@//C-M@ Pq0P@h !T@d  Rd*  Pa Q^` V P RW R Q RP  0  @F V  `-@P5pW 0p  -@P s 0p0 00 0@ | T@  Q 0 .@W ٜV  ԜЍ@D:cI@- @R00C0dXp@- HpqP@@?Uzp000spD:cdp@- PR@0 0S   ]Tpp@㎜@00 WA-`Pp@T 0V `000A00Z@0@-$M@P l00 0 0Po$Ѝ0(+ 0Q @-O/(@@-@T  0L^ S0   $@3Ѝ .5@E@(@s@-P`@P0 @Ѝpp@-P`@P @pp@-P-v@Pp @-s0dP@- P H0S <ɟ0@d0S lb+dp@-@PSQ000p@0S p@-@`P?Q0P00p@0S G-@᝛p⼠P"0`V S0PP@Vp R 0 pWppU r0 0]`G-(MP`܂@ނspP1؂spPHq  k0 0 00sV  S1!11%*X!:Qax|0SxZZ PU  mP<]KD1 P 0$1;(Ѝy9pP fpP 5WfPfPpfPpf0 *ἵ㄀P  7/P T0q P #0!`@@+yara@@8+@++0@-@$MP Q: |創$Ѝ0 P 0 0000L000@ 00Ѝ00q P /@(5+A-PMpP@ᄂ`2p▵P0p0  pw 0 7PAOp+r` ]PV0 80j0V404001 0`,@1$00(0$0P00 ROPPЍAxp8100\`P\8 S]P < _]P<D0@ j]0P@0D0,0$ b]P0$0$Q  H~<0#S@0S  R:tϴ,0SԀ0H0 0L04*PЍ\@@@+@-@@@@@@@-@a@-  pPZPZ   $qp@-@`PP X}Pd00 PpPpp(00S0000S01/T[cX[c0   (0S"" /P/@-@0 j 00@-@ oBPA-Pp`@P@  0S 3/@P :@- @R 2/@+O-LMppt0P|0 0W0 2`@xQ [Z 00Z 0!) Z7 Z< $0 ~0# $$00 } QH00$C0#t p0$0 "0 aQ$%00$00 @p0 ;/ LЍ[ 0 |LЍO/W5  03/P 03/ (03/P Xo `100@r[ `[0@X" Z V@ $0I3/PZ0A@ 03/P  03/P Z00S (0Y3/ 03/P @-0 0  00 0 00%Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/@-Q@ q @@0  /@p@-@P`HP $0 p@0/pO-PLMpt0  0000 叱u @P PP40080d(⭯4004000(p00040  00(0C00}LЍOuk 嘯0 ;40 B0 0PS40(;40e_LЍ8pW H0q;/P 1|! 0,01 0 3?<K3Q#3?P [@P # [P0  R= 080#80C?o2S>^{0 7/,0@ 3 #R(0\\Lp{0 0,00 <0Vb@+A-(@  0 S0000SA} 0#dt0  ~ޭP ,0]@[ 3 [iLW{0 8/,0@ (0LPL{0 5/(0LPD{0 A/@7@-@(0HP6{ 05/0<0(0LP+{0 5/040 Ѝ07@-( $ 0# 0@ Q 0HP{ 05/(0HP{0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LPz 05/}_(0H`z0 6/0SPU 0S , P(0L`z0 ;6/Ѝpp@-,0@00(0L`o 06/=S  0"SpT@@-eP @G-Ppo@`V᠐<Ⳣ O Kpp<0 00(`0`0$00,0$003/(00H|o0 8/3 03G@s@-,0@!;90(0LPco 05/}㟵dP(0H`Xo0 6/0S㑵PU 0S , P(0L`Co0 ;6/ЍpA- 0pP(@@pD0(0 `H0o 08/(0H(o 08/(0Hp o 07/0@00@0(0Hpo0 7/0  D00D00@0Ѝ D #D   D0 0 00D06 D0D0D07@-@P B 0R  0"S44 0"S (0HPn 05/(0LPn0 ;5/ Ѝ0$03 0 0"Sp@@-_P @A- 0pP(@@pD0(0 `Hn 08/(0Hn 08/0@00@0(0Hp}n0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H``n 06/(0H`Xn 06/ D0 R60 R R6 0R R6060D06G-Pp`n@`᠐G + ߡpp<0 00(`0<0$00,0W$003/(00Hn0 8/3 03G@p@-@(0LPm0p@ /7@-@P B 0R  0"SAA 0"S (0HPm 05/(0LPm0 ;5/ Ѝ0$03 = 0"Sp@@-lP <@G-Ppm@`]̐H⺠ [ Rp<0p 000 0C2?000(`00l0$00,0$003/(00Hxm0 8/3 03G<@A- 0pP(@@pD0(0 `H^m 08/(0HVm 08/0@00@0(0HpIm0 7/0  D00D00@0Ѝ D #D  $ 0 D00 (0H`,m 06/ D00Q0066D0 D00D007@-@P B 0R  0"SZZ 0"S (0HPl 05/(0LPl0 ;5/ Ѝ0$03 V 0"Sp8@@-P X@A- 0pP(@@pD0(0 `Hl 08/0@00@0(0Hpl0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H`l 06/ D0  0  0D066D00D0G-Ppl@`'᠐$℟ 7 pp<0 00(`0H0$00,0$003/(00HMl0 8/3 03GX@7@-@P B 0R  0"S 0"S (0HP"l 05/(0LPl0 ;5/ Ѝ0$03  0"SpDT@A-Pp&l@`孟p<0 00$(`00,0< R A ]p0,0$003/(00Hk0 8/3 03IAI@@@p@-@(0LPk1@S0$0|$ ⱜ`($003/(00Hh0 8/3 03UAUP@@@@@7@-@P B 0R  0"S 0"S (0HPh 05/(0LPh0 ;5/ Ѝ0$03  0"SrpL@7@-@ 0S ,0 (0HPh0 5/0  Ѝ00帮(0LPrh0 ;5/孮금@-!P T@G-Pph@`᠐`o s pp<0 00(`00$00,0$003/(00H8h0 8/3 03GT@A- 0pP(@@pD0(0 `Hh 08/(0Hh 08/0@00@0(0Hp h0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`g 06/D0 Q6  60D0 D00D0 6 0 6007@-@P B 0R  0"S 0"S (0HPg 05/(0LPg0 ;5/ Ѝ0$03  0"SmpP@@-AP@A- 0`@(P@`D0(0 pHtg 08/(0Hlg 08/0@00@0(0H`_g0 6/0  D00D00@0Ѝ D03D00D0G-Pprg@`ᤐY + pp<0 00(`0<0$00<,0h$003/(00H!g0 8/3 03G@7@-@P B 0R  0"S__ 0"S (0HPf 05/(0LPf0 ;5/ Ѝ0$03 [ 0"Sp@/G-PMPf@뺐 Ir?p`0D P D 0SA 0  j˙<0` 000 0C2?000(000$000,0$003/(00Hpf0 7/3 0 3 P(02H`~f0 6/PЍ 0 )4@@@^@7@-@P B 0R  0"S 0"S (0HPMf 05/(0LPEf0 ;5/ Ѝ0$03  0"S po0@p@-P0@ P@WT0 0p$dp@-@X0S L寂P0@` P$P(P,00PEP00@@p@|bTN,$dp@-$0S 4j@,P0 R00 p@f@$d,dA-@ 0S p`P@UTQ P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$0%$d,d@-@D0 000(S   0$00C$0@ ,dp@-PPL@T  0R 00 0 Tp03/4d 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-4@P0 P0l   p4dP,p@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ @A-@pP R00 0`0C 0 0p0 0 00 00S PP0p 0@@@S AZ 0 #4d@- 0 8 00 00 D ᲏ 0 Ѝ@DdA-p0S `P 8@P D MX U PP U@ 0@P4 0`Dd@- 0@ @0@ >Dd@-04 00 ( $  ဈ0 0Ѝc@PdA-hp0S@ @`PP @ s@P ᐋ0@0 @PPd@- 0S 庖@@{@Pdp@-P`@U@p 0Rm`P PE @-@-@N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/ЍDd(00S @- 3//Ddbp@-LP@0 S   R 2/$0Sp p@/DdA-P`P 0003/Dh@p 0 R @Tc$0AcZ0@A-@4P. 0S+ 0QP0000`0 `06/#P`p0 0 ;0P00U000lY,p@-Pc0@ mc   pl@p@-P@`U000000֔p@p@-P@ ``2UPEP!A0@0000 0S p@@@@@@|p@- @l!`PP0LS  1S P 0 p@ 0/ppp7cA- @!pP`pjP0AS1S  0p 0A/7cC-pp@` @`!(EPPP 0S8' ЍS C0QU? @T8 0ll10А p1@0廐P@ YE0810<1K<@10D1=`1\1$0 00003/PY 0 R 0YO000000 00 07cc,V,+p@- @!P`O\ p@8\  1S P 0 p@0/ppp7cp@- @!P`O\ p@8\  1S P 0 p@40/ppp7cA-P`0`%@ LpO0S 01S 0S  A7cL@- @<!rO0S, S s0P7c@@A-`Ppb0eP @RU0PTP0s$M040000U0 40S R p R@0X 4/#P P A[000 A@@:@d@Ddb,A-`Ppa0PЍ@qU00004PQ !R P000U00000SL0 H0 0S800 `8/#P  ЍAc@@@b,DdA-`Pp|a0ĔP@Q嵓 P 峔P0st嬔040000U R000 0 x000 At@@:@d@n 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dA-@0 A`!(9N00QU0X<000hp 0`0h   8/`P 00h  P 5/0P00UP 0<00Q;7cbQA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 0Pp w0 R   8/0 800@ 0 03/ ЍLd@A-PW``@P p0S`VÐW P @-@0   00@A-pQ0@`P VP0Q6\P `O-Q4M`0I@PT`C P= 0   @ V]0@000,  ( @$0 4/`P# 00$0 0,0(0@ 0 pS0 @ P 0  03/`4Ѝ0@00 ;/p 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8; S 0 0//xdQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/A5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`PpA@-0@000\P T0\0`P N0`0P H00P B00P <00P 600P 0000T@(꜂d\Q@- /6Q@-A/%Q& 4A0&S0&Q  @-.0 .0!/  /A9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 SW0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V d0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 803/JЍXAA0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 e?0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPl?Yp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000&\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hl> p'00(Ap,Ap ppA8A@-PP@ p`Ev(0 0 000@)$080 h\ Pc`dP ^ Z V R N Ѝ蜂d@-0 @04 80\0`0d000000 Ѝ䜂dp@-Q@<0 Q Q!R0 ,R0Q *Q !R0 ,R0!R0 ,R0<0p!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@U`1P3p1:PEU`p0T 08/`0S T P0T D08/`P T0 P=`0S  0S 0d00 00CR00d0A-X`@VP1p1:`FVPp0T 08/`0S T P0 `TD06/`0S T h=`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00)= R 0PD05/`P  =0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?S +@0C4S00*SS *S *SU  SW $Ѝ*S 8$ЍC?*S ! BS;  SPh`h0S! lPP*S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S d8 0TipFQ D\PQ R00)P ⽃  8 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/]0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRC0A0d0>X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍColQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0s Qo\0Cl0S ekl0 S0C BR 0[l0S SV \$ЍC:\ 0L0HPLPph Q@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0l 1R1R aRYRPRB0dBPP\pB APR40@0D0HPLPpPPPPPPPPPB R p\&P A Rt 0$P(pB R p\P A RtpR  p \0 AR00Ѥ pl0S0D!0 0   8l0S S S< 0T 0C 0 S S w o s p ml0 p S03S0!R 0CQccPW< T0X00AJ?u&p$c>Al?p$?AAAAAA^AAAAAAAp@-PUpU- @\90  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0 AA-@P` 0!0`3/V0p4`e%n 0!0p3/ WAp@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@hAhA; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000갃dA/AhA AAAA A$A(AmAxA,A2A8A=ABAGALAQAVA[A`AdAhAlApAtAxA|Ap 0S S"0A(0,D R  Á(,//0C-DM (00`p@ a<00,$  @P< z0PL @   p  a,($00 0@< fDЍ$Ab<0S/@-@W0@`cSA-@ S t |hP`pP   03/@NT@6@A:M<AXc 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-@p`Pʾp@@0S/p@-P @ 00 R PD  Lg@∿ 0PI4p脪b|,@0S/@-@@7g0@04@kO-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ IV`@0  A0@0000@Y 0S@ T`` 0@,`@[ L#@080 0@P >jAA-@PpOA@` 0 R@)A-PU 80p`h0@6p xA @-@80S 080H<0S4@A-P0 @R <"p0CS3 : U `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@MT00@-M00(p@- MP@l T`[P 0 R V ,TL ЍpRV RW SW lp@- \`P:0S@0 00P00CS0pp7c@p@- 0@P:PP  p@p7c8@- (@:PP @7c0 000/G-P`0MP0@x000000L0Sp 0pW奀0S1h0$#h00h뜐 ' \C(h0  @0l0 0p000000t0h0VP 5h0|0000(00,000000S 0$@c TP LZVWo P h 0\ PL P8GꈪbAd ,AbAAAA,A AC-M`MpP0L5@V7 =5V 4V! 4V 4V l00 04V 4VU 4V|@0000 0 000g|4V P< S0< S < 0ShPQ(4V^ 04V $4V X 0T p|`P  s Ih [Y3Vr 0V`Qd3VB \3Vt T3V |@000000000 0 0 000`2 l00| 0pލЍC/ 0     0 0 000l000`Be0 0000 0y`P0B ލЍq @000000000@00000FA0 0000 0{y`PA 0S*` ,4p 0S 0 S0`` 0P V`ҙ00S> ! @Hp 0S0 ލЍC0h0 00P0`P PލЍCk ``W W @W@W @W W@W @W@WWW W W W WWbb@-@p`08#8 S$=;G"0C S04W00G?o  2`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  t0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZA01 A$'*As@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 괃dbA-P:Hx0UTPS@UTp W `W` 0 `U`RT0 01#l00p3/`PTPTpU@ G zG = AO A\ P/0 !8 00 (  , !/@bd d$dp@-@0Sp@z0PS 0p Sd :!"T0S` 0Sh0T0`!bMb@-MPGX0@S `""x0S 0$ P`V% 00S" 0p0CS00 00yP b< p00` P RGHz<L@FG0 =Ѝ贃dbf Am A AQ @-z/ Ap@-`P0@   `P0(0p贃dX,,,p@-P@PPP(Pp贃d@-Mp`P;G0@S 00D"_80S$  hPP: TP0S4 S P0 0!! !1Ѝ@"h0Uh0TPP @ R 00`SPU0P00 P F xЍbMb Ap@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ xA9 Ap@-0@SP S` `ŵ < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 Txw0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02"" AL Ap@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pDPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p,b@@- @ 001P,b@@- @ 001P8,b40 60 0 1P;/,b/@-P`xヴ@fp0lpp000 P$t0@@0 P0tp0 Ѝt A0bp@-PP@0S `ᄴ`0Pp0p,by As@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HC3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RodC0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0J 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00B\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcW@bd d$d$ 0,bp@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` PuB \uPlpWXPVfB@ cB <?u00S 3/PP\p A A@-@{BTT0 TQ S S @Q @-u/ Ap@-@PX1Pp BP /P X0SP0Sp@ p A 0`( "4`#/R/`0  B@-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P Q   @@-:#:^:,\:( 0 / AA-Pp`@@0@Dp@0@L$<#@`W j=0pG`@A-PlL0pLALA$ `@`W L=0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0`!pW:X  QY Q  (> 0P AS/G-` p P#"Y@PX <0S  =00H@PR/G-PQ0Fh pY@p`V8h =0S h =@pG-Pl @R`T  Vp P匀`#801U "0S  =0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  |=00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  \XP p A TX Q0000000PLbQO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@bd d$dO-`d)@4pS0ʀ0!4)0,)$)   !@WpVP`P 400 $aW0@04 00$00 , 0 4 00CSTEW40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ J{9 { l9p1ʡhPL|00 10000000  P 0 Tp ` 0h`Waf`` U9`Fd 00C0c& 0R0 0C i0`y 0` 0RS0C2x05A45t454545454544 W%00t%W$43 W 0倀TV.q Ѝ R97;BSA S S  @<Π` P BP RY 0 S < b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ夂01 `@380!A!Q Q ^: 0 0S  u U`@2og( %b`0{p8lpGW04 TP    ̈́I 000404040404PTP!  ̈́I 00p04l04T04P04X0@bd d$d, A$,$,,,,,,x, ,,,\,,,|,,,O-Pp`( 4M%0S=0,0 T0$WpVP` D@ J I0@@ @@ P,po004ЍT0     ,o,9 P,0D0 ,@@ D0 m /0P00#0CS04<0@pspp000X [0R bQ" B3Y 3R b\Q" B0Z 0R b] BP"YY !1"0202 2,Y0XZ0cY0[\ ]0`kX 0D2$ ÆahFh`bV`a"A 0Qc2 0A$ Q0SW ASL 0CS>T0H90 P U=l0 S00P10000@!@1P@@T(T0 [!1P@@TZZZ0X00X00X0 S 0@00 pYD8#  T0,88 < T0 A Ad A 98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-]8/ AO-PP L0!p!`W1 p` Q02 !X800#0Q00p0` P b C22  A X80z  " Sy  " 0S  80p0`   ,A,!A!AS/O-`4MP@XA P^!1 00 Z P0̹p c02Aq4Ѝ W Ġ   ! Ġ ! ,  ,Ġ 1!Ġ !  ̠̌  1!̠̌!!!P P h i P D\R@TqZp0pp PN0@000ȷ@T0 @BpGBS0(01 0 0d$000Cs0v 0S0 "<<"$0,04#$(#$0,0 S "<<"$0,0$ 32# $ (#$,0 0"00#0  0ERa0SP 0G0S@0#Ġ #4 <0!<Ġ< ! 00 Q Ġ    `1! Ġ ! 0##4<0 48,0(4(, L<\0? 00#00#0B0S (0 !600pP^<T! 4 8!004#  #4<  48 0 0$30##4<"q 0i3##4<44, 1 00A1@00Z@@P0S0$0 00 0C 000Cs0~ 0S N 0#,,#4 < 0#"<<"$0, 0  R ̠̌   `1!̠̌!0# # 480.̠t.4̌ x<^0[ 00#€t 00#0R Bp0(0 0b,0(0S^0S2 4 8 0 02##4<00 S0 b##4<032#$(#4 < l!0!  0S $0 !500@PW 0i3 ##4< 0 1 00R! 4 8!002#  #4< 48 0 0,30##4<00p,A,!A!AO-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? 1!pW:Y  ! !QZ ! !Q  5 `A,A,!A!AO-$R@4M@ R^v C^r*P`! !!X V`"( !X P",!P Z S $p0~' 0p RhʠS: 0 02 (,0Y4:04!48#8400p0R2##48 0S0`0P 0" 00#0 R00`0PY*X0 0t 0c PRx `R 4Ѝ衯0 :00 B0c 0! 00#0Qa0 !    R h@P  "S ] 0qY4*X0 0t xp0c PR`00W 0PE0s00 #  "0  S r  !  " 0S 0 `F4pG0s00 #  "0  S r  !  " 0S  30`0P0p0 cR2 ,00 (0 1$0Y:0 $4"4 8#8$04  p r  000!Q"  "$,   P r0  00>  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ _30`0PA,A!A,!A00 04040404/|-,, -O-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  20 `0P[:004!48#804pQ 0S  20 `0Pό\00PE0 S 0S 0 `F2pGO-Q@,M@Q\ C\*P`!!P pV" ! P` P S"! P) 0 $0 剐<*4,2,2  )00XR:0 E 0=R0S  Z20`0PX<:0 Q0$ Q0! 0 a`0X0@0cP[0$00k0僱 Y0K0c[3\;$;b!Z A bQ"]100 0 S0S  20`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F1Hd AT00  ,0X00500\04/,--O-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  10P00 $4"4 8#8$04  ` R0S  10P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PER1pGO-4S@P,M@0S ^0L^*0p%!P0`P#80!)V` P \"P !)ᇀ ("( - $0⒎($⊠""00 0000 000 0YR:0E 0=R0S  00`0PY<:0  R0$ R0! 0ba0X0A0cQ[0$00k0僲 Y0K0c[3\;$; `ZB$aR!]18#80 0 S0S  00`0PP0 0t x0c PpR`X,Ѝ0PE0 R 0S 0`F 0Hd AX0S  0R   Y  Z0X0[ 50 0\04/--,00S/  R 0dA-`PV0@P0# (( M00`0p $A00$p,P`, 0`000  @@d"/p@-P$0@Tp5/@d\0P/ L  \/@-  , "  dPbA-p`^@P P@@@ @S PU$R : ^V WQ .P@^T0 N^@D@D\'LD@D BR@D@D\ @ N!N'O-Pp``08@TV#2 Ѝ 0 U`P@dp@-P` 0@Tp 5/@d@-P0P0P`@P , 0< 0 00 20ЍpdO-PcTHHCUDsT# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@PbP,AO-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0PPb//O-0`p,@000:0pp@-` MR@@P$0  `$!1/@P 08S$>F@ Ѝp7@-P 0 ?@PC@P ">00 Ѝ0s@-P@<`>` 0ЍpC-0000`msߍ@$P V Z  T @<00edAcT-A,A/Z-A^-Ab-A0@-0MS0%P@  A@0T <Ѝ0l0 000t@|@x@@T @bdf-AdG-@RMЍ tRRQpeP U  p tR  t x $ | ( t2tR"*800#U0S @2``00@`  P 2 P0S <00 00$00(000)0S<@< 00p 0&000RPO0& K`PN0 `@V KuN;ppN0000 e0S 0 0R\0  t Q  x 0R| $0R (0RDN;``@bA0 R@ r= rq8 $ rq30 r0 rq+ r(x r%| r" r r8< rqHL rq r"sr 00SS-3#/S-/-//O-@4M0S 0S.`pL Q00 000S(#P Ё QL  0 R0Q0 R H0A0 0P 4Ѝ0 l1,.4,P 0\EP#QP<Y!L^Qɯ Q  L,  l1 (Q%  $(P$PP 0 00PE U P U" Z0SU  FC-0Mp(`h0S,P 00$ `30 @<121 @)@,)`"30#@P4 00$ 0/,0 \*@Ѝ0 00R0  R!p%* `<p0 ^PY T<xY  !@D<0 0C0000 00C0dM>C-p@00CSʺ0 V0  =# C! R%P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 40000 P4000S 0 ,00/ 0 S _R Qr4P ae> 0X&  ( , P B R   ,0[,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, /0`60A00h-AT0T \/@- 1"\0?0A@P4bl9Ap@-PQ0USLpR @@T00APES Q T03=?00QS^T ?6?0000@-A\\^CS0Q Ӂ0ѳ 0ҁQ/0C-P0M`00@V5p h 0R  (: {>C 0C"4T0 0  ?d @;c U l0<#\0B#E@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ h@Podv0PЍ耖p@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP00pH2A G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP )0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[H2AC-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁|  x  sY@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP D  @ <`TF`% @P TT@@ YV@@@$T P 0!1RX 0SRRH2AC-P@?00CSLM`LЍ@0 `p0R    0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ Bv \ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 @-@tPt`0 `x0` @AT` 0` 00 @@Al Ѝp@ݗH5Acd/@-E0@E@ӗd@-Q|L 5ЍC-@$M` 0pS rBL S?xxC@x  !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \fD$ЍP @0 H0 0I0 0J0 0L0 0M0630-*'X0\0800sX L000 3X0@0000H0H @0P0`X< 0!*@0@dMd!!`d5Al5A 0Q0A-` @ P80 rGLppF\P:)Opd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P *0 00H0 C2 000\0 >0>00C000\ )ЍA5AO-@L8`p0,MP 0s @$ L,Ѝ0 )\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$rP$0p 00 B G0$ - \P 0A;P> r 00 0Pd0;0hl0 Q! 0LP L AH B"     J\P0 00S\P00#Sb5Ap@-@P-E P 20 0`W`4Bpd@-P`m@P!=A@ܕ0 000 001 0!00 Ѝpdd@-P•LF@P4Ѝ Bd؉ddp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@{<P$峕FЍ0 0嬕d؉d@-0Pp0 0ad@TH嘕Ѝp 0S (`FB@d؉ddG-P@|xpRX `D2 H.W L R ! V x4x 0 d@-   11 1`00C`0`0  0`0 11 1/@- D Ѝ0M000Ѝ/p@-`@TPPtPU \ PU*x^\  pO-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P Y l0d H BT02000V`pd000 0SNX\0S*(P  j$00,0  0[ $ ,0(R:P (P 0(l ,0 B$"=P 00s000p0pD 0S (VpP pGhplgd h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0Ppp`0 00z0 {0 0 &0808<r0"\!o0C00D0l `$0 B"0$0$ 000 0P T Ip.0Sp P 'IЍ5AO-R4MXP0v\0@Sq:  00$0 0(l $p0 B$"i`P5( 0 z/E 0 0! $1Q- q5 :CQ0 : 8 #8#40 (-0(00t0(P 4ЍZ  R 80 #8R#4P00 0RP ,,PA`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`pPW 8PQ{>>0800S 0s \ S00\ |(0$000 0QPP30$010,000t010(0@1110  00 10:0000l0$0d0 0_SLЍxk|e00P@8P T P a|_|006A6A6A6A@-0Ms0 P@ A@PT "0 00 |00 0t@x@`@T AЍ@T b2!(@bd6AdC-PRM@Ѝ R `  R@ @@ptx| 2|000x00000S0x3 p R0 -@   @P 0S0 $ '= 00` 0&000 9@4T0100S 1 @P0S "@00S!@0HML&0 @`0&00 08@4T !g0'pp& 1@l4T0 @P@P Gl& 1Q4!$ 0R 5@00 0 0@+@bAG-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0!P08< rqHL rq0 000 ~H@ 08P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 bH,0@8P L000L00000| r 0 0 DH,0@h8P~| L00 0L0000ЍGB0Sk iC-0M@p0S   RP- 0X0P S 80 \p`HA@X!V0 @P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$PP p00 0CS0! 0@T0PSWTPnO-`$M0S S@ d; 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 0:@PV 0 \ G\ >0>00S H0A0*0000 0H0  C200000 @P[; 0S0\ 0T [ 妩000D 0 0 >0 .0 02@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP mp000 #8 *(80( 0M2P @ [B$ЍOr@<@:$7AM!Ѝ/A-0 @p0`SP , PWG-` P@U@P pp, @P 0 -00@ B@s@-@0P000CSX:#SR`88 d0l 0C S c10PQ0/`P 0##sr$ 000#sr  Ѝp@M18l A)A0<)a21 #ЍpC7A7@-0TP@6"X-80@8 w#( #$0!88 Ѝ0$7A00\ <#0X 0C S0 0 ! /+ 0 0 0E7AG-0 S*S* P 8pL  PS  P50S2  I00 > `!C 05S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!0Pw0`S0040 0#240Cw 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, 000SF: PF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$0PD0\ T00CS0H08 S  8 \8 000X :50 L0TRQ)Q 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  lz0 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0 P+ \P,0@ 000 000< 0C( 00\ @TpTp0S [   0u0P0Pu |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D Z7A7AA-@Mp0@P`00 R@@00V T0L0 0L0800"0 VT@`00R 0 W@T@M00N0P 000Ѝ@-0`P pMX0S, \0R@#0*x 0P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, x@P  0 000 Ѝ80 000 m7@-@PkP ʄ= Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  0 0|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S }P3 @pPH0 0I0 0J0 0L0 0M0 0L0\ppK800s  `Ѝ!@- `P@P 0   0L 0 0<03100L+ 0P Ѝpvd@bG-0p` M8P0X0S, \0R@#* 0@P~x 0PP(0(wl0dT A@! 0C#p00$?@ p 0@ 0 00!e   XpLP:!0.e2-8640q."@* |X %@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |@P *7A 0`( "4`#/p@-@(0Sp0PS㬣P 0 R@TpO- DMhR/@lp0-`p0P00`$,`崵@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P "3PA,?$DЍ$ @P P0`S< 0P0 8 \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R Bn(0W0 ,000,0dGA8b-C-萟M8P Qo<01 @`pĞ000o, 0 < 00 0 0 )P0SP7 000ᏢЍ蠆A-PPP Up`㊞U@ 㴞0@P0 8A-0Sp@㉢@P 0`PP`P0 P㦞00`p@-@L004P0 pp@-0`S@P@P P0S00  |᨞pG-0`@ `Pp@lT Ѝ 4 VP0 00@0`@`@bO-M@Z0`@P %1 1PPX{0Z00008p+08{p0 P8@{W(8p ([( (( (  (Gk{P X S R  ̠" . 0) Q0 0 0#  "ta0/0 姠t 0lQ    . ?y)`QbVH0 [ 倠t 0lXQ   . ?R)`%@b`cPd 20S~ G-`00@PP%u<00<0%#0 3!0mLVP0@8003!0I@T#%X.>0 SC&P02#@ 05:0P0 @ 0000000$000 p@ 0 SS$ 0$R00S0} @0刔pC 0SjS@#!P$$(00D 0(0#00$ 0@@P$p00ʿW0 x!G"Т3" R 0P03Py 30p 0Fg@P 0! 0B"@0 -0  0U80(, <00PQ㨞0 1 000$00 100@p0@$0  0@ 0 0oT8<$p 000w$0/0 0 v!P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S 2!@0w妞T!@@I0 R噞 P0R 0 0p\! 0  41T 8@@8081T#\ wn#0S  0S`I0p+w!@!dw 0\ RG 0  8@@808Pd@b{GAd1uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0 Q Q Q ,0S S 1H0C200<00 0aP  0 P0*&00000$0 0;00@Pap| 060QP T0 ;cS10! 0p$00:0 @P 060 %.P   X- 0 0$00 "$Z 8S  0RP a$0 (000J ( RY#QQY*  R, ( RNڸ \RD  v00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* c 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 >% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AC000  0  0   gX0(0\0,0~p,+B(00,0 040S W mX0SZ%Q@bPdGAbO-P $@p @@DM $c T<✐0娰 ` 叜P  0 DЍ`&W`V ``P  0 0$3 0壴  ! )P+X 0S68T08H0TSJT嗛0S 0t 0 R #1 T/X T倛 0V  01 Cr T 0!>t!O!tP0 !h !0Bq  H@o/@-M@P`  J0 0P Ȭ@P M*Ѝp0@  4/@P2V@002d0  4/@P H/* 'V 000( (0XGAciGAiGAbHA-C-p` 0TM P p催@P *TЍ. " !>V4D`Y2!>3`04\@ 0$p 4/@P 8) ެ(00 0HAci@ P0@@`t<04 @ 04/@P X) PHAicHA@- 0 0000 0ɮЍ @-0 000 00 0㹮Ѝ@-!>0004!4 0ᤪЍO-@Pp`LM$@Wpl)X lP0 7 |8/P $$ LЍ ``  4:/P ( $ $` 88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 Sx0S $0x 00$0HAIA 06-p@-@P$ Bp@ 0`( "4`#/O-P@P00&m@P@Pf #P Pz R R 00U>000 C&H)10S@0   @U. p)&000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@ʕX0#T00S 0 #T T0S0S0<%T@0 OoB0CB001 tb墕00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @l0 00 S00  P  Vt60Q &(10(1Thnd6@Ty 0S0Y @0 00000D60S: 8, 5(6P:# 80  <0L P0C1001008 ԕ 0`000d0嘚*0<00L 0  ! ɾ 000d5 000 s 00bR0d`0Y   P:dd0 00 0`0542(8p  ,?$<'Xy,XX0ka0HS^@2 00?7V;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :8v-70 0 0 as-ݺ0S<Ѝ8< 8    08 08  0`HQAd$QATAd0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8-Ց0 00  Ѝ0@-Ѝ0S O-@$MToP`L Hp RQJPP0UPPӔ0U  QS 0Q P=`0S00S pQ0R@6 j1 1H!W?Q000 00U0P00H0 00000`00X0 181qj$ЍP0PP\0001 1pWÏl0W|j1 0<U 181j/_JAeJAQkJAJAC-DMP` p Y` <  0$ 00 0@ "400 00 0 0|0 0 P0 S  S` P O`DЍL\ 0 \0? 0 0 90 0 0 0,` 0@-8@ h0l P 0P3<P<#/G-@$q`0d 00000`Ph`0d P Z000Pp"SR \ R3#. + + 8   088  H@Pd 0`( "4`#/O-$ @ i0q00i0a@S 0F  `iF` }i0 S  0 `@iriPU- 00iHhio?0尡Z | Q ! |! BR! i QMi0S 1S10C1i0S {i :i8i0S hri 0XS  0 hifii$VJAddhd0,0000H␦ q删!!  *P!X& ^! ,++:10 0 4 ,P !*!0l 0 ϥ4 ( 40  ++!LbJAKAG- MP  p@` ?0@T Ѝ Z@嗷ʟZ R00 00@@]TP0T00PP- $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X 0 T0 0C S 00   @P Z? 0 )0P0? P!KpC!0 SH080@S \   004005000@@;?{0 S0 2?r0 *?j@$?d-Q P@ 0P 00T 0,Ѝ@0S   R00   S @P ~Lbp@-@P'g0 >p@]gG-1MsgQa0S 00VLgЍ@T0S_@AgT  PD 00 04g0  $P_! " S R- Z03H0 $0X\ RP(0` R  X000 R 000f 040 0@0HL RP0P R 00 !/ &@bpdDbxdbQp@-@ @Q=\0@$0@0$0ppPf$@fTp\0$00$0$@p@-Q@pP @Q=@pifd 0$ 0S (0, 0@@fd 0$ 0S (00, @@p@-p`P Ef@T 0S4` 00S0C040S00  0S00@p@bf@Dbpd@- f@0upd KA@-T@0S f00K,h0S;f e@]pdxdA-pM0S S\1 @#P1P!PCh0 4a4Q!e R100 0/S@P fЍ̀`V@00@0P `X0 h00|4000@00S`000pPI 4e@(KAKA@bpd0 T 0(T@0 0 07T0S  H DR2320   (T @@bKAKAO-@Mp684@P0S0B0@0\<`4IW00 Q, 3Q00 3`0 0'00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  <Z|Z @H  [ @ R20 030000 3SH0L RP \0 㛅0@`00^ P ,00 B R  R@0 00  `!H0GS5040v400 3SH L0SP0\ 0 Y0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0 '0`@0 <  0CS00S0W00  ;< ed d,dPd@ e(d$d4dKA@-8@P(0, 0(00 , @ipdHd7@-P Hcb< d \@200P.0Y 800(.0R D@@0DpK Ѝ0pd X.KA@-4T,)$0@H;bPJ(Hp@Epd0/pd@-@H/b00H@ibpd@-Q0   0P0"3 p[ 0ЍA0C-P4 " @ 0哙@P s0  000000) 0㈝@P t2h"1t@P 00 Z9@  ဣ1 $R00S 4 `P 101@@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ ա@P1@010@00@1:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S j  000000t 0 R00tp@ሀ@M@b@bHd LAO-P`1 @薰pᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,`0S2a 0! d0    !tT# 000 回G@P8?P 0 R (@- 0@bHd@b@bd d$dpddLAG-0@@p` !4#Q!PPZUpp@0o8MAG- 0 p$@: @T6 W` r@"\/XQ@EDA@T0YW@T SR @ l00P 0S , 0$0,(00(0@TT0Y8MAdO-M@0P0D0 0000 0dB 0SX0 H0Sp`000 0 0@T0YT ,0  SR$0H SR 1T (00CS(00@pT 1XV T0Y00(00`08@` H$Q,@Q@$ 0 e 00QA000(00@0(0(00(0T0bYV ЍHQH 8MAIp@-0@`8888 0SpT0PX0#100#0$0 $`V U@` HP \H`T0p@ Y ,  , 0S@-@ oP 0 S % 000 0800$<00 $0,1}S00p}?  $ ( 4 "3@0 D0@ X1 >Pd ddbMbdd@-T@ L-P 00CS0<(X Pd ddp@-P0 @0\R B@ CUp0% 3SH L0SP0\ 0z0P00 P Up@AT 0 S~00<  0CS 00  p@-P@O L IP0 H2!0< 0?,R:,7(41. *$0#0#0(,00$4 88<@@HDP HX L`PpT @1R10(,0P0#01P0S 04 $ (8,@p 0B`0H4Pp `0B`8X<`0s 0 ?@c@p@0p8MA0AMbG-@P 0Q`pL ' P 3SHL0SP0\0 y0 @0 <0CS00S000800@P 3SH0LQP\0 y0 @0 ̄00LW\\0XX00400dO-,p@0Q0P`( / R 3SH L0SP0\ 0 y0@0 <  0CS00S 00018000 @(ЍOdR 3SH0L RP\0 [y0@0 ̄0 0L\\ 000P0400,(H PX`dP P /0 R0@o/0S@-0 *oG-@`pPhM㘀`} @ A@P& S}04 a 4 a bba 0P]} 08 0^"*0VV191V{}hЍ\.p@-04 $   4 pP@^@^ñ@- 4@R 0P@- 4 @$R 0P@- 4 !4@T  R!A-@4PU@` PpTpPp!@T`PPU@- 4 "(,4 @$R""R 0(,A-@4(P,U @$` PpTp $Pp"@T`PPU0P  H R L01x0 R R// /bQ 00/8MA@-(@D0SDtP @xdLdO-0P wppW`w000 3SHL0SP0\0w0@0 W (Ґx< 0CS00S@ 00 L0P   8 04% "Z Z   #RHL RP \ dw0@0  #RHL RP \  , BR EwU 0@0    EQPE X    #R"HL RP \  B/o"R  #RH LQP\  ,vfZw @  K Z 1 4 40 0 40 JZPGUX0 R PPM, BR  RM<0 S<0  00 #8 M8[808 000CS  R 00@0(p0D0p0 0H0(p@ Ѝ0, 3SH L0S P0\ 0  0C?o2S nvf[PvP@0 3SH0L RPP\0PP 0  <\0 0PE[ P1  < 0K00<00<0d8MANA@-@V0 (0Ao z00Ѝ 0`( "4`#/d0SI /-//s@-`P80Q30 : @0@(LЍpG-w@ yS181S ` PPWPP DPP W VS181S1p 01>PPnE4yz6S  o v z0  bDQAp@-@0` P@PP pC-MHoP`p㨂 h@PЍoP  ``PPdd.O- QDM` @p ,0  0,@(p$` `` `<ҜS/$ 0'   0  <4,@(p` `弜P P0  0<40@,@(p$` ` `媜DЍDQAPdp.A-0MP0`0 0p` @0 P 00 0000@u?o2P0SЍ@bp@-M\  LP00  L?\@ R` 0`@P  0T@@1 @P `Ѝp@-t-10 0S0! 40̰dd@-)@P P /容߹PbO-$DM00p@00D $0e8 P``8`# #RH LQ\P AVL0S0P0\ 0  0CS]otVڠ$ , BVOL $8#`P RxC800008$00$000$0$000Fa aF1(L0(04000 0 `P a4( <000CS0(0 ,  PP,  0x`DЍP 0 0<^PPV 04 (P0 00C/S00(0 , 0 rPP,P t0 PS!t tPXXt p0 PS!pPppQ00 S Qppx0 PS!?0x0S Y ?0Spxp 0 Isp p P0r05q5Q0ao0a 101VPdcQAO-6LM$3@ 0080 0p圀0|W 1 0 %W000 D ,0) WP@ 8Q```# #RLH LQ\P AQL0S0P0\ 0  0CSb0sVC, BVTL ,@`P0080000<0  0 `P aWq 0<0 D0000CS000W 4  wPP4 N 8v`qLЍ@0000@,00,000,0000Fa aF1(LQ #RH L0SP0\ 0 r@ 0   @, <  0CS00S0 ,  0 ,0yP 0 0DPPV 80S 0S Ha8v< W00 0 4 0CR0000 4 PP400'R 0<W0N 0=P:?;;0P4;T0P.p +_[[PpT[tPp?;;0 4;PUĠt (P,pP  0 0$P4P0 P$ 0$8C2 |2叶 0<0:t0p0x00008|0l 0 0X 00Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 0?PK0 TP D!`0  0Sp   0 D P0S00000\0 Pp0p I gA  P ~ tM ovz&!t(@bQAQAQAQAHdbPbQAG-PR M 0GS p`0 V Q 40p }@P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@p VS  7<$(, 0 00@SD@EC m|@P6Z;CY `0 ᕁ@P)Z `Z+CY 0D允@PZ ` 000E@P 000 s@ 'C%C #C@@@bA-1Ms1P@{<P0< !0 0WB[P_@P BTЍ0( A(0 !    Ko@P  0p0X0 0(0"@P( ( $Jlt`d0@`T!(apW (@bdQAPb)RAd5RA 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P W 0 P M 0 0# KPp 0&p p@bG-p0M0`0@8 ;87PPi "\D00D0 D 0f U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSRmnU3", BUDL (!PP00$ 0 0 0 013 PP Q 00 0,,PPK 0r0Ѝ(0000(000000#000EQ QE1(LQ #RH L0SP0\ 0  n( 0   ( <  0CS00S0   0 0,00S00  R,0 UPdRA@bO-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C SymZHQ AZkL ,<P@P qP<0000<,00, 00 0,0r000J! !B1(L2<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS CmT<0000<,00,000,00DA AD*00010(LTP QH L0SP0\ 0 m< 0   <, <  0CS00S0 ,  L 0 ,0<0 D #RHL RP \ ;l< 0   <, 8, BTL ,<@PDY2Pp?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<J@P@004000080 0 4@P AU 080 X0000CS000( (  PP(  4Mp@P, B[ ,@  0,0?0 0K1 1C! 2P 0 0 XPPX0 080 P000CS (  `P(  4 p@000(2 0R$78 00 00CS000 (   y`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  @`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X H(P 4oP0%'TZPdRARA@-@8 0 ,@PRAG-8`08MP0 0C, S0, 0 @8Ѝ 0R@ #p000D (08 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CS]dTg, BTOL ($f@P h$0000$(00(000(0000DA AD1(LJ T2, 3   !  3@P A , 4000CS0,0 0  PP0  Oh@hNP 0 04PPT  , 000CS0,0 0  PP0 00CS0! 0  0 0C?o20 0R 1 0 c># C,0!0 0 0H03!R@P  08ЍGTG|RAPdRA@bRA00 P 0  2 0@ЍO-p0PDM,sr`l90V0< 4%P00P0H $078 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CSAcTHhY0 P@ X@ @T@ T0S@DЍR 0, BTQL $8@P2 g TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L80 3SH L0SP0\ 0 b800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013Q@P A4( <000CS0(0 ,  `P,  0mf@fRSiP 0 0<`P<T 0UfTN0K 00G 0S S@A4( 000CS0(0 ,  `P, 4 @DЍOsS@ K |0@0T PdRA@bp@-`P@M8  ;8P00 ួ  08 H@  T 0 013/ЍpAe@-p`@M8 % ᧏   P00e  0H X@  0 013/ЍAep@-@ `(MP0} 0 0$00 000 Pa@P A e(ЍpO-dM000/H0p0H0 <D ` $0O X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSMVaU , BU?L $4 PP 9eX400004$00$000$0.000EQ QE1(L4$^0q  R[ 3SH L0SP0\ 0Ra400004$0PQ #RH L0SP0\ 0 `4 0   4$ <  0CS00S0 $  L 0 $040 3SH L0SP0\ 0`400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05`400004$03R 3SH L0SP0\ 0 `400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 M40q u R> 3SH L0SP0\ 05<`400004$03R 3SH L0SP0\ 0 %`400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05_400004$03R 3SH L0SP0\ 0 _400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,(80 ^0P3l:0S#S$Pe PPei"^؀(,x1 3ھPP!  0I[E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 卾PPЍP@bO-00$`pT0DM|0T0 D $0' WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_.\T@ڔ, BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  vPP, L 0_@DЍ800008$00$000$0000DA AD1(L嗼Q #RH L0SP0\ 0 [8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0_4( 000CS0(0 ,  @P, w P 0m_?@R 0 @P@T4( 000CS0(0 ,  @P, M P 0C_H@\WAT!PdRA@bO-0 0p0/PTM:0`<00SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSNZU , BU@L 4HPP! ^ TЍH0000H400400040000EQ QE1(LyH0A 3SH L0SP0\ 08ZH0000H403Q #RH L0SP0\ 0 ZH 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0W0PS5 QN0!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @^PM,P< P 0 0D0Lf@PLU@4D8 000CS080 < 8 Dz@P< D8 000CS080 < 8 Db@P< p0@P@]HP0 0D0L"@PLP 80DP @] P@] 0K0 00S Oo0BS@T@$0TPUPdRA@bO-M<00`D  T JP0 @0/P:0 <(0006a00(0`SX040H00L00$`40 P 0S`Vڨ+tPH\00\0 0SP1<0,PS    T0(0 pSd 0Q8```$ #RHL R P \  BRH L0S0P0\ 0  0CSh#YV/ژ , BVZ TdL `P: ] 4<0S 600C00S{ʐ6{6D0$ V 00Ѝd0000dT00T000T00Fa aF00010(L囹d0\ 3SH L0SP0\ 0SXd0000dT0QQ #RH L0SP0\ 0 Xd 0   dT <  0CS00S0 T  0T00 LSd0 3SH L0SP0\ 0}Xd0000dT0<  0CS00S0T00 0T0^[XD0`S` <0S~ `OX HL D`P   T\P$ A# d X`P0 0C0000 00C00 0 050005  d B'00X0 0`00\000 00`63`P a(0Sp `X p000CS0X0- h X `uP$ \[ `<  0CS00Sb0T000T0 } T0d`P h L5 0RK` X0 0 0CS0X0 h X `6Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh YP0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP VV` X0 00CS0X0 h X `pP \[`P0%'hUP\[`U0PE 000,0C0 0000 0S/0 000$0pS SPpp n4Q> 0P㨷Q 4$p[ P0hH0\ZV 0, X0C 040040_ 0 LP0$0, ?oU20SS 0 E000 0C0000000 0S 0 59$0 0嶽P  0`$0SYQ0X 0`(0‐PP \Z`wꀐ(k|`VbRASAPdRA.@b `4V@P QHL0SP0\0 R<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<M@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(c`X\` ^`[L`HPVP'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( l,P 00 08DPP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8PP(  4U@`P0%'0000 R p58 00 00CS000 ( 0 8ZPP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8#PP( `P 00 08DPPDZP 0SW P00PX0?o2X HP 4oUMP0%' `TT1T ZPdRA LP8 ,Hp0 ,ƼX H0,P0 11x C60 0hd,P YM 0,0@ 40 00CS040 8 4 @=P78M<0 H0aPH0T0,0S040 8 4 @P8 P@4 0 00CR4ղ4@P }{[UIPdRA@b0AO-00p L0DM✠0L0<$ H 00$0 P -0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS93KTڜ, BT+L $8@P O800008$00$000$0 000DA AD1(L˫W4N?@Pl0SQ #RH L0SP0\ 0 J8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS JTv800008$00$000$0000DA AD 1Tp00(40  h0p ?@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  0RN < 0CT0 $8@P )E0@?S`0:NH@Pl00S=T 0l 08 U6 03 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0  0 LӪ`p 0 l@P  0MDЍ 0@QL 0 L  L嵪 0h`L0 0 0  0-@lЍ, BT3L 0@@P M@0000@000000000000DA AD1(Lĩ0S;L?@` V8080Q #RH L0SP0\ 0 H@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@n@P@V0  R- 3SH L0SP0\ 0$H@0000@00"  @Q00@00000y0A A1 :<  0CS00S00K000 00;Z@0q E R 3SH L0SP0\ 0 IH@0000@00 <  0CS00S0000000:00'@0> 3SH L0SP0\ 05H@0000@003R 3SH L0SP0\ 0 H@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 G@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 G@0000@00 <  0CS00S00 00000008<@tz tTZ@0  \ #RHL RP \ eG@ 0   @0 , B R  R 0  000408C@@HL@tz ItTZ@0  \ #R HL RP\ A Q #G@ 0 @ 00  00040H P 00CS@0 3SH L0SP0\ 0F@0000@00\ #RHL RP \ F@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 F@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ F@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 [F@0000@00 <  0CS00S00 00000001<  0CS00S900000002 '0#0 <00480 00 0|2 3ұ@P `AV <4 000CS040Y ,  <|@P, P 8R 3SH L0SP0\ 0 E@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  <@P, 0@?SP8yIH@PdRADd@dhMA0AMb@b 0;*[PP <4 000CSST 4 T <g@P[UPP% 0 0<XXd@PXV <4 `000CS040 ,  <xPP,  8H@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < FPP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  < PP, `P" 0 0<DԶPPDp[P 0S 0S P00PX0 P?o2X HP 8UHT# $0 [P0%'T+p@- P`0 PP@0 0p0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSSCT0$00, BT@L L`@P G`0000`L00L000L0000DA AD1(Li0SHG?@80VT00S $0S S V@0S ሽT0 yQ #RH L0SP0\ 0 tC` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$,C`0000`L0"  @Q0L@000L00A A1 ѣ<  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 B`0000`L0 <  0CS00S0L@000L000P0 0\00X000 0:3w@P A 0S \P 000CS0P0f T P \!@PT ] X$`0q E R 3SH L0SP0\ 0 B`0000`L0 <  0CS00S0L000L0T900``0? 3SH L0SP0\ 06SB`0000`L04R 3SH L0SP0\ 0  &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\d`PPsdY`40SZ00S P00`X00(pp?o2x h~Pp ( <0R0(0XBTA80$ R00S x@l#sr8$srH(5 3 )@P/09 ,0 @0 a 808(0S0ЍP0%' }TO-@ 0lM/00p0@@P0\@h00h0   U (0 L0  <  (0= U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CYE>Y@, B RL (<@P (BP`!<0000<(00( 00 0(0000I I 1(L۞00SKPB`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0 =< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< s@PyU <K0q ` R/ 3SH L0SP0\ 0&=<0000<(0$  @Q0(@000(00A Aw010 9<  0CS00S0(000(0:00Y<0> 3SH L0SP0\ 05L=<0000<(03R 3SH L0SP0\ 0 5=<0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 <<0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0 <<0000<(0 <  0CS00S0( 000(0008<@ty iTY<0 S \ #RHL RP \ << 0   <( , B R  R (  0(0408u@rHL@ty {iTY<0  \l #RHL RP \ c[<< 0   <( `\ #RHL RP \ C<< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 <<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<⎾@PU<0 3SH L0SP0\ 0{;<0000<(0y\ #RHL RP \ ;< 0   <( , BR (  0(040<0 3SH L0SP0\ 0 u;<0000<(0 <  0CS00S0( 000(000v AR( ( F0 0 0C11C!0 t<  0CS00Sz0(" 00 0(00$1000 08@p 1B`HP0s0 !?@c@004000,8 0 0D13左@Pp UAn T`8, 000CS0,0 0  `@P0  4>`"PPK 8, 000CS0,0 0  C@P0 0@?Sp 4>`H@PPdRA@d0ADdMb`8, 000CS0,0 0  @P0 jU P-@8, P000CS0,0* 0  ٻpP0 ! 4H>@P 8, 000CSST , T  ዼ@P 0 0XX`匬@PX` 1 0R88 ,0 00CS0,0 0   㝻pP0X\ ` LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  _pP0 PP 0 0D&pPy 0DSp $0SX P00pX0?o2X HJP 4=P0%'@ 0  x0X0X00,4 3 00 0@PX0T`00@`:T ႳU`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00 ' U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;/9Zh, BZ-L 0H@P =Pp H0000H0000 00 000000J J 1(Lř0S3P<p?@`]Q #RH L0SP0\ 0 8H 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS 8XtH0000H000000000000H H10 MHU0 | KqU R$ 3SH L0SP0\ 0p8H0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00>H0> 3SH L0SP0\ 0518H0000H003R 3SH L0SP0\ 0 8H0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0 7H0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 7H0000H00 <  0CS00S00 00000008<@tx dTXH0 P \K #R HL RP\ A Q v7H 0 H 00  000408`@]HL@tx) fdTXH0  \o #RHL RP \ fF7H 0   H0 c \ #RHL RP \ +7H 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 6H0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043x@P AU( D4 000CS040 8  #@P8  @:`pP U8080<00S0T0SpV |,003 3 00 0@P,0T`0K?o 2R0S@  00@` \ #RHL RP \ N6H 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 !6H0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 5H0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  &@P8  @90@?Sp`@9H@PdRA@d@b0ADdMbWP D4 000CSST 4 T  {@PWX 0 0```z@P``@U D4 P000CS040 8  ፶P8  @8@jp`02 0R $4D 40 00CS040 8   iP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 D3P8 PP 04 0DLPLZ㜀 $0SY P00X0?o2` PP @8P0%'T V [ wtЍ ᆮXZLO-p M0`[s0 00S$U@6hA~3 1 H`P 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0EVPP PU 003 00 0H@Ѝ000zS0P$SA@b$SAAG-P `Mp߬PL0S@ լP 0r003 P@( 0U&2߭ЍH0S0 RP@PP @ P0SH0S300 10 CS 8:8꘭1SA@bG-`@0 S_Tp  SXtPڜ0H0S0S 0 Pn@1 3 00000 00 0 P UU0S 00   BrT 0S 08rTPT 8 JHЍ0 P(@bO-0pdMA@dЍ%`000D $0ܳ8 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CS2T, BTzL $8⚵@P 6800008$00$000$0000DA AD1(L~80V 3S HL0SP \0  B R 2800 80$ $ 00 0 $0 0(0400 00 00<@P ]A4( 地000CS0(0 ,  PP,  0X6@B0,2 0R `54 (0 00CS0(0 ,   óPP,7`P T`2X/P@D`*'SR0000HS#VU8``Foob4( 40)l"0<  Px0q \\%<3R=S\0#S\$0( 嵏0 $0 (| RP$0 00 S21 00S  0IB˱ Q!Z]P  R]P P<@@ 00\ PE000 ;R cP_oQeP?$00P40S 00 {4000P0x RH0x0 T3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#3202 4P 'f0%f0$0<Ѝ(0 (0 0e0P Ie4P De TU T=XA@-003!z?` 0 Ѝ@bXA0@-qPM:Ѝ0@@J80@ 3P@z?00`0 Ѝ0@bXAC-M8`0@XP:@DŔ  8TAVp pϬQ @$ @T@ `~8Ĕ< R d(P`ЍXA YAO-,M 0%!@ 0zPP``[\%1R=S[ `1R\0 嵟 zp1>0S100! 0 $N=$S+ 01000W 00p50 00Tp 4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍO TU IYApYAO-fP $d 00\ Ó\ b,ЍZP  0!p `X$8cTU s@-`@ PUЍp80 C0ST1UP!P 0T 0 U"000/ 0C0O-@P ` T0 Cc c`2aʿsL 02 A 0 0C R S R0  ЍO O-p00@ S` 00P `ƿ 0 ]x 0QP_ p(80 00`(`p Vw 0 00C030S3 L32  B \%D1R.=S+T @i0P SXprpppZ ڨ i0  0 iq00C00 ST0T00! B!00 080 0c 0w`` V"P00 0S ЍU TO-0@4M 02$0L3 20`SX\ 00 S T00M  6Ϡ!$$\Ŕ\    0 T0/ L,    )PL)l .300^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP Y(Jb  $  [H000$ %pH04H0 , mH0 00S  00S  400R<0D@$0C!d 0 o$ 40`R0A|00S p 006@4",,30S HY(ZA9ZAZA\/TU Tb0[A][AO-p`0P4M 0 ?o0@00 !0\%0$01R 00@ ``&!! X0 00HP@? j4*!, ZS QS:\P ,l 00\ Ó\ 7Y4Ѝ $0 R  X   !,YT[AU O-P0@Ḡ $M&o0\ `#,^ 00 0T ? A)A<)a>21,, X :@ 0@PR\P h 00Q Q X $ЍH  0 0 PLYT[AU O-PḰ@ 0$Mn0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X :@ 0@P@ [P h 00Q Q tX $ЍH  0 0 PXT[AU C-`PḀ@p 0Men 0\Žß0.S\! 00 Q    ` a 00T40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P (X40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00ZP0d0(T0(d C)CR)0c\1S"8 QR!<`0d 000100T3<0 &"40 `0010 0Mp0$0101 0 "p `@ H0PP0805@U50P%P0L05P000T40 `001 0 0%p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0DP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0-PP <0 B2 b061")(!|''0001S 1' V X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(OY T8U@e8 L0PP`P`U1S 00P000T%\% 0 R qq p0@01 0 0@9p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000T0 p001 0 0 p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0&l0000 0($P(l00Cl00 01 0g00T1 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPdUPP0 0ap0T000400`0  0 F Ϭ 0f2f6Td000 00 00  00Pd0+ "TpG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( Pd7S3S< 0(bd0000000%FVP p嵲H0p`d10 `S040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T2\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( 0p !0001S P 1 HS X0P 0 PB2 b50>" pPG Q0 :1S1 !< P8U@e8 L0PP`P`U00T\%0 R qq(0@01 0 0@Sp0$01 01 01 0` 0Pp@=P0p Q0@558 50P%P0L05P000T0 (001 0 0&p00101 0 0PnP1S 01Pp 0 0T0 C)C)ct00<21 ( 0 l0000 0(H!Pl00Cl00 01Sb00T:1 P  0 p001 P@000 0 0 H'PPx0d000 000p`0T0x` C)C)ct02160" *(t PPdiRPP0 0a0T00|0400`8P<0d000000(0!TPPd00L0L 0ql0< R 0P00 {Qx0PT40@HIP dlQ80slpJx`40V:[ h04Ch000T1P Pl0R 0 L0P 00 0 0X@H@0H 00 (0 0K@Hp001 P 000 0@00H00 0PPp4ph0400 0000T0 C)C)ct0201<" (" PP4 d Q4ph4QPP480< s0L <001d Q<04p80P0`XuQ10J㿏`Pu00TBL0 010l02H0 0 0p001 01 0000 0,PPV4 ppt0p!R  !  0  T B)B1) b072  0(u PP400407l0 2H0L q%QP1S !00h  0 0(SPP  0T0() C C")0c7#10 0 B d 000"00  ( 2 PHd0p ἐ?00T0 `C0)0c VQQ? Qmf/" \5 S 0?!>0  0 F Ϭ 0f2fPd000 00 00  0 Pd0) PpG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( PdOO8 0(bd0000000%FSSPd0H 00dP|040n 000?Z00cTO-@P wp(,`PT: [0 S0S ❀PZ@V 0000000@@000@ @O-需TMpP0S@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0pe$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0ez_o@RTP$OU000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUPHPPPA;8%P@5PL0P@b@bAO-p|M00-P ` 븰[ 000$P|Ѝ0 00\@000S/ :0 80P0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P fNU ݷP n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ QPU@7  N0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @HQ( LP@% 0@D TTw 0,0 X LyPU@mMV 0080\0000!Pi@b0   R  R*. Ru@-IZ\A000S -/0   R Q   -//@-P`00S-@! < @P@P 0@0 0 P]@ 0S R x@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 墜@P 0ST 0S@Pu@PL t0pI@p p G ppz w뼰0@0 0  Cp 00 @W  A Kw@K0P L" l1. Q*k  S0 S 0 S00@$Ѝ 0p@ 0 3t p/t nw )t  c  +x@P 7  z  b弰帀$  @-@@A-P@00S= 00CS9< PP0Sk@p?oV20#S 00W: 0R R 0000@0` R w@@-A-P`00SE 00SC 00A0 姛@P 0S 0S@Ѝx@Pp v뼀 0@0 0 Wp ]@ @ A HvHp ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$a8H\0`0P00 00 P (0P6\0 44#T20T20$ ;60 0RڼQt ?0:# 4080$0H0(#00\\I@P\u@P \KdЍ\0000S00$00?@D0@0S@@T @ 0Q\00 0v800t RY\0L0 @0S 00004L0?tPP0(0`E 0/#\00000,< 1P(080< SH007D0 R00S 00S`0 1`0 0 400$0C0 0@a T0 C)Cba)0c9c00, `Pg  R !00 R(  ) 080S03 S300S P" 00 00y00S01 0( A0L 0 0P 0 ,0 0,000 000<0`V0<0(00C(0~S 0 00T0C00 T0 C)C) c0<;2 , 00PPT 0U0T0S 0S P0 w_o$0R_P@0S \UKUS@bo\A@-`Pp!0MV @ pq0 W p0 P  $0 Q D 0  0V `0 P ( ,0 Q @ @0D 0 @0D 0  U P0 P 0 40 Q$ H 0, 00:00Ѝ    O-`0Mpp@P0 s00Su 0@ 00@`p\%1R,5S0 0 0 `0 o."\哞T1`Z 0 ?  Ϡ ,2 0 `x 0_`0 C c00T0 ` C)Cba0)0c"03.MP0000x 0`0_\0\%R ,KtW gJЍ0 "J TTO-]M 0 0$0@ C0CSR ]ߍ0S1  ;100P`S00hp(0\5pSG\\D@5D0L 04;(pW(SØ,31  0 $00R 0x0$P :(pSWl00$ S(p_ 0)PY 0000 0 @e8$\ Q?00 \0L&/ 0L& 0 0 0 0Pm  P P 8ŕ0 @L $QgY~!0$800 <00 PS 0/0Q0S:0  N1 $0加S 00kP0$ c2# S,P!Q  RQIp S1Q\Q\3PR= $08u< p 0 H0pß $0YW/  010$0  W 00 $ 0P 10$ 0X #H0P$ p  ~p. ?w 00 S100 0P 0wR ᭱0 000 0R    0唂00 0/SP0 c0 SRQR3000Z,00004000 ZP t0T RX  R?&4D00\h p BW, W pq0S*0p ,Y ! !X4@X Y   !0 C 0[00 0 0pQt1(( R@ 0pPi1XXϠ R$0 0 0p0 0R$       0 0000j0P0[0 S0&t 0( 0Sp0 0St0Sx0|\% 0R  P ! P01@ # 0@0H  p 0T0 C)C )0c8Ì"h0 /0P(0@0S" 00 0 00 0S(0 01H0DL0H0LpW* p,0S40 0,04 rs \%5R,00 0!!0 ,0 S400 P00 L ᜐ pl̠: S?:0p000000S00000 00,0 S400 P00 A1ᜐ a8:<P0%:00S.N8%$"6600Q 00Si 0_P 0 b R320 QP1Q SQ ☐ pBᜠ b<  YS:0 B z'z b~3p2z0W p11$0 唓S 0  0H0$p5 5C20000 0G0060 p 0~pY 0X%0'00 0jP 0 S100 0P 8@ŕ L     1ptpt1p@0S(0#S [ 0(0$ 0z$0(80 0<080 H0<00 0R8   < < L   0 Rh  Bh    R  h000_\%P0R !0 !08 P L@ l0 ^85@50%00L508Q Q0(0A0 0S 0 01H0L0H0LpW8up@5pL0p85@00L0T\A\A\ApGWl8Q Q0(0 TS1 p?H0L0H0LPp@-@00Px q[00S o0 ) ) d l p t00p,o0 ) ) X P  0@-($@0P `GP @ tv,08`<@S 0$ 0j[ 0 <0S@@P  E00ЍpG-8`pPP8 ^ U A 8YY L @ሀP]A_At_A0` RP/! 0 P  C1  1 @- M\A\A0` xRo/ 10#/C!000P/ @-A)\A$]A0` |R  /  /C! C!/! !/ @-,A\A4]A0` |R  /  /C! C!/! !/ @-9Aߣ\AA]A$Ő\/RO-ࠡ@lPapPGSh$eppX!W@@đ@@ T'B^!B ɑP%P@DpNU"N  R Q^PQ! B!T!0B1$5S P#1 [ @  R PE  R0Cp@-0@ PR00^48<00Vpl0 0\Vsp DVl  4Vg0Q000p_A ``A_A(`AP@- P `RP PPrL0P@E RP0P bh$0`Ad`A B @-00@婛T/@-JM_A 0O-AiO-@0$Mp0\5`0 0 X0_,"x1P R  0 ?<#΋ 0Px 0vX`0 C c00T0 P C)CRQ0)0c"03EP) P Xp0@ "(, Q  )B0`0(00 P0` $ЍTdīdHaAG-pM  l!` tPP @尩ZI뜠0P S ٛ ՛PЍ  0 $\%0R,5S0 00 )@|* \\\I80(@@ꬫdddTO-TM4  p0 3 a0x `80PP # 4PP # `TЍ40@)0R \0Ԁcؠlh  0 0 $P PPС\l ph Rmx0s#%*0x00唙0 hQt  0 &hQp  00 Qd0X00i` qr 0P( p t!40  d#90 00Ql0P0\%d1R@h$#H 0L 4){*4\\\I0(@@j    #\"000 l0h@0 0"V➞00SP|P0  0!P e!c0A\aAddTRhVQ # 3 Q Ra00L Q\L Y4 A  Q R/p@-8$< $ Rp RG Rp RA , Rp\ R; \ ^x ,\R  p ^ PR pRT ^8P@pT`@^pH ~pL~p\QQp0S\ p @/pT R P/@0  0S/d0SI /// p@-MP`@@o 0@ V@Pnf@P   00`0 ЍpvdA-p`\%1R=@SPP,j0 " " "0/3#0 4#/0$/4 0 $0/04$04$\/84(0<$@4/0D$/H4L$ 5 s10 5L5cs0P50 00(\%0R,5S `pS>`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRP;j p$`W0@: ,0W0:F,Ѝ\0Q.0U 08T @)@)`"30BPd 00\ Ó\ _?x[?0哸+0[0: 0 TU p0Sp/p@-@PM 00@0@ @@@N|`0 0@0@ @@@@P0 @@ @@@P 3 Ѝp@b bAd8 p00CSp0/@- @ 娘妘@裘bd@-0 R  @ @0b ` 0iЍЀ-M xPAhoЍ&bAO-0,M H P00塇0 apMW XS@?n /h+p+ 0 $+4BP z  0Ci % ! % >\%0R004\5 P  a ,Ѝtl4RR  Sh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3h  0000j0P0<(%0 0R@0@0 0T`0$S> ) %> 1S 0DV<3<3g0P4T$0X4S E>0X4'40`AML V$5S0P=$Yx $ Z`P 5PΆP/ 80HL0S40pH0pՓT0 C)C)0c"03MAPP  0xh  =80`$%!0, R0 `0P T:꜀ \Sἠ_<#| YP  0 ?<#Ή p 0Px 0S`0 C c00T0P C)CRQ 0)0c03"@PP SP$Y"   m=Cc0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 S<0400P008T0<P C)C44)0c03"?0P440$ R:<4 5Ҡ  0 Z00C?o200004圀AL$%,0R004L0Y]$5S0Pň, HR4\S944S@040T3 0P1 Z110 1<(%0 0R@0@00P :>0 $  * IP\ 0L00T h00@x4P <Ub0HV@2@290B00080 H0S0L0 C40œ T0 C)C4)0c03"R?0P4 0,0|f,04 ;,04080q$%0 , Rr 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P0Z 0 <Ѝ\4S{ 5  0V000  ʘ0j* m@tP ]$X00qbA8 TT 8T aAUbA/bA0bAbA@-0S0hP@  sAX@0T K Ѝ 070@T VV070Z`0u/PpQ0Y V 4C^FVb@bdbAdA-P00`SP pjW@P dW@PH0  M`嘑@Ѝ cC-@p3$M/P++  h0$+4`P6TH0h 0e0 51 50@0\%R=S04, 030304040 50fe0" " 200(0\5Ww;`$Ѝ8T8 O-,M@40AKJp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"03=P$ 0e0$000S';8 P8G-p MR R`@A ZP   hPV!P4  UPP0 RPq0kP V 0S 0 0R\ ~~V 0\P 0]߂0 P@0&00 0ߔP刐U:040000 0`PP,V,`H`` 弍PiU0_w q0P^wUp`y 囂 宍K}D}p`=S0 Po0-=S30N0SSP(0 jPPP 0 0S 50ó 5=S  0  PP Ѝ0 5< 0`V000L!L!$000C?o20000\4S 0Su/V90 5 0 5=S# UTP=S 0 0C>00~0SUT֖010|PXPV@bAbA/bA0bAbAcAA-@`D1pPP d00' pP@=TSGP 0 N<=0S E岁= SŒ|$%0,RL1~h~P ~~000:0@bO-P@`=$MS =S  =TT㜡T00p@0 TP9TT 00T RdX$X TQ 屍PpT=S+ 00P/CnP$Ѝ . P B|T 0(P"| p 0   |XcA00p@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0eP 9 ;909  000&00PRP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0\M0(0 0 0 ) 0% 0 000 ) S RQ0Sd0$0$ 00 0 ^0X:$0S$> 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  0q80 V 0(00 0 0P40S P#H0 .`np`` ? .0:P00S P0S 0)̚ 0p0`085< `F V`!V"40S #H08<Ř  Ÿ   . ?xD HLW  < W Q  #&&  "00`0,00,000"R0 0 00T:qTQQ80@ 0(00 =P;H0 C2 00000 0&",R0 0 00p[@0Sh0'C( 0C8RP] 000 #8 '(80(0yPK $00(0 +\Ѝḟ0( 0 8 @  1/ᶟ[!p@- @Pv Pp0p@0@-@Pp姌9S ʰ;S  0"L`PQ 0 SL0L0G]0P0 0 ԏ Ѝ贫dddO-pLMP4  P3s:Pp R00`5M:eP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@9P80' @DXT $@0,0 $`Y8 5080[ 0 0 0 \$  0 $ R0 8P p5 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<8O-@P `R0 pM0 ЍO> 0 P0<:P: 0 6S ⱔ0\0:  ЍO㤰0 00S Y  И) R 0P0 1R H0C200 00 0<% P ЍcAO-需,0 0/\*0 ,\0 0 ) n,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` _@P 4_4" 0 @P6<Ѝ8e@5``L0`(04S 5oobT`V 00 0Sl24@-P`qZ@P0 0@P   0 00PY0 ЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?J p p* 0 00000.0>000 @P9 W000 04@P, 00S)i 0 %@@T0S3] 00S00@P  0  0@3 100r\Ѝ2 1pP 0   0,011@Qc@bvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-V ! 0p@0 1/iAAep@-`Pd@00`L`F`V 0V3$@w 0p@0 1/ȫdAe@-@80$ 00 P@1p@-P@0S ؐ tP P 0S80$ 00[00y1t #!SpP00S 0 8Ȏ0t UⶏiA@bldiAȫd@-`pPa U@P|0@@3 S@P UP H偐$D00减 } Ѝȫd@bjAp@- 0P pf*\Œ\\p0QpVQp8LP8840=40 0@pbpkAT:ckAԫd;c@-  P0 SQO- 4 R 40  #H/" R @RP `@ p`f9gpTpTP^@!`n``p R  ^N  ``QRV^ 40S40p ЍHp@D `4`j PUiQNo @`j `>i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000X0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(02PP 0 =$05L0 C c#3800 9!600< 02#T20T2{-P $'/ Ѝ`(0$ U-4D40SU //00 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000@bc@-0S    P (000 00 0 <Ѝo0 p@-0@00P`06/ 000`06/P Er00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0sPEP0W(0,0ů _|=t1 000040 0 0pP s$sLЍ0x 0 | P ( 01/P]0@ 0 p 01/H4Q}OWpUp(6*C/Q @ ?QD   00ã 0bPMMM\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0l!  0`؊Lc⺌ hQ Ѝ!kA@-0,@00V@"4/Ѝ<6а6lAp@-@0@000@@PD @DPPP0 p P: 08Sp0PppppTlAHlA ʠ,ʠ`@*ᎍ0  m@R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#o0 0 p~@PX0|0#880'00 Rd0X00$00|0 *P\P +Ѝ z0s8 0@@z 0 { @*0 pK~@P 嬰0 Rt 娠0 Rp000*P\P*"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 ᰍ@@ 0 p}@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *00)0 p}@P# 9  :(090*P\P%*-@@@@4mAA-`p0S t 0d0 0 0P0 Lf@P90VeЍ@eO-` 0M0jPR@X1)RP##G*D1 0PA@0 03}PPP79 08C890 000000p07/P _{p 0 L. }{[ P ) B(B()    xU w ЍܫdC-` @PpTLp T, T4000S-@ Ѝ贀 {@00@ L   b7 00 0P @ -{ 070 @ՀܫdLmAO-3v@P= P P  cb000 Qpq0$0 P@bP :bP 4bP 0b-b (4vX 01Z(@@d@cȼd@-! @P  !2- $MD0< 0 4 40 , 00 0@ s$Ѝ@c40x0@dnAp@-@ PQaa a$0@sap@ u@dA- HP0D`p0C ##R@`V( 01S P `0D1X  Q R 1P `0Sp@-P@P p@X0! 000CS00SPP0U:00Bp@G-HPp0SЍG20 0 0S1 0S- `` N;C@P0T@0P `` 0u<`P  =00C0 0 A;W;; 0D0 0p0000C0nAnAp@-P@ /aP$0$0p 00 $0Cp@A-@P`"vv$0S000000AG-0P@Sp`P0p0S(W !R 0 !V R"*0PE  1  BS !!  100C000CS0O-p@$PM 0`TT00 !1R 00B0 00TЍ1X0 0HS G 0 $ 0I  0@!1Rp0p  BZ F 0  0G p  00 S[ 0  0[ ^ @G-H`傊p  V@ P B5^:0\P`R  \ #RP  V 0S*0S  (  0 D@PH00000  #P0S .v PPH080j0S00000000C0GD  !! !R  !1   0 S  B!V000CS0000$00Cs0 D0HPD0@cA-P$0@S`p000$00Cs0 AbO-P`H@,MD0 P0 0C#& #6&& 0! `0p $0s  }0  BwU  R!$00Cs0),Ѝ 0 ` 0 pB`FW 0K0D$00Cs0  0SH$U0@ s 0R0 B{ $0H sF q  B0 $ 0$  B `F!/  B0S 000D 101PXÕ_ 10$00Csp  ^p  ^  ^  ^0 RS00P0S W ^0S ^0S ^Z  ^ Y(0 U0B$00 0V  !C0U0 00Z  ! }C$0!#/U V  !nC0W$0j UP  !bC$0!/ 0$pR0 B 0H 0 P 0Q0 w^ t^q^0Is k^0 `C0 R ! B!0 0!0  C  0 !0 0 !C0 C 0$p 0 0H0`F0D`Y0$0U A-`MP `pᮿ1@0%T00S`Ѝ,0(@0P,0(0,0(0SX , X00(P\0P<1 <u(0SX@ @S , , , P0X0S\ , \ 0崿P0SP0! 0 R00R0S"000P-0000SHN(0X@S, , , 0X0S\ , \ 0UP@cd(nA 0 !6/ ! !lBp@-PS`@!V 01P 0  0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P`0S00p@S000 p@0{ /-@ $M0 4  *( 0 0 00o$Ѝ01nA@d @-pP00@dA-P@T* 0S' 0pᙾ 0S `Pξv@0 LqW 0S 0 ; 000C0᳾8nA p@-@5 P pP MPpv PP `[N0 09767wV sppAnA@-@ P>N0 0p@-@PT+ 0S Q 0`)00C000a 0K00,Ap@ Lp 0 0 0p@6 0S{"@d$dp@-P@ 0 0 0J<6Pp@ 0s/ J0( $ A\ @-4 00A A"1S@ ^\01,0//O-(0`9p"AR0,0Paq04`0AAbATW" i@P 1@ S0@A ,PQW`p V000 YZ @`W``fV00C00S0S   qjAcO-tMp0圀P@`@, ` R80 S6 ?8P K80 `oᩒ tЍ(P,0PU0%VZZB8 00`0 < 0!8 V#8X0J0 0^8P "SR 0 !r5 80S ^8 0J0 00p8 `$6:00@ 000R  0  0 0}6P:Y% 7  5NY PL5V 7 !+7h0S8 0Jp@0 00`vTnA\nA|1G-p VZ`'v& TA0$pp P(00@0?o20/ $ AP0# pB"   40T0X jN(00(0XHZ$p@p P(p@Z,V0h )/Y L(@/DP Q@18@AS8 80< <@@↼@ddhnAAc@Bc@/0@-`0ML@T LPL   @A'0 0,0 0X0@@eЍ0@dAcnA @-VP@LO-plM $@6 `@ /lЍn @`  t!@N@ S * 0L0B"  YV[ pf$ЍO0 AT  QPP SPUR QP  RQ  R R  0R h0@P 0 K000 A`P X0P`@ď T0,0PJ`@$Ѝ$dAc 0s/p@-@`M7 GP12<Һ800`S< < #  5 0`5PP50  R $0AQ0%4 0OS-HY`Ѝp5V 0 P 25f(0,#6j[3,XBcnAC-Ap {@QU嵺` Ѝ<0@8PU |奺8"AR0@4 R`001S B XWP Q00P `iZV U T,0!X00W0S `"V0P `UAcBcO-@M ` @VsC f %  ! . R  (  0SI ! 04     BR - 00> $!*E {  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ <P H2 2 T2X    0 ,  4 @, ꐰddM>G- P@P  L U `D`(00@0$V0:Pp5$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5x`P(0pnAoAdO-4MX傉 8d娉0:hR 0P?)v%t(0$ 0AT,0@TH3 0B!0U QY (@ 0`0DC3f0S   $0D#0* 0p $0(0S, , " 80S< < # 0P 02( $ (( P( ,A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0`09 0 *"*0 # 30 #6: ,00$0d 0! 0 0*h0 d!l'l!0 \    ,  d . 01/pP6 4Ѝ 0`0DC3fd0 R + R Z   ,d2px:6kd0$0 6 0/0 }p,0W 0h 0 0,00ꐰdboAdM>O- 00S #6:(00  $ (01/#P1 0B!0S@(06` 0 0T:0q <Ѝ0@s 0,  }0J0S Y5 1P0,,10Q 5f0$0d2P,2/$0   0 E,.0,/,/,80, Z 00 0 0ꐰdboA0@-,A,Q0  M*UP & U0,0,  P0 O0$( R*0 000p0&P pdo ,#004 ,0  $ 0,,Ѝ0@Oꐰdb$oA@oAd#beoA0nA/O-pP@+0 2 00 0P`P 8,+,D, 3P ` n1` Ѝ0S !,,-,. !  {6P  ,+,oAp@-`$0S 0$0P@P   04p 04pO-`P 0M 42 p3RL"H"  L"H"U =0@T 0S p@T; 00  03 Q, w 0P"V+> R [i WQ PB0 0  ; Y HW;p9@!Pa 0U 00  @@`[,@P  6 0&33PK <0 ( 03   Dpx+Y  Ѝ 0 J+++T+ 0D0 0-YU  0DACV  0 S3SpMp p@boAoAoAO-`pAM$ P@\K!0h0i0j00$0Xp>0S .82<082$1<0S$10|$1o|v: R$ R l 7<K<@D0H@T0 @HP X P<< 02P@0T  BRT 50 H $@ H@L   P000 <8 /H$ | XY p X 0h0h R 2˟`A&f,P 0V`!0CFAT#60CS  00`00\@d`h0YpD 00|0|MP0 D>PP0V200C?o20S6 Y 1S Z 0 * ) * VX P x(0,p0 06?  0 1/Y Q0F\@0C0`00d0 pP0H0(00d`WMZ <0!P0rH@a <#PP |p P0 @0S k0Sl00l0 0SP0XHp0 <P P@q < d< .0`@\`0d`0_X0bcX0P0x0g(0S [00p0W0 `V 0S  <0 !P3P0Sd)W)p) 0#1<0P(l0[ 0ÃQ 0  ` MP uY i7 0/ uO0 X<0Pe Gk0S* 0S'0P 8`t0H 0X<P6 0L1p00 80<p) P P680  B  X<P 0/10 Sl0 0Ãl00$PU XZ B 0@ P 0<5/ PP0P <;x 0"10P@800 " 0 R002` 81/80S1O E q Gr  Y R; 6(0<0XP3*PZ2P0S(((0 $0l0Z0P 0   0 ,0R< 0 0(0p' ,0(  0 SZ <0mk0ASTt0CP0@`X Hp,`F( 2<`0 0 P ^ < 3!#L20L2 0k00 800 8  4  @ 04@1/PPN #UIX3 X0/ 0@t03#H20H2t0S0 >0P000v l00l00S k0Sl00l0 P0X<Hp0 P `Pf <& 00x.-0@ X<0P000#10yuP<jW``V@ |40x P4'4'4'40 0  V P@ 0DAP@ <t@4 0 0 0'4b'4'T4@T  0'/4' 1 R"P'D'' 0@0 0P0X<Hp0 uPp00 80<bp PZ8`t 0 /0 f0u/XSjpd@bXdpAoA>pAb4pAIpASpA]pAzAC- @ pP)f0 P RSPP P M:P  P 0@0S 5`P '&)'JT03P5:P ) ЍhpAp@-@P`p  p@2QG-@ 0S`pPU@# * 0 @P U  ZX 0 bX 0bA-@p@`@P0 ΄0 O@b@- .    Ѝ0.   0/Rp@-P@ 000Dp@k 00k @- 80000  0 ;  ^0ЍbpAİd 0 `İd 0  `İd 0 6`İd / /A-D0Dp0Pc00S@Q0000A@b@b @-,0@ ,0,0t ,0 1,*,*n%& 00S:d%0@ 6, P0Tbb@-\0C̝0h0H0a3Νt1(@+'0 <@bHAbpA0 0@b@-@0S#300Ȱd@-@0SkeP  +0  C$3TU=! ( 8s~0T<^6 : vЍȰdpAd?pAO-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! 0`PE000 pP  Vb4 0S/(0(0 S;3S8#0/bdC-pbDMPA  p101U 00 1 000! P |d 0  0P$P(0PD1P 000  P  0 ! B)1PPp>W000P P0:PP00 _sP00P5Ft0 00x(0x0)0:00 T P>spDЍbd?ddM>'pAdpAd(qA8dd66-qALdvJA-, N0RǠȠ̌' @N@  0 `p0PP |d000lULJP(0 @00 0 P cЍ1qAlqAG-p`0P00@ @@ A0  / e T0XhGN 0$pP 0 d #f$P$fW U$J`dbdM>$dqAO-DM@p ᄠT:DЍ! Z`VU3#:E3  V@P`2'$dM>@-. .   Ѝp@-N@N@`P@ v p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0$`0S D+P (0  {$0P 0S  $0`,Ѝ zI ~"@0 jdbdM>qAO-N@N$M@0`-qPP$p`AfX0h000  :$0PV l(`0 P  zq$Ѝ H 8"@0 zdM>qAbp@-P`N40@N@ 0- p@UqbdM>p@-8PPpr@r0P3#pb@-@P  04+ n  0R 1 0&+A-p`V@0: 0SP%PU! 0B0 0S0S 0  B;  0a0S 0S0S"U ?`FPwP0 qAA-Pp`VX+ @$A0S0S"000n""`0 0@ X @"$Tp@-0Pp0 >"@t"0S @"}"K"Rp@-@P U Tp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXk@$0 SV 0 RP0`PX000 00Cd Sd05$0000 R0X00\0d080D0<0H0S 2 0` 68 4000 R 0F 0H0S xLX.9Sl `0< IpPe 0@ P 0  Q 0S `0L$ Hs@lЍ000pD`0 HL P r #RM4 0/x [p 404 J,00,0f@0S `0LHE$0 S@ $ 0CA0S!000h!!@ 0S `} `0R $@Hp0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #Ph2 d0/ vL(WX OD0 @JD0 0 &X `P 0DA/P LD 0 !D D!D 00 0Y D 0  !w<Y 0 |D;PsiD00^0 B H@1 0 pP0 pp0p 0!pP 0D00 0    0K0@000Jl04\00 LID%LP T  H'bqAqAddqAO-4M$0X0 P\!@lX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X% T \n4Ѝ,X Y , !!  !0 / v\@bqA/;@-$M0 @CcqAdd@-`@ 0 ```` PP  " 0@0 0 00 0 0SC!ЍpC-`M 0 ````p @P 4 P!v"W' 0`0C0@ 0; 0! 0WD0 0StW1 0S1  T 0005Ѝ 0; 0p5@bb 0S:0P//0 R:P3#//p@- P@Ц00^p@ FYꀺd0 @0 (p@- ` H0@SP`B   DD00 $p@2p(0, 0 (0, $0Sp0Spp@/0G-8M,00@p00P  0P0(p$@ @ @`0,0T0P 0H00'>000(p$@ @Ppm8Ѝe1rAbh61G-M 0p` @`)P0 P 00 0 0 `@7?o2P0S0S 00S00Ѝ R 0000 0YP bP @-pXP010耺dCp@-P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#p\0R 0B  UL b  pp̰d 0R  S01 R  S0100S/0/@-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B a$0Sp@A-Pp`^@P (0H10@0P 0A!&0D{$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```$0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`0S #S P00S e[;000@bp@-P@ZP 0S p000p030/@b@-P ȤBc-@ $M0 * , 000 00P  U$ЍrAbdA-P`pP @'0 1000000 @ 0@AA-P`poP @'010 000P 0 0 @ 0@A@-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO- T;@00CS@0Z p@bA-P@pUPP0` 000 PP00`V D#&R + p@0S 2 PU000pЍ4 R @ R  00B W $6SV X130PPV40S @0S00 80$0S0 0 0@00@0 P@0S P080 VpP 04 R@  B@  0VP`U40S @00CS@0  `̰d@bO-P@4M0`<0UP!@0, T@1T@!Pp4Ѝ,` 0 Upt2300 000C0Uw0  spQ @ R jp U 0 R H$Z 0  0 U01 C00 0C00[ C$E U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ 0P P  $R  0S0S 0S   W 0 S K\P 0 0  BR @b@-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P0*0000p*O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  P*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  P>Z   R 2/  U   U    B    AX D D H H 0  0 pG-|@ pP`00LP0PP@/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !0:P0P `@IPZ0sU P3hzAoAhnA@-@pP`MS  0p@ P Ѝ@0ЍG-0@P0`Sp0S 00S R 3/000_ <@  < 0 000SX@`@@Щ$@ 0@00@(0 B0 2@@ R"` x0p0?U0 0S?#03@, 03030300ߍ̰d(dC-MP@P`` pR0  P H1 R*Q,> k! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221`c@_c̰db0a/Q/0S //C-Mp0@`00 0` P0 P 00 000 0Pt?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 SP Y 0 03/:#:SSX  0 7 0D %6SP0S 0P 46Se0 x00 0$Po 0 idM>@b̰d@- J$JL^ >00>0^0 s *0#03<@ Q03 R0S O-,M Z%ZU@N@>0 0Y*1 00000\/$6 0 0U:@T/,Ѝ 0FpC W|#$ QP9 @Tk0  @PP Z P R:Z 1 0 $`  PR0 HX xV s0V00'0J R$0 0$000$0S Z@X 0! $0 (,0 D 0PJ0SV 嗷X 哷$ DD'P Q @w@xoAO-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { OP 0 0(0S 00 0<00800400 0 @00bbC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00\$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 08$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 xP0 hUh*Po$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20]Y ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P 0D00 Pp@p@-P@U ȴp@p@-P@P T@@pG-`@P $v T0Gdz 0pIUJPO-tM@$0$0圀@T` V0 $$FJ0H0墳p T 000@  ,0X0 000 000,00 0 1/pP  $0tЍ P!p,0Q P,Q,0,0@TÏ6 ÿQ Q00   {0P000P0H` 0S P   prA@-" "&*C6oP Ѝ@-" "&*C6n Ѝ@-" "&*C6z Ѝ@-" "&*C6IP Ѝ@-" "&*C6H Ѝ@-" "&*C6T ЍO-A11 0R tqs់0\ ,R 0 (R 0!L P ʋ` Ѝ P @`V2 QE A00S00S  R 0  z់T PP\ /P101101@@@Ud@Cc̰d@b0bG-` PpOP |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T bd 0p@- @P!  ` 0( 0SH0;H0'= P0RDP  0.  0+  0< 0000pzA 0p@- @P!  ` 0( 0SՊH0;H0'  X0RP 0.  0+ 00C0 0< 00 0pzA7@-""&*C6@PP 0 Ѝ0 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-@P@eT@Pp@Ccp@-@P@♊T@Pp@CcO- s@0PSDM@0S^ D0S@Z b10  B0S#0 0(`0@`F`0`0@00E0S @0U=DЍO( ?@@D @00r@P 0 Q"0p`0[) 1 pW1 @  P T a(DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@?     ̰ddbdHdrA@-T R*0B 00 (AR0\ ̰d0sAA-`Pp@P @P0SPD0S TA P  >PdgsAA-$aP0AS 30!>00000000 81Pn 6810`U 0CS*LA뤀p0WW000N@N@W\0ЍP< 0 <Jbd̰dsAdsAdM>sAO-B2 ApP LD PшU@@_pA_`@fP$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0iP\P`EK@0   S0P  w  @P 0>0000000x (0D0 , 2`%`F `뛦*@@Ec@b tA̰ddB}bdb/p@-`P@&0`P @ p蔼d0@dp@-PU@@p@x0@QX00 1Ġ  S0 Rp@l@@bvtA̰d6tA h @- 0pt0S(ds@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6 U`" 0pɇ P(,`0p S 0: ` S 0; 0`P ᮇzAhnA@-@`P0pជ0:0Ů0 pH Ѝ0 /@-@0:0 /"&*C60S/w 0S/{ 00CS0/@-@d@-@| P@m @-0@S000d0S/@-@d P@Y 0IPp@-0@0P*Bp@?=@-0@ R0 @q00n@ A-@ P ""&*C6N0S7 0 P 0 0; 00  (0:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(00 00 0S0SPU 0ۆP `V' 0S 0x0FU 0  :0V681` 0 >>⣂R P A 0S 0 `(0`0p 0s1Q癆9 0 6 &! R  010@ 0"61@ 0"601008 00000将d@b@Ccd̰d0bO-M 0DP @@pH뤲2 a  00"603S P0 PYYHP T>Y  V PY ,"($($ W     " " 00W @(0 0p,0<  0+ O$ X  Zh0L PY 0 P0 PI ЍP  00P0SX  R * |R + 0`  P ᾅ  @b̰dtA bbzAhnAA-Pp`VUAA0Ds 0 0 0P 0P 0  0 0b`0 00≅IԱdp@-0@ RP0 @00 R TpP00婅00奅TUpp@@-@@p@-@P0p@@-  @-  @% @- 0S Q P0Sp@- 0P p @nP T  0Rp@ppzA000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/====@-@QPЍ@Ѝ /A- @@Q pPW`/ Q 000  0 +P(P0@/@! R!/! !AT |P 00S 3/V@bp@- 00S@ SP` Q @p@@-|@|p0 S 0R``&0000P0XQ &0( Ѝ谼d̰db0@-@t0tM@@@0 @$LP @ @4P00S 3/@TЍ0bbdEctAO-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z߃ 0S 0 0 00 6$0$pU0$,Ѝ d0X 00L b0 PEz@bd̰dDdEctAtA@-PfMp0@T0 06S 哃0 0Ѝ@ʃpqp 0 ^P倃 0S  p0巃 P FЍdM>d̰dEcO-P0M  R0 Q" @K `p)0Z000 U00 0Z$[ T{ hЍU Z `@ p ( , "&Ep@ `p@` T@ 0S0` 02000S QU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 0S  00 00`T 0 P0  ( ,"6  U $nU }z$d@-0 9 ЍdM>G-`@M@fo PrEVY)X 0   P0  ( ,"& 000  V0 {%"嶂@Ѝ0 C-@PpȐf`V686P@`p啂V 0 t;@fh0@P:`XFE4@ 4PTPE_o@RPPbEcdtA̰dcp@-P 0?A3c S 0 S<` , R0L <0`ODS0@r @@@?CD0p̰dQPcVUUUȼds@-`@#L0R4:P#L0Rp00SdB8`0@AX X 00 000 004喿Ѝp@@bdtAEc̰duAbdPdܰd@-X0 < PDȁ@߿@0@0PQP P̰dEcPd0L0Co/dYdP/@-aXRT墁H0, P<峿@(ց,@ R ⪿0 0dEc̰dPddA- 0@S0p# PU# P`ᄩᵁHq 0S `U 0S 0  ; 0 B 0SᙁP0S`}PፁV Xp@- 0@  P P A0 0p p(0, #6 fP +O-EM 7 5@5 `wn`P D9\5\Ep#T5 8L   0S 0SC0S@40%0妾000 00 0RV `P000@0 0 0S#1 D@0[:[ 1 0 1T0 HU.2h !0S000C0< 0S0 00 00000/d0b@-@P R00 O-TMPx0 @S@S#2[@T U0!:3A00C 000|00  U00 Z0Sl  z'(0, 0P!0SZ H0L00H#6$000c,0x00c(0p{0J600P @0$#6CP0#v0P,0  $0$ 0S[@jTЍ6$0Pv0#fVnWj* @)P@!@1 V`!x0@D @#60c@(00S00PIW@1@!@D @P`1,@x0S (00C $ 00C 0@0D 4 B Q 4 R00C@<08 8<0 F A0|00Z ~Pl 0 ZPR 08 0H0S0H0L0H`0 pS00R0S<D ,0P`s 60C00 0@G @D@ @T@1T@1x0S (00T@1d0VSP1x0S (0px0pUP! E R %p# 6`F :  T* 804  80 $4  Q* `F$ R 0U:Z @PZ@HP z$ p 0 p R0L0 0P@8 0|000|0 R0L0 08 0|bM @ 00# "(0, 0P@0#0P00S 0S @*T 0S^  P2[+X'*PPUP1[`! `1EpV.PppW PFE0 S0 0Z" l@XP1P!pP`1gEp 0  |Z PP @|uA J@h̰d(duAuA y(d04 S/P @- 10FcuA/0@/Fc/0 \/у0P1FcA-@p`H1ƒ RL R^!^D*   R `V`F`Pp1 E@V P^@o#PA A B R`V`F` V P L@FcuAp@-P@y2 Q*    0R p`VH"1`F`V @ LPpFcuAO-10S1쀟`Pp U@/0 @//W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ K̰dvAFc>vAyvAvAp@-@X0Sp/"R\:@\*QLp@0C?0Fc@- pP 02 0  ЍFcp <0 P 0 D R 2 P///Fcd@-P@-@@-P 0Fc@-P 0Fc@-P 0Fc@-P 0Fc02P 00 /Fc02/Fc02 /Fc@-@P02 FcO-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000wpFc̰d@-@PL0"D0S 03>4000$ ,02Ѝ000dvA,dFcvA@-0XP`B 0\`R 00P@0 0 0 ЍpFcs@-P0@D0S00Sx Th/P: T/`A P8/0`P@ЍpdvA̰dvA wADwAnwAFc0O-M`  0p0P0p-00ЍZ4? 0$$Q0D0BS0S Z5*an/P .0P Z`VZ/0`F`@V @ DpD @R` 00C 0R P 06# 00 P 00C 0wAdFcwAuAFc̰dO-,MPP@P U.` 0peP 0㤠N@T P,Ѝh ``F&&$ $    01/喝 00`@0/@- 'P00 #QPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P`0vw6 00DeЍp0 P/0S  4\Q 8< Q < < 8H  BH /80\d̰d P00S/P 0 (Q, Q/8\d0P  /xbp@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P?0S  00\d̰dP0P/@- T000 &T0 @S\dG-@0Q00P00CP0uP'۵P""R,40Hq0S)44140P ! " |uL00CL0$ T00CT04;P - `ju000P00P0u`0``FV`>``u, (3<00 @ ;u `̰dKc\ddPxAxbp@-0@P ,ugu&uT00T0`uP00p 0 ?\d@-P@D`40 00` `v@ 0Ѝphd3p1@-P@H`̛<0 060`0 Fv@ Ѝphd3p100@-"sr9 (b ?  0&" 0BS0000L Q`P( 0 0 $ 08  <hps0% s0PÿH X Kcxbh2~xA@bd1O-QMM`M6 1H`V1 Q` q`, [P`嬚 PDN@ws<1p@0T sV000p00000CS`4@0U MލЍ R @ pV 8 aJ. 01 04 08  @0< $ P$ 0D0OY 9/ u`P @̰dhdKc\dp@-`@0M @H@ sP0 >PP 2=+ }@PxM'"000!X@ @@@@O;P0p  (0 Ѝp\d̰dKc|d(BxAyAxb尙hdhdS Q9N//O-@0CM`S$@7H00CߍPd/X匙0P'0CS087 03/@ә 7060`J>  ڢ0 0000 0&@P0 S 0  P!l6pP @0S &($0P0&00CSu00h`P0S %h+ I$0T T0,0h0X 00$\,`Vh @@p0S@0wP$5 5s`PrP`  `LHrV z@ sPn? `0q04p00S 00 < #(qP r0:q JG@ r$9 0$ B0P0 ) !h340X !)`PY& Yp2`0P 30X !"q[q0q @b!hG`P0 0 0(0S0,2?d4;&fj0S0F0Ye 00 210X!10 0 4C#"#04>0CYC 08[1 '1 I "'넱 x!(07Phm0S !0S     , $!:P  F)(0,`(0 q00000L L P P 0 0 @-@nH0 0@7n` cO-$MPH0TQ@`LpP0#0@ 00S 0S"嫔0S R0 0`P60 0 H00\XTPLp$ЍO`B Y O-Mp8000 0 0RЍl ` 0 ,` BPT dH2F2PD2P Q /BCbO-|MP`x Dh@ pT PF 000000 0 000000 00($00(0 000040 080(2<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 E0PT00PE 000 @P @@ P0@00|Ѝ`Ps@-@P` AP Ѝp@rЍp@- L@.P 0S 1(S2S P{AO-0|M3S `PP1S S2S @$$e@P $|Ѝ22 000 00 0$pP $}@"E 000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J ,J@D@0> $?@"R)0&0CS$2@ w0000 0$>@P $0SW00CP $@"R"T@10 @ " 0TL000@ @,@2S0$0S(0 40s0N@N@4@800XSB 0tp<1W00 m@P tp0t00S3 @ C0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!@P00( 0;0L@P40〰 0D0@PDP5S7S 2$0$00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$}}0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $D00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@ 0(@1!00L0 0H0T ,0 S0002 02000x0h@|0l0$03/@P! 0@H0 0@0@PD2012A-PpU@` U RP  Q 0P  R@T P q{A0O-Mx02 CR@#2` 000 00 0$V@P  p2 S OoxBA sЍ0S%P U"0P0 0$1P PEPPE0PPEw@ U @-P@`pP  0 00HPX0@0X0 ЍG-X0 `Ѝ0@S P `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ Pp  ?Z`    4`{p 0Ӵ00X $p0 $0X 0  0;`P0 (;` X0V X  R!X0`P 0X0 0\0kR 00dX0"Up^W L! {pP t{AP P P>>//@b@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀ@bA-P@U 00 ` 00000pU`  `hbA- $0p0 $0 0@R`P:    U@` P  00 00$00hbx @0D0@0D0S/p@-@P`0S000p P PhbA-@T1  0`/ @+ P!p@P0|000[0 q 0  0 0 @P 003/Ѝ@@-$Ma01@00 0000 'PP0p  W 0 00 .  00`P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000P$P,ЍA-X0 00$@0#,C04@ R1D@(2Dp<`C0PB` R 0 00000H0Es 0 0000 000H0P 000 0 PPЍhbPD2$0 0!0 00 /@bd d$d@-0`iM0 0 Z<P 0 iߍ#@P pX0 tpPd  U00> !0ddddedA@-<0DT 0 !0  !@bO-Qz ,M| `0S &a3D NP䢟Di202 000*0@P 0Q0  ,00 p 0Q  \PPU D@D4P`$DP{PXDP D0/SY0`0DP0F-0p 0pa s0!00 "0ǐPSq`y0 U  h  00`ᮐP:0 0C4/,`000 P0@`@ 8 cᗐP#$ ,A00   P0U0P0S@ PP@U00@p\^Ѝ{A`cpdA{A D|Ac|Ak|A|A|A|A|A|A|A|A|A}A0@- ! 0 !@- @0S 0@定ddp@-T0PO`d !0UF Ϡd 0!T@!p謼d@-0`M0@ 0 Q00 00I  @`T#ʴ@Q   4/0 0 &#: 4/?&6 :  X 4/`ЍH@Dpd<6hBx}A jBjB}Ab}A6iBFgB}Ad}A}A}A 0O-p`'DM@O! 0 0 0 00`(p$ _0,0> 00!0 0 00`(p$ J'0 !0 ,0  00`(p$  5 0 ,00!= 0"00= 0 00`(p$  0 ,00!= 0)0 0 00`(p$  0,X !/0 0 00`(p$ p0H ,090 0 00`(p$  0,0G0 0 00`(p$  ̨0,0O0 0 00`(p$  帨0 ,00![0 0 00`(p$  夨; 00!e00<$ ,0  00`(p 卨S0,0 0$!`;0o0 0 00`(p w0 ,00!x0 0 00`(p$  c0 ,00!:00 0 00`(p$ N0,0: 00!p: 000'> 0 00`(p$ 70 ,00!:D00 0 00`(p$ " 0,00 0 00`(p$   0R!0 ,0  00`(p$  p9 00R!0 ,$ 0 04`0(p 0ɟ 0 00R!0$ ,0  04`(p ʧ0ȟ00$00 0 0R!0 ,0  04`(p 岧%0,00 0 00`(p$  垧&0+,00!0 0 00`(p$  劧(0,00 0 00`(p$  v)0,00 0 00`(p$  b*0,00 0 00`(p$  N+0,0< 0 00`(p$  :,0 ,00!>0 0 00`(p$  %-0,0;$05 00!50>00'> 0 00`(p .0,05 00!K?00'> 0 00`(p$ 10+,00!N? 0 00`(p$  20,04 00!O?0 0 00`(p$ ʦ30 ,00!|4 0Q? 0 00`(p$ 嵦60 ,00!(40S? $0  00`(p 埦70 ,00!3 0U? 0 00`(p$ 劦90(,00!W? 0 00`(p$  v<0P,0Y? 0 00`(p$  b>0,0]? 0 00`(p$  N?0 ,00!= 0 00`(p$  :,c? 0 00`(p$  &@0 ,00!1 0f?0 0 00`(p$ pA0 ,00!1 0g?00'> 0 00`(p$ B0\,0j? 0 00`(p$  C0 ,0m?0 0 00`(p$  ХD0,0q?0 0 00`(p$  廥E0d,0u?0!}Ax2k2bj2p95tdx2bv2@z2bo2PbhAq2$m2 v2 {20 0 00`(p$  nG0,0}? 0 00`(p$  ZH0,01 00'!?0 0 00`(p$ CJ0 ,00!1 0? 0 00`(p$ .K0 ,00!1 0?0 0 00`(p$ O0 ,00!(20#>0 0 00`(p$  0!?0 ,0 <00`(p$  p 0! =00<0 ( ,`$  p٤0$03 00!3< 0?(0  0,` ¤;d$0 0 00!|30?00'>< (0  0,` 姤; 0 0 0!%>00'>(0  0< ,`$ 古 0!?0'>@A( 0< 0,`$ y 0 '!?0< (0  0,`$ a&>0,0> 0 00`(p$  K05 00! 00 D,0  00`(p$ 55 00!? D,0  00`(p$ 0!5O@,0 0 0`(p$ @ DЍO-ADMP/ `p  0  0p,`(`$P P P< , $ 0 /      <0p(` P Pԣ ,  O@ 0 <0p(`$P P P@DЍ}A8l2y2pC-QM`p \@ ,\ \ 0` 0 P 00 000 0@?o2P0S R0T8R \70Ѝ887td}A@-p|0M@P? 0`` 0 P 00 000000;Ѝ;cC-p0MP0 0`` @y0 P 00 000 0@?o2P0S  Ѝ0dC-p0MP0 0`` @P0 P 00 000 0@?o2P0S R Ѝb/uA-MⰀp(0@P`` % 0R R#  L,* Ơ$ d `  L\# Ơ1 00X  00 000000᪞Ѝ謼d̰dC-@0M(0`SP0 P$0p ` $0 P0S S P h00X  00 000000xЍcG-MP 0`` @p 0P 0  00 0 0 p@V?o2P0S  0000 0 P00  ЍO-P|M p嬀`@` +0H`{000 00 0@ 0 0P?o2P0S 0000 0 PPP0SP +H0S|ЍO-P|M @pt``  <+0H`70 00@ 000 0ڝ?o2P@@TP0SP +H0PJ|ЍC-|Mp@P` `0X X@0 XϜ-@X%X H0XS  00000 00 00p0000ᄝX@H|Ѝ@Pc@bC-@|MpP`` $1T0 T@@Y00?(P @6 (V(RXX @HJ YR00 D @0  00 Q 0 00 0000p00*X@H|ЍPc@bbG-pP`0Mk 0` @\0 P 00 000 0@?o2P0SD0Q 04QS03"# %05Ѝbb NMb@-1P3@j `q0VM P0 ! 0l:01 00$00$00$0P@$00$0T0(00,0 0S00@000G8p0900S  @@0VH00L0H0 H0 0P00T0<00 %0`00d0`0h0$Ql Ѝ0 `ԣ 0 H0ͣ l Ѝ@V@bAA@BA-`MPp@k 0` 0 P 00 0000@M?o2P0Sk0PЍG-@Q0Mp000` @`~0 ` 00 0 0 `@ ?o2P0S, 000 0000 P 0R ⁦<0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 #Ѝbɚ;6eA-M@P`pዦ(0` *0 000000X00˛ЍC-`0M@0 0p` P 0 P 00 000 0P嫛?o2P0S@0S@T03K 0%PS0 0i@PPqЍbbG-`RMAxp P` ($1 0 1 010P 0@Hpi?o2P0SMЍC-鄐|M@P`` pHZ0X 00 000000=|Ѝds@-P`ዅ00@0S 0 CЍpdO-PM@`Ȱ0kU0s 0ȰĠp@ЍO蛞X 0UT@@ pwX U2U`010# 0ZC L R?0b|P X3UT|pW,U4T|Y[$JEQEU  P  { &T| RU{# W!`IKq@pTXQ 0`FV`G: T:`pP0T  尜 ;?0 |`TV TU010#`| 0ZT{Y[ D DT 3 PxT|0S Z1`IK@s Ѝ0 M@XH `c`cO-PR`@$MB @paMT0 RTN@D @$Ѝ Z X  !     DhT  ("TZ0 H @p PcdTcO-|" 00,p$@ @@ @`~ 0(00 00,p$@ @@ @`m 0P(0 0,p$@ @@ @P`\0Ѝ蠀AP ƒ #60 P *R  P 0 / 0CA-0@{`P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0!L0 0!d 0 ିP:00 dbāA؁A@-L@P 0S  00P 0000dp@-w@`PUpPw>00ST4w<0 80᠎wAddbAbA0000 swd0@-M 0000P 0`@PP8 L@P 0 @@0@ 0 @P Ѝ0S  @!y!5@P @0Dp?  @Spn!@@Dp-@Pp 'w`0S@|ww0000 ݼ@P L0S00p 00=@P dd A2O-RM0SP@ AX  v0SPs,0 Ёa,0zXⓟP08 0(dq;P0(@8(0H> C'+(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$0$0 ( $0,0!@0<]|x|O[0) 100S$ ,(O?0 00000000 00 @0X PP  @,0a0vЍ 0d@Bbb`c*AdO-MQ@L @pP `VTP@%ЍH0 0D00@00 01/PP P@ `p@-P,0@Tp>P @(b@-@]@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00@-@-P0S  o` ЍX/\/RA-PR`@P\p 0!S (P d!νX@~PP@@-X^ :S!\@   s@-D0`P h @P,`00Ѝpd@-@0 d 0  d0  d@0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!v00@00H00L0 0T0000/03/@bA-pP `V@P PtP 5u|V w@000V 0 `@ 0S 0 00 P000 @  ud(bp@-@PM`t@@ @@@`0 g     7 O h    $(ЍpdGAbP/H0 R R 0 R R (bp@-@`PlRt2@PTtp0`0 00$P 00000@t@d@-@P0t 0S 0 0S0   L00C0wt@ 0S 0S 00  d@-$ P P PЍ@-  Ѝd0@- 0 Ѝs@-@P M`0`DM0 0Ѝp7@-@Y+PPTPP8P 0  Ѝ0@g Ѝ0ds@-h` /P0@0@PDPHPLPPPTPXP 0PPЍpd7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍdBd=d@-p@`MY1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  YЍ d d$d@- $Ѝd@-0 0 0$Ѝd@-0 00 0 0$0Ѝd8 0(  R@0/HP 4/@-  @((vP @ tP@Ѝd @-K0 00dp@-000@S0S00 K0P0p@bd00CS0/0Kd@- (LPd/0/d@-p0M`0@ 00P0$00|0 0, S00` (0 ` 00 000000tЍbbbd0S/$0 R/@-@@@b0/d0O-aA?P0 1#A$'@P@Q@ bA-@pT0 Q]P`I Pp0 JЍbc\A@0p@- AM@PIQp@I Kbcp@-P40 AM@IQ  ;p@Ibc2/@-, 0#@0 @I@b\Ap@-4 0#P0 @zIp@b\Ap@-@4 0#P0 @gIp@b\Ap@-@4 0#P~0 @TIp@b\AG-@0 `0p0 0#`% CPPP `0 @pAP ?ܷ0 RS  W: 0 Up p^3  0S 0S 0 bG-@0 `0p0 0#`% PPP `0 @pP ?ᒷ0 RS  W: 0 Up p^3  0S 0S 0 b0S/ 0S/P/0PP/ᄃA/Pp@- P- p CJ "0?P.001P ۺPP0SPPSU`P P 0 0=0d1  PP 0S @o ITPP 0P80S101?1?11` P@V@@pp@-@HPD@080C@00S  0 %Ep@D[c@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PEਲ਼D @0 PUDt#p0@00XPS 0  P@D003`EDpPc[cbpA\c@b@-@@Tp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0 Q2@-  a>Q 0 "Rq0 o`/O-MAQ( <0@@|UЍO蓍QO(0pS<0(00 0 00?o 2?@0HS=0 $00H?oR20S30H?or20S,XC`xW01x0#L0C4`P(000U L0S:Z0S7 $0S`0$ S0C0@0 P 0B@CT`?D0k`P C `=,0C1@4008040 0S`,CCDjP80Z80 @T XH3$ 0R 0 S030#R0S 0H0|C`0H023W`x X_VX@\0P XP@T`寐 0dV`0(0h000l040p00|x0P00P xT`嚐 0V㌐0P00P T`刐 )0V㜐0P00P T`z(0S V0000P00P T`i"*0V0000000P00P T`VH0000 0000t0@C,>CL00 X@宅`,BVT00000 00C 0X0 0$000000Cs  0007X @00S0000PCX< CԊ(0S 0 '" <0 Ѝ`,d`c`c\b@bO-p3tM3VW3@03?0 tЍZ0@᱊T`3 0((00(@IP 0B,B(3(JP`U L0STZ0SQ ~B0 0000P 0@BT?? 0iP8 B =$0`B1@0000 0S 0S  @T  JB00S $ 0R B000?Z0F 0vB $sB2B \iYWP133V@ 0 #0S/ 080 0<00@00D00H0 0P0$0T0(0X0,0\000`040d080h00S<0l00< lE 9B@0 0⩄P0@J@`$00 820 ,-,0 @<00&0 D!P@00S0000 B`FB`1@b[c,d`c`c\bO-@?0 ,00 @P@b\c@-@e@ >@-@>@@W@-@P 40 +@01 \c031 0g@bgO-`2 31 L2 0@1=0>q1WPPӄaՇ0cU.  `P n  J ⅭPR0?Sòʂ?1?1P1`11Q1儡U> ЍSP  Y UX Y P(P1SQP`Q>00>U"00002q EŠ0 3 1@b\cO-13A1Lp~gPPPy넁`pU/^U 8 Q020?SP !011QPk?QQ? ۬?10 Oe[ P 0SW ( R 尐U4 AP00@b\cp@-0Sa @1S@ @A1S1SpPk?Pa`1Sp0S  R R    PQ @bp@-@T 0`QT@dPT\= IPHPP=UP@pT 0d3IPvt`c@b1R  !/1R  !/G-pPt3a @P    T\@@b@-@`Pp0P @! W#!! 0@@ @ 0  @o  0  @P@ Ѝ@bO-%upWpF@Pd3졓10S?b` < 210030 10 .11 R`` =%+ e- ThX 0\P0 03 [V * Ѝ3 <)0P  < z@bA0Q`/wt@A-@PxM␀ Pp`x vdp` P<T  HP  l,<xЍdHP 0 l`cA-P`h0hp@0 0"+ - 0(00  03 b3@bQ-//-//-/-/-/-/-/$0 0!0 00 /@bd d$d0  c P0 000 cP000/0 P000/ 000#0 $000#$0/Qp@-P@ X;P0 R 0SP400S! 0"PT *<p@\c`bp@-XP`@ PD03 1pV T( LP p8#p@\c@bd]c0 100S/I@\cT[c@-@;01@;@\c@-000S d 0#  ЍT[c@-@0S0 R 000S 0s0000S0Sp00`` VPT00SH$A<T10 0 0 `b@\cAAAdT[c0]c8]c7@-@P J 0h0,t 0>00l00p00 Ѝ02p@-@P, 000 00 0X0$00(0tp@2@-@ ڟ@5 20`@s@-@`P0 0 00h1d`S\PZ_`0 00 0 !`0`@Ѝp%A Ap@-QAM0 0$0 0S$0 S*:01S< `10XZ00a01 ;V  ⴩0 :!(0,0(0,P Ʉ s X 0R1!0CSQ B0 00 $UP t.S1! B0C 0:0  4mxx]c@\cT2b0]c2`bH\ctdXAdhAAA-P`P p吀H0L,A0 U P#H0LTp0    0S:|03/0SI:@`b@\cT[c@-<0DT 0 !0  !@bp@-00P@00.px]c0@- ! 0 !A-p@d` P΃0S C C0CS0#T X$ h0l0h0lA@\c`b@-00@0~x]c@-00 @0 0堃Ѝp@-PHM` P@ (݃P P `9( z (_ $ p  U9HЍp@\c0@-AP0,MS 9 d0S&  BR,* ⣃ hM00 000L!h0l0h0l,10S0P=P,Ѝ0 R t,Ѝ0@9 ,aR !00 0` 0@,P(p$ c} 0!(#w?P  0 0,P(p$ R} 0`!2" 0y?0P0 0,P(p$ >} 0!2"P0B>0 0 0,P(p$ *}0 00!8"~?0 0 0,P(p$ `}0 00!!< 0 0,P(p$ `}0 00!!? 0 0,P(p$ `|0 00!P!?0 0 0,P(p$ `|0 00!?00< 0 0,P($ `| 2l)I21 S,AT0t tl00 <8r 8HDЍ8t@CAAd`bH22@\c022x]c@- ddi`0PTP@0   040 P Ѝ@42x]cAA<2/d 0 0// 0"/// Bp@- ` pP@TMpA-P@0`Q 7P@pbA-`PD0@XppQ P P@dRp@-P@ R" C 0t  0!R4 0 R R 0`00  0t0$0p\ 0\0\ 0\0 0`0000 0ꔈAp@-P@@1tP2pp@-@`PP1'00p`t02pp@-@PP1(0, 0@@1pp@-P@@1$P1Upp@-d0Q@P` 1 @0, 1(0@S@U 1pC- M` Ѝ0 SpA" S) S /00P@H10@ 0`01 ց 0!0 UTQ30 ?P@0 P@`S@T0P@`FV`@Tt0P@00 P0 0 000 0!ʚ;@Bʚ;R7@-@P R: K0- pX0 0X0 0Q 00 0@00C@0X0 0X00"eP 0p`00q 0 0\0 0" Ѝ004 Ǒ꺈AX 3p@-@P0@081@0 p@1X0@/p@-P 0X0p@0PX00 0@008@0$p@&p@-@PP0(0, 0 (0, `q p劑p@0p@-P@@0p@0p@-P@P00`00p@ᇑ\(p@Lb@-Pk0;@P0`Ѝp_0x0t0 0@ 0000`P 0 ` 0d@ 0 0\00\010Q0`c@bp@-`@ $P  RP|&0p@-@|$0@O-X`M@``x0p0x00P0R0P0 00@PT``p dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 00)0X005 \`$0`0/(00,  /@0#?0 0>0/ 0 000p 0D`P / / `10/ 0!#4#0 !AlS ///x00CSx08ЍT `[ _@bC-pP P`P' 0堐   ( H@ h/@8&`0@@<%+3 1 03 ЍA@bA-PU@d0p00`h0G/!%/,Ap@-@d0`P6/%p@o/p@-@Px0Sp8UpA-@P pP/X0 @ 0P  Q/x0SK/=o@0x`X03V00  ?/:/7/@bA-R@P` |p.h003/%/h 0 * !01 0 R) p .X0$ @00C@0 R 00 X00X0/ /h00 l2A!#4#0!10  .p@-@`P ᎝@0 1p0@00F=00`'t``c pA-A@ `p.@0Q0@@$.@b #] #^ P 402 /,0P/0 0R03 0@2#/pbdp@- @`0PT 0T@)0,b@P"UP P@ 00t^UdUP ,~<PU0b@p DU@k dA-P` p@0U @TP . A-P0@(PP3pa--@01@0&.1S1S .-8A$HL1 Q  PP10SP@bh0 0///C-@LM@ ⟜\0 0`0 0PPP弹 P: PLЍ( `P fpp-` qp` 0"-0 gLbX 3@-IT@ d3@AO-P 0pQS lQ`8TP.0P <T r @ |TP$ @0R @R0@ @ D $[  q  @@000㓔$ 0T 0DC1 00  TV009Tddp@-@P 0S SP |%Tp@P\TpPU @Tp[ PP U PTpdA-P,hAT h0pS ``,\0$ 20S$0 ,@A,AA-Ppᘀ,ATA,h0S ``,\ $00$0  uP$00$0$0S ,@AG-p㔀oATPP,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101,0S 0h0/\AO-M( 0$0 0P 0 (0S $ Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` RP 0S< %SP3S 90?00P03 @#04/PP30C3000 Z R P MP  +1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>0!#4# 11 | p~+h003/PPp@᜷pP |+0 0Pb+X00X0+0 PU+X0@0 X0Ry0X008 0@@0@@0@0$!f0 R 0R @T @k )+Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|C+0@+X0@0X0H73007+ pRW Y GU0@,0@`S 0 0C 0000P*X0@ +P@0X06300x0S  +* * P* 0\00`0; P~P|3Sp< 5310 0P3S7 H@Xp0s0( PӀ hx0`0xP*00@017[@*s@ 0S 03# @04/3pC(0PpA 8@P @0!S3S XHVPt@ #T@0p00h t0 p00|*s耍0 7*5* @hTX0x# @00 00S R 8i _*0SZ 8U*R*Dj 0Q 00 0h0T8K3S >*{X0 X "0X0@00C@0 ,*|00) (0!*)X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@0)  )) 0S@ 8) ) 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 8) ) 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| I)000h0 0S 0040;)h P 5/P40p)U l) j)6dpA@b@-,0 00000 00Ѝ䘉Ap@-P@Tp`QP y@G-`p3aM)1 PUG8)P (@bp@-P@``( 0@I @p@)p@-@PP( 09 0p@)00/A-@P@pET|`(h0000h0(@꼉A00/0S00  0S00o/p@-@PP(X0d`)P(hX00X0F(p@(0 W@-@LuPP@@-@X0 0dX0dh$`03$!$H@^ pP tP @@bd 0'}d 0}dO-p`@嘰  HQ:/PDPWe \   0\P ?P Ѝ0S 40A3/0`@00@`dO-dMZ@$ ` +0T L0P $0(`T E`P8p$p* dЍ P`P$0p$pE X1 00č`V M/txP @0Sy@!wPPt!(PPn00i( 0;0!*PP_P1 00 0000 0 PPN0$ 0C0:P0 1 T01 R ! ` !l  2/`PH0T S *P S:00S18 ,0 0Rn pP ptP tX0Z `x\P P`RPbdG-M@` 8pYP+0xP@@0/S WϓЍ[0 0 S?@# ,* b 0 C /  C1$@ M00<`00 U` ,NV@ k`F 0W@C0`F`cO-`4Md@q̔ 0L0 ?0MX) Iw峓4LP0 0/0 0,0p p00 000@P s,0/pt0Q0*#P,00 0`PP冓,0L 0P0 P000 PhP|P0v0(0L0 C5<0X0pPtPlPxPg$KM >^PP X0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S p20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRm:D04Ѝ(PH! E'b$ v$ R!0 R $0_$0P(Pz`10`1Q\`pX00X0 jP\`bX00X0rX0 0dX0$Q!$d$O H P FpP XtP TdL<L`0 0R0U0S \{ dyA{A@^c 4 4db00S/ P 3/bA-P0 `p00l 0 0010 (@0UP Ѝ UP'0YP 0@00 0 0CS 0UP`V pZUPp UP'0YP 00@0G-PM" @@L a0 @@9 7yQ1q0; 0 @0p0 PpH(@T `X-W0AU2@P ~000` S'Ѝ 00S S S  )00@0P0p 01@ 01p@ 00P!0 R @^cbbdTbAPbAC-@PM> (0S; $ X7 `V6 h0Ԑp03/ @0^P00^P 00` 0 ጉ`P 003/Ѝ ԧ Dw0 (0p`003/bA@bP/(0S/P/ R  00/G-Q @D;K08( Q!P( U Kp PU PU ^sKp R(0  @` jpP PU *\XK(0P(@S0`(`(@0S   0 @^cPbxbG-PQ pJ@(`T `(䀟V*K#t! 0S2$@0S LPPt%$dKv"(@T 0Q S   0 UE`@@^cPb`c|AA-@`PpU 0S /A + 0S SwP@-@b֯P]_#hP lP 0 @A-@V`墯00Sʬ#Ѝ0 0 0PP-0 0,0pp00 00 0P ,0/pt0Q0!*^cbO- `0  0 RR^  ą00 q$1|pqL0 48<0L0 1 111"  "Ip _h\#p* <0<0ڄ$,0SE,p,[ppPpulP`0<1xp8pM4"P P0$(, 0P0Ҋ#T0T0(G(I~`0pQ h1d0l1=0c?0h0040083pp0 `040qq40poW 4p40qcn40qbm40!0R "40pG"|0, h001t"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@[d 1\D03/<"(Jvr40004Z0mbn"@l"1S' Af"{OIMI(0 T 5@ "5`0`S P"<ЍD'4040pWev $f!  DS @yITI -"BY -t#@@ϊA֊AۊAU3`c`c@^c0O-,MpQ #0A`P#@t@T ,0〠X2 8 PP@PP -T P` X !P P`@#0SKo]V 0U> :$@$ P@PB `0V): `V 00 ` P@P0 00# $ 00`00 @PQ  $Q@0@,Ѝ 0S S+$0U@P X x$尿$ z`᩿Pb^c-3|0S/@-@h3/0|0h0O-a4M00PS@!QQ!0S 0081S X|X0T P3ᤇ,00000>0#6040080>0#60D0>0#6000<00@00( t80S M 0/1000L09L0 !5@ 0 0  0PpW(pWL0<L0y0P . ).`1Sp ״pP0  n0  nZpYW pP[qP[!0R s p7 ls:T0  d  [0 h[ 000[  [ 0D6p30pGor  FqP ͼ $$01 0Y:p⿽$!$$壼WpWpA /pz pD ὾DD0ĐN I1 0`1H!<1d1D1l0 p 07/pP\T!@0AX0  81 0<1$0@1(0D1,0 /PpPG l0 0,03/l00S 3/Sl0 0$K(0Sq [o Yl 00Lp @07/ 0 03/3 0000  0 0各pP 01K 0 03/FZpFX T#~`HD pP tP 0S{  IpHW   /o"    2/pP#pHdP1S t l0q 00S p0S$@F$0p  $@aF0tp0P  1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/<10S X8FZ04FX 0"#  "p EPP0. pl 000p p p $pKK0 0Z000C0OX=0 ] 0S  KAp4Ѝd`c@b{A@^cdac0@-_MP P@P0 _ߍ0@-(000000 0Ѝ-3@- $0000000Ѝ-3O-dlQX (X)0Ph G>10S`10$0P  `Ap@-Pa|@T 0Sp 0.P T  P06P0 0S P0 P08P0\A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/xdH-wA0`SM P0P:P00Sړ00P0*  IP|CA0l 0\000Zv 00C0 l 0 (Z$0 1111H0Z00S PH81S _뒏Bx6$$~0$04:G僟` 180S 3/ >>nT0  o#[0 00[ 0 [ 010S2 [ ` 0`Z0|`` 0 0S  KLH $8 `0 000 0 V q&Z[ + 'YĽ *5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x lB%0@ ( H R( S0,02 P   , @0`080 (0< 0 D0(00H0K0(0 <|E$1S  'z  01501 0Z0C000000E0Bl Hl>V Av] 0 Y4$$+9(F1 P 0PL 0S 0S5p@ 5 =5l0Q Q*00pM `* x0S `JxdAac`c8 eac*A`cAp@-a@PP0   !O-M00S`؀  lX fv80S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y %P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0 RP  !P  00C0X 0000PB ,0Z R R%@   B X /  5@00PPUPP0,0 ,0p0bZ0S000lP030dP00 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< y5 =5`V2`H0S& x 0S%0@ @ H R@ S0D02 P   D X0`0P0T(0 0\0(000`0I {M|p(_;(X\;((XX;0S X (kX (0e0020Z00S   00C0p0St t ' `$D}% a P~,;(=P D彷  OM?$; B/o"S R0 400P%`0 _0Z 0RP B+ 40 0? `c@b`cacxd^c0@-q@M QaT0P0` ,0 TP X ܛЍ00@-P0dM 0 0@S0 0S0 Q  H?o 2Q0S X HdЍ00@-@0P SMS0R  0 0 0000?o2Q0S  H?o2Q0S H?o2Q0S HSߍ0p@-5lP@0U5Pp@0`P *Pl+)5<50 Spp@Y@-X0C50S[0  IQ 00S @ Q@bdO-`$10|0L048<0L0 !80 !!L0?! 0g  c:> 0 0? I00K1P DP  D+ v<0<0, Uy,0S(:0[00,00[` P055 l`0<10x080G^cbbd0ATA[AdAiAxdo3`c`c@bbd@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC 1*@Ee@00@00 00 !!0400000, !  !; <P 0 aT@0h;PL;P3S @bLcd d$d0@-@0PM 000 t0PP mP00P0@00S 0 022201Ѝ0qAy3@bA-`|p0PS ds @P U ; p0S0@U@` )<b|3p@-P`@0`S LOT ;PUTpp@<0 3/b|3@-; 0;dp@-PP@ ;0S   Upp@; 0b@-0@0S R 2/b 0b@-(@ P0S   b$0 0S/ R0/0bA-Pp`@p `Pu$ 0S0@ 0@0bb0S   ײp@-`P0@TP  冇P @03/PP pb@-o 0@T@z 03/@b 0b@^c]@^c 1b 0 bdMd !d b 0 db< dp@-X@P0`S @d8:@Tp@ ';03/@b|3 d 0b@-0 @T0 3/@bA-Pp ` @P  p `d00$ (R (@$@0@0bAb R 0(0 bP@-@`$PP0!4p( L00 PU,0,0S%  Ѝ@S 0 0 3/00PTp$PU,0 S 04 0 3/P ЍbAAċAAp@-`P@  `^ :d000p@-@PM@ñ0S   廱G-P`?X y0003 0@T@T. 0pSW00  喱@pW @U 7/0SpW H LW @@ @@8@bA-Pp`d@ ``p0S0@@P A-P`@p0S 0S   BA00 00S<0 3R W pW@bp@-@P@Tp@- @0dKAO-`0Sp,M@PTXdP ` x/o 00 00P0" 00  `00 @00 @`P d,Ѝ[  ۰$ \0 $$0wZ`p?pW  )U 0S $  0P 212 2<22@022 02nRoY 00b@b@-|0C0P $l!Qm2  L1S  8 W(M @n@bTAddA0@-@D0081>0S 1ЍSddp@-40CLP0[;P0RUJp@bp@-@00S:P00#;#P0@Tpp@J@b@-0 0@/@bA 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d00S/A-@`ăPqPX`00S \@P bP P4 00$  Xd@bT[cٌAAŒAnjAьA0 0 0/^cdp@-p`PC1S 01O000p@ 40A0S$0O`QP e@b^c^cAG-霐P`VU`P@@ t@u0!0C8R#8 @< A@0O2S P B!0E@b^c0@o/^c 0P/,h_c0@- 0D0R@00,$00WP r @bC-p0MP0 0`` @ 0 P 00 000 0@V?o2P0S  R ЍKc0@-@0$@0 @0 @PZ<Ѝ0_cAA303D_cKc3@-p p@p@0@@SC 1X019q@ Hq@@<<80@~_c@bb@_c4NAbVA(b@bA- 0b@SPpbtb|0@X4100S nc0 !!04L0H0@000, !  !@bd d$d@-@Q't T 03100|P0P4Ѝx- 00SEP 00S t T0 #!R `0S@b`c@-P 00Sp@-P@1PpTUpp@-@P`tPpp@-@P` tPp@p@-@P$Pp0U p00/p@-P@0Tp@P 0 P QOp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@O?0S P00 0000@-2 @0 0R  R@\ 0CS00S$@0 . P51Ap R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3Sis@=@bp@-PP@W t PpP0 l t BR 8P08P0P0 O8P0MP9Ap@-@`Q6 P08P0Z0S P0S 0 000C0.p@N41041/41!0CS41/p@-@Qp@p@-01Q@101`41Sp PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT̬@ L0`` 0N81S-8AFZ. Qh`0 !0L @0;/2 00  00s`P AS^ЍZ㌬8APU 0RJ `0SNPXuPܡ  2/0@ ! * 0 0r`P 'X[  2/ `0*l`P  0*_tXD 0000@ :0<`0|0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* +M'@b#b#1[  00/p@-@8aP 0PEu 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A- 2Q@Up` 0S sqt1 00$V;0 0 `!`0  0 0 0 004 00 0(00:/1S ! !! 1 00C000C00100C0= C 4  gЍs90S (9ZNL0S \P ~00$P Kh7_W,0 KЍE@b@b`cD_cO-PM`pDT 3RU |@pr,0 \ *00 0 0P 0P Yr #@T  ᠰ8/r{L h Q4Op 3 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S L0P0<P0p|tm jmZ20H0S@e1 1w^X@00#C^ @p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S KP 00OP 00S  | x p@0@@SC 1\0100 1<0SЍ3/@bD_c4NAVAlA `c_c@_c A-0p3a 8Q@T0S 00((r  081 0*rX@@bb03hl2/@bg@-@1 0S@ A-Q 2@sj 0  BR 00 1@0S 3/.ၭQ4lL 5P0PSF P0   1hS!!1 ! w 6  P01 P  !p<" @P0#:0$ 0P+00C00S  H NfWh0 IX/(1S,1S |`V V8^a@b`ceA\AG-@QTq KP` 衔 嗻5P03P0< ŽF7S  <P p>  00C0   0 PI &  0 000P00P0 O-pA000,P0   P  j W& zPP_ 01^0USS [G  `W dP (1 S0(100C00,1)|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010Xr  Q 0P 0R `P ` ```A- Pp`3@2::P@1@!<`J PP   x0@D@P0Q @@(p@-@PPp@U``FUPP@p   B PR / t0Q   0RL     / Q b dp@-P00@Tp0 儋P @bp@- P0Sp8 P`@0 QV ߧ Pp!!0p@-P@ӧ@0$P0Ip d@-@000IP ῧ@@㻧 dC-MP00`0p0 0` @v0 P 00 000 0@O?o2P0S R0 Ѝ7@-D 0P0PP0@EU Ѝ05xA0/ d-@-0@00HP(CЍ@Ѝ/xAO-P`С,M @TpPP VPp ׊P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #tY0S 0 PP 0x P 0 000!R00! 0V0C0@bA dAۍAO-0@!T0TX qԦP `1 !R  !t1 `V`t ` 10 VP y`P `V@&0Q@D0 ,P `Y0 `  S      XI@ဦ Ѝ`0   0P (  -`VPAb ddA7@-P p 0Ҧ@P X Ѝ0Q000 $!@ ꟎AAA,A-@-<00S 0,0 ЍЍ/H_chAAG-`"Q0B  @PpX  p$0S00SpQp @W 003/pP  P 03/p80S 8T$0S R0 0C0!R 00! 0S% P 5$`X!P  Y0000000@0@@000000!00C0}AAǏAA dAb4AA-0a0QJ,q@T V ➽@Q$0S- 0* ~<0P000@03/ P R00S ' :0S (0, 0 nV"P<000@ 0"  b d̰d@dbH_cIAgA0 /$/@-@RP` Ѝp@Oꔸ0 0 00 01P Ѝp@-Q`M P0 ( 000@PȺ @P ӺЍ辺Xp PU@ 0  匈@P0P S  !  00C0b dO-DMB,0RbS20,0Ѽ a002"@000S200  ׼ ϸB/PT:0`PhB(0 <0 P0`,P$  iP8 l/@@PD{ 0 0 0(00$0  8/P   00 0 00@00iP  T 1T 0BS  5R |DK l?0S Q L6Y .P  ($0S0 PP$ 0 0SX$'0S $Y `T  Pe  t`(P 0(0!R00! 3  @T 0 P  @T@0S P @̅P 00 0@PP 0 l@ `!$ 0S ,S0X,X I R (0SY yP  yP P {y P[$0dbS @ T `0, SP $0S(( Q03/( P,X -  R80S 8O$0S /`,8 X 03/ `0, P`, X 0(0 PP$ (03/!R00! ^0|pS@0S 0S R00(00,00 0 0 0+PUA 03/Pb:ADAlAAAAA6A|LwGWAAAՓAA̔AA"AqAAHAA dA(AxASAA@-pM0Pp0a @T 0S$ 0S/ЍU 0S@00 !R00! 0p0@@@  PU  R000@  P 000bA-P`p᥶@P l T@㫶ЍD @@@@ 0@P@0 h@8AA-P1ap3A{z?0 ` 00S8 /%P r@vЍ@P.@P @@ 0㤵@P tV[0 %@ I@bAH_cA 0 嵽 d0޽ d 0 0 d0 01 dp@-`Pe` P@00@0  @@0000PUp6/0 dbp@-@L0PU  R8 00 p@: 03/Pb d@-@0 ׻00_cp@-@@`P00 ɻ p@_cp@-@`ܻ0P@ p _c@-$@ ~랻 _cbAO-M0S0 P0 Y`p/LPp 0#ݷ  LpW @@T /4PpD3D#PP÷ y  2pW ᰟ2Y C0.fЍ00S00$0Yr  㗟+Q PPo@tPcd( mP @L P D<(00,0 PPPB@P9(0@P+0!R00P@# _1, 30100 0000( 0 @PP,0S( @AP((0 0坲 ɥ[m 1T  T&&}0U@ P x PP@Y vP U{P |v@ jpS$0S0gqAtATdApAÖAɖAЖA@bA AA0  b3Td:A$0 0!0 00 /@bd d$d@- @ 0 /PA/20C22S/?@- $0 C0@՟ ЍbA'@-<0DT 0 !0  !@bp@-P @oU00p00000P0p@-0@000/G-`@#202P X4 CX$S\U  7P@dU P0Sa pq7.d U a 0aG{@bAp@-0P \X40SX4p0 !J 0 !p\0@`V dPpaPPcPp@ac`0 p@0b@bT[cP/0 00@o/@b/@-D@ JX4 CX$S\#7@co@bA-P`@p}@0 B0000]ȣZA-P`@pj@P 0 .0000]ȣZh@-@cmPc2@ポ/ 0  pQd `QT}r}}r4 R? ?  /d@Bx 0/d 0 d@-0000(0( (0$10c00ЍHAl3֗AdG-P `0$T@HZH0 00 pPV < 80$+40 Sp|Q0 000000``F`00C$0YGYO-4M$0h4, 3\`1`p@00S 8XX06000 P ! ` v$00ݴ $双0P0D0V l0 Yp 000S00(000 0S0@f0僡000S00 H@T 0R@0T {V@V@000 0TP(0$0,00H000000070|2 00 4;80 0$< Sg0;;00S8#$0000\03/$0" 000 0 (00O0P  Y0PH 00 00O0 000SY " 0S0 0S  00S 00TT XX 00=V 0`5000700 04Ѝ m0S1೛0 00 00,03/0 0C00 000  000  0C0?0@ @b b3ޗAc3$0S8$0/$0 0!0 00 /@bd d$d0@-M uP@T  uU T孳Ѝ0:sP U,墳坳P u@AAAC-`pl0lPB<@C0S 0SU Ѝ0 \ uAdt03O-Pp`BLMa0 (`0`D00,p$P PP P<DPGe0`a0D0 <,(p$P PP PF 0 0 0'!Dk0 00<,(p$P PF0 0 0D!q0 00<,(p$P PF 0D!y0 `00<,(p$P PF 0 0 0D!0 00<,(p$P PF 0`@!0<,(p$ `P P@D FLЍAdp@-PT0@Tp@@ 0R0P 0S 03/@,bd 1S/00]]db@-<0DT 0 !0  !@bs@-@P0@`Q Q10S8 0 R    ቲ,T Q S`0 S#0@0S 0 Rt    X00S Ձ 0S800 00\@Ѝp Rd{AAݘAA0@- !| 0 !p@-r@`3P @0303/P PU t03/pb Ap@-r@cP03/pp@-r@Q@0Q  !1PS\p@ dds@-@P@`0S S 0SRTP00S I0@ \($@ϱ00ЍpdAAp@-0P.@@Pp0(.Pp0 p@LARAYAp@-PM尳 s`@T s女Ѝp+qP PP 8味q@P 劳` s@]AAAoA00S/7@-Py:s@0(00T Ѝ0ԀpjpP\0 &qP@],s@qP XdxAdAAAp@-8`@0PSmpP0p p@],b@-00P Ѝ ~\P ,b@-@pq@-@qq@pA-`4p@v?0Pz 0/20P0AA-pa@0PS hTpPPpP p0.BP P q0S Jٰ0./P 0 (P 0S3°IqP 0S&d嵰HpP 0S4娰pPdALA7ARAYAAA&Ap@-M`PPPЍpj!P00S 00S傰4QP{倲 yrP@ zrlvP Hl_P0e qldXdIA@b`AkAqAAAoA@-Pp0`Ap00<@00S V Ѝ 9P0@-MP 6rP@ 7rT Ѝ00S q#pP 0S S S P  P  /p(A-l@0pS hPoPPo`P !.OP P p0S Iد.=P 7PP0S4ïpP 0S'd嶯doP 0S4婯FpPdALAϚARAYAAAAp@-M`PPPЍp喱 qP@ q匱U ] PP ~P ~Dvi@P,oP~P pAAAoAp@-`0 MP0UqP@@ ~U p @PIqT 8@ Ѝp0000/7@-@P~P 00~P Ѝ0 Pp@-M`P qP@@ ~~V p>@P qЍpp@-M`P pP@@ _~V mpP@ pЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0jo Ѝ303p@-`@P㱣P 0S Tt ~ `單p XP@70SpT  } 偮dAA$A,0 0S @-s@d?AA-Pp`@ሖ00$0p ` P@ ,bp@-l@Pp^P UPU  PU0^00 p@`,b7@-4Po@P $000 n Ѝ003p3@-` D@gtPp1S`00X1S0@<0 AA0,000 n Ѝdbd3@-0@p`PM  000@kT|d0t t@p`S0PP P02J@P =⶯0QX ( Ѝ@XZAd3dT3 ddH3@-`0@0 0@0 0000 0@00C@0ac_c|0H S/P  \\1XA |000S \/0!`0 SQ/PQ//ac@-PZ00C0 -@-eF2\2O-0S0PrPRM 0@0\* 0 Q00S  0 0Ѝ 0@`g`@  L0V  C 0倐 00 00000 0\00  0#00 00000V00 @`F BZ0@@D0Z @T0@0@h @0`0 `坰 P` P@~@b_cac`c0ud 9G-MP 0`` @py 0P 0  00 0 0 p@4<?o2P0S 0000 0岩P0S0 0Ѝ@-@TZ0S[00[0f&c&d@@-p0 0  ^8 0@0000@00C@0ac_c 0@-81M@T,  Q Z 0  P@@   t!00P 0X0 x0@@ 00@@`@Q 3@d HЍ0@|A`cdac0u_c@bAb3A 40O- 000p(P$@ @|?0谟,00 000p(P$@ @ @Ph?/0,00 000p(P$@ @ @P\V?00,0T0` 00`0p(P$@ @ @D?<ЍbXAp3dd 44000/p@-00CSP0@@$P,eU ᗓTpp@(㑓`c A-0 0 2#PU 0`S@T AlEpd0S R@D:$ 0R @TAbac`c8 eA-`p'|P@?Y @0@00T0S@1S 6@2 0S 1S acA-pP@`Y @0@00T0S@ 0S@1S1S acp@-P`  0 0@0T 0R0S 0S @P4Pp@Q} 0S`cac7YWD 0  !"P/ R0S//acQp@-@ @PXSTd0P1@0P !0@@T@~p`cp@-P(80@p`op`cp@-`PX\' T `@00  RAP @pQp`cac `0S  0  /ac 0 ydp@-@Td0QDSh h h0d 01&0Sp@p@8 e`cA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR wO-SP ` ( `p"0 0*@T 0 SV`0S f0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#boYQVT T R S+@0`00@p@S V `0P @$00@01 00001Wv[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@*x @V (WW R`cac8 e@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0`cp@-L0@3P1S P0 00ST000pp@bp@-P0PSA,00S aPpFp@|@bbG-0PPpa|@P @T P03P0NATAU !YL0<L0WPTGK@b 0 d0d0@+ds@-xR +  '@ ⊨8⇨ | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/  0 R0d1`0S00#0H1``0S/00 /0 i/6& *P 1:i@ 0q`0`0/0? ?,0l`00000Dɲt0*|`5T4  Ѝp@Y@bAA@bdbac_c`cb@bbbKcbddM>d0@{d@-H0 ̣0@Z077pp@d 0 @僭d0 @嗭ds@-@P%`"V`V`V 00 "P0SЍpBp@-P- R@ *B B0 0CS0 B " p`V@Tp\02S SMp8000CPp4A@bbp@-L0@P P`IPp@) p@0wu 03/@Gp@QcO-TM@  0@ <000,R  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Ps 0}C@P ?0 QF R  QR03@0B  x0 1 |>0/h2p0l"/`2 Z0S CSY 0) 0`@0101010園#620!6夒0C2q*0W/p2t"0 00`00` dp; 0h1P;p00p0T0000 0S00@00zip0j10S  b>0W100`00` dp;`00H  |0S ,101D04H0 (L  @J@q PNPTX\`q10S7 $0 |01f0010 0Sh00h0100Sh00h01=1 0=[0 100S R  W 0X00\0`00` Xdph;Z 0BRS00 0#0i-( (!!( 0!!0 k00X 080`00101 01(01(7q`R @"D !HL  $ (,8"04<(h X00` p R=)B0 -BP2T"Ѝ0`` dp: 0` `00dp:$0` (`00dp:(0` 0`00dp:,0` 8`00dp:00` @`00dp:40` H`00dp:1` P0dp`00:儰 ` 匰 吰 1 00A4A`A|AAA@B@-@P`2t Pt tePЍpt L[0 00000 00㔠PP t 0I`cO-Q4MX@dp|4ЍO}6QT@@Z`P: J[q@EZ4 @P; S>0 0O0$@ 0;00 Q@ T VJ8@y 0-4  x@P DATy @44ЍlV@y 0X01 C/@P0X@0 Z 016/@P0Z@4hx P% r[00 @@00P@ VJ0700Z0 CSRL0 @꒟ @T@ 0J0 G@P Z$0,0 00.0@0 V00 0p`J@`c`3C-M p"@P0S !PU  Az` 0 p@P`P oЍ@@-@ɝ0 000 0@0koЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍOC50S0000(00S40SU YPEU U00=03 P 1L0:`@40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S u0 00080@ 0P  @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S ; 40SW; 0000  ZW000 U8 Y YW& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@YH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/N7<1W<1@1@1D1D10Q/Q7 RRm1 1mW  11222/W22!2? !. (2W(2,2,20/v70 ec0Z 01$ 8,[ 0S%?S 10 Rx ?RQ ΚXȚ͚Ț2,/c `1OP00 %70  70 70 70  70$ $ 70( (70, ,700 0604 4608 860d d60l l60p p60x x60| |60 60 60 60 60 60 60A/A60B/B60C/C60.60E/@6@0F/F1060G/G60.60/62@0@ 0 Dp60{60 00C0$0 0$0(0 0C(0,0 0,0 0S @T00 YQ0S $0 C00,0Y * B,@,00 U=0m j0 LЍ R@b_cDA`c1`00/1`<10/1<10/p@-@Q100p`cp@-PP`@V11 FP@ 10$00@p`cp@-PL`@V11 -P@ 100@p`c@-@]p@-P@UTp@-@M@-@Jp@-P@BAp@-@:p@-@`Pa PpR0p@ypp@-@Q0` `00p R0Q`R /O-MPp8K`u@w5xGuYw PWx   ޘP @ ژP  0 僛P  ЍP  ẘP  ᶘP᭘P    ᦘP   ᢘPᙘPᔘP u ዘP ᇘuMrM널I~isM pM႘x ၘw z jPzO-MpP`8嫚w@u6vHwZu TPXvl   DP @ @P  0 P  Ѝ&P  P  PP     P   PPP \w v u  P@- 0  Ѝ"0@-00  Ѝ@-0t`qỗ@uḗP᳗$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`qᒗ@uᏗPኗ$0P 000 Ѝ71M000/s@-@`ᾙ00 0Pᤗ@PЍp@ᓙЍp@-@PT@#a81  i Ѝp`c0A-a(M 000` 0P@P p0 @P ?T@(ЍZ1P0 ` $0R  }YP 0p0z/`00 X0 005v`cA(0310S/00S/w@bPc@-d03" " R @" B"2S %@T*P @bp@-P@Tp s000000@p@-\03Q0S m@T 00@ XTp@bG-@`T; T[ T[VY h1*ERU:0CVQ 9p81`3  1 0S`} P U* W0@ @03A } @T@0U00CS  @00J @@@bbA-@ `50 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `Pd50 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#@P 0 |0| 0 00 0 P"3S<0 R00Q qI@bdX[ctdT[cޝAXd|d0@-M 0000 0@Z0P     4P ЍBA-@ `$P B  pዕP刕UV#3|P{U V VX031S ( ,02 0P03#5P @bA-q`pQ TPP<@ ovB P`c@-QM`@6P0T  R 0@ 00 0@`ٗPP PP pW pWP Ѝ&LO-QM@p帰Q @PH0P @@0P 0塗@P:00CS@5 aL0` 000 0Mg0 00P 00 0 0 p)0@?o2P0S` 00 0p@P  P0R00P0  ЍAO-QM⨠崀:p0PS5` =@P0 @@0 0B@P⒟ Ѝ 0` f0"00  P 0 0 )?oZ20S@ @@O-(DM  0!% Ppa B, 0  0p ,`(P$  |-0 000@!<.  -  0 04p,`(P$ @\d-+0$ !H.  6 / 00  4p,`(P K- 0! @vT`dPT`0PU L0S$0P@ @`UTPO@@``c`c@-` V@Q,  0x0@0C0000   0 S p@bbG-@6`Pᰐ1qS21 0! 28* h R R R # oʎX0@00P0#*1S0Ap@0 0@00002S0000SPGfB000@!Ac@-@0( R (   B "R  B  \!RA 4. R!R b /o" Q AG-0@Sp00SW G SP0` 00Q2@3>` T`W p KW 3U  GP 0STcb@bp@-@Ps p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0-Ap@-TPC%0C0\0(@T@ 0S 0AAXp@b@- 0!0@@@b0  /LA0/000S/@- 0@x ЍXdAbb00/00//O-H`Q@S 0p0202  [0n=3" B"2S1 ЍOp `00S: ; 0  [ :0 40:V 00S 0 Ѝ@bAG-P@0 psp(= EY bUP:`P WVV `X = 0GE;=0 X<0 @bQA-Ppp `D0@c`  $T<@@bA-P<`@ @V`f:pX# @m:0 "S V@0 A:Y:p@-P @H0c   0S@<p0 S p@bP/0S#/P/ 00@o/@bP/P/ /p@-@P(v@0000p]Ӆp@-@Pv@P 0000p]Ӆd@-@L<dPG<@4v/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` Z0 P 00 000 0P8?o2P0SP00S 0@ 00再03/P c dbݟAA@-Z(A@-P P d`jPL)e Ѝ $;[Vd@A@-DMꌠA@-@| Ep4Qڀ  !L D<, !  +)꿠A@bd d$dA-P@Mp1 p`@T,0@400000 ,00(00!0$@ @ @00 000'>0<0 @P<0W0 00PSPDT`@ЍXPp@@bd8r4dC- LM0|0 0<P`pA0D0a0,(P$  @p 0P  ⷌLЍD  I    '. a 0,(P$00 0S P X⛌PH0H@0<0pP ,<厌PU@dAb AbAs@-`P- 0@T T0@T  S  0D 0 0 !P, a Mo`Ѝpdb¡Adh0#(1< /@ ρP PQ00@0!!#/@b 0S(0, 0 (0, (0, 0/ B@- @ 5P 0S,031!10P@bp@-P`|@Tp 0SP0 `00C0A@- Dp@-Q@Z0S P0S00C00 00 p@4 \/dp@-@dPvF⺬p@p@-@803Q 0dP 0 0eF⥬p@b0P/ ad0S co `/P0`o@`/p@-@00C"0!300 P p !A\  Q` lX000PUR0(00@@@#pp@-@P0M  0@0@@@P|必0t` 000@0@ @@x㰅85 0(6 $Ѝp@bТA`y4Pbc@ac<4x4p@-4` Q[ apT0(@  0P8+ X`Pbcp@-@[9`Pp90p@ 2Pbcp@-4`8SpP0P @  +W084@p@PbcO-04`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@ @acAp@-@T 0 R X0 iPP T x RW0000@pt B0Pbc0 0S/0 zPbcO-pPP`@U#`V0[00 U00 t  W` @T 0S V x B00p@-@0PQp R00  3Pbc0@-@PPM RS   PP P 0   >PP  E2 1"  P0E"0A 30Ѝ0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@M04`pP,0 000"!       P0?S$P(P,P0P4 PЍ L0QQ 8QQL02 SR|0p!!!!!!!!&0S ЍA@-Pa@87i?,10!(1T00!41  1 00000110010 0 ]@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0 | A10101A-0P`q ( @jT  0*@P 010 10010@-A!  !!! 1P $P &A-@ 0S Pp`P0 8P0@0D"0!!#  0SW00S@ p0>S? 0 0CS#0T P@G r 0 S 0 0000@`S P@@  @@ȢAO-Z0M0C01@S FⷨP3 1,<00Jp"@03 qp[`) `P iP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  0P pQ   BV *V .`P [3  ~@P gP5 0@; B "Vx1Sp` 0lT 0p!x!ZR|||!xatZ0SP RU r50|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R /1P0jWТAacacG-P葐lp@U" PP1@T' L0S` ZR` 0  ``0PX P@T ,P @TUЍ`0SL`` 0  ``PX Z0S 0CSPd@`c`cp@-xM@?x ` PP?0U0000`0 0&(0$(P lP, 000LP0 fBxЍp@-P0@1P00Z00l 0000l@ uA-p`)@T$ L0S!P0S[@]0SP`PLU ,HUVA0P`c`c@acG-1`pAZ0S'P\W lP'0SP0SP240S|PP0S G'0 QU 0@b`c@ac0@-|M@t P>00P |Ѝ0p@-PRQ0@2  0$1\ P P P$p@A-P`p@TW [0  d@p@-xM@`Pt Q>0 0 0`xЍp01 10/O-`P1Mpp0ALHFP0  (~qSv54c@㇒) l 0R[0"? R (`pap0` 1RYR PX 1 ` ^0% ЍO/0G" 0# ?o\20S +d20 d2"ЍO]YP k` 0 0  2ЍOЍ`cAO-p1|MSA僿P0  hXN -Tӆ%@4|ЍO R (alSt m=0! Rp 40堀尐1!` p$Q0  kWld`0STP 1`@T 0c/ 4/|Ѝ崄@b`cAp@-@HP`A?50S xp@u@!p@}`cO-p`PA$MZ0S P R U 0 gSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000qPP,P04P03ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` P !!  Rv UX [  l Q W   0 0?P}vPPP p402S SU 000 000 000 000S0X 1J< HQL!`0S7ڠ01,0 [ Q , lP( $0 ?PP01 P072Pqo @acТAA-P@q` 4Rk` <2! !! ! ! !! !0  E2 1 U"! ( !, ! !02A0ТAp@-@P8`0` V` Ђp@ &ТA@-APP0  =P08P0庽B   P!p!,' :P0|`V0S 0 00 00C0 VP08P0a7P0倽ዽ/000X x;0XHqL1' 䀟P&  03/`00S P ;}z?V` 0 t`{aVP02P0P0 :P0Z`$gHARAТAMcPb\AAC-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  ;` RfO1嬁p0P [ 1 ` X 0 8/Y/ gP  0 Kx |Ѝ@bp@-@ 314020SS \4Sp@ <@P`7Pp 03/p@<@bڤAMcp@-@P@`$PN@  03/@(pLcp@-@P@`PN@  03/@pLcp@-@P@`PN@  03/@p@Lcp@-@P@`PN@  03/@pLc0A-PpZ0P01P0?`0Sl 00C0|@Tͻ 0SP0 ѻ R AV   ` p000G-`1SxMpA 1 0t $:001Wpp00 0 0$00(00,0@ 0:0( S :P0  UᢿH0 R (! CxЍ%@ S]`40` 㠐p0`1R0N P 1 `@T 0c/ 4/Z@bAA-Pp@ ᰻0`V S R @0៻Xڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/@bd d$dA-D`DpP@O0S h00U@`00bcd00/p@-0@00S00P00R -  P 0Q 0 p@$刺b 0 ~&0C0d0l2P / q20 0`p@lAp@-P@ჺU cOp@-TC\  P 0 P  &~`@32@bp@-@P R` Q00l=#0`PP0 % p@P0=P0/G-1`S0Sp YP@F DP@@D P @P0Y0>00P@ >U ||ЍQAHP!LP Kp p|UKPKHy| =KPKn|AAAAAA A@-2@M` T} 0  20S& GP B0 rs |#PPP  40T"0 !& @0! 0"Z| @PPKPc'>P@% KPVKPQ WPPM pt0 p(s`+g >r)bV9|GP4>T cK P`PZKPWK1 40 0000PsQ0FK~`KP ?a~~ЍF=0l`0`)K@&K7:!#: $ : 000@0td:cd;c$A)A0Azd@3A8AEAHA;cO-@0pSM700770S >PP7 730:TQP>@NDPP 7GP0ST S\70S ~?CSpJPw,0 000000000T0 0 ` @{T J9{JP a2{0{.{(g 0P00S J ((DQڧ0 0R`A*S 00B(0 0LPP0 0(0CPP 5  J 0P"zZ [Jzz(!`PZ D%0 +l5 006 #:: 0 $0 `#4 1hV(tFP>   0(`P " 4$00[.Ȥ z(P0 TFPX4$ J@PXJp} JP 3$?a}<4PC`D R  *FP hP(!FPP(FP (BC0P D R]zx3[ WzPX(FPD0S THzh 2 f+4?z30S ЍPU:T) I NPP"IlbP40Lb I w bRWPI˱Q PV0%Zအ Z PP  PsIPpIV0%ZZC  0PPa " QI@PPVI}pIP 81d?a}|1Pm 1 NP0 `y81PU 0P0000{(!0 Pt (M20*6 0 (1000 0y(uPP( yy007;cd;cXbRA@bUAYA:cpetd]AiAEAvAxA{AA$A:c4 cJAAAǦAdAAAA AҦAAb/A)A A/ p@- @RP` x0tPS|0|Pp@jx0Q0R h R t|0 p@tP|0p@-` {P0 0 00(0 0"E S`P  BPR7  `[ ` ,` R)hX&d 0+0!0`PS0P  P `Qn +0Sx0S0SI80Si6Pc X  S0Sx0SH`P ;P`0S  pP( `P*,0AP ?[  ` Z8ER*"`0PE,0PUx0S `0 00 0P S0Sx0S  Ā0 pP 80z4p02` 0S c:00S0P0 `08$ >$ 0l*`0 p0p0QS8哱080`04  Rp B0l=`0 M*`0P@4 YG 4 8 + 4$ X@P0 4 G 4;00x0H00800P@T( 0 SQ0 00(0 0#  R0 08P@Q ` 8,P 0 Q:8 R `8  P0R: 00S 0S S`000 S`000&#`0dkd00`( P0Apb?AbAO-M Qp0a4S  !qЍQ0sVz@0P@T0p 20p} X 00 1$FP` ()84匐0尰 ThZ `0  ]Q4QB P 0P 0  XP X `  (=4 BQ  B8` B x<4080CSE+`  T)P4@@DT4@8}0@8@0PPU(00ZAp00$0( {0 000 00 0mPo0pujYS 02<P0[ [ @`00S @8! P08004Q (0PvApbO-$MXp0 H$RLPT  Np@$ЍUQ RQX`Y`X00S0p``V @  0 0 0Rm@P 00 00000 0Cm@P  00`0`S@90SY @0Z 01 ]@P 0H!@00CS0 U0  @P00 U0 0@ ῃ UpP @~ 0 @P ᑯt0@S@T@ U@T ᆯhU  <0 ᖃ U* JC(rꞪAAs@-@PP 0 <0`0S 0 EЍpЍp@ dO-M00$0p0尀`$R uo Ѝ0SQ0s PP  0X8@00m (00 0$P 0Sa V `40, [ S0 0 0flP ^ `0K$P0S ( S2   0P0S0p p 0 V X0S 㽮Pl 00 ;bP\ ή(00 XP î0( X00'000V0040$ S4r  ,0RX0 H+t'XPP0 00W0(00 000C0 0 0  S "Pw 0 B   B p$0s) o$0sQ0` ^  RPl V ;(07(0倠a0 00000 0kP`@?. 0  P +'0ȪApbp@-D+<0<@AO-MP 0`0尐崀$R l@Ѝ0S@Q0ps 000 00*@PH R Xp40S& 0(0PR 0P0S(0R 1 1H0S G0 0B!B P04800`08 ## 0S PIQ Y0`00000P0Vp` SJ J@ȪAO-@RYM0Pጁ堡1 @T=lPl R  U Y ,$ .0 @ R4  00pwp pw  0>! a v```P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,kYߍР010804 P00F0p<0,MP`Bb7P H1R0!sR g |kPP1 00 400 80@8@UpP` `84p40SR40 8✦$@TR4`Swk` `0Y8 @T2@P @P(0S1S X@T01X0| 4p@Pt  28X@070l@ #00 0@0QP P0S p0 0R  O 0$0S !0(0, Ī0P$0 , #$0 ! 7ժ$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@jvP 0p 0cAAAѫAA-C-M00( 00P00q0PE 000 0g@P aT@ЍCЍ/ S?@X X` p +#4X001 ``\    p @`$0$@JBPP804 \@\CRQ f%PU Q@R0 0P @@`  R XP L0@3$@P 0$ X37 0 X@' A-`1V`04S ,jAPp`8@T 00S8@P 4p0p8pPPUV  0P ۩0p0 XP өXp`@4 802#T*0 R0 R P8@(dpb.AA-P0 i0 p RAi sA S s `Ci@Hi@,i@0piTSAAAsAAO-`PM PU (4` I" Sus00|Ѝ    p @$G 1( P,00 00J P 0 10P0 00`0 0@$0$ C 00 0(dC-` $MPS@p@ ppY 00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`9i00 T @00$R01 @00-蛬AQ|O-//0 R/ 06S/`Upb4@- 0 d Ѝd@-@0 00 #3  0 0 0 0 00   0/@dp@-P@03/0@0pp@-hP@0S03/03/@p Q \ :$0@cA-@0pPP`@0V P0ScO- `0ptADM! <0 0,p(`$  @`P<<0 SG 40p0 ,00!1 0 0 0 0(`$ "<040p0 ,0@0$00'!0 00 0 0(` <040p0 ,0T0@  00!0 0 0(`$ @DЍ谬A 5X5DdO-lQM @p@ `0`0` 5@000 000 `0@堰0poᨂPX $pP V 0S宱`Vp00  0epP Ѝ3pP$`03/03/`0S ɱcT[cHdO-в$MpT@P0P0P 40PS 03/0 0 0 %(,0 00#0( , 0$ 0 0$ 0S 3/ 0 00PPEUPa0 0UЁ%1!80 SH4 0000 l?;#;0 #5;B%!!   QP h0Q 0 0 ]000PEP0PY3O04`0P`D0 $V0Y@ 0D00;@倠8D`儐5@P00SP00P0$Ѝcc@Bʚ;@dO-M0 SQ廰@0pP?oU20S@ ЍWp@! ! 0 0000pg [`0P0ϰ 0剰0S,p@I$PHd@dc߬AAݬAp@-8PD@tz@`D0Tpcp@-8P@th`0Tpcp@-@PTp0/cO-0夐@crW 02PP 0С*0  00#0  0 0 0 X P0Sr@bc@-@  00Ѝʚ;@-@  00Ѝ@BA-@0pPP`W 0SV P0ScA-P< O!$" (@,$[`3# 0SP@S  "! ,   ` \@  ⚮ R   4 0 !ee0ЍHd Kc@dʚ;A1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P0a0 0 0P0 R00pcO-@Pp`.0$(0,0 0#   \$0 $ $@ \ 3 Q\ P0 00"0(00(,40$P \ P \ P 0  L P0@ rPpQ0 jccʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P0S [$000Stnp@1@dcHdp@- xp0p@Q0}/’\ \#3$0'P- 8@#4se03/p@0/HdbMb@d@BcA0S0/0G-P@M@(p(0< 0800,p$@ @@ @`P0 P000'>0,(p$@ @ @P<08 @ЍA5C-Mp 0@P`` 堐/t0 00  00P 0 0f?oY20S 0S0ńЍc80< 0S 800< /cp@-@Y@0`0@0c,PU 80< 0 ቬbp@AcPb@-@PP@J@-P@.`0S 44q4a 0S@0 Y( 0R0000 Qvb0 ^mb 0SƂ 00"#! "#1bP[3 $103$!_(0 3/0 00000@000@bcMbcb@-d A0p@-`Q@P0 +0`, @bup+0` p@6b1A5A0H-@`,M0尫P0S? T$PU? ,XO80< 0 80< ܫ ]P@ aH  @R ppD ̱00P1D Hp{W  ] !0 Ya@0Iap00 0P00000pbpm7ᏫN0SI 0R 0(0 0 ,P0$  R 0(00$P 0rc7Ptbj)| Q 0   PcbV넆c9AAA(5bC-@,MP` 0 $0(  ,0p@0000 HPD` @Xa@U  t000000 T0 EPP Ba֪,Ѝժ00bWA`A!5p@-@`PP9I PpP1I00p@-@X0M 0@0@ @@@ a[  00@@Ѝ@薪kAchdc0SA-@p`ᐪ@Tʪ`H Ps@P `HH0V P@v@0T@SP P0PT TPX0\ P0 X0\ 塪U `H@@H V P@hdc@-@dMX0\ 0S X00\ @P0ST T % {T@`Hꀆc0SA-"<p8`)@T cH0P!`P P0S OH Ѝ0V @@0T@S 0 |0P 0P0 T0 0 ,U O[H@ V @hdc5$55ld@-@hө0 0S 00 @0S   $T[O@/Hꀆcp@-@7OPGOpp@-@PO@p0-@- p@ 0P` 0`0`00_PЍ@Ѝ/p@-P@䇩`V `_ 0  0p@O_ 5tAp@-@8Pՙ 3 $!ۙ5`00p@b0S/p@-P@r5U,0S  (0 0@0(0`p@脩0 0R0000 000 @0S  Sp@-0P@0, 0R 0(0 0 aR5Pc`pp/p@-@PPp0Spq_@-X0@SHe@ ep0S/ R/h l00hpdĆc @-(ܨ 0   V0cpd,5Ćc0 ,P100S//èccA-xM⻨p`@TxЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x t0000x0(0\0\P0 `cpd0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0%Z0 0000 0@0[P H0L 0P0S 0003/(@ʚ;pd0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0S&P 08gH \0AQ00\0`0S;,Ѝ06p@-PiF 0@   S%0S@#p VF@@- KPcT@-@ eP Ѝ \Q?/ɚ;0@-@MP P0 Ѝ0P@-@ P P0 T0S000305: 0$APʚ;ʚ;@-@ PQ  ЍG-p`@M00  0`@GeP <PT 0 00 @Ѝ R  T@0@C09#PPPU 00Sg  dP $ 0 S (0@P0R0P100Q:UGeP !S R(QQ\( 0 BR0 \00 \0 0 Q R^ 0 R R 0u{|Aʚ;0@-@,MP P0S00 0MPQ 0 P,Ѝ0p@-@(MP` 0P 0S000, PQ 00 00(Ѝp 0P @- R R S12S1`01 0 Ѝ@-0@SM 0Q  00  R P Ѝ0@-R@P$M 1` lg]T U  tP  @04 S#*/00$Ѝ0脮A@B@-0 ЍA-@QP  0!`Ap0 R pW=) -` p`FUP0 S00 10\00 1 p 00 00\ @@S0P S0."? AdHd@BZ{c /pd?B0p@-0M 00000` 0PAY@PP  0P@0S!Q Q  @0ЍppC-P `0EQ@P XP\ ` f HUp0Sp0 0@S((0,0,0p0 p4/5pdxd0`0X00CS/@-@8~X0S000S(0S, , " c@-@X00CS@<0@-@00S &R, l00& 00@CpdA-X0@0CS8CPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0cʚ;ɚ;6ep@-P0S H LA  R5k9 SAUt $\RnA#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A: @PA@-0 Ѝ䰌 A-1`PU 0FS0!RX00CS 0S 0SxxS 0oHHL@LpH@L@PPp^P@HL@P0ɚ;6eO-4MX0YP4Ѝ0@S`p=aP9aPP`ATPW 8H0L 0P0S# X 0BQ%SR  H*aP H0 L0 H0P L RP 0 H0LP p YS ~ H&aP H0 L0S H0P L BRP T0SH0LP0P0S0 $0P0Pɚ;6eʚ;p@-@HM` >P P1U(P0 0WPU (BHЍpp@-`V 0@S@@P(P'p}"p@-@ M P  Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M  q P $Ѝ0Q/ЍO-MP`_P_P@p0 0PW 01S 100[%T ?@W DpU0 @ U 0  0t pxP 40匐P@@Ϡ0H0L0P #0 RQ @ U U% p FT#>H_P H L d0H PL QP H LPV?6eAɚ;C-P`U@p,M0S U P ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@bp@-@`Pဠ0SpG-1C0(qs@@XP`X R00G覠 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#3:xP(A Ѝ (($0PhW AAA N5cA 00(1 (  S !$00/@bc00/A-@p`Pp ` Ap@-P@~ p@p@-@v0 0  P002%pp@-@Pe0 0  0000 T  ,03R pp@bp@-@`PD` Pp@@-@=@$A@@-@40@@@-@*@@@@-@!@A@@-@000@ٞp@-t1(A啞 0XP0 0!` \ \\dPd\`dP:C$ `C/!P \\dPd\`(d( &C( `/!P \\dPd\` d # :U 0D P@\p0P HLHPLTPTX\^X05\5 0HAOAdA-`@ 0 0qPUT9@`p| Wp0SPT 9@d O-2DM0 S@3 #1U3`p\0A (0a800,$  P000㈱|< 0a0,8 ($  P0000< 0a0,8 ($  P000< 0a0,8 ($  P000< 0a0,8 ($  P&000L 0a,($  P<08 'DDЍO-3bdoAf5Db5O-p@Mᴰ0T` lPP(`` 0 X -K*AXX 0" 00 0000`0 0=Ѝ@THA@-@ @@-@@ @-@@G-@pP@B $`Y030#T00S d`4!M8#8#40Ѝ/@-`0F S#*@\Pb PJ0 0900@0<< 06P@TЍpA-@pD`@DTP/J0U090E0U@000E-0,M$00 0 00 00 00 00 0 00000000 3P,ЍıA-,M &  O,ЍA7@- P@0000#4000#40000 P  S  Ѝ07@-P@0          00000 @  S  Ѝ07@- h0Pb"@!4b4# 0GD000 P  U  Ѝ0s@-P@`  |0b"!4b4#00000 4"400000 4"40000 @  T Ѝph R/!p0!?aAS/G-0@`pQ@M(0( <0a0,$@ @@ @<@<0S+ 0 0 ?A1c00 0 0000< 0a,($@@ @X0P000a0,($@ @ @P< @ЍAbgfffcl5@-p0@0PP`M:? 0` 0 P 00 000000Ѝ?cb1`SA-@PHpkPUTPE 0-p@-0@0p00#1R m p@莾3Sph0SpS @0@0 P@00@0 T RP @00@0pPc@b@- 0@ CSR0SP D0@0\+F@ 0 ꄼd/ R/@-@$0 B @ꄼd@-|@Ts{Ah0S/@-0@; S :#0b@i|000000/စcA-P|0@`l0` 0|p BG0S `|P>0 00C S :#0AA ꄼdc//00/p@-P,0C%0 0 S :#0p@(@b//P P  P! // //@-MAA-@P`Tp` T T M`0 0NA 3@0<01 00/p@- P  @`\ QP00R0S 0S S 0CS 0S S 0jO@ Tp@AA{A0SFA-b@0PpP TUSQ #P RR  BR R R  P R @  r  r   0 /A@-@w @- 20 2O-M0l2lb `0`@` 0 0L2LR@P<00P00P0 2000 0 p0 <X< W < <<@ ЍOX < Y 0o㫲0Z* RR00@R0S2  R0S 0„2 @Q002  " P2 0R ;00R 000 00S 00 0@H 0 S0A- @`V?000Q|LPURPU P   \<,  \0  @ \@0@ @U P  \ 0   \0   \0 @U P   \<,  \ 0  \0   \0  \0  \0  @ \@0@  \0  \0 0s@-@0@S`GPm0 @0^ 0 =Ѝp\\ \†$$ \0S!0 CR.@-@€0SS 0CS0@S0s 0s 0"P0,B0S2 RQ P/ͲA/QPG- p@@ `P7/P @@U@- 0@0 0P DЍ|~5@- 0@0 0P DЍ@5RPA-p00Q0SP@` @ R 8/P W@RQA-p00P0S`@P @ R 8/P W@0 0S S :*\#3//@-@Q 00 0000P A-h`@pPUpW0P@@` 0RP PcA-pPP0@T`0S  `0 RdP @c@-]oO-p( |0Rx`P@P@:/@P 0 09/,JQU 57/Pа6<6زAAO-Mp8 Qܠ ` PU @ 0  7/PP 0   pF P :/`J VЍ@ Q `0 9/@T*W @  pG1S @а6<6AAp@-@P 0R| 0 00 0 0  @  1 Rp! 010 00p Qp0cp@-0P0PT当P@0 0p0SpPp0 0  cc@-@4墓 ,0   @ @ @@ԓcc@-0@ Q @2@f1p@-P“@Tp 0R000 P 1L2 L1IeHPl0S 0KD0S CD1c7Ap@-dR`P(@TL勓! R0,0 ( 偓 03/1:dc0@- @T0 Q P^KQ R 4VKR        dAAO-Mp0 0R8 `@P4 P[EVP P  P " 0 00 ;Kd P  < P 003/PЍcl{5ܳAAAA@-D@0S Id (00 !@dbMb @-@o00 00000/c0@-@M0 RPU0S0S   Ѝ0 Q0 PPp@-@PP`D p0 RlP @TA-`p@PPPQ 0 R NP0s @op@-P@Tp0 R2P @ 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d@-P`p  Q0SOJH@0 xPt0 hPd \@\08< 8080H@0<0V80:][

pPR @> /T`@ A@0@~0 @H0@~ЍpcdOA5@-d@0P V0P H G0P K0P  G@/dZAp@-P<0@Tp0 R3P @cA-Pp@P`  0RP `VX00PW@ G0S PP00c0@-M@PPP, +0QPaUP 0S   p00S  QR000 !R  R 0PЍ0c @-@x0P@tp@-0QX0P@ @0Ppp@+'Pp@TpcO-,MP`PC MpP> P .Pf. 0@00尴00a00h0l0@P0<043\0 0PpST U0Wp00 01S PU 01S PuG@,ЍpW1 00S00C00 00v .1 0S 0R df .P"!  G!00S  S0 Sp H0p%0%0 UC0PPC&P PE0S *H 0%0"0CQ 0 ܏\EF$0  X0480080<00<00S 0 P5.D0 D 010 D!50H "HX HPep  .L.00SM % PPJ 00 X1 `P. 0S  0P0 epP   R   Q 0Z lPYC  LHF 0A Pc@bcA̾AƴAԴAAAAAAAp@-@P`}0Pp p@0/A-`0@Pp t Q A 0P1 P P O-`p0004PU/Y Ѝ@0SP  R@ 0S 0CSP  0\P tP [ 0 ;/P cd0@-M@P Ѝ0O-@P`p||0S Ѝ P @pU 05/T O+Bd(c@-@ 勎0d000E@ŽdA-X`P>X A/p,@,s,0p P0@,@A討cd@-@<cP0 SP T0 0D X @T@D@@蓎dcp@-40SXFP`,@4B00(0P `L  @L@p@u,Adcp@-h0P0Sp@/`,@4"00(0` PT  @T@p@UT[cdc@-@LP00CSP0 T X0,R( X0D0X0T FE@;ddcp@-P`@Tp@p-V0  4 R SD    03/M, Ս0@dp@-@$PHP(p@cp@-`P@Tp{ R0T0 L P 03/<0( F,埍dc^AA-0P0`SxpX@ 6/P0S 0S @T+@\0` P0\dcA-BPoA@0S-娍Q0SK`XPUKV0Xa0XPI@L1@0 X $O0S PC再T!TA0B $CAp @0R :<RP!`%`56/@@T 6//0t"#0C6/T@3/P0 3/P` R0\0  }+dcH+BtdAAb6X6AAMbA$0$$08S 0  td5ddp@-@PHT 0S 0AT 0 0 @pc@-@LK,A-P`njŌU㰀q@0S 0@T 0 0d0S\0S #S`0S (0C圌dc@bG-MP8 `p@PHD 0S0 0,20SV 20SR qCVQ5QE0E014XXpPt0 00rA0 03/HHT\C4傌-$?P`{V<0ID77[VЍE D EW 7/pP 0R  P0 4S 0S pAdT[c$Ac7AdcdA.AA- Mp` P @P 0 A@ ЍU H00S <00S B5/ 1p9EdT[cزA@-$M@P8 `py0 $Ѝp@-PM ` @P 0S0 0(0 03/8冋00\0B 忋jЍpddc L0*dG-@piPPU`0S23`0p0APP \嗋ULR0 0 4勋$J(`PB儋PЍb000z=0S0S<0K 0SH 3/PPD0e0<00<0!x!L0z*hZ4P 0(0S 3/4Y.0S  D0`0EB;50U0C0   S(0S%_-P  CP  0R  P 0S0 4S "+00d@bcdcAWAp@-@Pp@A@-@P 7@-@/Ѝs@- P`@P 0 0@ЍpCꐶA@-@P @-@=P@@-000 Ѝ{5@-000{ Ѝ|5@-000 Ѝ=@-000 Ѝ\= 0Q/P /@-00 0XP Ѝ{5@-00 0NP Ѝ|5@-00 0`P Ѝ=@-00 0VP Ѝ\=0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0͉<0`0<00Sʸ0Sp@A"@@-@x0P|0S@/|/A-`@ᨉpȀ<0P 0S#Q003P0 000?00C0@lj@bp@-@Pဉ00CS00@p@赉//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS A1'0`S0Y030#@D 0Shl`}W ' P0!!0A-P@l`hpT1S S@ R Tjh@l@NA&1GQ @p@-P @WPe0P  $     PU $  U p@p剈Q P  80R 0 Q }P 80R 0 ccp@-P(0 0S S, S@t@Ypm@P`F`i`V80S@[@P``W` 0V80S@cp@-P`@P P p@@-0@Sl00@s@-A_P 00` `@t000TЍp L@P00P@@@dAA@-@8@x@-@0塇,0@T   B B  @ԇccp@-M` P@P U 4 @Ѝp R 0 R G0 QS8  %PPPP cжAp@-MP` P@ Ѝp U @P C-Mp `@T ЍTPaߍbpTUʀ 0! $!0!!   !r3W@ 1r8Taߍ@- |!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`- B0zDcb(d@bd d$dd0b@-$008 @{HH Ѝc@-0( 0 08 <HH Ѝc@-(0  08 @HHЍc @-6~ 0cc@- 2~0 @i~ccO-t2,M@T@ `P\~50S DU~%@,Ѝ050404080 80<0$p<0@0H@0`0S^5~@H R 'BL\0$ R*0Pn#TH H L L $ p0Nc#H00H000W:0H[ ~P WQ*HM&0 0S 0  BR %0Sk) ,0 0{ 0h?B3cPÿZ 0$ 0 ?p,}(@RqT[cccMbA-\P@`T|}50SA<}$0  B2#Hp PDPccp@-<0@P4`}50S DQp@}ccp@-80P@0L}5@T}p@ccp@-PP0P`9}5@@$U@T ,p}p m h}pccA-@`Pp}500#T0S lT}$ R$ .HJ0E} HU 0ccA-`x0pPp|5@$V@@T L(}0S0!}$ W%H }ccp@-80@`0P|50Sp@}sccp@-00@P(|50Sp@|Ecc0000/@bP/0S/@-0\0000C00S P 1 !L0 @0C000P0 p@- R 0@ Rʠ4PQ BP P0 h00R Pp00000C00 0C000 0 pǹAAdM> S$ @-0@(M0T (Ѝ@賭l03100P (Ѝ@c0 00!4 Ѝ0 0  (Ѝ/dM>@b@b S& @-0@(M0T (Ѝ@腭t03100P (Ѝ@N0  < 0 Ѝ  0(Ѝ/dM>@b@bG-p@ࠟW `PU0``0C00S 0WP1R 0S0 P0pG0000C00 0C000 0  cdM> 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q  0R  ^P 0 @T   0S  R `F P0 Ѝ  dM>@-P`p᷈@P0  @ Ѝ@-P`pᤈ@P0 &@r ЍA-@`p:{ĆPPds{@Ѝ.{၈@g{,e{T0 @J`c\ @\ QG-`p0S0 0@P202O@P0 Sh@20C22S ㆺ1 0@b/ /(/07/>/M0P PЍ/  /M0PЍ/@- P P R:H0R 0R  0RЍTVRPA-` pP@Tl@lpT: X@0 8/P ЍPP fPkBkB0S 00/TVRP@-@ 00Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</0S= /<!@o/D0/P@/@/H/P/P/@-oP/P/@-oM0 Ѝ/   /@-PMp`0 T@PV 04/Ѝ@-0`S@ 0S0000000HPP000 @0100Ѝp1 0S !S_.B"B(BPP OPT10L1P) =3;0P? 6;0P+`V) 0P+ 0P`V 0PD0S :P |P  +00@T Aatadrbmngnts@-P @$Mp`(TU80pP@ 0$Ѝ WP0P@-`Pp$M@  p PAP $ЍPUP~ 10SvS q00T00p@-(MP`@ ` Ѝ P(0 0CS"00 "` UV000! R 0 1   0RS "(ЍprbmnAp@-(MP`@ @` ЍP 0R  "30%(Ѝprbmnp@-(MP`@ z` ЍP0 0CS00 "` UV00 (Ѝp1  0RS "rbmnA@-0 0 0  00 ЍdЍ$A0@-@P$M / PhP$Ѝ0@-0@-@P$M  PRP$Ѝ00@-@P$M  PAP$Ѝ0@- Ѝatad0atad@- Ѝgnts0gnts0@-,M@P 40P 0PO@o,Ѝ0loob@-o@-@ P@Ѝ@-!o@-@ P@Ѝ@-0o7@-P @(PP@ Ѝ0p@-P M@`$`P o Ѝprbmn@-,MP`p @0p ЍPP@,ЍrbmnHHH|HHHHHA-`PpP P1 10RQ0P W4 @0 00RQ0@ AV ` 0  0 0  0!W\P0 00  0!V@%c%cPcTcd@- w@0~-dHAO-M @ 8PRP@P t`w0ZV 0S $4$0S?0 SJ;- @*Q P 000V 0S000S00 0R0SRV SR !R @vЍ# !RVO!RR 0 S  X 0S P  0 0R P 3 !2<0䲟 01S  0  a0S "2"0S 0 Sh, @!RR 0 S  0S P ܱ 0R P 1 !p1<0儱 0Y@  q 010 0r 0!0 S @K P%  S! "+0 0oP}  K㌰0 +P X00 P 0 0 0 0  @PcTcd%cD+B%cNATcPc@+BxAXcp@-@Pu@p@udqp (0 $00P00//%c%cqp (0 $00P00//PcTcp@-80@P(00Pp!Rp%c%cp@-80@P(00Pp!RpPcTc@-@fuT00Sڰ001S 000 \^  R @Pu@ 0DP8AT @tud%c%cPcTcPcTc@-@P@P'uL0H0 0P@\@Wu 0dPcTc@-@P@P uL0H0 0P@\@:u 0dPcTcO-PP' `@pt0S000Z.  P% 0 R 0 B RPUluPh00S\001S V  D0@0Dt ЍpdPcTc%c%cO-PP' `@pt0S000Z.  P% 0 R 0 B RPUltPh00S\001S V  0@0Dt ЍpdPcTcPcTcp@-P@ TWt00S001S 00 0P\ 0S @P@lytPp 0\ RP !R P< J4L @`tdPcTcPcTc%c%cp@-P@ Tt00S001S 00 0P\ 0S @P@l3tPp 0\ RP !R P< J4L @td%c%cPcTcPcTcqpO-p Ѝ A Dp.10T00aV` .V @T! 4/ppU $0`Tx0 PU QU $@P 000 0;/ 0pS  D+B%cd%cA-pP`P ^ 0pA/A-pP`P p0A/@- @P00$0 0000/cA-pP`P p0A/A-pP`yP p0A/@-kP(@-eP(@-@_0P 0S @/A-aPPP a0A/p@-PB@Pp 0Sp3/pp$Ppp@WqpO-p Ѝ A Dp-10T00aV` 2-V 0@T! 4/ppU :0`Tx0PU QU (4@P 000 0;/00pS  @+BTcdPcA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ P@0/@-@0P 0S @/p@-P`~P 0p@/pA-pP`oP p$0A/p@-Pa0P p@(0/pA-aPTP a,0A/@-GP8@-AP8p@-P;@Pp00Sp3/pp4Ppp@>/ 0 6/O-@P(0!夡M#&0 1 09 ⃡p@Dtqa` h(dq0`P@0 0 007/$08` @7/8 03, 0.$ 0ЍO/Y`_ 0'7/#$PQ,7/Ѝ<6AԦ6AAAֺA@- P0Sp@-@`P h4qt 0q0|0x0X0 0\0`dPp` @-@f@ `A-@tP`pqP@T @ U@ 5/@Bq@-@` P 0 0fj@@f@-@tph@p` ` `r ` G-<@Y800P$A`Ϡp ? V: `V p0 W$PO-@8<M Q00Ѝp0(  R:8 R ( X`Ϡ !R F f5 $8 0  / 0?V;; 0 4; $U *PU0P  X$P f PV FP< Ơ8Y X` : 0X*0 600 ( 0$8 0p@-( \:P80S @<4;$< 80(0$00600<08A5/p@p0@-@MS 0 0C?o2P R R R4 R1 @Ѝ008@P|@P"080 S  `"008S9A AA-hfMQ`P! Q4 Q, sv 3Qe B3Q ,7C0CQ 0Q @tpo PUV` `oVV@ @wfߍ00@ <# T2QQ1 f/ (R@E/2QR 2Q 60Qr  5fߍAH1Qe  (fߍAFQf/@ 00 S0;30?`aV! 0S 2     *! R R 0S fߍAH# I vH<?`P3a:@pVp 0 Wp0pGd @]d@edAd@edA|dhd ydG-0`S<$0@b /o bX c0?o 0c\0 P$0 ," S  R Q t$:8!p  R ("( R ("($ R 0< R @  pV  \jU `  n 4VG\fAwAAAAAAAA0 60/80S/p@-(0@S ;;S0`s- P S  R8SP peo(0aSR a#"P R 02UXf/_p"2P 0R*pWEVs@-P p5 `@PA@6 #:@$:@ P  &tZ \@P TH034( 0&#$H ЍpAA@ 0p@-M0@P0( `*Pk0P X <2 CP*P0 Ѝp00 0 Pzd@hd A-0(M pP0`@P. 0 @P&`'d0' pp)q ap #@0T p#! * * 0(Ѝzd@hd =ADAp0S/@-l0@ 0P 0 P0p0ЍA@-`DM@PP `& l0 00S p0StP p0pS0l0@0 0p0,pP$00004Z`P0tpt0DЍ00@-dA-@(M`1x0P |PU0p SZPU=p  0R0 00?Pp *+P 0DP0S 0P=9C =CP 0x@(Ѝ@BO-@,MpxP `|倠PY XZPU=  R 0B000?P 0 P0P0弰ZP=J JP弰xhPl0PYp``XZPU=i m 0R0 00?P `0 P0P`<0嬐`VP=iF mFP嬐`h@,Ѝ@BG-@(MpᎴXh0l `PPp0`VZPU=i m P0B000? `0 P0P`0嬠`VP=iF mFP嬠`hX Y? 8 < 0# 0$ 0 0$ (Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /p@-@P@|0T00  0pc 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d G-0 M P   @ p X@`lP X 0000 ЍG@1  @PccdA-X`PpW0S8 Aq P@m@cdֽAp@-@P0 p@cp@-@0PD@Tpc@p@-@PDPpUp@00@p00S:t/c00S:/c00 R !uc0 c0 c0 gc"111/"111/ 211/ @-L0!0\Q S0c,0 0R/Q0 /c@-0 vocD0 0R/@- 0Rc <0Q/1S co `/ c @-@0^1 0 co ` c40@0\/@- 0\ c40@0\/@- 0\  c40@0\/@- 0\ cA-@`P$0pW@Pc 2 2A-P`@$p0SQ @cA-P`@$p0SQ @cA-P`@(p0SQ @cO-` Rp;:Pа$M0@T$Ѝ0S:?T@Q; P 0 ?0@4'V`1  L      T: 0I37<c@-@0@T t0Ѝ@'\P0 1 8*b0 PЍ cc`dp@-P@P  p@-0t  B^\  @ ŠP0 !@0. . cc`d@-0+00Z,@  0*QcA c/-@- p$P0 P@~`0 P Ѝ@Ѝ/A-pP`R@j0P U @0p@-@`PW@P  y00p@-@P.@{PA /R/qN/@-RAN/@-LA@-HA@-DAN/ 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-`PS@0 0/0 p@Zp@-@``@PP 0 000 Cp@`0@-@0s@-@0 PЀ ``0 <**`0 000ЍpL6p@-@`Pᾞ0S t`0 0S 00 `p@蝠/x,dG-`MpP@ᰐnP!0 3 0000X0P3/H3 00P00 eЍ,d@b&A.A<6AAp@-T@d `\00 P@ B?"@U$O`p 00C0/(0, 0d@-@ `0@ @@;`0dp@-T@`_ PUP 0 001`00 0RPP"`p0da0@-$0P 0 0@# Ѝ0d@-@_0U@`0dp@-A@ <`P_0 0RzU@_p0dp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \P_0L$PBU 0P_Pp p@ !0 p@"|f~f0d8dA- pM`Pi_| 0R( p@T1 00S 0E0C@S@1T( T@# 00S0 Sph_ P@L>_T W 0v_#@Ѝ@P k_0dpdp@-@T P,0,h0 _ TZ_ppA0dHdG-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ ^ ` P@U`1)_V @0@0Ѝ 0`` 0  00  00P 0 0廤@PEUP!U @ 0@S 0 㼗T0p`FP@0da0dQ/p@-P0 @AlP Q PP v @ 00H0p0da0O-P@p@-QU@`PpV 01p`U 1S 0 *>A-P0QppU@`P `U1S0 V *>G-`PCu1pS03/GP\ 1Q  /013/ @a181@b@-1R001@ 1S @_ @ 1S/ X@-9(0@tQ 0 @@b*>1 2/ BO-P@#80 S2Ԁ<0t`̠Wʀ ! , !8!<o X0p 0"t  ! !@ "H #L #P $< $4 %8 % k& k& l' j' ( m( m)Q[ !F P$0 000S 0 T0s \X0 ̚XT00CST0U[ @0S ( , ༰ ༰ а ԰ ԰ ܰ ܰ $ 0 4 00 0 0icddp@-@PTp0!5/@hA 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dA-P`p@`T @㏐@DT0V`@ T0AA-P0p01A`pQp 0 S 100000V 0 S %00000ASa40040Sa 40040@bA0@-0$M @ 00P0U: R 0U  000 0 0S 0S0 00 000  0 $Ѝ00 @ U 0!*  0 R 0 p@-0PS@ 00  0R :p 000 0 @p 0 000 p@-0SPp0@ P\ `R` 0 `7@-1PS0@ @0C0H00CH00S   t0@ 0D S l0 0l  0S0P<00C<00000S000 Ѝ0A0S p@-E@ P0Rp/0-Q$M 00!  0S  0 R 0  0S   0 R 0 Q 0 00 000  0 $Ѝ O-M@P<0@U`8D0  Q0 Y$ (45% 0SV0 S 0 S:00 0  U0 c0?o0c 00S5Vy V `@0p00800p ppppS@@T`臁 13/ pddG-p0 @0 0 P  (`,(0, 0/X(0, 0Q h000C00Ѝ 0$ 0 0$ P@  13/P pV 0 ΢PAdM>A-@Px`]Q@pPEPgEj804P"8%< 40R:AQpp@-@Px`=QH0,PU< 40R*p@oQp@-@Px`*Q0Pp@eQA-`@xPpQ? 00+0`@`PPPEP0pE!8AEQ//\00S /@-X <!t  L  R0S c@-P@ QdO-PP@4M?4ЍO/lR5 pR5 cR sR` SR0 RS 0S! X4/X0V0l $ $00 0000000L0 0H00<0 0 4/4Ѝp0`pttb(4/X E4/<0Y0804 ,4/P00@$4/4/00-4/Z 0S E4/ 0S 4/ 0S 4/0SJ4/Wx4/X Pp 0FNP `` `0``` ``p$`0P Z`\P,4/, 01p4/U4/Yy r4/Q`Us  4/p0X:P\4/ r 0D4/p4/A&A0A5A\AAAAAAGA]Ap@-P` 0@Tp @cA-@xp`OPU  PUPU  bPP ZP POP MPP@-M8PQP1 ! !1@11/ qQaP1P0  $00 $0 Ѝ P0RP Q  (0, 0(000/, 000PdAp@-0@0S00S)5  P`01!000C00aP0A!400C40p@0 PcTccc@b0r6A-d0@S h3/P x`NPЍ00PpQ <04S N0S   0— E R :@H B, R:0CP cp@-@`P-N0 ;SR 0@0<Q ;T0T0T0YN`8NT040CT0WMNU@pTdcd@-A-@M1S0/R 0,2/ /NxP9M00&NpFoNPU Q 00Q 00=U 0VA,dcA`d@-@@pddh /pM//A-Pp@`ᘀ010 R BT1P000 0 0 Ѝ P   0P P@bA-t0@@Pp X0 0 `ሀ010 \ *! Pp0 0 0 A \ 1:0 UP@bG-1@PZ`00S 0 5 0pW V`P 0V00  RPY 忄 T T00T00S Y oTrpW 0003/ZGi pT[cXdcDc @-L 0 \dDc00S/LDc\d00S/"MDc\dp@-P<L[@@ 1 @T W1@Mp`c@-@P L@W`c@- 0@ XdO-`0A?oR20LMS$00$00 00pP?o2 00 000%PPppP  0@p 9RFR< RE$0S0`803/LЍ0[00 V 0 V03S000  +p X6R @( g 00P 0 0p@l  BR  D B6R P0 GW p@ R b @ *Q  !0@ P K  0 B  0 @ Rz@@@ lR @   @LLP0000 p00@" 00PQ0-ppZ[S S G000 0h0SQ000HBN  P  P @AP@  00PZp0P P P0@ P5 0x0@0Zp0p RZ  KGG00CZ W0P|4XZE =P @Zʟ p0 R0 00 40(00 0C W [V 0 V03Sp(0 S0 pC 0p0JZ0Z0 @ C Y[V 0 V03S@I@  00PpZ0G5P|P  00PP0@ "P P P0@  0㌹0  I P0I*0IWG 0 0!0h0L[ V V 3R  0CSi   ,09,0  3ig [Vc 0 V03S] 00  Q R`0`0FP 0   [ V 0 V03S000pGW> 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    +DctAAAAA-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/`Ѝ 00 U00S`C 0S. z,@T@p T @@V 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 %ADcgfff(A@-< 0 0 0,0; }@ XdA t@-@@-?@-@P0 @ @ @800S @ @Ѝ0@ Ѝ/2TP Ѝ000 @ 00@- X( b0A*(P Ѝ`c@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@P39 X0P4 R0 40 Q Ѝ0@f0U @-,^ :@!!<  12@X0 0(`cX 0 p@-@P8`Qp@191S3A-@pP`80 00@9ЍO-s,M@0`PVP`$ 0+t3B 8 8  8404#C8("<pXw/ 0C0CVp40 2p8<000Td0a @PY `h 8d0H0> T`X` 0[0J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,QW1011410Q&3*`5WpF&8!U. P0`Pd PR0 9 0 PSD d0 $SP= K@,Ѝ`QH  B(`z`1QES 0 @AP h00<  W0O< @@ QF? P q`F pఃd0 qL7( @,0,@SI$1((0(1,8`cdXdPA66UAdcA-@p0 M`00P 00 0p0@N0 00  0|0p0@0 \0\ &P(X00@0 p0P0 } Ѝ d6HA6%1$1`cb-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-uA00@-M00|0|@| 0x00c00PP X  8v40 0 Ѝ0@4HAdH6AA(6b,,00 C#' ,00/Pcb00 Q0000$  B',#  /@bbA-@PM` p7i0 0 0! 0?P W 0  \ \0P  P$PP 6JЍ$ 0  0 P>$A`6Ap@-P@6 P 7$A-@P6t0 3R 0SP` p!VU A6S0@bG-0P3x0@ $6p `V 00 06`03/V60 0 0 @b@-@G@Q@bs@-0PQ0 7 0@S X60 `0ЂЄ 0S 6E6 @Ѝp@@b6O-0Pp,0 `0@ `F`! P Ⰵ(0P@0 0 PP PUP@b@bp@-P@6000PP@p@560@S@-%0 /A/G-@+ p尐Pd嬀Vʀ 0 ! $ 0  .!4/ 0!d!0    !4/@bd d$d/@-///p@-@P5000CS005p@Zp@5p@-`xMV 0@S x P v000(`(05 e5xЍp`cC-M 0`p` @宸P0 P 00 00 0 0@L{?o2P0S RR! %*ЍcC-M 0`p` @~P0 P  00 00 0 0@{?o2P0S RR ЍcP  0R://O-0 ,p`@\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 0p@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 Rp0 0p R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`02@'2(p@d2p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4M1 0SPX 1`%ꔰ[Y( z@`@P  (@`$ r10 0`P ( 14Ѝ@A$@(`&Rl00& 0T0C 0Q `T1h 0l0P$0hP P0$01 @F100 1 PU T`h0Ss`P@$`(Pp@-@ $1P0P@ P00P0@PpO-pP`$ 1@T @G1T 1 ?100?0p\ 0,fVp0 ЍG-@Q8@T80S <`0P@0U:1@8G080D0@000GL880兑P p W 80 0   (Pp@-PL@y 0D0<8@0 <008 8  0 S  0080S 0p8@0A-@`P$pv0h`0l0@h00 00 00Q00p@-@$P`a0 @T0p(0S H0S0p$P K0$0S0@H R}0h07@-P @P@P 80Sl0@ Ѝ0<00e018P /p@-0P@ PP00u p@0A@-@m0@w @- @/0 000eA-`@p/ 0S P W00 000A/QU q/00CS0 0`0@-@/X/@/@-@TP 0T0 @$8e e0@-p0 0mPP@`TV  P Ѝ80S /V P@00TP TP0 <0@ 80/V  l8e e18P /O-pp3TM`3@ ^P00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0n_P @@ ]   Hp p /X L尵T`P@ `P80S .00 000-/T`_ @p`~D0<.80!0S0 80R1``80a8000 /.$ 1 P 0R,:. 0 + @#T 0T0$W W  .T0T0TC0. .0Y00000.1@b8e ec0SS  S/@- @P1@8@- @P1@8p@-P`Q. 0SS 0 000p@|.0AT 7.0S 00 0r00CS0g.`b.@-@.0TP0s0XT0T.L$@z@- @   0 03/@P0W0>   5Z@ X3V0 0,Q *Q :/@  0  o@001 1 000    K   N@w#000 S 0. 00C 2 0 0 00 3/@PY 0  "  00 0 0 3/@P 00 3/B0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  (0`S10 0P@0+]@ 0 03/0 0 0 0 00 @ Ab~f}f3{f@|f@-@P p p@-@Pw0P @ 003/@Kp@-@M P &YЍp@-`@X0P @ 040S-@  3/@(p@-$MC@P @, 00`V-@% 0 10 !0S! S S@ 1! 000 00p q. 0 006/@$Ѝ0A-@P P @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  nP0000Ѝ7@-@P mP XP Ѝ0A-"0`p SB@ pP P`0 @  O-@oopb W T0!03SP (0S0P lp(0SY @ 1!H  @@] PU @yP-dM"h0 (00@#0 00 ,8dЍ07A-0P`p@0 TЍ@- #0@-G-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;00 ЍO-`0#MPܰ" 0$0P @Ѝ(0SppW @P (0S0pWpWpW @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 -P@x  @q0  @P @g0  @PQP (*[1 01  010/ 0PPQ`"0 @ @ T07Ep@-0PS@`M  UP0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqP  (0S[X\00X0 00 ` X N&0 &C&  0z&[ AO-0p IR@4M, [P  SU@P!@T  IU@P @  @0` @P "LV@ w4Ѝ?@-@%p0t 0 0x08 6@+&p@-d0d@P%&r"0@3@#V&pp@-d0d@P%h0l (00, @@V&pp0p@-Q@ 1CQ 1CQ pP%h0l 00010%p00f@p@-d0@P0S S p80`h0pP%m%p0@`0ADAp@-@d0P%@]p@%p@-@d0Pu%Qp@%p@-P@P  @]%pp@-@P` BR%&'00F= 00'`P000@0 r%pp@-P@,%A` h0l 0H0` &r0`3:0@S%p@bG-0SP'@  pPP srF $h0l Y^:0 h0l 'u1$A#%ЍX#x0S `%P000p0t 0 p0t Bp0t `0Sp0x0 t S PP #`PA-0SP-@ `$phl 0 y0S 0Q h0lt $@u$  ᝨPX!x0S P$Ѝp0t 0 p0t p0t P0Sp0x0 t S PP #PO-50S`5 P&`P-00p嬰 0 0(0 @ ?$@H @00y0hl`qt%+  @ 0300 ЍXA@b0 0R0,00 0 0/ᜎp@-P`@t  [Pppp@-P@L`#U<<P@P PPP@ @,$pcccp@-@`P E[PpQ@-@ <@ O-`pP(@T 0(  Y #$Z # @ #IPW(@ X #$[ # @T 0( q p,0H0@0,0#PPp@-@⭨P@oЍ0P :0Q:///0/P$ Qp@-$PP $@*U#p@R#P#0/P$ Qp@-$Pp@#P $@*|#y#A-@`PUD,0#`P@ 0S 0S~00\#T0`#8P40S$pP##(PU  #KA#Pd9#""8ZA@cJ EZPcccA-P0\!Qp# `!0  ᅌPP  PP0S Ѝ@/@P P0 0$pP" 0"804P(Pt,0"0S``gT0`0 }PP`("U0S K@bAcccO-STM@xp|N `PP#@E W 0S@P;0  00 0  R0 0200p f@P(P :",H4@L@$ 8" P  p"#@P ,$"TЍ#",048@<0P80,0Y" W"@`"H@TK 4@TH VWm H`P0  RS> QQ< <`4@0p!40S@  @004PD0&"0$L0!"!!""!@0SD  D 040S8"!@"T0@P0S 0AQ 0S 0 P  ,:#P`,`ɚ;6eAʚ;0@-@M0@d QP#!0  2P@   r@ T@Ѝ0@bA-PR  p@P `VP $Z!0 pP!(0PЍ@P/@-MP@`lP V0 ! 000Ѝ"RS+ P `V $p!HP2U0!30P  RR   .?!(P2U0!P!SSp@- ( 0 @P^ p@ZcA cO-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO10P ,ЍO;0P 0 $07JY )P@/ [, $ @P&$P "Y 0 0 0` ,$`P > P :,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P R@Pa0+ S0&%&b"x1Y, 0 $03@PM$ 0RXP 0 00,P[2 *"*kA 0 BQ    "0C?o2S0S0S000  P S00S00S wPP IPN@HAAAA0@- 0@SP$M  NP 0 P     $Ѝ0 0 R  //p@-`Q0@0 QPp00p 0@-@ 0P  OP OЍC-@$MP NP 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V XPPPW_X V  A@BUA@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @WP0P;4Ѝ@bd@-P@`RP 0) Ѝp0 ` O-R@|M 8PP 0  @|ЍY 0,Q@! 0000 1/@P0qlX X@` M@P V  8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @MWᶼ (( R LP0:WP ៼ i@@bd0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0h3 +NP 0PED00S 0 @VX0P.4Ѝ@b`cd@-P@`DP 0 Ѝp0 ` O-R|M@ *PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@`  L@P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  0;3 Mt (0X0B 0 R  @0Vᙻ (( R LP0VP Ⴛ L@@bd`c0@-0 0I ЍO-1PMp0sP P @@ P @f  0 03/PZ  Q@f [ $/ ^  P 5/PP [ $/ L P R 0 _U  ߀0 S @㿀 0 0@рub xz/  A$4` 0 , $(    TwIf rdAedAedAd}f~fg~AG-pM7 P ㄺ0` S<P 0   @,᥀iЍ>    7@P  07 000LP8'7 ℀(P0S6  S1#U S1 #0 LP  7m@P0@7 L@P  7 X0 @LPd ᫟@PU @[P0 HP @cA@bAA00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0@b/p@-P@x` ̹pG- P @`$pJX X X@(0WPP@ z0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0 #΅"^0@@A-QPp Q! Q`+i`@c2` R`   Q`02@J20C-Pp`=2 v Ѝ S @ R0P0@A`0 00 c(0 #Nj 0R P A-`Pp S@"@Q  0" R0Q@H0 00b 0@ "jЍG-`VP:Pp B @ ]ۙ 0 NPP$!i2 02PP 0 ( h @  &a= B <00Ѝ^  A(AG-` R P0S0R@9@ 0+M@P)V  U @$P0p M@PၑP`@ P0 Z@ <pW ÷O-0TMp$00S00 0fH`P#`TЍ0 0M`P0 0OH`P003 ``3 1P00C9p$`W[3pWb xt0`op@⫲W[<3pW+4@T0,0 T 1 #0p$, *I,0 @Tp00P00S Z 1 !, I,0` T00P00S U 1, I` 2/VP P 04PH{0`$`P PPp0`$`P PPp  li R<  <` Eci`` P  R , (b( $ , 0 0@@00 0$0000pu  @i R<  <` E7i`` P  R , (6( $ , 0 0@@00 0$00pOxP@tP 0 03/`NV`2Q`N``gnA@bbbQcxA B @-00S/A-@P`p  00P0000 0n?@r?v_` ,A-P@pA` $0SH0( ` $ 0R`0P  @bp@-P80@T ,PpAc0O-T"DM`!p <4B 00 0,p(`$  @P0p %KPP 5Ѝ@P` 0 PP 0,`P  `PP1S!!1! PU020( j P f @cp@-@PM TP0NXPP+0@r@@T& XP`@@ @@@`0  xP0 @L@X PT`L0Ѝp800@<0|AcAbDcpo7 ep@-@P`0P ( R  pU  @@p@-pPPM @P @  8E@P0S00C>S@0`S@ 0S@ x410-JЍ0@-@M P  P 4 FЍ0@-PM D@P  p@P @p0`S  0W000 Q  E@ЍO-@$M 0Hp 0` IPP VPP<@១3 Py@P  + (  , ^ R !W$  RR R0R Pzʳ@ H@80j/ 0R( P 0W`0" x1 00 0 100嬡@$VpP= @]  XP $D1 00? 0@0 4<00000 P 7 Py0 000 pL0 T# $Ѝ0S@P^voe`rτn0X@Sk/1!p@@PFV0cPAAAo c@c0p@-P @`M P  CPAЍp/G- p0`^PP PK@nd 0 Sj$0SD `V10 c /o 0b4 baQ  S  !R!0C31$00C$0 PC  U 40  D?oW20SP   DP)ЍV   0P P` `0 200"20 #P<#(P@- 0000@uP 00Ѝ0@-@PP$M  2CP 0 _P 00$Ѝ0O- 3P MⰰR`)0S: S: Y`  U@  C`P 2 # P `P  `Ѝ rcU(`; p 0S:$ 0REXc00 40h!  @ 1@1181$0 SfPU `x0S P x ~|0 00$0080匰$00$0 A(`  VU t C[ 0A P `P   P0 #R< # 0S000@@ P0 0  @@P(`(`lcDc`c0@-00 Ѝ@-@PM  LBPЍp@-`0SA 1X03/5H0HSp< 5H0HS p@ A!p@GD@b`cC-$M@`p*ePP @ \0 0@0 0h00<0p `0000@0@P e$ЍA7A-`AMp? 1PT A@P*0@& (>K@P! 0  0c? 0  0@P BB@TЍ& @- 10/10/G-Qp`P@W0S P0  @\@P P @P P0P@@G R H@p@-PAAnPPyprpp@-@Q,Y@Pd@pP0$P R @U@q@s@-@Pa0 y@;TQ  ;B@Ѝp@-p|M?WP$x AP` р00`0p 00$Xp0pPP W ?P |Ѝ`cp@-@aP1S @T 0S 0QU00001501 0S NpPPO-03pP@`ᄠT P 0 S G @ 0SPP02P0@bAC-p`$MRP0P P0CP0 4P0%@ RP0 0  0"@P $Ѝ0( $G0 ` [Gp@ #P U<@ @U  @bA@-`@V  @@PP  ` 0S  PQ Ѝp jP P0 pP0  700p>0p////// B 0@Ps //Q 0S P 40 P0@1S///$ eA-@t03@`P |0S 0 R0`hd0P0U TpH0AD 0Q00C0 R0 Q@c@b`c@_c$ eO-0@pPDM(0( <00,p$@ @@ @`<@qY<0S% 0 00< 00000'>0,0(p$@ @ZYT0P0000,(p$@ @ @P< HYDЍA$ e77A-@pLW 㫭0 P0`㨀0 V:g%T` V 1d?@`厭 WЍ0`1S 0 + _ A@c$ eAC-M 0@p` P7$a0 P 00 000 0PT?o2P0S@.0S@*VPU@$ D@pU*0!R0X H@P,@$ %@VЍ$ e@c@-808@ P 3  @b$ eh7A0@-M 000 00 0p@P@,P 0R `x0 S | @ R \@0`80 @>@P Ѝ$ e@c@-0 000 0 000@PЍ@Ѝ0C-Mp0 000p0 0PQa'V  0RI@P0P XX@ЍwP w3pU W @0UC@ PU0pPpU#42Q  4>@0S NP ɪP PdT@I Q0S 23:4r Q@b@c@_c`c@0G-M 00 00 0`.P@ h pP L @Ѝx4143P@刀 0S S@ u`q tp P@ TQ  =@u`L@@@k |PU Y W 1S 0ሀ03Q@c@b`c0"!S/ 00/P /A-L0C@1S`H1P1 @ATAj pq`@@b00@-AHcHATAO-@QMp33!! Q 1,0<S:0P>0BRUbPEQᆢBDU$XQW]YiP @Pa&X i :0Pg  Z  00ЍXWYPELD  :0P;P 0  :0P.P  :0P"P   :0PTP   :0PTP   |:0PTP  /zW < h:0PY 7  _:0P0 01 0100/oX" R0  `;0/oW" R  U;0/oY" R]  ᕰ I;0V y  y0U@b>Ap@-P@U`0M  :PPP  :P P 000Ѝp@-@PP4M  9P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V P P 9@P81 00H@P :@ U Eߍ@b|A@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  9PP P  v9P0(ЍpE/08!PR/p@-SP@HanP@10D1@A `0p 0 pceO-0`SP 0S 0@ Q @280SP81^0S ?: @0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00    0 X@UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍO @ PHcHAA-`唀p?`@T|@0C0ڧP@PEP > 0 F0 f021@& 0@@AHcb@-@( 5x@pp@-@o0Sp 0P9  R @1S0@1  0S0000p@e @-0M?SU1p`0@SPT:4 `P Z@@D@ K V@@ S @Ѝ$`˹V00S @@0` 00n@P@T 7@ T t T T 0 d0 Ѝ@70@`cp@-@xMP` x w` 7P0 xЍpp@-P@xM`x w001`0 0p0$ uxЍpp@-@PaM. w 5. 8ލp0p@-MaP. 7@P 0@ s 5@T@ލpO-A$M>ZL`0R00pPA 0UV4U 0S31@0b 2w " ~h H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 4W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[޻LWH1H0S ,1 [0(0[0޻H0SP2 v2 020Ҋ00008`1 01 1R 0  04P P0 4P0^ P0S 3$ЍP[H0 A@bc0 eAMc`c0@-P@Pp@-P@P ;Pp:p@-@P =q9000,03/@pp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@hP1QB 1CQ [?0Q Pp@d 1R::1*Ppu!0Q 0 0!0000c0S: R :SP0C BS000KKP s@As@c@b~f s@-@X0 0 0h0@Xp@-d0T@`X0\,0(@P@UXp0Q/p@-t0@QP d0QX\0S0010Xp R0*X0\0pp~fTf@p@-PU @d0`(0p`h0Xp6XppAp@-@d0PXp*p@Xp@-P@P~X[[h⤷p㯟pA-@Pp pgX\00tp00@`0^X00F= 00'`PP߱ @-0 @0 hJp$@A\  \ R/ A-0SP(@ `%Xhp\ 0R$S$X#P0S0 0 0 K0 P0S00 S PPXЍP S WWP\0 PW  Pcp@-A@ PW\0S`V0p@bWp@bO-50S8QpP Q1 X@P)00夰 0 0(0 `@hݶp*PWWKK0 ZW%+  `(0300 Ѝ@@A@b0p@-@PпP D0R ᦿp`~W[}W᜿p p@A@- M0@ P s0 ЍO-P4M`UXpľPP ᓿP  81R h 4Ѝ@>WW [8H0L 0P0S XX0 S'#PH0 L0 H0P L RP 0 H0LP Zp 0\0X0SPP0PPW O@Aɚ;6e@-@LM`p .P P0U(P~?oU20S  /LЍ B 0  @o/p@-dPp@d| 00C/(0, | 1R@0@@1B @@Vp8 eQQ03 0# 1Q10C2q0Cq0CQ0C0C3+C? R0//p@-@pPP,p@8 ep@-@pPD p@}8 eO-M0(0P`p` @r\$ X $  Oo0EBP@T$ЍOЍc-@-0 000QЍ Ѝ/A 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d8 e 8 e@- 7P8 e@-@(080(@8 e͊p@-PnAT @ڊP,p@ D<6Pp8 e< eA-<1P@$"000000D1hPWPUP U D1 _```fh !`F000000000UD!000000D13 !_ 0? R(  U P D00000 h,P  U  _?0S00hPS0C PZ0 CSR/Z Y 403 ЍO!PB@dP2Ē 9 \몢 0"<I <LT a `00z?\"0<8 <L|PU[0( P0 "N=0S 00 001  0 00!N=0S00(0, 0(01 , 0001Z R[Uj0320M )2P! 000?A6c0(00 0?A6c!d0<0 <,LЍ~쀟|耟z 0S S! $0d < L0 ű< L1 S0AL0Q$0dL0X <⭱0S@6AdQAA@BH'hASAoAAAAAA1 |0Q@-@0_O0hAG-MqPU=;Ѝ0`AT0AT( 0d@Oo@@d D12 1"!10CS1!1R10!1 T䠕 V. V1 V# `V00d@Oo @d0D00 0 l Y   5+Y Z Z P *`c8 ecp@-Z`@`0@1B @ V @Up8 ep@-@ 0 cOPP <0<N8Pp0SppQ ް8 eAA-pP`LW@ P0@S@@@V(` @0 0000@P0C00@1B  @d8 e0 @-#PO-`@pᄡpS|M 0@!B @ <C |Ѝ0< :#" (120!Q/[0, R) D!& $'P 1 0S F&}l ]*TH2[ _?0WP ` D1 |0 S7W) |` dVd`#}Pp`WN<1) ?0X!IW#0P|J `D1pG|0 Sk|0 ` S)Q0`h 0  0A000 pG000/P0 0D1|0 S{0<: =8 e@b`cbAp@-0 0 00`,(P$  Pp:B(0 0 0!?0 0 04`0P,(P$ $B1 0 00!? 0 0 04`0,(P$ B000X1 00 00!*>0 0 04`,(P$ A1 80 00!?0 00 04`,(P$ A 0!?0 0 800`,(P$  PpAh0 00!X0+N@0'> 0 ,`($ @<08 ADЍ8 eA77c7@- B 1011 S!1 0 !q 0@$A0c8 ep@-@PX0U00 00@1B  pP8 e@-@$I0  (@襮p@-@P LQ 80Q + _? = 0>;0p0<0|Q h}$p@p@-@P . I&c/0000`0001S 0TV (pq8 ec`c< eA-P`p0| @@ @@1B  lAT 4/0 y#P@"P 8 ep@-@0P#PP@ m pb8 e@- @$^8 eG-DaP@ 88$ 0 4 0 T 4 T ( ,8q U( ,1:00%<$ P - 8 < 8 $ < $  R P @o l iU <0SPT_H\ P @14 0 LS 0000?Y$0!D1  L0S81  UP h4P000@1 t1S 3/P0000  P , 9\0+4 V1SSQ   ^kh090@W1SSQ D15 0L s xD15D1;T9 P1SSQQ1SSQ ViP1 S S  b0 3  1T!U1R*,R1SSQ VG   U1SSQ 0<0RT1ST1SSQ D15D10<0 U  P < SK1SSQ 0S H. U@ PM1SSQ# _ 0 R P I  DQ 000S0>;6RH L1 S S RP N1SSQ1 e P P p\ p0U P P  l p0D P P V  "@ Z1 S S R ,L 00 S   | 1R"Cy  PX^ U_ H1S I1S J1S* ( U& 0 08C0  :/0H1 S S R  P PEUP#U PE0 S = 8 eA@1  p@-P@$p/8 e@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`Pp=A@@ | 1R@ 0@1B @ TPT Q X @S8 ep@-T@p`< ?P,00(@@U<p8 eO-0DM S @0 Pp#48@3@(00D h1 Q/[ , S) d4{!P[01 0S4`DЍ K$3`Vp<0Ya00VX0FS[`0#4 0=0 0PS!RRQ   R V`0# 0 # ?0cR81  TP hp P000@1 t1S 3/P000"Q8 SQY0C@0T0R@2 @A0.@!B +@) v`qQ mC!008  R(00C?2cO 0@CdB$@FSzYL0S800q0)T0S 0  8D#`?0 `:X1S#V V#VH /S0`Ph(C0CU 8<U ,<U50 A<Q ]k0CQ$0CQ;0S ,л3!1PS a|;U;U0CU;+0S00p;U %40cS KS V0CS@{< ]P 0 :/_zCz HP 0  9/J/:Q ::0S[  S 1 0S [0 lP @  I"( :P Ѝ90AU? 9UPu 1 0R0[0- PP 9U908 0;bl9U 0CU 0Ui, us10S 0RS .9U 80SQ8U" 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0Pt eD8U >0Uu >C0CU# 0R000U'U L7Un70 S' S00p7U  d7UY_ zP4  9t I+70SL70S  P;07U0p p1S 3/P  4p |000| 0C0;PUPPK@8vZ + RT 0H0HS G]PP  0D 80< 0Pf@bP #]!$2$]ZT@TЍO, Ns+h0S ! S [0 0S00c0P1 0R[0 0S00\A1 0S[  $0|00@1$0\1(0S`1 i%,4U D1 "    2D10D!810 R<1 0;; 0D!"0D1 GsB 8P D12D100FTx Ptt0D!  %<D!0* Q}[z   Q0(03/z0<0q}P uP= 100100@[00[0xCP0S ! S-[0* UUpePP 1 0RyPPQl0 :cE P 0S ЍOvSLS([ЍON( Petrtht@t0^t 8 et,@Bt @ut@bf@AtPcA@VcACt gt`cbvtt nt ot st@jt@wt@HtH~ftAt,T ec}Ap@-@P0U R  @  @1B  T08pR00.P8 eH/H!/81 - p@-U1@ C/oS" R 0\ <0 /yP 03/pT1 S S R 0<0l1S (l13/#/#p8 e/p@-P,0@TppP @ c/@-@PD0@PP  80P  R 00 08 e cp@-PP~L0@T 0S 408 CTT 00 0p@8 e cP c@-@P(b$08 CTT 00C 0@8 eP cA-@QnP/NpPP` CpPa00|0p @R 0rPQ 00400S  R  0?8 eA c@-$PP E cAP c0A@-@XT08 CTT 0S 0<0S   28 eP c/ c 8080 1l1S 0 0// c 8080 1l1S 040// c 0 601/ cp@-PT T0 601@0003/(0lQ00p c8 eA-pt`P@@@ @L0 @ S@P0/@(0,   AR SD1 WP00C8 e0 /@-P0 @"6 0<  $0000P0:@蝤 cp@-@Q@ x0`"6 0h Q0000X00X0 0$0․p$p@w cG-0hMS~ 1P!0 & q`됀@@,   XY 0X0M p@P@  ,Q,#NqhЍ YY 0DY04 hЍGkp|0S  @ Z;[@P   Sp@T0@@ @hpdRd #A@Px p@\T0@@ 0R0T0S3@#@@ c8 eO-p@`x2Pt"0tM & 000L @  I L Rh00 4 Xr 0W#000  ` @P R8m X⯣LPTdRd #AQ@!@1l  cpPOLP @000(CT GT p RdR@1d@#v  BpP./ @ `D!L"$ L\ "P R (`dU ( 2/H@D8偢(FZr 000 tЍ c8 eG-PH!D1 60q0`A@ 0@ # | R    X0S  Y0S@ 0@  L0  S  0@ T@  BQSD1  @T Q sY 0n@ c8 ep@-@p p0 601 R R p@ Ph p04g p 0P ctA8 eAp@-@pPy0Up@8 ep@-@pPmIp@8 eA-p`tP^ @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @E@Wm8 ep@-d0PQ0A T#T 0SlA@OoBU $Vp@T@ cx eA-q`0S3@Th90VT@ PQj,0TS@ )] R P! n0@@ I01S`A@0Pzxh01S Prp`(}0A cAx eA-P0` VP@P@ x0x0qPl1S X@H0@`l1̀0003/D1;D1@E c8 e48Qp@-4Pp@$n0S@@էp cx e@-@ $VT@ ͈0x e c,sr/p@-Pl0@"6 0\ \ aC $₡ 0$0zp@o c8 eA-`A0` F@PpPP840101@0@$lj 1810<10D1K<@1=`1\1Il1S000( <0 03/P @ 0尝P \'PЍ00   h0PP0C0 8 e c+p@-PP0 601P003/@@dp cO-쑟p3`!1 ر 60P@ @` 1 Q$ L0S1 8pL0SP@T:L`pV#51 0S [ X@P  [  S P @< #@ X@T @|l@dKT L0S8@l1S 0 03/@@b cb8 eG-`,$(4 6 0Q4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;[sP h3R `3Vl 9>C1CV %@3Vm 0 $p 07/pp{ 0 *ppr0o 2 Rk0S Y`v2V, 1\0CVh||2V" 0CV 0TR 0 00I0,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>SxxD1S0 008h|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0 c`t\%8ft_t u wt@8 ept tttut 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$dp@-`@PJU VBAP0P0 0`p@-@P 0P 0SB'000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP j0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0S<  0000`P  BR1 " 0010 0000S000plAO-`QI@p0 S> S 0S4 000 0R*PP P%PEUP i R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [ A0PQP/@P @- Q^00@S0\3| e X0P/@-0^  0CS0\3 | ep@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P /@b@-[  \@@ [@- @ [0  P p Q  Q\1P!  S[ @ [ @@@@at `cp@-`d0@31[  10 PU 8 0 ᭒@ᷔp@@bp@-`d0@31[  10 PU 80 y@ᘔp@@bp@-0@1[  10 PU 0͆ ϑ@|p@O-DM 0P0<0p`<@ @00<0,(p$P PP P`1/*<@0 0 0<4,(p$P PP P@`/DЍ eAp@-@P0Upp@&@-@H $0S 4* 0 S   0   eA-Pᔀ M @T fP$q\ TPP` d  5 pu0S Ѝ@ c eAb0S/ c:8A-tp@h P`V U0PD 0 p@ fP ` c e h000@-@AM,P zSLA dQ d, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01"PLaPU 0S 3/P Â 0$L1H/@-PAM@zU 0S"Aߍ@, `P Aߍ ``3pP ` 㐂0PS 0S ㅂ &d0 L1S0Sp0LQ:03/PU`P d a$bHO-MRQB 0,P|ߍOY-Q 0S 0 S 0 00L\0$00(0+ͤ`P+ pߍ003@00T 00PS, (0S)pW& 0( S"0$ 00S0 000,0p 0DP0 S030#[0Sw 00S@00008S 0 0`023s - PPR0 P 0T000X0@0\00XK 8P0p01 `00' 'QJ  f0S QE b zf ) 0X 8p> "2 2" 2" 2" -8hpTPU000 W >0 =00 =C00Ks 0 0  K00 0 HE000P0001P0100 4000 *0-000 0&000 +00p,0S 02* p[c\c@b@-8C0C0$ C@0 C e eE8G-MⰠ P`p ` @ c0P00SS00-ЍS0 000000@%?o2P0SQ $0S S S h 0QQP<0H 80(0$00b eAbbC-釟M|@P` prNp0p $  i0` b2 020202HX00Z%ߍ eO8p@-1@SHP呗L0S0L0 CHLkP UpH@0100p@ őCUH  L00L0H0P @0` 峑T^ p@X0\ /EA e 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d@-M`0@T Pp#2Q120@T ~ODT3"P%QR| 00 0ЍP0SX@(0S 3/,P0S 3/A c@bpe e 0O-DM`'p!< CS P00 0,p(`$  `(3 ?0080 040`,p(`$  |(83 ?0 0<0 040,p(`$  e(000 0 'Ȣ!0 0 04,p(`$ M(0 000'tŸ! 0  0 04,p(`$ 6( 0'!2Ÿ 0(0 0 040,p(`$ (0 000!1 0100 0 4,p(`$ (0 000!T1 0700 0 4,p(`$ ' 1 0I0 08 0嗎NP 0 P@< 劎  0|P &R+3'! P<0l  <0$,0DЍO e A{A{AbHP8bbQ8P8@T8dAA-@`(pP$!$'Aj eP 0 0S/p@-X0PP Lˏ@P 0 H@Q000 0p e@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` 圏PP0L00H@40 400;\00T0X0 eG-0MZd0\ 0pWЍ@L\ T 0E0 0 MP@T 0H0 0E0 0 D p:` `FV`!  =`pG@0]AxAAP/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PAp@-@P 048900H00000p0H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ0/0\/ APQ /p@-@TPMPP@ppd$00$/$0S0$0/ 0S00/@-@Np@-$PUp@Qp@@-@0 ( 00@Kp@-@q0 0P0 p!R 3100 wA e RA-@P;bS`:pc@P PU0P SA-@P;bS`:p_@P PUl0(PPp@-P GP@ V0@pp@-@PPlTp00 00FS0^ 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 w^0@DJ0000CS0000`VTT`p eO-pPU' `V':S`F' 0$ @P 2V2(0 0C(000(( 0 ` 6P(@PHV@` [@P 0 0l 000 000HLfH0H0`0000+ ]0O-rMP`@0 ``(`0 0`S`F 80000U Vn0  ( R(|pPEWY80 fXp000<)0" 3SH L0SP0\ 0fX, <Pp 0% 3SH0L RP \0  <  0CSS10U 1 !4I0PI00<,00 BX 1U  1 Ip@Pp@ppWm 0j 3SH0L0ScU 0< pP7Ѝ<pP U)0& X븀V0008000T   #RH L R!X B/o" RX0@0C0pfV0 X 1S  0  00HAQ00@0Wp!S  \000P`V PU @P@-P   Ѝ@-0000P7 ЍP/@-rPQp@-t ⴑ`P@Pp0 0` U PA@-@P@Ѝ@-  0S  Ѝ0bSG-@9p`PP2 0 0 0  I,b0W`!V`! V `!0 a\0pGI0000CS0000@TWW@xP eO-PR``Ap0PPPM 0@P 2 (`200V [ ^@P P Ѝ00pJWp!fW{  W 1+#  \ @PZP`F R[ 000R000 p eA-0@S" `;(0 S8ʸS C< 0CPHPZP (00 AQ(0000PP 0 ?0W@ [OpP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP e[pA-@pP$`V@PW0$000@$@p`p@-P@ 048900H000$0p@O-M@0r000?` `0 QPp000, vVQ@&U #0SPpGW0pUv  :  0 $ P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S000 0 00HLcH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! ZAA@-R Ѝ@-L ЍO-0P0td RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 o0000H 0CS00C R0 0000 Y00C0P0PX 0 YDPB ` Y00C0 00 &000b00rPAG-0P p@P: ;  0 0  000HLYbH0H0`堀VhYPP P  0  0 00HL8bH0H0`KYy@lA/-/-/-//-/-/-/@-@b`-v@-A-PUp1p!0@W`DS W c cd_PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  RDXP  XWPp  X`G-4pPPP8 `=@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T U @ 00040"(P 0  0SCBT D@DT@(P U1V< 1CV VM `@4TC@@ @T 6@H@0` @T*`1@00C?o270 T:0 `T `V4 `V1 qT``P @ Y( @0@T@#C  U4@@iiip@-@PPPU@` W`Pp Bp@- P`8@"<0P p@0PppPp@- p0Pd00S P0pDP<@ʆ80 @l 0AcD ecp@-P`0` 0@ 0AT 0S` 0SE@ 00 0pccA-@Pp B, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0A$`P@@ A-P@p0`,PVU  AWG-41p!,10RC*Q`= S PP<*P00 /R0S /zTPPr@ e$`Dq@ ||0PP 0,`8$0 PaE<H@<:9$_@P?c cA@-@P q00@-@<9l7 0S \0LS   n,P 0q7⟉@Dqccp@- 0@0CS`P 040,PP_oRaU vpp@wp@-@P 0S 80 31R00 Fp@bp@-P40@AT ,TPp@c@-0 00 0cP Ѝ0A-0SPp` x@dTPKP (0S "@ 00 0@Pc0@- @P ,0S@uT p ЍЍ@蒑@-@ P$0 0[  Ѝs@-` @P)P,0S(0S@ 00S |0 31R@4T <00S 徑Ѝp@Ѝp@L@@b07@- k@P@P$0sT@ 0$0(0S ⅉ Ѝ0O-@PDM TP^DЍOtQ !@A@AP1  yj @88咄4q@0 a H(00<0,$@ @@ @0 00!00'>< 00,($@@ @ 0\! 0 P0< 0 ,($@@ @uFPP DЍcc~8AD eA cp@-@P86p0 @P -pp0@-`PP @BTP ЍPPp h P0XS   @00C@0 `V40040V"@ccA-p MaP 3/@P5@P 0 (00 0<1R 0 @ Ѝ0 @P  0 PQ"03̀1 0뀁@BP 0 @0@ 0QPQXN   803/@P   P少(ADRSP@bccc@-00 0 Ѝ G-p`0 M 0*@P⻑@P  Ѝ0 (00 01R 0 ᎑@ D H03/@P% PhaP cUZ0@@000 P @  @ FT  VP G`P 00 0V @x0!0R:@@1PPS0P1@01@Q00  P(Ac cc@- 0000 00gЍ A-Mp yP@$`'X``P$P @@$(0V0(0  0 @P  ؆@(0T0C(0  ЍW` #@0 0@-@MP MP 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0R0 P 00@00 0 0?o2P@@T 0S(0 0#Ѝ cL eT ep@-@P0Upp@Gp@-d0Q@`P  0, (00@@@@V pp@-d0Q@P` $?R"0@@U pQp@-@PmP pPpp@-Pd0@X_P0<0p@p@-Pd0@OP1<1p@A-d0QPp` XWA i4$0@W 4S@00\0`@@P@3@#p@-d0Q@`P _0,(0!  =4$0@V tpH R\  ` !S@3@# 0!< 04 0 (   !/@bd d$d\ P/0 !8 0 0 (  , !/@bd d$dO-TM0P;3P(00 00400<0 0000000Q 000x0S0x 0|0S. p`+ 7@ 00 <03/X0 Q!Q0@S ?oP20STЍ|`0S0 00$080 0 ?0P0 ` AT T 0RP*R:@K SH<0 0#R00S@ H0S T;4S4H J ``0! ( T- +Q' $0S00+0S  (B & $0   P v 01$0(0S`2( 0`2 0p0 H 0S 0 0@00 00  1SH 0S 0 0@00T 1S0LL0XD x0S 0 x0x@T 1S X pc 0S @0 1 A 080@  0S @0 1 A 080@  0 1@ A0px 00R0 0 00C?o2s R00S a00&# 0( 3/nx0x00SR0L0LZ qTp@ 1S 0` 00C?o2@000,0T 00S0X0S 1SB 0Sr1@01T0 S0 ,0CS0!HX!0S B 1v 0 -PDZ 408 x0 R00S W00 03/, r@ S R  0 0CX[0`0@X p0SC @@@ ATA WpAT0S c0CST0d1@010$04 0T  R S` 00 0S 0080( 3/ 0 C/oQ" R 1  @ W qqq 0000S 0 DP  0  ;000000C000C0,  S, &0 $D0T00 S @T Oo0B0@1<1HpW(1 &D0S >pP 00 0S 0080( 3/$0    P A1Tpp$0p@SmT]W qq 0SVqT|0S 0| 0090#0@bA-pP`@0 0S@0d004T T0T H0'&@P9$YP @L e c̰dbT e@-@ 0@bO-ؐؠ`PUV #00뜰0H0P\@P `N@@ p @@Dw] $`#0 ,0}UL e cT edM> eO-TMP4L0p0L 00RZ(Y`|    "200 \20\2x0S@|0x@3080|00(05<0X008 P z4S @|  $+ +LxTЍ00 ?o2Y0S 9@40SN " <0R0 YFTD0S0ST00à R0S  6|0 3  8 Pa0@0H0Z|0 L 000L0,0?L0S 0c~ 0`(0 000D4 R8000S3# RQ. $ 0  0 R& S 0!Spx 00 N@H0P$0  H0 `0  @P(6@00 $H@ 0S@@ [fYD0 T 3 0{b W p00K M@C0`H01`'A0 D$06D0@0S0&0$ 0H`\p:XP#:0 P000L L"4040T 00 0C0000 00C00 R0000C0 0SK ,0p`L(00(08p_TY,`C|00001`P LR   Y;( 10R04 D0x 3/0@S000Y1;ò10PL02Y[xY Y p{p [ 0 0 RppR@@TKd V`0[00S  @@4 x04/'@(@#@ @0x0 cdM>@ ex8I0O-@`'~0Ny@! !@-@Ay?y@ /C3 <}-@{40 3C}@@ @] AA@b@-Pp`K|@P'~1%@ @P 1 $@Q@1T tT 101t@X{ Ѝ$ R 0@4 @ 0@-AMP@ NP Aߍ0G-L1p30Ma0$000P 0 @P/$0 (00000 0 @P*$0r,0 (WP@ !@T (B@P , |( |0Ѝ, | 3( |-@bG-Pp|UUpW @0 S0S``F``T@PA{P z@O-`RYPP Ѝp@0 T    R R @ 0P0l UpW@@IYW 0JPpAO-tM  ᜀe 0X  q_ RL R(@WYP RD 0!  0$ (\F! RL` 0 0 0$ 008A 4/ 0@0BPS 0C pP  #P ROV= H! R   @Y.0P 9@P 00U yYtЍ0P  #J WP ]Y `'>VT `0O0X` `@V@@AdA-PM`pz@P 400000 0>@zЍ7@-Puz@P w@y Ѝ0p@-`PV M  V00 R0S@"  >z@P0kV Q0@0    @P dy Ѝp@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1#010 S;305<0@T Y$ zS z $ z z 00$00,Ѝs@-`Py@P19@ 00003/@:yЍps@-`Py@P 00403/@#yЍp@-pP' c@0P0  P ЍT@ 0 S 1H05 PV00  A0p@-M00000P0` H@P #0@P PxP lxލp@-p PP`IM  @P0 0000 0@P # 0@P PxP AxIߍ@-pP* c@0P0  jP Ѝ RT@ 0PR 0% mPV00  cAp@-0M@P` ' 000 00 00 0 0`4,00002PP #0PP 0Ѝp@-P4M`p @P&043,0$0 S0 0 @P$0S 0@ P T @ @4Ѝ @PAO-PPlM%  (@PnB00S@i8(8_wP- ( 80,00< (0 @, Q00(0H2 , 000 Jx@PG0DT@0` S;# p0 @ts0S@( 10@" H@P 0冲*S`  ? @X0 S$0 00  H0P #0@?oV20S@ P &TV0`D@ wlЍX0S- 0HL@P H0 Hd0c@P`0`0S 8L(,08< SP00@ S00S p $ HA@P P000ɚ;6eA@-@0M 0P 0# ܍@-@0M 0P 0#܍G- pW`P_R/R-?U@ὭPP 0L00 H@$ B# \PT0X0Y P`P :W@ W ` 0 R $R ÕP`0311  U`pV 0 0F0ER8m000  R` RA@bAO-MP 0S 4qM Q6 Q(@AU` R. 4  0$0 8^4 Q Z R7Q=@20SF *WP? U PV:8@` ;@P @0V {UvtЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* [ tT00#T0S  T 0 0$; |岶 hU T00S 0@ 0U0K@@Ad`cA-`MpP ?v@P 0 0 Ѝ000! @u0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` zP3`$00 (ЍpO-DM`  u@P0P S;# p0 ts0S 0 P0u0U@DЍ F0Pⅲ! 8p0P ,0 <0H0PPA-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0pp eO-P0㄰U`!R `VP R@ R R ppG'qZY08/0Եp@-@Pᐵ0Upp@0R0 0S  0Q 8xA @- @-p@-@0`PVp@0 `!b`p@蛵 ep@-@P0S 1`0D0fH f@0L0@0pp@-@P ] P @PS@-@-p@-@TpP0P R  RpPp@  R   R4Hm Q  101pA@-C-@MPe` 0` P 1 p`00eee ee0S GPЍe`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @z0(00M  X ЍplAAp@-P@e Pp00Fp@-@ 000S0S P A-@pP`V lp娴Pp0S 0`VJ`x` 0S  0S 0SDI@kA0僴6P A e[c e@-@5p@-0@SP 0S%Q㵴0S 0S PRP0{@Pp0S@`´00k 2lhP p c eA@-@P,80 S 08  @< @#[c ep@-@PpPܳ 0  p@(0 S 000D ep@-@Pų400C40 7p@}r ep@-@`Psq 0 ` i p@1M/  \@-  0S 0S00;k)/ AA-@`pPP 00S0p&$O-zt@PkiS0S 0S4 3t| i`V/d```V8Z@0SX`(V pA(0S 00S 8 R4 S 00S n `i<08p80bWtQpG p&W`p      B 0 R; 0 R  4R 8 R d( R`V  1Q   R  @ 0  0 47 @  , qZ   e(pW0pW  8p  8p0S 0 0@000000ײPղpOq$勲`V000 ;A[c eb e\c8 cl90S p@-0S pP@1` 0 c 0S 喲/O-PM0S@i@0%@e@`0@0  >p {50`PR 0,0X000`d4s$@P @T ,`PNN0@1z@00@0(N@00@0$0 00D0, @0L^@P pN\ gS[0 0$pa`N@00@0Ѝ @O-pDM@0%@(@0@0P7̧ 50r`P @ T0,00`c4$@P O Ч@00@0DЍB0S&@ !P^@P嚱`VԱ=@ N 0R ʱ)@±001 0 P @`0S $m$ 4$0$0@0@01`0D0-bH0b@0L0@0@0 DD4@00@0 `@P 00S p@0@ 0  0Su/0O-DMP` '(00lBlrl!0` 0 ,`  84$ pP 0(00 ' 00 !0` 0 ,` 84$ P0(00 ' 00,`! 0  840P$0 '(00 !,` 0  840P$ P0 (00! 0 ,` 0 040$ P0(00 00!0 ,`0 040$ P *&`$@f 00`@P ,hDЍ e#A c090@-00PSVP`. P0 C  SK010SG 6@P0S S S @ Ѝ @0R 0 0@0 @0R00 @0R00p0S S S *@@0@ D6@@G00S @*@ cO-M`00CS@|#0Q0p}N$@ 0 Rs $Q Y0 ! o@P ' 0[T^ p(@T R 0lP 0p P pY000/ ;yp Y';0} 0000 p0.  Jr  Or Ip  ᥯4  B4 ߯`n00Y$@ N0  B{Ѝ@(@ eP/ $9O-@S,MP` 0S t5R0 SppSpWH%C+1#0 000,5! 5 l0 0SLpP 2  / 0 01QM 00M; 0S4*#x pp 000YP[0  @0 L00H@Pp4000 0J00p\0T X 0m[9 rp ,ЍxnP (0SOnh pp$  3 0߮*0044$ 0 00,n[ C0SP 0S0S @ p  P@ @ @0 0@0  P P" 03/@ Tz  P @0 ,00!0C00!, 0 (00  C@Q0 ( T u 1R0B S8BP P<0S=/ pPH!@0Wp  1U@0@0  ⭬P  03/@ ᱬ0 P7 10 10S0 -S9#~0S S~(Jf9@b cb ehA@OcxA\AP P// R0@-@d 0  000R  0 /0@-cMPa/@Pcߍ0R@-@ 0S R0a/@-@0  R 0  /0@-R@cM P cߍ0a/P2P0S p@-@`P4Nt 1f]P\ps@-P`  @P @IЍp00A00As@-P`l@P0 @lЍp@-KP00KA-@`p PY@P <N 1 ]@F\@-P` p @P0 @I Ѝ0@-00 ЍA0@-00 ЍAs@-P`l@P @>lЍpA-@`p\PFN 1\@[T @@-P` p: @P0 @6I Ѝ0@-00 ЍA0@-00 ЍAs@-P`.l@P @kЍpA-@p`7 P@Ph 1o\@/@-P` p@P0 @H Ѝ0@-00 ЍA0@-00 ЍAs@-P`k@P @kЍp@o `P/@-ZdA 0( e(00 e`O-QM0 | @ЍЍOQe0R 0 0p hW01h0#0@T_WPUY b3^P2^PPE0Pb|ثP@T d2`VPL 0 @ [030#Z0S@x 23ſPh  0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%0U  &H & 'L ')(Ἣ  PvU0S' 00S 0/ 媫sm0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#Pl e@ccc@b0P R0/x/G- P@ U `ἀD`00@0$V0:Pp 01StI0 H0L 0 H0P0L T 0P0 T %R0XP5\p5(`Pl0pAA ec0P @-P8P/ 0!< 04 0 (   !/@bd d$d\ P/0 !8 00 (  , !/@bd d$d/P 0%%#3/ e| `0R 2"@-D | 1# H LH RH P LR P cp@-`P@TQx`0S<@@ @DX  S d uJ F0SpP!p_Q`_ c eAbA@-P7310! 0 eO-3#SLM  ; 7`#0S @@   D .Pp_b@$@`3`c 0@@ @0@0`Z000 @@ @@00Z Y#3 pB࢟ 0(<0pHg V< "0&5o` V00 S"0  0 ,SXpXW0@`p<"[z 02 À $2%BL0 ,00Rp((0,o l00 0>P0` |@TX 0#0L0R    ^@^ 00 000$0l0 PSp  p p0l U )$dc e@bd ep@-40P (ajZ@P ;UP00p e@-@p^`@m^p@-@000lC_05000  00;0.0)000 Q :0`P =>09#900S? 0 0R9ڜ  I S `P 40083/廧0` =V0 $|$^ 0S 1pp@|Q t  | x x |000900000 0S"^x0p@ ZxS0000 |  @|    , 0C1p@^ ecpc e@cp@-@PZOp@哧cp@-@O0  _<00 0F PU 0 0w0p@/0 np@p^p@eAp@-[  P8 jl0Sp p p0l X  @P  0,P Hx E4 PllpA d0ic1p0: tP00c e@-pM(ppP,`@P" 0 "0V060000lS0#T20T20S qP V 0 0 0 ЍV 0 0 0 @b@- (pP @ P@P $0 R;`P Ѝ`q0@0O-@0@Dp8<P @ P廣4` T@P@0 $;`P Ѝ {P Lߣ10 k,嘣@``10@0cA-P`pᆣ 0Y@P 0 p 0 0(90寣AcA姣c0/ e202/@o/ 0R:****,//p@-@|PE0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@fcA-P`pAT 0S *,P A030#A(0S A- P$`@ZV Z Q+ a 0R010 ` H"0 S(0 1D 0 (00a@00C@0U *AGA 0R010 0A CUcc@-@弢2Sn D!1,,N0 N 40N48 N8< $N $<@(,N(,@D04N04DH8<N8<HL @DN@DL$PHLNLHPT(PTNPTTT X 0%, ,0,03@yc@bhebcep@-]@L c!Pp@P PT0QP3Q/p@-@P|@0Sp(@\DLP00L0P00CP0T00T00Qpcbc20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *LD!000@ Ѝ  0 0Y "!Wm0k 0jP'D!00000  xD!000$YX)0W0WPPU D!@000t XD!@000g >P}U D! 00 0D!@000Q80c@b@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY vP D0s: 1sT ,@@T 1R" I  .  @ : #:0 1!Dc  0DT P T  mD!(00(0 0PP T ZD!000$`VPD!000Y T@0@`@D!000c@bO-T2P 0MS ao@pd@0S; 1s@1\R@pT 1R" I  .  :D #: 0 1!b 0gT P D! @(00(0cЍA,1T v!D!$00$0R/ @ *0.SY Y+0.S (0S X 0 0CX:00P"@ *`# i=@CT X0 0000$ D! 00 0c@bO-p00 0 0S:tRP0lbT 0 @S`0cV`V``V:HZS Wq 'R` $@ 0 80)0  *# V t嵟 P0(  0P0D00`0D0<T a_vW 0 W7 .R4 .R1  ! `1 ЍO 0=0P0 Q L  L 00 L0ᮟ ch*=!R 01a@ ЍccbG-`0 S@Pap ZPp` Qq ahGe0 S00 ///0S/9@- 00 ЍA@-0)  0SЍA@- 0  ЍA@-@a`0,($@ p@ @`<08 :DЍe Ad( cp@-@Pp0SpP`0S  ! JQPUQ 0L 0000 0C0p0S  ! Ie( cp@-@TpP`Pz 04R00 0 *I00peeep@-`ޜ@PT 5H@ 0 S0S 0R00 0 0 ,000R 0P0@@pee@-@寜0 0C0@eO-`40@SPp0E  0S>Q  0RP?S 0 ! I 0 0S 1z{100P+岜Gp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 0 0 9CR:0S 0e( ceeA-@p`PUddG0Pp `P00S 0 000$ 000 00Pe( cA-@ `PX00pQ7T0S0 R\S  ! 0< 0C0 00C 00 0C0 0pA2A( cp@-@0PS`"00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`;898X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 7U 77Cߍ870 <P@@p@@0$ p@W`<0S lJ@T P$<  G@Pp81X10  hG@P LJ0 0 :800<024 @00D04VG@8J T Xf p0 W|00 0q9 m<@P 7 0 H%,,H0pLXp\4 (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* $ I 9 @T($0S C$ /  C%701 P0CVS @@01ڀp41p@H X;T(  2G@P" I0CW IedA@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@8`F F !p$@ 0TC0@0 |@ ST0 F f@8$ЍC-P`M0F000Fp00 0h@P t@Ѝ0 C /  C07s0 0pB@y6T8 1 !S X p  P000`F 00 ęe@-@,Ǚ(0 R @0@e0 c@-@T嶙P00S@ S @R 000e0 cp@-P8囙40@Tp@ә0S 3/@e0 cA-@`TpᄙH0PU4彙 0S  3/@PPe0 c B@-  Q &Q  FP-/p@-@@P0S0 0S!0Sp00Q!7` '00`00Q \R H  vO<YQ C0\SAAhAAp@-P@@0Sp0700P 0S!!//O-Q48 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00c8 c@bA cp@- l3@ h3PP c3p0P00p@-P@ `APp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P $10P@1O-PMU@  DPC R& R#     TP 0T R@0P@**P W *pW`/oU" R 5 0Ѝ `P  0h*V O-p2`M0 @U Q Q 20S@0000-   R  {5P Q P``Dz_P0 P K|0 00000P @0 Ѝ 0    0 0z0`0 0@000 0S 0 25 ?PP) MU $5P BP@U 0 0  P?00Pu0 7SP PUPPT  000 B 00 @beA H0R  R/R20R/20@-@1@ 1@-@ 1 @  p@-PP@P 0+P 0#pp@-P`?@P P 0+PP@ pQ@-@@P 0@-0@S 1)000p@-PPEUPp@x1PpO-MH00@,00D8 <000 ,0(P0SP00000000PP  0$PH0S! x?0S 00P0q/0 n/00000 0 0S 0S H/0 00H> c0 P 8/0P 3/0001$p@s`0V  x.`C0 /RI 0S  0 0 ` 0 0S $/0 P /0P /000圹0S =rP  `pR0"  ! P !PS U0 [0 TzP 0 S !" 00 `Sv Br 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S ~.0S00T0.0 X.0T0S P X  Q   P S0S ^.Xp.0 0000000S 0CSg| J 0 00 00C08+  Q~  00x0d0 p0Pm pP\0 00 c03Sa d͸ +.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S -0 00000,00SQ 0N <0< (000000,00q,0(H0(0b0S .P 0p0p00S 0  0UG U- .db[/ -TP0S p00Sp吰[ r.P 0 pP0  b.P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU S|-zX0 0T00 0S 0S0'0-00 0S S0S L- ^-0 00000[S009   R S R S0.- 0T00US0S 0S0?0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d 1 000 40@ 2=P ?-B .\0 p00['`0\pp0`Pt`P40p  /? ?X .ꀀx.80Sh50S 1@0.80/P$0 `@R0 r {R`" /U  0X \P@0凯 $ 0 S o*000/U  ` `[0/P$000N0}P 0X0S 0/U00S 0S*0S 0+P0 SC*/U 0  L00/P -00`$0L0 /UZ Z2* 0S/  P) 0 S*/U  `0 00 /P$ X$ R  $0$0,. 0 0 S:$.?//U  X X 0S P 0 S */U 000 ` s/U X X 0S `P @0 1 w 0 S */U 00/U [ [* 0S P\ 0 S *000/U   `6/U [ [* 0S xsPh1 0 S*0/UP w<1 `00g/U[ [* 0S SP  0 S L0g*/U00 000#/U4[V ;P1@?0 d}E 0 S 00J*/U dee@bdAYA@D cAAA A8dP: X 0S /U[ tP?>:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@w P?Pq/U`PPkP(j ,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0)0 0PS U<00U0S R 0S ,0  0 PP )U`V ,0 z.``4ЍA- 00S : *E0pP`4900@   0S P n)@00WP@J.@P ^)jA~A 0@-@DMP\, 0\ 0\ 0\P  D 00 0>T4@P00DЍ0@ AA-P`pO@P P 0 P10 A-P`pF@P0 @Ѝ0 G-P`ሀ#pk@0T00/ 0P0TᝌZ(P 哌@  ,PV  6/P 00S0P00P0x)P07@- 0P @P  VxB Ѝ0Ap@-P`@`` TP@ @ G    0!pec+@-@^0PY<0(G0崌岌尌P b@!ep@-P "@@ "@pp@-P"P@@@ "@p@-@!@A-P`P 00幋p@T00 0S0PPP@ 0S@@݋V P@友cep@-@QP \00SpPT ` @ Vplep@-P`+'@g0 R000@00P0噋@pp@-@&P 0PO/R 00/ 0P0僋p@A'0A-`@VP p6/R 00/ lUP p'0000@@@]VAO-`M@n'$P̡̱$00?Pڍ?@!OCAd@. 0P p- 0 S   v'4 pW U,PÚ 8pP# !(7p 9W T'W' kPUPW00S XPrX R0 R 'P &P ڔ  BR*'*'PW Ѝb@bgfff@-@@0 !!|0x0t0l000, !  ! 40 r@P@A@bd d$dld#A.A 0 Fe0.Fe0(AFep@-P`6 (0P0P0P@0ԊЊ̊`0 4.0 0@0DbpceA-Pp0`VR@ =@Ph`d0l0d0CPP @ 00 N/ V?U 0WI=.pP@c4 c0(Ee 0 (Ee0 (Fe0@-0MS@PV@P@ 0  MVP V@P@ BG&Ѝ00@-@P0UP0S# S  Ѝ0`@P @qp  0P 8`&VUP0P (`@0@ R/"A-P`@ t0Q30Dp6@0@c 0Sh圉AqAXA薉 Q TQ1@010ecep@-P'000@ 005,0$ R @@0@j@pce@-@P V0 R$ 0 V@'ceJs@-P`@P !0R!0RЍpA-`p@PPЍT$ P*R0*T @A-sMPx% P P8 P L?@,@3 sr* 0" "@2qp@R P* 5@7T >Ѝ@2P `P' PPf D0SO@ 3/@d00Cd0T\7`dPK0 (b90d00d0 @Pa @_PU D0SK d00d0哈D03/@Od0T0Cd0<A儈U|A0S2h{Vd `>L5@T)8o@> 0z> P0 r>p>O@ PP) 4:7$whPh0`V>h@0P  $ 00$0$0$0@儇]d4AA;cWAAdAA:c:AeA4 c@c"V "#A,A7@-`0P @P  P 8N?U.0 V? > Ѝ0eDAO-pP`0M⁩Ё @P Є c P N?U.0 V?A>p V  lV,<V T&<[ H"<@PЍenAoAAA@-@ < @A@-$0C00S@@bXdd0P0S R0 R 0S 0S/00e@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00|Ѝ@- 0 0tЍ@- 0 0lЍ@- 0 0dЍ@- 0 0\Ѝp@-@H0  9PH0 0S010H00A PA.00Q00@@@peP c"0O-DM@00(00p0,e@-@,~ 0 0 006V0,eQ3_O-M  @ (R0 @PBU1# (pU< ` P``0 @P 0@P( 0@P  ,@P@  @`0V 0U ߍ`PC-$M@`100 00(00@ 0 ( 0P1 0  !000p p1-p 0-pP  i# ?$ЍT   @p @Ap@-P@`M$ G !|`+Ѝpp@-@P`M< 6!! *@H-Ѝp@-DMp `P@P 0P,@@00P/4P@P DЍ -@pC-p`Mc!*PP*0@S+   0P0`'01PK0  000`0&01PK0S@! @*P,ЍyKxA-Ppl@Pdu` 0/S ?=@P0 3Ѝ0 du@ 0/S <@-`Pddvp 0/S =@P 000dv@ 0/S <Y ЍC-1@3p MaYP9+ 0ⰱ@P, @P'L10S 8 BI0<00@00000/D@P (0S" ,<,,(0P(@Ѝ  UP @P0P0$0,( <0P0T0< P0+@P(,m@bdA@-DMpP @P`P0{ @DЍ ,  @0 0.4I@Pp0!0S RW# S+R@ , 4+@-LR@, *@,}+W+@G-M⨀`P pa@P [@P0@0X.@@P($pY +H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0/.L|@P}0d``PSx08x0V p+0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `!@P<U `PU 0R'S)XD X 0S#YH 0RD@P 0 8 C*0@X03/# ЍS@@UV  + +0X03/ *cU _8 * ZX@@@8 @-P !M`#q @P 0,00@0000-4#@P B@T ,x*T &$2@Ѝ @0@0$0 0 00+8+D 00, @0)@P@b A-pMpP`+@PE?`00\@4@80;-4d@T pЍHP0S@00000 00!0$0100! `(0 `*@P !'@P 0`F0`@-Mq` P@P 0,00000@0,4@P 0S ,)0P@Ѝr@0@0$0, 00:#:D0@0O'@Pr\@-0 R@ z,eO-5LM@P $ p`tRP P p$P$P NY 3 LЍA8, $00x0PYPSPUQ |PUPoU00&8pP|P|P0E S p!#P# * | p P6 0S U0 (P T X41Q (P<(vPf0((0P 00 (( x(P pP pG |0S 5$` @ 0000-P0 WP0=z0 M85 0|0i 0M( mza[x0S | j |[Bz0S PQz~ $0  @002 00   0S 00 0o-P] PX0y M8M( 0& 00001 0! 0 000 |0PW  9p [* 00M(  A +%R0y[0dV 0 oP V/040w    R Vj 0 RPb tV/00|00 0$PO-AAA,ew]AA@- 0 0 0000 yЍA-`PMp @P0@00<@@0+D@T PЍ(P+Y(0 @@0P 0,@P 0 0@ @T(Py0S O4@ @P0/S p4@P0  dЍOc@-p0@ @`jPP @ (0 T@J Ѝ@b@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR000BS` F00S03P R30Ѝp\! ! C- pሐ)P@``V`31P01 0@PP  ЍT0p@-0P@-0P 000S 0 p@Fp-p0ASG-Pp@ `LPP00S!3 T` TS @P{0p@-`M 0000 0Pu'@P@PT0P00L@$@(0%T$0@T }`Ѝp8`xp@NT  @P`0 0S030 @P 0S@3:@O-P0!M0#q` 0000 0 '@PcUPd  bd4@PX  a@PF@T0SG  /@P  @P  #4P 0S-@+" o 0$  - @P  0Rs0X  X s 0 P@Pl" 0  3Ѝ-@@@b@- x Ѝ@-M pP 0`&@P @P`@!T&@Ѝ@-M@ 0P @ЍA-M P` 0pf&@P @Pp@T 00 00@DЍs@-P@P8 0`00@P @ (Ѝp C-P0M 0000p0 `&@P  k@PxpP0, @Ѝ @ @0<]$D@PZ(`V@&P$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<*!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,< ,,P0< (i@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0-@P+X@P$0`800 @4`0# <H@P 0$S@0S 0R@4 @$ $DR@HЍp@4 $ 0P5 PAA@-; 000c0 Ѝ@- 0;0 00Ѝ0 c" 0c000@-DM 6@P$P0@,P0000E#4@P 0S00,5 0P  P @DЍ0  , @P ,  0c I0F0 cA@-0S@`@P00P @ 0,Q@ 0P000 1/@t0ЍpC-pM`0PP 0c0 @Ѝ 0,Q !!1/@P Q@@F000@-MA0 0@RЍ0C-pM`T0PP 0+0 @Ѝ 0,Q !!1/@P R@@000@-MA0 0@RЍ0C-SDM@`p.  E_U_`S@P#00P,@@0d"|Q4 #PO!Z!P![! 4P@T Wo#DЍV@ `c  @P @0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P "4@P @ЍpP?@ @-0 c Ѝ0@-MPP @@0cP OЍ00@-MPP @0cP >Ѝ00@- 0MP00P0#@3P *Ѝ0@00@- 00 c\ Ѝ@- 00T Ѝs@-P@0` F@P w@/ ЍpA@-P`L/@P 0 pb@. Ѝs@-P@0` @P L@ ЍpAs@-P0` D0D0 0@P D@ ЍpAA0@-0 c Ѝs@-P`.@P0 '@.Ѝp@- 00 Ѝs@-P@0` @P  @ ЍpA@-P$0` L0L0 0v@P@0 +@ ЍpAA0@-000 c Ѝ@-PH0` @P00 0 @ ЍpA@-P` .@P @0@G.Ѝp@-00 00 Ѝ@-P` v.@P 0 00@).Ѝp@-PD0` F@P@0 @ B ЍpA@-PH0` 0@P00 0@ + ЍpAG-M0`@S11\p @T0s_ 0s0Sp 0PPp?X!(/PP 0 SP? P0UPP(d0 s` 0 s pUZ0!(00PfW  0S  ^PP Ѝ 0s⊾P0PPAAp@-PM`-@P @0 @0c0 f@]-Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S (P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` 9-@P @0  00@,Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ @P!@Pk #!*@ ЍpAp@-P@,0P @ 0<Q-@ 1/@,pp@-PM,@P0L` 0 0 @L~,ЍpG-PM,@P2 0 @+ 000  0- @`@0! 0 J R@@`pXbP0  @ ?,Ѝ@p@-PMq,@P0L`? 0 0 @,Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp,@P 0 @ 0 @@P0 0@0@0S 0 h00+Ѝd@-,0@31!$ @bp@-P`Mt  @dT0@&0S00P04 @PЍp07@-<P @P@ Ѝ0AO- ` 0M&J0 S1 0C 0 p +@P 0  @ PTe 0S@  0 9@A+@Ѝ@G- `@ 0p%J0!S B   k+@P 0  @ PP5 0S@  0@ +Ѝ@@-@(k$0S( ( (0$ @kc@-@, 0k,0$ @R$$ ((0kc4e0S ( #P QS//@bp@-@ptk 0S0\P 0 %0Sp Q R$0!!c4e8eDe0@-@ 0 o%"@k4ec00CS0/@-@P $ 600C0 @  4e0M, 0S*00Ѝ/4ep@-Pp0 0AT 0S P 0SP@p0S00   @4eA-p䀟3AT j`P,k0S @000 kPU PPhjX0 $"3`U3@103 P000 @@bc4eL031S  R R0SQ 0/@bA-`@P 0S00p$P P 00 $$V DjP 0$0 j c8e0@-0@M@P `j \j  y$0h 0 \ \0  00  , $0  Ѝ0c4eA@!:|!:b1S/p@-P`t5jAT`oj\@Q p0S `` ```@` $c4eA-p` P0@PP0PpPP$j 0 0! A;jc4ep@-P@`i0P 0 1S 01  0S 0 0000p@jc4e . + (G-PP0S0C04q0S $0SB !$i00 Gi`i3}?@T iV @ $ ` R   R  R R R A 0S  B 00 0003``}?00G#4ecDe@b@-P0S003@oѠ@b@-P003@o@bG-`P@# PpW@ ЀCi `a#@TW% V@ @00@P Wtp `fi0U 0S  3R  P $@0304ec@bDe8e@-K0@-E@;icp@-00S-@ `P4@P V\ kiP#@h@P (ip@@ @ecA-@t`ph0@00Li7Pp `E0S0P0P0`cA-@`phP|h,@TXIT0S0 R @S    cG-0 PP;0`0St5P $10S00@S00 " 0S' "\h 0S00hpW`0;00S0C0ʊ" 0S "pBh0h0X{hLP00" 0 3/`Pp0"ecDe8ep@-P~P@1S  DP⷟Tp@p-@- RA-@`PPp`wVP,AH035@A:\e0P R04/p@-0@S`L Xg0SP P Q  - `a0SPE 00@0@@U04 @ V @ 08VU@P@ 0R08<J0S  B2@ S * p00Sd% 3 @0T"#!p@,g#0@(00PpV@cc\ebbMbA@-@g700CS4.h A>@0@ l\ep@-@@P0SSpP@-@ P ET@GpP P p@-0 l@-! g0p PTQ>T@Pu0P00 00""00,p\ezAAcp@-PX0t p0ATp 0R 0RP @\eG- P@÷ ࿷U `ἀD`t00@0$V0:Ppfp01St g0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P0pAA\ec0P/@- R  0 RP <04Q0 4R/00C-@2 TMc刀pn0S @Z=00fAjfH0   . b?CH0<9H0f再 00@SPP0S Hf Pff0 000P T BP 80S ;40789/0 00CS>3`P !0SP U`0S h`e0t p 1S01  0S00*f0U [ep0 0000f0DP00eTЍ@bcA\eeeO-@`Pxxxp 0R0S TP1 U ֌V ee|PP e=`P ! P0 [P01 X0S "r0S$U 娌V ete`PP1S  EP UQU \0R|Sz ЍL 3S00SV 1P esGeV P VV `P0xH0 0 U 哌Pde ePbH0   . b?H0P"0t p0p! Aa0 0000iL2a0a !,iaga@$a aac\eO-M ` p~D@  `vPȐ`İ@la P LЍ@0 t p0 P! A`Āp+a c\eG-M K8<p C`` @ P` aWp0ĠȐ t p!R !  R t  At `!R ! 0 R ЍGc\e7@-@P`0t p 1S01  0S00P00000`P hr P p qB^0i`L000000`Y Ѝ0c\ee L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVY[ 0S [ Y\ 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000  00UP48<40=  , L06   03 00vpP * P RP[P2 PV UG@0@01[D00, 00@0P ^y[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P ?[X  X y[, 0P0[P0L P P@+ 0&@ P -OY 1PZ- 1y 000 20 @bp@-PP@`e ZX00CX0'[ oPYp O-,M\@`ကP`dpP>0 0%!X0ЍS`!  =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡@-TV@GߍA@-PGM`p0 Ɖ@P\0 @P 000 @-TV@GߍA@-PGM`p0 ⠉@P@P0@] 000 @-TV@GߍA-`0 Mp @P'`00 0@PppU0PV0 `F000pP P@p!00~-TV@ ЍAA-`0 Mp h@P'`00 0@PppU0PV0 `F000pP P@p!00F-TV@ ЍAG-P MK@P)0 000 @PV0`W0 pG00 0xP P@!00-TV@ Ѝp@-PBM`0 Ո@PP0 @P 0  @-TV@BߍpAp@-PBM`0 Ⳉ@PP0 @P p0 @-TV@BߍpAp@-PBM`0 ⑈@P@P 0@N0 @{-TV@Bߍpp@-P`!0CS@V2Pp0Pp&-00p@-@PS0 *p@*Tp@-@PS00PPTp0@-P0M 0 0P@P0 03/@Ѝ0A@-000 03/Ѝ4A@-000 03/ЍPA@-M0<00  3/@PЍlA@-M@000  3/@PЍA@-4000 03/@P~ЍA0@-0M00 03/@{TP P_S<0 0R 0;*SЍ0Ae@-000 03/ЍA@-000 $03/ЍA@-000 (03/ЍAC-0M p08@P% 0"sr`@ P`S $RS0 ,03/VP T 0"Y0 3:UЍ`0A@-M@0000  3/@PЍLAC-M P 0@P @ 0 `R $p S@0403/ 0P Y` X0#3Ѝp`hA@-( "!0 803/ЍA@-( "!0 <03/ЍA@- 000 @03/ЍA@- 000 D03/ЍA0@-P0M 0 0PT@P0 H03/@Ѝ0A0@-P0M 0 0P<@P0 L03/@|Ѝ0A@- 0 00P03/Ѝ,A0@-T0M0 0 P @P0T03/@WЍ0HA-00$M0"!#!0 X03/$ЍdA0@-,M\!#!@0 00P @P0\03/@+,Ѝ0A0@-@0M  PP 000`03/@PU 0QT 0( 0 RЍ0A@-@000 d03/@PЍA0@-,M080\ 0<0 $0 0P @P0 h03/@,Ѝ0A@-M@00l0  3/@PЍA0@-@0M PP &0 p03/@PrU 0gQT0H(0QЍ0 A@-M 0400 t03/@PNЍ(A-$M0(000,0 00 x03/$ЍDA@-000 |03/Ѝ`A0@-P0M 0 0P@P0 03/@BЍ0|A@- 0 0003/ЍA@-000 03/ ЍAp@-x0M` 00P  00 @P 0 03/0@P  ЍpA7@-00P00 03/@ Ѝ0A0@-,M!80\ 0<00@0P 00 @P003/@,Ѝ0A@- 0 0003/Ѝ$A0@-L0M 00P x@P003/@Ѝ0@A@-000 03/ Ѝ\A@-000 03/ЍxA@- 000 03/ЍA@-000 03/ЍA-,M 00H0400800<00@0 0D0$00 03/,ЍA-$M "!00 00 03/$ЍA0@-X$M 0 0P @P0 03/@F$Ѝ0A@-M@000  3/@PЍ A0@-X$M 0 0P @P0 03/@$Ѝ0^0PSP 0PU,0%V Z1 S\0</0P0 A!⟸00(0S#0(0I`IX 408  (0(\*40X803/P  0R \$0S40S  Rp"R 0$0S  0R \} 0 V,0"&0:808 01<0D0 000<0000 0 0P $0Se <op<< l0& $0ST P<` 0P0 0~0S8 00l08 Poo 0bp @4\  0P$0S* 00, PYV`` 0U`V <\ 00D0 0000000,00P $0S  p0`@00@PS 000 $0 P0<731|0L0S  0PX0 @00`V,0P0U`PY0 `@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 vI P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ  [L0S4 00S ;@XT0X00S 40S 0| d0  d / ,01/Po@0SRoC$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C Ṷ40St 3^P0x >0 PS 0%VZn0H 40U n0T0tPx`F)0 0, RS00V00S000 q 00 E 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 000X 0##@0 080UDWY 0@  0  P0ShnPݿᠿ 0D0 0p0 uP s 0<!_$0SL3 L00 mX 5nw$0S0`0~ WA@bH1O-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,0ֺ0`S P00 0 FH0  d0SyGW ,0S 408 03/mPEߍW5@12 0 SpPP) mm`눀X `,0 0gm 0p,08P @1 40/0\3/PP 0 0z$0( 0` @1]V` @1 0S 00<0 R0@`D800 0 0PP "$R( 0XP BKFX H0  0S0000 0S 3/H0  0P d0SUmL0+ gH`aFi&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0P (`,m넅l 0`! 0  D1 SD1P P0  S 00(`,S Xjjt$ (0 T0,0X0040 qX `X 80` 0S4`080_8`3P @ x⊴ 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000d[ `x0 A !id` B[x0x0   @> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`000d `0 0`0`0 \0`0S"X# d (`,0C6`ïDl0` x0P 05/PkU 0xP`0dx0X 2@0PD0  $0P(0 R \0S  R ᘽ c ᤽`40S  ᑚ  <0 0 S ~ \ ᘽ0 S\ 101T0S@` T0S k@bdAA̰d@-0 000! Ѝ 0  /A-@0MPb },0F00 00hЍH1A-@0MPb d,0F00 00OЍH1O-$@ @` pLM 00 0 00 0 0 0AOoBBLЍ06 ?\0gk@@ak|13100 000 ` 0`pMk 0S@ojQ(T [1 0@  @& (  6, ?(#<@$8C 0(@P8 R  ֲT 0@ 0 0,፼\ᙼ`@bG-@0(MP3 聓0bḿFa@Ѝ @ 0CT0 0T0C ቛ0000 0$@ b62< RW1Q00Wrp @0(Ѝ@bO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+pi0 @20>00 0  .p0 P(0 S00 ,40P1~pp p,00 00pG<010801 1!&ᮗWK8呖|1 0(0` 000 :#: 000 ᖓ8|0 v ,XE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H < 04 HΒdM>A cb̰dX:p@-@PqB0 Rp@BG-P`$0@p3/@PZ@00@800 4/@P 40T00S omVx P P$03/@P P 0Sf P @0S|00S@0SP 00L0D 8/PP H0U00S @2@ 0W4 V4 P 0S m P 0P e 0S0S PP 0S P P h<0 P0Ѝ0P PPSSA-`Pp@ T AW ;AO-P @`TU  'T #0 0 06/@ ЍG-销@0H?oP20p`PS V TXTYGO-DM,00000l h 0 @P QPሠ$0 3/@PF`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Ux X880 R R<`VS <`0S0S VV86<P @8-DЍ8pW0S@; x0S@7 U l0 0Rl0 |@P*   03/@P0 @t 4/ 0tPp@P 000,0p 0@ 0 t4/@L00SF0 80S @@400 @ 0 t4/@P40S,80 0,0B 0<0 0p0@000l0P0 0 #P`@p 8p40<`S0 `p@4P Tt o<0 0p0 000l0@080 0,000V9`@ 0  4/@P`t0 @ 4/ 0PtpO+0@tI@P000p00l0` 0,0 0@ 0t4/@Po00 00g 0R S@`@ 0 t4/PB@VS@RA-P `@0pv0S 0nW 0gT0S A0\p@-P@ \ pp pO-pM0<0P0H00P0 8`@DL 0t@P& W0V04 P0Y04  0 ЍO  WP0S NP @Ѝ /A-@` Pp8P W $0 Aj<@- 00 00! 0!""##$$ ᬾ@-`??Qp@-@ Q  8PPpp@pAQp@-@ @QN\0@$0@0$0ppP2?$@n?Tp\0$00$0$@Qp@-@ @Q /ppP? 0"R? 0"p@-Q@pP @Q@p?d 0$ 0S (0, 0@@1?d 0$ 0S (00, @@p 0S/S 0 / E/0S//0S-/@- A//@- G-`@0S 00s  r Pl 0 r 0 pW S S W  P UȀ- //@-0  @-   e  #fo    e4e/@- e@- 0   e  eo    ee@- be@-@MfPeP/@-0Lep@-@Pd@pd  ? Ra0 ? /0S S S00 /$0@-h0p00ADAXAddLe eeA-`p@ PP @A=: <900   P1 @0<3@0<O-@`Mw0;*}.0d 0P"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H"Ꮰ@ ` 0Pㅠ2 S n2@`{? x!2@T`0!n!:#@T`0!b!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @20< + ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@AQ<0S00$00V (`嘀?`aV $'0#$+41P W8P< * !%!  (F$0 ᵟ V (00100 @ D@-0@00$00ωPp@-@P`R/PP`䍶 ᢁPp@-@ 00!( :@ N@-0@0!80@0A-P?@ `!tpR0 W\00\0  WX00X0%0S`00S 3/0500A-@`PP pz0⎿0p@-0@pPi0巭@0Tp@-0PS@p 0x 0000ሾ\`J00 $A&]00@k Ѝ@%AA0/G-P`t@+0U 1P0;m0SG[00S0p SڬP嬐U[PP !F003/0 Z#Z P & 00C0Z $00)0/@bp@-@PPpp@p@-@P/00P 00$00师p@0O-M00pQ  (@`TB  0 h : 0a 3㺰t 0U0Ѝ0 @00D0 0(I 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  gp`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/ҜE/"p20S-0 700m`P1 TT *600 0!00 @`070-f 0R88@9S}E/۰@-P`  d~`-0$0> 0S`: 0i`P3`x-@T 00-T{ ˪xT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp@ 9!%6000!0 0?pP Pt` l~(0S00 3/v0%  (ЍGi0 (p(P  Wpt UPT<$',P * O8SЍR 0030#  P0l: 0$0 "ǃ Q0* 0 (a (AAAdAAO-@ᄠ?t`pP Q4,0SU`V` , Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU//A-@PCSkSG-`pR@0P @`PO00k1Q,01,aY巶Ƕ0  ᳨ 0 ᭨匩  0 t,, x00Cx00S  . t^,~T'R 0!400:S,R'"A$A`AeA-@|`8 P X0 0 1@01?::0 5:1<,Q@p``  0㐚Wp0G0A A-P@᠀僱0 0P`tp+lRdPR+m e++wᏱ00wAe  cG-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC FPTP1#pAp@-PR@DP0Sp@0]R0Q 0S x@eAO-M`8*T(;bA-@[$0S* P0p`Xw0X B 0b03"P H8 h1728 <x 0ko$) *Ag$00A谂ap@-T@P"`0S00k_0ӄ)0 $&Aĸ)ᔂp@Cs@-P `ɧ@P @T Ѝp @P  U ) XX)00C-`p@PP Yn)hk)@YDl0S/ 0PP Ph)) Ѝ 0PU0 p  崑l00l0 W<181P0081<1<18!0@1t2)| R T @1S 광tc)1` @-@`P 0 0`0 i*Ѝp,;(;@-@`Pm(0 060`0 V*Ѝp,;(;@-@[b."0d0S 0S 3/bЀe+@-R@` ! pP! ר0 ` 0 B ^\ P 10 6#::00Ѝp##G-P`ahpt((|@T(G(P VΛ(( %@1S @p@-`@P& Y_(h( V<1810081<1<18!0S@1  l00CSl0 pp0 1sh((pp0O-p, Nlt 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 pq^P$ p,0 60S0!L0p@-l` d0 hs@H0P*0$p,PEr  0@Wspb@cdM>Dc0 60S#3//0 R@#0 Q /R0h0//\A0( #&0  R /E/00S/კG-`0 00000P@P< 0 @@@@p 㜼P@TT ,ʂᎼY ЍGL T1# @PW01H >4^P0 KP @Ѝ@b e4!  \ / : sB e$0 0!0 00 /@bd d$d0S  0 00/p@-|0pPd3@1`000/(0, 6Q 0/(0, S @@Vp@b@-@0 00R 0(0,000@p@-P`@P @ `T`0S $0CS@ R(08 8@@pep@-PU @`00p`h0`P:ppBp@-@pPQP-p@p@-@P`E0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $TUᆻp0ep@-40@SP 43\0,0S S 00 008@Tp`0 6/@ep@-@P` ˋ[ 0P6 #::0t $00000@0`0: 0p(BA-Pp@3A`1`00 0S60S50S 0S E`LPK Q 50S0 xg}050@beL^;@-@BD0S $UP$@K@-@f50S0500S @A- p!PPFĺ9@0(0@P<1``00}lx}P SPPPPPPPPlPlB 00 0`S 0 r, `P 0@PЍh;edBhB@-(@,0SS0 DP 0S @T-\M0Q0 0S 3/\Ѝ G-`1@p31`00l 0RP[50Sx|0550Io멒B R  00 0S#P< 0 0 0  嫟P0 0000&6Q  R  R   0 0  pPP #P 0SPU  P P @b 0O-DM!0p`hA0 <0 0,p(`$  @P0(` 0$ 3e<040p0 ,00!0 0O0 0 0(`$ e<040p0 ,00!H0U@ 0  0(`$ @eDЍdB cf;e;d;O-QdM@0 | PdЍdЍOkdQ0 00000`0 PPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H nk X  JP `J@ GrpT @DPeO-造Mx@P` p_0` ᯝ0r0l ,1 0(10$10 1H00XF` 1?o2P0SЍem;C-M 0P`` @|p0 P 00 00 0 0@`?o2P0S  BP Ѝ cp@-@P@T $@DT\LTpP 6=0S(@0 (0 0uQP,eBpm;A-0pP@TU,`T`1 !@DP0 BD0S/0@-0 H; ЍA-@dp`P0S$0C(@@ R (0S $0CS `PAe Bp@-@P T-p\P @<0@ @$ } pedBLc cXe@-<0DT 0 !0  !@bO-@Mp,@T P0b0@DTЍD <0RTSM (₥۾0 0 0  @0\P: Ui000PPPEf忾0 0 0 ʾW  0R H/ ( 0 S" 0SZ,A嚾0 0 0 奾P@T @DS00 6P5Hoᨂ0 pQLa :/0X0 geMbA-@p `PBM 2SJ@ @(@0 0@S  ⭇02 100 0 0P`9Bߍ(h;0@- ! 0 !A-@`XpPU 00`0S 0U0  03/>Xep@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#212V@T  0"0#!"4Ѝ00 030 Z}wh`P0S @D R 2x# P1  PT  C\0 : :0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ |:07=>?00A0Q01 0͛P00 R 2: ^:  P( U 0S40S ޚ81  00000C0( @D0P0*=(  2 š80S 40S 0 @PU 0 /@PP220:00lp\ 7/U P @p03/@bLcBeeeA-P4E,a @T @DT@T $@DTAt30S 0She@0S&$S>008P0(00S pP ZN<z080u00n=(@eLc@-0  Q:0 0(0 0QS Q  ] Ѝ=(h;00@-AM@0 0 0 0P00! ! 0@ +=Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp pҙ A9#RH L0S0P  <-CM       rCߍG-P<pӴ@|`[ PPl00P(P$P,Pe0$008P$PS( (0 z 0P pG|eLcp@-@,00,0PS0z0,P@8PUp`0 6/PA-80P4@`pxzT  0A/ c080/ c@-@P zP @ rA-Pl@`qT1H1x`31`0050Sv0500S 00000P ;P 6 P 1P 00P 0000vPd VMdbBe@bO-鼪@,M3p1P`0050Sxv050`V `:W 42090 9W 1C7CW 0SY 00#212V8pWW `Ḹ$pGW(n#2!128W Lx8Wp8W 2;C?>CW >0W >C 0CW H,ЍOF8(0 S008(0 Sz007W 0Wp0S 00`7W:> W`0S  `d7W  ;CW0CW5C 7C0C07WC H,ЍO6W^ 97W >C0CW1`ܖ W 6W)`VfX# 0 W0@P0Prp|&0`W`ppxPVV N$6W! 17W 6WL000 RV 5pW $pGW`5W 00200S0Sp%0 R01 5:S 000\Z` XX  ᄲ `9CP |P `~00mV2f0S*4 R6`P0400 R0S 0 S; `00  01  D` 0 (pW $pG`Ps0S R0P WS R (PU $PEU`4p000PW l P040  0 B R`-0 E0 0A0CS…R'X1 g`P,0(S(0SϱP ɱP`` ±7`,G0S S 4000(pY1X*,1`s{@?P 01 1i{ P 0S 0 00( , 0 !(00,00|060y000u8000S080n<00S<0g0@0d@00D0@bwt@HpB@~B f@pBbbzBeLcoB@|B@oB@BBfB@{B@}f|fvtgBBfBwB c) B@B/P/@- 0`( "4`# Ѝ0M0000# Ѝ//Q02 //0p@-0^PN^00p@A\" \ @@T00 ^< ^  80p00p 0p pp0\ @-L\ 0 AS/P 0000S000/AP/G-Q@1 P`@A0pS S0P@S S S @S S 0SYS 0SQ$0PUp(0S 3/XP c@-5p@-@PPp0S00P00C04@-@( p@-Ph@1 01  hp@C-M 0`p` @嚑P 0Q 00  00P 0@ 0 7ToP@@T0SЍ6060'onG-p 0P`M !` @aP0 X0 000000@PS?o2P0SЍ茓;@-@u0(q@@-@ i0@.t0/0(P/0S @-  0@/Xe@-<0DT 0 !0  !@b//0@- !q 0 !p@-P@p@p@-A` 50S 6PU 4 R040`0,p@ 2S 0C8C8_o2RU0}ncbA-P `Gi|<0@TA00S p3/qX@ cp@-@P`03/,`D[ 0S 08 000 0S0(D@np@ E BbG-@d`@> 0  +PP0 0" P00@j ) Jp@$ 1@DU] TY @ 0S  000@J G@SUQA Xl =$X 80S  3/XX 80S  3/Xc cA-@P(p` *R'7PF30 0 0 UhJ004 0  004  @0D 0 @0D hM3 000SP0PP0P0A-P`p@T  R    B "Tp03/@-!K 0 4;] Bc ;C-`M ` @0 @0X {p 5KP;F00߀h ?0l 0 @0GD  80 q ЍCW`ecA BcHA;P; c0-DM000,00(0P0 0H0000<0$ <0< VDЍh; B~@-0  } Ѝ BO-|0DM S4|00^@S40p0d(00,p$  `<0UP` 8%440S I<0S/ 8:` p l l0@a 0pc(00,p$  `<0UP Tx0L#LLcSSD3x0 0000@000S ~_S #S1!~_O@oPDЍO 0!<0$   ,(plUP 0!.00<0$   ,(pZUP|0 00!<30 $ 0,(p80EUPg0 00!700'>< $ 0,(p80/UPQ0 00!0>`0,(p$ `80< UP? ; 0!<0$   ,(p UPg 0!p00<0 ,(p$  T0PU    '.y` ,(p$0 @ 0`< TPB >P1S ~?S?11~oS1O@)oaN4;; B B c4; B;c`eh;ped;O-LM@c *`d` P@%B  t呰~ 0@Da<00,(@$  `D0TP <LЍ 0!<0$ 0D0   ,(vTP 0!00D0$    ,(dTP 0!L0>`0P,($ P @0D QTP l;̓; B B<;@-@PA ( ׯ@ 㫨꼕;p@-@PR`寯 Q   嶯 0p@P   RP PP  墯B0 <0x 8RR00R0S 0S/ 2Bh;;A-`pS aPTP@ p \A0V`` B谓; ;p@-@Pap0p@/A-M` 0P@Txp~OD&ЍA -P AT ~ODT`ec@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@h;p;t;;x;;;И;Ԙ;l 0@o/h;A-@`pBTD@D A0HP0UDPES7/@T@-@4Y 00( R @@0000@ `e c@-@0F 0$S   00C0@y `e@-`pP@M1 PVP@i ЍT@UP\0pWU  X0S   Y9@PpPE`?@`e c0L cO-0M05p  s3PP, 0 X`0@"40e300  [3 w$0(0`0`Ѝ褺;0@-@%m0P m@,/0p@- 0 `   H0D0R@U DPU ?D02DPSH H0 lR0p@ĔPH0S D0SH0D0H0D`SH H0 lH`0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S MPP0r00 Ѝ0p@-@`P5 0 503Upp@0[0 L Gc0S/ L UcA-M@`P>p0?P00GSPBT D@DTo>ЍAd -:PH@@-3M@03XVXp)`RU DPEUEPP70PUЍ.~'`HP0S00P00C0'.,0S 3/XP cG-VM@V/ vp4T }?8c 3"02Q  ! R!0S Qm050 th, FhZ8ѥ䁄刀 2S ?  ǥ0 2ZRU DPEU RU& DU# 0ZHP %0 RS x R H0 3/0,P0 8P-&U$1PU" m  8/P Q01!Vߍ40S 01Q 403/0SXP0S    H03/,cc c`e B; c0L LcA-00S P`~CW l0SB 1S @0 R H@T D@DT%P 3 P 0S %P~C`eh;p@-@`P@P HpA-0PU `p~_EU l0SQU@3B T D@DT 0 0R H@Q t%P~_E`eh;p@-@`P@P  pG-pW0S !S* 1S l QP0PU ~oEPVl0 SB aV ~oF ,  H@T D@DT 0SP 0 S:UP3.P ch;`ep@-@`)P@P Ep@-@P\P@p@-@`P@P *pP/D@P/00S/HA-@p`P@P t A-`P$V00l P0S/PD@@T0S0S $P Q $P  0S*p0  H@TD@Dh;A-@p`ᢿP@P $὿P/@-(0pMPL0`  @P $(0, SS  3/Ѝ褺;p@-@P,}  R80S U U U00 p@W00R  00000c#A-`p!P40@TA.80S 3/X@ cA-pP@H)W` 40 p0H0(0B A>#P H@T D@DT02S D0CS   QH0L0S Q$`e@-@@@-@@|0/0/0/0S/  ſc0 R0/ c@-Pl 0Rh;C-0`M `00Q@S 0`8`0}?`>Caaq cJ,aab lbT!0 ƺ 4D0!` 0$10V!0 $0 p䐟00S0 SW XpP0Q:0PSp`W !H#`2$A>Ѝ0 ccD Bc`eL B@-@n1@0A- P @0L ^U 0S |0`@Tpp~OD7 0S0@A;l0S …P AT ~ODT`eh;p@-@`P#@P 0 ¾ pc@-Q@MP@`YpPP@ \ V  @LЍ0<S %0! ,F@0A- P` @0L ^U 0S 0p@T㈀~OD½ 0S0@AAT ~ODT l0S FP0 X`eh;cO-`0M#0|8@QX 6^0Qpu TXP  03/NZeXwP   03/{NZUWgP  03/m0S  P7 `2@P@pWKP  0# 3/P00880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @qP 0?S@ Ѝ@/S``iui vi iiiO-hq@Q`PEM L1Q-YU4↷'0 00 0`0P Eߍ7X P  0R =nBT1 ጹ1APV14  41D@DT 0Q H@i i BC-qM@`[P)  03/P`NU# 0S  * &Pp@0S   m  0SЍ7PpP  Wcx0/p@-`Q@P R 0 0 0 %47p000SP0PP00p*R 7P%0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  .mR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PPLp0@-@0M0S09@P  WЍ0ϖo Bp@-Ph@s1 01  hp@|@-p0$M03`A0AS P R R R1  $/@ ;$MRY R @ 000 S( )04 0 #RH L0S0P  $ 0 001   01^000000000 0 00000 005@P #T@$Ѝ3  '0P0C@0@ 001 0 S#0 ☀< 04"48#80CS=10 001   \110000000081000 00D@P @j0 y 0H   C Rw0C0000P( 0 (00(00   J0T0 0 ?0 @P| Qx 4@u2@7@ B33@-3A0@S AS S ;<2@S 3/4P@.O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20`H2Y HYRpUHp0 0pW0\.?0PPY00 00  pP0@bp@-P`@Tp P څP @A-0PXMP- 00 0XЍA/`@p p1#`1014"410 0CH00UL 800(080@`, 0 0 0 03/XЍXe@-@MpPx`0 00`P 0 PЍ0 "׃@o% B\0p@-:PL@0 R 00 Cp.APAAꫪA ep@-PQ@M 0 040060000 $0T l00p0 200P000 %U 0 000#Q0PR,R02&p0LRlP0HP` (06/0   DЍp耖Y B\;;;Xe Bp@-@0|0D%D x0003/HaRUHHHRQp0S  0 Ù20C24XeDNQ/Da00S/   ! """  B0p@-0PSp O T  RQ7@-\70L QALQ 0,aL\(00L S A@LT 0aL\  0C70C020 ^0S?.S,S :S/ 0C70C@-@ 0R R% RB ~0  ~ R ~   ^           R R  R  R P} D3          / B B B B@-`P@H  `P/`%0, 0) " P 00 0 } }0 024`S 0 0B0@202HT ˜Ѝp`@-@HPB  a`P/` "@P 00CS 004`S  0 2H0C2bᖘЍp`HY</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Spy4Pp3" p@A1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00SS603P p<Ppp@6PpL2!4<01p0 " $"S $2p@p@E8"Rp0S 0 0 8Pvpi1iii2i(#iX8i(i B 2 @-$2@0$20 P$20$2/(2S /@-$2@ 0$2 P$20$2G-@ᬗpP(ᰀH2(20(2p02P0H02g(Z p@2S,`Yp`TV v H(20C(2,2S0S,2?02HAW 9m p 3/`P  0S0S0 0"p@-@Hj,2&jPU R,U 0S,2?02(20C(2H U @2S 3/(2Sa+p 0S0S0 0"PpA-@` Pp0H   CR0C0000T7@@#RH L0S0P  @0(00(00S@P  sz0  $' ! "$ &$ "$ (?Q0@ a060 B@-0S 0 P0 P Ѝ $"$# &  $ "$  $"$# & !z"0C-M 03` 0 SPLp0弐cS0 00004PY 0@DC5( 0 0Yv 0 00S:0 3  00]P  pW0P<<00  0:0(Ph3(0, O0@,@(0h= I/oP"0#2 D)D NPP p0D#DH# $H)3  0 0P0 1 PPU p0D#DH$H ꞿpzqŸ Io     3:#:SC1T Tb & 1T (0S` 0  00C S.0 M  J 0:0L1T?T  PP  kz /0T&  T 0T0@  !0T00S 00@0 0 R o  Pl3Ѝe _eG Bd 5c݆b?c>c(1O-0 QDMA00(0M?0`p0<< 0 0a 0,$  <@0 0O?0<< 0 0a,($ @ 0$0\0QO@000'> 0 0a,( P @< @DЍBe B;)0,00@00p0`hn0 0 0 hy7 BXe Bb(bc@bd d$d?c0 c00S/jxe0 c@-@P Tp@-P8P@` / @0S@@1@ @p1@@b 00S 0 0C0 0/@b@-@ \ 0 0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`pӏ@[0 p`000@@AA-pP`@V@D`0 S/,P/0A-@`.P pPP+` `r PPpV㉏P P` 00PPP pP(0 p6UAgB-BRPG-@  Q R"pS`F #B'BS 0PS  P  0S &P0 S` 1 VP  0S  P P) 0PP `S  0S 0S?  0S000000000S 3/p0S, 0S,  PU UP l X 0S $ ?o W20SP P pˎ pQ0p UQ 08i(p@-@P`9 Pqps@-`@P`Ѝ(0S u  "U R `Q  `  000JP @0T00  uЍp@-@ 0S 0 00l0 S@- T2S@# @ T00^02 @BBG-HbHHBTDrUʀ 0 ! $ 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 81 p?]x0 p0Tx000X`\p1A`p0t`0Gx!O,03/d1`0\1#$C,03/0& B0R  ! !/0 u]@`` BϠ ,>o\࠳ࠣSp^ 0(0Xp\`8>P|p @0X@\`/>0T`!C`@400o @$ ⷦ@`yepBbkPq00Ѝ0000@T$<$<$<0%<Bp@-\0P@*j`8PPP H!2pPcp@-HP&fp%u(^P@ p@bp@-P@UP0S00p@ %'P)5P 0P '8H!P) & &@bB@-H@0S <0@T@P@ ch$<cA-P㬲&\@p(`P @@TP@@bO-,1 ARF@0@S` pqP0 Sm0 ~뼲@`q`E0S І &3p(孋Pً` ,*&  y0P Pc'<BC-M 0P`` @hkPp0@ 00  00P 0 0@.?o2P0SЍO-`@p4QDM(02048 0<08 ,p$` `` `1(<080408  000600 <0,p$` `10(00'>4  0 :  <08 ,p$` `140AP 0@00 ,p($` `P<08 1DЍB&<,/<\&<0 @R/p@-P!A` ! 0RpC-aMPp@Aᔱ0p 0` j0 0000P@``000*d-PЍ<1<@- 0S0!Q\ S0!0 BS   " 4e0 S 0 / \P:/p@-|0P@`T   ,@PH>p V00 000P`0@4e B0 0R  0S/0 R/  0Q/@-   QO-` @ 0  SR00N\ : 0P PUP 0 @0S 0#0JR㊁PPU @Y. 0 0S$PH 0 0SP *P  pW 0R  Z 1Pp[Pp@- 0 BRPNP0@ ` T00Q@:T:@ #pQ p R\:p0@-S>"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PR{ T @(@ЍU Eg Dg0Y`* sR `FU T`T BT` 0 ` @  EoP@0@P  0 0T g0  `0pS`P 媜@U *PQ pI Q`FBo B10P0 00 00TPÏʁ4eH c<B Bp@-@Q`P 0 g0P @pnPTp0SpPO-P0M`Q@0  HpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUff0 S0 0 T奛VV 00 0PO P4PpPrBA-P@k`P p   BmP TO  mP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@'Q !  BR  \R\Q 0 Sl!0 SD 0S0S0 0 S0Q00 R Q RSR њ0Q `U P0P0 RPPQ AQ  0 BB4e BB0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ 㲁0P@  p4eH cA-@`pp R( `0PX 0 0`0d0(0 0 0P0000 04e:\Ѝ6@cHcPe 0!< 04 0 (   !/@bd d$d\ P/0 !8 0 0 (  , !/@bd d$d@-g P000V  @J@p P Z 8"g`T7 T T`,PU00G,gPP00<3`@bPeexBeBcO-`TMP|pPq 0P0%3 @PA Z @A20x@PT0L0S 'P 0S 0S40@ 31 4 I0P DP $`(Hp0UQ4PP AP [ Z RZT 0 0 0 P @@ P4 4 @3h "$  "$4 :Ix0 80 0 $`(- TЍxeePe@-@Pp`e H 0040000 P X  [H \H 0  BG-p`6 P@PG8er-@-@P`CMp,-p0  CߍB( @-[BA-P@M@@AT0p` 0 S S( 0 0(01 0  R:000P0 ( SP0 R00000 (P @Ѝ 0@-PDM@p0`S S' 0 0( 0  0;S 000(P0 0 (P DЍ(0;SP0 (0000 0/S(0/S0/0S p@-@Ppvp@/0@- 2/P 00@- @ 4/P0@- @ 4/P 00@-@ 4/P 0 ,B@- 0P  c Ѝeo<@- 0P  v Ѝeo<%P0/ep@-000P@Tp0S 3/X@ ce 0/@-)BD03" /@b 0 /8 et0 @ P //L00S/800ST(00Sx//4BQcTcTc-/-/-//-/-/@-峏TB@-寏bB@-嫏nB@-@-"0@-`M 0e@pPa8PU 0S80<000@00C@0PU 00, 0p Ѝl eX c8 eh cp@-@ $' $'  %(@ %( &) #& #&phPl`0 &PU`P`pO-` P0S0M 0Xp@V V00 KQ   RpBpp pS G /Z Y 0 E 0@ [ S  R Z" 00S 00S QP >u:u@`V7@ЍS 000@080S80@ 0S @-9/ 0S @-9/0"SKPp@-@B P pPP P *p0 S  \3, R:,(Q $tP$ tP$ (7pP 0C~\0C00  R( $Y0S*Vp*/TppA-0@S`@M4 0^ 4  "E0000000H00S 00 00$0H030,000 0 P:0S6 PU3 0S0400@00'$'$(%(%)&&#&#%"p圀0 %phplH0@2@@0 0@ 0 'P@0 00@ЍL0P0  0  !P P  /$  $ /,  , /X c0"SS@- 0@SPM(0S? 0S;0 s0S R 2#! 0C?o(`2V0S$ (0yS x0x$PYx 0B~S(x0Q:xx0Mxp`V  @T x_PЍT@@D@@P*/-/-/ 0!< 04 0 (   !/@bd d$dA-p 0P0`@ H00000#   20 000 P0 0S 'P7&  aX@0 0400'$'$(%(%)&&#&#%"pP0 $pPhplP0 0Ѝ"0O-_M00x 0$0(0#212P7@&_ߍ0`Sw`P 0  (PwUp@PPpPXP $P W 00@700SU #x 0tHTPPp7@PP0 b0Sp+@Pp3L14 `00wC x0@L QTpp ^0  @@P! 0 R  B  0PT Ao\Q Q  a  0T0t0P0S 0$ST0S 0$S0( 00 0PP,X0S P0X@P iW  JCX0X%0CS00T0S  R$ R R @T , P,00@P0 R0@&@T x( @Pr ( (0P/T0S  R   00&0@00( @PO(0$P000T00X0l p$ 0k@P 0pS0P @ @P 0$ $0o@P*0S- P$@ *]PX0S0S;@0Sn S S $m@P  $0X\X\ (, /  X\ 0?0::S $0PP $0PH1 R R |!$! 9/v Ir450", 00 Y F] $ 0TP' 0EKS0 P,@K@m$0P000T00X0 p$ 0@P 0SZ& @-@p@@>0UpW01X㾁V 000 W"010 @(0SO`AUpXp㾁@b{BX cBB8 e\ P/0 !8 0 0 (  , !/@bd d$dO-QM`p @tЍO\h^e崕t00px0\00`00d00ch0 0l0\PUU27[x@6T6tP6 pt0xt@p0 ER 5034 | 0NA43!"圌4@00T1 ~OD0T+ ᴌU `0S   0S \rP@0S T @\ [P\`PP&U`0S "Se2Sb DS` 4L z0 0 |0,00\0Pl0吰S8 x[5 h0S2U U UD XUPE D ,0| \;/ W[ N[20S 2 030,M|0 0 lPl0 0l0 0Z DJZ'00004ATd ~OD`HP8  R  Q^ H$0i$00U00000>000 \0|tP%l0S" x0S h R " ,  4  |  R㸰 R԰0 lx$ Pl0$ 0l0夋H$ 1[$0 4P  0| \3/ I HxT pod h00 R l  BR 3 Ѝ , ?A1c0QcTB@bpevKpO-`=@PA pP: p( 0  pU E|?p1GS ! R``B``00Q  FL0Pp W(0S0P0 Ѝ@B@-P@`pM4 B?  >?2 0"!0 qЍA-@PP`<@pD0W ↆH0L P0 H0L lA0 `0<0SP@0P8P0\03@P8 1@P`0PpH0x0AP 0 T ЍX c@b000S/0@-@PM4 > 8>2 43H@0B08 1SS0SЍ 0C#^10SY0CS!23 U !5% !D!C ⒇aP  03/`0 D`0@00800L01H0.>2040 0,00131`000S0 S000 0 ,zP 0, V W 0`x 8000`400`=d03` ,1`0p02640h00x0x0bbX c!@BRc@b0@- 0G Ѝ@-A Ѝ0@-  : Ѝ@000S/-0 00 TP H0SL0S 0 R00G0S  $@4 $0<<Ѝ0` 4 dBp@-`@P@THp@M0U@w$E *HQhp@3<"eL"ep@- PS`@(M 0S0 @bT!>0000!>0000P @ 0$0e(Ѝp d@-@0S00<"e@-0  @0X0S ( 0 ҀЍLcVB 0 0 C-0PM  0!S1000⯀Ѝ蠁\ R00ЍC 03 HgTq@}`VT4  0!S10<000U`T HЍCg  +*P\0`` 0 0``0`@X0 @S p ` WD `0peQ~y80EJ 0( *ЍClxBtBLc<"eL"eb\<@-@M!PU 0  . 0"S2000%`# R   0LS@20 0rA0Q 2X0S  0 0:W`$V )H.gЍ R% 03aA0AS   00  0Rx`I0$! ) R&000X0S p ` `0 pf000 0S0 0 00RT0X0S p ` (`0 pL"eBtBBLcb\00 @ @$1 03/@ЍpO-`0Mأp P@P 6 6S 5 J@Ѝ3 T V@1T2Y$1 0@4/@X T060@l0 0 0 l@n'P0!  t~@꬀ P | "$1 03/@pT,@ 0 8ЍO<"eBBBO-M0( P0`pW08 0(PP8 L}l`0d 0 `0d l0S@P 3!  AJz $;J00  |ul004 0 004 l pW$pW8C+$00G0P @P(Y Z!. 50R% <{Cl@0D 0 @0D Nl `5 0 ` }U L{ pQ Q Up L pPՀpP LW W LZlX0\ 0 X0\ l5  PPZkh0l 0 h0l l `}`0 y}P0 帙4"48#8000 0SlxkP0T 0 P0T k$Z @9kH L,9 H Lk\0US 0 S SZ00 - 0* PP U OP40"` P P ( U`  0 0_`0C  (`(0 } 000 0 Sbkp0t 0 p0t mk\0S ` 00,x0` |0$0000 0@0 cPZG !.T0  ∰ 匰PT0Jj0 _  Sj>j0  P PHj 0Z R Z &o᪢ R" R&{ j 0$ 0 0$ j$0QP0P  G00 GL= G $G<0004 Q0P<<00000(00,018i0 0 00 00 i 0>8ⒿЍS!>0刐匐 $1  03/DY 6ᬰ  Z   NG JG 2 <00000Z4LP(<"eh d8BiBLcBBBMBBtBBBG-aqQ@PG0|Qi0 0 0 \i0S]@PI }-P 40 ᐐIoᩒ S)~Y -i80< 0 80< ~"iX0\ 0 X0\ -i00S'@P  4"4x ;C R 4"48#80CS?h@0D @0 @0D hl ec<"eB-/0@-(0,0@<,00S 0S 3/0000008004000 $ \ R0@T4308P倢@0 0@P0R{L <\P< \ↁ`P8`VMe{U 0bh@Su Yr  $09/ |Ѝ 0 X/ R 000h  ${0S<L0 8{ $09/ {Y  ${Y U h{ $| @P 0S 0 X/ Rh  ${{ $0:/zZ  ${`Z U h{ ${ @P  { FX"ecO-$M pp@P0 `nP 0倐hS [  $0;/@ {$Ѝ }{ @ t@cO- qdV Q ʀ !  , !p0^@p  /00  0唀0 0$ h&{ R g$@ !d1000  ! Ѝ@bd d$dcG-P`U U9 $0ppR^@ N^0Ud0 P  C C$0h(P 0(0$0 00T0z 0< ^T`00`00<pX"ec0SjO-0S,M"PPP@1 P t10S T, 0 0S0U0Syp4`Vy ᄰ,Ѝ`` 0 vP 0h zwY0S" 0 S S Rh0  0iz 0S  0R y 0 p$07/yp hjz`/۽@cA-d0Pxq@M0D 0S S2T1pH1p(@< ᵀU`F00< <0塀@P'PĀ y#h`zl]pi]@Ѝ`0< 0C`00(<0S `U0P@S  0 h@x9zcX"ep@-HʾDP@`L@T403L0$5u@P p@cc@bDc@- @@ⰾ0DL0u@@c0L03@o/c@b0 0 0 /@-@ ]O-p 0M !P``  @AP0僈 0\ d0 000000@PX?o2P0SЍ|0 P 00 0 0 p@?o2P0S 0 S$  Q0Ѝ"exd 0O-DM(0 0Pp b!0 ,p0800P$  @80 <00!00<0 (p,P$   0'!|1"< (p0 0 ,P$  0!80 (p,P$  .0 0 0!08N` (p`0 0,P$ |`(pp'㌠ 0 8 a,P$  h 0',0 0 a0P($  UDЍT#B<@- R0R0 *0R \ \ 00S``\ \ \00SL00S0 80Q L\00S4#B"e R0 Rp@-0@P*0 R .P@D T00SpT <0P \0P0 SpSp(00S0 00SI#B"e 0 /"ep@-|P xSFlp@ lk@l \;l L 6l <1l (,lpT#B<"elP ZJ$Zn ZJP & ZDP Z` ZZZ ZZ >P Z'$ZK Z'P ZC ZC x>P Z$Z3 ZZ- Z PZ% Z% >P Z#Z ZPx & ZPr  ZPlZ Z x>P` Z#Z ZPU & ZPO Z ZPG Z Z S>P; Z#Z Z C>P+ Z#Z ZlZ Zd .>P Z#Z ZP & ZP  Z >P Zj#Z ZZ Z =P ZU#Zy ZyZs Z!Zm Zm @=P :B:B:B:B:B ;B;B,;B<;BL;B\;Bl;B|;B P0C /@-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/;BA;BP/Q //  00  00  00  00$  (00,  0004  80<0/@-@Q@P @ "G-@MPXp @p P` 0@DS @Ѝ@`Q@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@mQP000//o/00//p@-@M P@ `@Q@T@@KQ@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ QPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU/QO-R@M2 `ᡰ@[N00<0唆+00 0<  BS 0 KSP`F0V6*0PS㔃'!F<0pG   RVKЍ蓄% 8 09/P0P0'8 09/P0 Up0V* p꓄' 8 09/P 0p0% PEWP8 <9/PpG0 Q /@-0s Ѝ = 0 R/R 0;B0R/@-0CA @R A@BT R LP^@- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @@-p@-QK @\@ ,0CS @PUT S @CP U\0^ PL_UQ@A,à0@ 0@ 0@ 0CSQ S`p\\QPAQ00@p000 0@0 ! 0#2 /UUUU3333 @-X// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00 / B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?@- ^ S@-c0o @-@oQPO-(p@@@, P`T @D.`VPW:/@P WRQp@-@@P@T@ P`Q@!.PPPpQPp@-``` P@.@T`PpQPA-`` p@P-W PU`@@@-0 0(0000 0P 0@Ѝd=@-0 0(0000 0P 0@Ѝx=@-$0000 0vP Ѝd=O-`pP-  1L@P W  0 0W "L@Q A-HR @P,30 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,U @k0@P`TF  00 0S !,! @D ...|.q!!,/;B0A-@R0@P0`?S + S# *S, R& M[S0^\PP^4 ]^F S -^>pQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  ^/Ѝ@-@P $V/@ ( 0"[BO-@0$M(`00p 00P0$00D2 0@00  2/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0[B$\BA-`P@. $QY ?PU(p8 0 8S($)8 c7 `.7XPP0Q`pDa(!"$a$"  t.0Uh ЍA@S )@ c8 7 )0(0G-PR2 p@q?p` @g(U: E. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (&. 0$ Q0 0$  0$ @H< 0$ @ .  0$ @H< 0$ ?XG @-Z@-@P $-@ ( 0"\B@- @-@@-@P @ (- P 0$$]B0O-P \M@000 0Pv00 8`$000 : r#R?0V FAd#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@ `B0`( a!"$,a c"/G-P`8 p#T0.@``T%0  Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T"e-M Ѝp@-@ P` !LNC! !@ApA-PP@#*pᩕ`P @  @P ἕ0@PWP )P w)P᪕UP@@-MP@@@`@pT:Ѝ Pp0P00 CIkBlBc00yara0tcid 0 :c 0 :cyara 0 :ctcid\ 0/\ 0/yara\ 0/tcid0S 0 }/:c0S 0 r/:cyara0S 0 f/:ctcid@-0p3A'+`P @ 0*.P 0@PP B@P0( Ѝ@b /p@-@P&)0PPptcidp@-@ P) 0Ppploob@-@@ @-@@ @-@@ @-@@1 @-@@H @-@@T @-@@O @-@@J @-@@E @-@@@ @-@@; @-@@L @-@@] @-@@k @-@@y @-@@ @-@@ @-@@~ @-@@y @-@@t p@-@P((0P pP pgntsp@-@`pP(@0P pP TpatadA-pXPg(X0P `@P  P @0gntsp@-@RP aP'pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P  p@p@-@P p@0!P/L`B@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  LSP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`P@pWY FWl g:W =W *W # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8ЍL3H3 S R 0C# M0   Q S@0S00S > @ @@0 SbW' fW ?R0@SfWQ ` b6b` B@S8a8  C# c,1 c0 0 FW'Pf0?Sp Rm  P  c5S CP2QPU 0  PU H  0  Y=  0 fP0U08  0R4 XS+=W 0  Q  @U 0S Y 0 P  @0  0S @ s $0S,R$00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` 7Pp-@-@`P +P@ Ѝ/p@-@P EPp-@-@`P P@ Ѝ/A-@`Pp P-@-@`P P@ Ѝ/00/:c0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

0XbBP/0 SP0//XbBC-@P ЍPo0 RQY0 p 0p`P 0H S00Q iL p`PXbBbBC-@P Ѝ0Y0 p 0`͋PP 0S00, p>L `PPًXbBbB0P @-?o42 ^0S0 S@; /XbBP/0, S@-P0o/XbBP ?oH 2\0S 0SP00Q|/XbBbBfP 0 SP0m/XbBf@-(0pSM c`@V `0P PPP 00 0P S ^Ѝ`0S 0 "R00   6PbBP 0 0#/@-0 S RS R RP/$0S @-[7@:c#e|=2#e@- 0@a(M 0l`S A  ^K H P(ЍЀ`, P 2 bBbBbBp@- @P!Ap#e @-屔06#ebB 00 S  \: P03#/S  \ P0///p@-P0S 6|@P ]峔尔?@P tLTeLPP F4圔0WA@p$@:c|=#e#e$ebB@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@bB /P/ 0R" 0 !SR* R0*/@-0  ^: P*0  S */@/ //@ bBP 0R//bBP 0R//bB0P L P ! R0* /0 \0://bB0P L P !  R0* /ɒ0\0://bB0P \ P  !R0 * /@-!0 ^0# %/bB0P \ P  !R0 * /@-!0 ^0# %/bBP/ 00R!  S //bB0P D P  !  R0* / R0://bB0P D P  ! R0* /R0://bB0P 8 P  !\0/1 //bB0P 8 P  !\0/1 //bB0P < P   ! /!S //bB0P @-?o42 ^0S0 S@f/bBP/@\   JQ\//bBP/D\  Q/S/Q\//bB@-@pMPW ` `0S$(0S!0+ C 00 0S0xSW  000000SЍ  pPcB0BR"SO- JP`0@ pD TWpp-T@p` +T@`00T 00XS0 A B0C QR@`9U70T PPſ 0  000D ^aD\WDAD\7D U0S0:0QP00\00S 0!0@P0 pY ЍY S F8cB0BR"SO-@ `  J0P pE UWpp-UPp` +UP`00U 00XS0 A B0C QRP`>T<0U @@gĿ! 0GbW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0SUcBH-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@#P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0 `PO PU# 0S P@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00|==h=Tz=T=Q@- o/@-IM@xpP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 iP ` 0 0P0 5/P 00|cBA-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S 6P0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@tcBA-`[pWR SSS P PPPP(0SP 0p P V` P PP   PcBcBcBcBcB{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P ᨂPP@pPH7@P <|i0 P`000U ᬂ$e0dBnj%e$0S @-.@|:c%e=@- @ k  $ePdBieG-@pP`VU@ 0@焑QPU@ `F¦`@-@n@kp@-P@@ wP_pp@-@P X0R@'PP@p,00$000@00 00dB== `dB0 0C0s@-@P 0U S вl8Ѝp1PP`P 0 02PP0 0C0PP$eA-p `Pׁ@P V  !V @pC-P0pS`@M>0}S "S ́00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0Sᇁ0h P ,0S(0S  ,bP \P=pdBudBp@-@P `\0 R@VP PPPV @pY0dBO-0bPS00@00SE ЍO IP@7 Ѝ2P pP 0IF0 03008P  00C 0 P M@U R\ Q ` V j` P 0SyP 0 03/P  0R#P P ydB|dB`dB0,S<S7%e&e'e@-@ %ep@-P@P[ 0 0 0p@誱G-@P 0R@ pDPP`ᔱ@ 0冡ᆁ!E C 0冁 0` 00V:0000dB0P 00R@-0P   0/0dBp@-@P 000p@[p@-@P ,0R@P@Lp0dBp@-@P L0R@P`0S@#*+@2p0dBp@-@PҰ@$pA-@P x0R|Pὰp0S ` VP 09`P p0dBp@-@P @0R@ P`ᙰ v@p0dB P /o00"\ R\0\`/0dBO-@Pi pl2 R0l  .PP @upt@L0S +偉 PP b帉0Q=P8W/媉 h P,U<UU p4P` `8 k 8PP ,PP 1凉P~U@f Ѝ` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@0dB:c=%e%e%e&e'edBG- pPW` W 00@ >P 0S0,S  0 G0P @-?o<2 ^0S0\ S@/0dB@-@P+ 0R'P`は0 @P 0 0 B! 00C0000xv Ѝ@赯 Ѝ0dB0P/?o( 2\0S/0\ S/0dB0P @-?o42 ^0S0 S@/0dBP/ 0R/dB0P @-?o42 ^0S0 S@/dBPG-@6 @`TPp P*  0 S @QO  S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@}0P@ A /|dBp@-P(83@P 0P0 0p(e eBP 0RR @-To//0Sb G- 0PSGt6 h@PR  pPWW(G0 0"!00 Pa#5<`P%c?P6 0+P0 `0%P* P0P$ pGP唀W%10``P R0P&RP0 P Wa<`=0P =P/,eB eB@-@0P g}B4(eO-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR30Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 + P  Ѝr@t@b@n@@T(P\fBdfBkfBpfBufBp@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPU5j@P  0jPIj<WP0 Pp 0 03/P P 0S PP|P$jP!jX 6P P(VP P{fBgB$gBp@-@P` {Ppp@-@P oPpp@-@P`E dPp@-+:gB011/A-@pP`P iPp` P102 P @-@\& P QRS  T00iLQ R S "  T  00 A-% M222ȁ bS1~'`8@JZ&~Hk- -m%?Mclqup{?J}b0.M%룏b~.8峨>pd(,@|e {mj 4;< '3Q% 30S#* :3#Q% 53#Q% 5Q *c>1E sz݄Mf맪tpC{p0  08S )V@#ʫt8To' 2R @00@0:4U p2p,QHY;@sdwdldWARNING: double match for boot device (%s, %s) boot device: %s iicziicnonei2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!@ 0A @ 0H @ P `@ p @ p@ @ initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller couldn't map registers scoop%s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopunable to acquire bus. error=%d output write failed. error=%d : GPIO controller ioexpzssp_init%s: not configured. can't map bus space couldn't establish power handler zssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846%s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferdefaultSharp Zaurus LCDC(.}Tbcouldn't establish power handler zlcdstdSharp Zaurus frame bufferdefaultSharp Zaurus LCD̂bcouldn't establish power handler w100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) console E F F $F ?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ couldn't establish power handler zkbd>D> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    : pseudo power management module zapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller couldn't establish power handler %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %ccons|LwGl B>Xg Xh i j |j 4Tk 6k 4 base 0x%x-0x%x irq %d drq 0x%08x core %d mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus**************J***************f***_***U***Z*gmv******C~Y$&/4~mxo>sI^ 3!!!!!!!6>0x%08xr%d, rrxlsllsrasrror, %s r%d, %s #%dsplrpc |&>&>&>,$>&>,$>&>,$>@&>&>P&>&>`&>,$>_M&>&>P &>&>&>&>@ &>&>P &>&>&>&> &>&>&>&> &>&>&>&>&>&>&>&>&>&>'>&>'>&>pP '>'>'>'>p'>'>pP$'>'>)'>%>)'>%>p -'>2'>p 06'>2'>p `;'>2'>p pA'>2'>P G'>2'>P K'>2'>P @O'>2'>P PT'>2'>- Y'>%>^'>%> b'>f'>k'>f'>b'>o'>k'>o'> %>%> t'>%>w'>%>{'>%>'>%>0 '>'>00'>'>00'>'>00'>'>'>'>'>'>'>'>'>'>'>'>'>'> '>,$> '>,$> '>,$> '>,$> '>,$> '>'>'>'>'>%> '>'> '>'>/'>'>o'>'>0/&>'>p (>(>(> (>@(> (>(>(>@(>(>"(>((>+(>((>2(>((>9(>((>@(>F(>J(>F(>Q(>F(>X(>F(> _(>c(> h(>c(> @l(>c(> `p(>c(> t(>c(> x(>c(> |(>c(> (>c(> (>(> 0(>(> P(>(> p(>(> (>c(> (>(> (>c(> (>(>(>(> (>(>(>(>(>(>(>(>(>(>(>(>(>(> (>(>0(>(>@(>(>P(>(>`(>(>p(>(>)>(>)>(> )>(>)>(>)>(>)>(>)>!)>&)>!)> *)>!)>0.)>!)>@2)>!)>P6)>!)>`:)>!)>p>)>!)>B)>!)>F)>!)>J)>!)>N)>!)>R)>!)>V)>!)>Z)>!)> `)>d)> h)>d)>l)>p)>u)>y)> ~)>)>0)>)>@)>)>P)>)>)>)>)>)>)>)>)>)>)>)>)>)> )>)>0)>)>)>)>)>)> )>)>0)>)>)>)>)>)>)>)>)>)>)>)>)>)>*>)>]-thumb insn eqnecsccmiplvsvchilsgeltgtlenvund%s %08x %s%s%s aif, #%d,$>,$>X&>^&>,$>,$>b&>h&>,$>,$>l&>r&>,$>,$>v&>y&>, #%d#%d ; #0x%x%c%dp[r%d][r%d%s, #0x%03x#%s0x%02x%sr%d!{r%d-r%d}^f%d0.01.02.03.04.05.00.510.0#%s.%c%ddaiadbibedeafdfafafdeaed, #0x%04x0x%04xspsrcpsridie_cxsblsdeppmzp%df%d, c%d, %d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown] lu tu <6oshstoshnshstnshishstishstsycpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxtmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxundstrtdaWldrtstrbtldrbtstrldrstrbldrbpushpopstmYnWlldmXnWlblimbimbrangeswistrhtdeldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsdpmsrpFmpF2bxmclzdmbkptkmovwdZmovtswpdmoswpbldrexdaldrexdldrexbldrexhstrexdmastrexdstrexbstrexhandSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnmulSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsdrfswfcrfccmfPRghcnfcmfecnfevandNuqwvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddINuqwvtstvsub  "No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxmachdepdebugbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() -1single-skdb-k-dask-auserconf-chalt-b-2-3-4quiet-qverbose-v-xsilent-zw!N_bus_dma_busaddr_to_paddr%s: curaddr %#lx not in range_bus_dmamap_sync%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botch:>*:>*:>5:>C:>Q:>d:>y:>:>:>:>:>*:>:>:>:>L%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x VA;>D>2PVA&<>D>2VA2;>D>2AVA-<>D>3VA4<>D>3 VA;<>D>3pAB<>D>3qAI<>D>3qAP<>D>3qAX<>D>3qA`<>D>3Aj<>D>4D q<>TC>4D x<>B>4i <>B>4`Rf<>D>4 i <>0B>4qA<>D>4TrA<>D>4TtA<>D>4TtA<>D>4TA<>D>4T A<>D>4TA<>D>4TPT<>D>4T`A <>D>5TE`A <>D>5TE`A <>D>5TE%V =>D>5TEWV =>D>5TE i(=>tA>5TE $i/=>(A>5TE0$i==>(A>5TE ,i/=>(A>5TE0,i==>(A>5TE .iK=>@>5TE0.iY=>@>5TEAig=>@>5TE!in=>@>5TE !iu=>@>5TE)in=>@>5TE )iu=>@>5TE-i|=>\@>5TE -iu=>@>5TEAi=>?>5TEAi=>?>5TEAi=>?>5TEA =>D>5TE A =>D>5TE`A =>D>5TEJ`A =>C>5TEJ`A=>C>6J`A=>C>6J`A=>C>6ZK A >>D>6KPA>>C>7ApA$>>C>7AA1>>C>7A/A>>>C>7A?AK>>C>7AAX>>C>7A/Ae>>C>7A?Ar>>C>7AOA>>C>7AA>>C>7A/A>>C>7A?A>>C>7AOA>>C>7AA>>C>7A@A>>C>8A0A>>C>8ApA>>C>8ApA?>C>8AA?>C>8AXV?>D>`A?>D>XV?>D>?A?>D>@XV-?>D> A-?>D>@X/V-?>D>Processor failed probe - no CPU ID %s%s%s (%s V%s core) ;>;>;> ;>';>2;>7;>@;>E;>N;>S;>\;>e;>r;>w;>;>;>;>;>;>;>;>;>;>;>;>;>;>;>;>;>;><> <><><>unknown CPU (ID = 0x%x)%sHz: %s %s : %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DunknownARM2CPU_ARM2ARM2asCPU_ARM250ARM3CPU_ARM3ARM6CPU_ARM6ARM7CPU_ARM7ARM7TDMICPU_ARM7TDMIARM8CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM250ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15=?>D?>J?>P?>V?>\?>b?>h?>n?>t?>z?>?>?>?>?>?>step A-0step A-1step B-0step B-1step C-0?>?>?>?>@>\?>b?>h?>n?>t?>z?>?>?>?>?>?>rev 0T@>D?>J?>?>V?>?>?>h?>n?>t?>z?>?>?>?>?>?>step B-2?>?>?>?>@>@>b?>h?>n?>t?>z?>?>?>?>?>?>?>D?>J?>P?>V?>\?>b?>h?>n?>t?>z?>?>?>?>?>?>?>?>J?>P?>V?>\?>b?>h?>n?>t?>z?>?>?>?>?>?>step D-0?>?>?>@>hA>\?>b?>h?>n?>t?>z?>?>?>?>?>?>(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)A>A>J?>A>A>A>B>B>n?>t?>z?>?>?>?>?>?>step B-3step B-4step B-5?>D?>J?>P?>?>?>@>pB>yB>B>z?>?>?>?>?>?>step Bstep Cstep Dstep Erev 10step GT@>B>B>P?>V?>\?>b?>h?>B>B>B>?>?>?>?>step Jstep Kstep Sstep TT@>8C>?C>FC>MC>\?>b?>h?>n?>t?>z?>?>?>?>?>?>*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15C>C>C>C>C>C>C>C>C>C>C>C>C>C>C>C>T@>D?>J?>P?>V?>\?>b?>h?>n?>t?>z?>?>?>?>?>?>userkernel H>D H> &H>D 9H>8 KH>hH>8 ~H>H>8 H>H>8 H>I>8 I>5I>8 JI>jI>Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=%08x, Invalid, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x data_abort_handler %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap badaddr_read%s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)  machdepkmpages@````` ```pmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx,b  dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable %d device bad device not ready area improper i/o error aborted from console error %d succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)# !!!!!!!!!!!!!!scsiverboseperiphdisktapeprinterprocessorwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storageunknownscsipi_dtype: impossible device type22@wuQa~>uuw>\bb\\\NbbR-pp },scxspl%sunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer 0x%02x   %02x DEFERRED ERROR, key = 0x%x S>S>S>S>T>(T>7T>GT>UT>cT>pT>T>T>T>T>, requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal) , data =Sense Error Code 0x%x at block no. %d (decimal)ES-6600 request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d q  polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedcommand abortedsearch returned equalvolume overflowverify miscompareunknown error key"/++-scsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter probe%s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d)async, 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueing tagged queueing N(8V]]]Fsoft error (corrected)ATA illegal length indicationATA volume overflowATA command abortednon-media hardware failurereadonly devicemedium errornot readycommand abortedillegal requestunit attention%s unknown error code %d probe%s(%s:%d:%d): \gg\gggg?wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d !!!!D!wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: %s error (0x%x) wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out }!{!t}!}!atapiscsibusdetscsinitqscouldn't establish power handler : SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info%s target %d lun %d: <%s, %s, %s> %s %s%sj>j>\>@j>j>\>j>j>\>j>j>\>j>j>\> k>k>\>%k>.k>?k>Ak>Jk>\>[k>dk>\>uk>~k>k>k>k>k>k>k>\>k>k>k>k>k>\>k>l>\>k>l>\>k>'l>\>k>8l>\>Il>Rl>cl>hl>ql>l>l>l>l>l>l>\>l>l>\>l>l>\>l>l>\>l>l>\>l>l>\>m>m>(m>m>-m>>m>Cm>m>(m>Cm>Lm>]m>Cm>Lm>bm>gm>pm>\>m>m>m>m>m>m>m>m>\>m>m>\>k>m>\>m>m>\>m>n>\>n>!n>2n>7n>@n>Kn>@7n>Pn>\>a k>Yn>\>jn>sn>n>!n>n>n>[k>n>\>n>n>\>m>n>\>n>n>\>m>n>\>m>n>\>m>n>\>m>n>\>\>n>\>n>\>\>n>o>\>o>o>\>+o>4o>\>+o>Eo>\>+o>Vo>\>+o>go>\>+o>xo>\>+o>o>\>+o>o>\>+o>o>\>o>o>\>@n>o>\>o>o>\>k>o>o>o>p>\>p>!p>\>p>2p>\>p>Cp>\>p>Tp>\>p>ep>\>p>vp>p> p>p>\>p>p>\>p>p>\>p>p>\>p>p>\>p>p>\>p>q>\>p>q>\>p>$q>\>p>5q>\>p>Fq>\>p>Wq>\>@p>_q>\>p>hq>\>@p>yq>\>gm>q>q>m>q>\>q>q>\>q>q>\>p>q>\>p>q>\>q>q>\>q>q>q>q>r>\> r>r>#r>jn>(r>\>9r>Br>\>Sr>\r>\>l>mr>\>l>~r>r>l>r>r>l>r>r>r>r>\>r>r>\>r>r>r>r>s>\>s>s>\>s>)s>\>s>5s>\>=s>Fs>Ws>=s>\s>ms>=s>rs>s>m>s>\>s>s>s>s>s>s>s>s>\>s>s>s>s>s>t>t>t>\>.t>6t>\>Ct>\>\>Kt>Tt>\>l>et>\> vt>t>\>vt>t>\> not configured LUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X VGENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307PiSCSI SCSI CD-ROM QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA Virtual CDROM !\!44t!476t34scsibusscsibus at %s channel %dscsi_subr|LwG,!u>xw!pS!w!x!xw!pS!w!x!z!xw!pS!w!x!z!xw!pS!w!x!Tx!removablefixed%s drive %d: <%s, %s, %s> %s %s : %d targets scshutsccompxscmdcouldn't establish power handler atapibus at %sw>w>w>w>w>w>@w>w>w>@w>w>w>@w>w>w>w>w>w>@w>w> x>w>w>x>x>w>'x>@,x>w>Qx>Vx>w> x>ex>w> x>tx>w>x>x>w>x>x>w>x> not configured ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibus"&) J-88c&&&&&&&&&&&&&&&&%15:9&?&&CHN&R&&&&&&&&W''''''''''''''' &,065':''{>{>{>{>{>{>{>{>optical mediaread_cd_capacity: extra large block size %u found - limiting to 2kByte cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cdm8!!!!x! !!L66c8!!h!(!!476t3!L66ccache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>f~>RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry !!8!!@!t!|!!(!4"!!$!! %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectors (%lu bytes/physsect; first aligned sector %u)drive offlineunformatted mediacouldn't establish power handler sd _CK.A\M%s: not supported ERROR TIMEOU DF%s: status=%s wd_flushcachewd_trim>>u>>>>>>L>c>u>>>>>Ѕ>, %s: (error not notified%s%s) wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %x %s: disklabel indicates BAD144 but BAD144 not supported on this drive%s: disklabel indicates BAD144 but BAD144 table not found%s: invalid BAD144 table%s: error %d reading BAD144 tableT""l"("4,"'"'"L66cwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed DMA errordevice faultdevice timeouterrorrequeuechannel resetwd, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcacheIDENTIFY failed 2>>>I>%s<%s> SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jd)WARNING: block size %u might not actually work l""T"""(" " "8 "$ "couldn't establish power handler hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate wd_standbyT""("X("("476t3'"L66caddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS(2"<"T1":"0"wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwaitrecalpiomodegeometrysetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq H0"h%%%W"@0"80"J"atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqataatastart%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout ata_thread_run%s: unknown type: %x %sunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atabus_thread%s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d,32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusQ"pU"44M"476t34atdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxferxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't establish power handler , " "%s%s%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x)%sat %s function %d%scouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed init failed sdmmcbad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short #(-27<FP d'CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: SpectecSDIO WLAN CardSDW-820writereadextended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz pauseerror waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't change bus clock can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d e @ can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostCardHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) >a>P>> ,">@Pcan't get SD status: %d  SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenance can't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x d' #(-27<FPunknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d error, retrying ld_sdmmcld|LwGx"\>e>config_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270PXA250: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxaintc pxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dpxagpio: can't map registers pxauart %s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostC CCCC !Not supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d unable to create new screen (errno=%d)console lcd_free on active screen (#@#L#d#|####: DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmac couldn't map memory space unable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicsss: %d slot%s can't attach failed to map MEMCTL pcmciaunable to map register pxa2x0_i2c_intr_sub%s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't map registers couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer sdmmccouldn't attach bus   CW[jM_a8]o\#Z#apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM : %s reserveds>>>APM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %s : Power Management spec V%d.%dget power status%sunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedZ#[#44d#4\#6d\#4apmdev couldn't establish power handler pcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) , %s%s (manufacturer 0x%04x, product 0x%04x)%s function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! pcmciaJXjj[  "$CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x , %s%s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS 5>>5>>=>>=>>V >>V>>>>8>,>:>>>G>Ĵ>>PP>D>I>Y>ܱ>а>h>\>%s: using CIS quirks for , %sSVECFD605 PCMCIA EtherNet CardNDCEthernetAPCMCIA MBH1030201%  8  @!!@! ! #/ ''w0 g'' c0c >>>HT>>z>>z>> >> >>>>>> >>@>>@@>G>@>N>>e>m>r>l>>>H>>>>>>>>@IeII>>I0I0E>>> >@&II  I>>>">@"I0)>2>7>-/@>L>@>h>@>{>@>>@>>@>>@>>>>@>>@>>@>*>8>")O>S>uE o@o @o @>l>u>x>>>>>@& 3BI@>> @(#0can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAEthernetAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETAdapterSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAETHERNETcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0NDCDYNALINKL10Cne_pcmcia7>A>TBcouldn't establish interrupt configure failed, error=%d %scouldn't establish power handler MEGAHERTZMODEM XJ2288com_pcmcia S>-o>>>2'E>>>>>>>>>>>>>>>>> configure failed, error=%d can't subregion I/O space memory mapped mode i/o mapped mode wdcattachunable to establish power handler Digital Mobile Media CD-ROMPCMCIA Portable CD-ROM Drive NinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEPCMCIACD-ROMIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciaH>L>U>_>l>p>>>VVwh>>>>>>>>>>>_>%>.>P8soo P q q sMkltU>_>tt3G>N> hCl>> h&wiinitcouldn't load firmware configure failed, error=%d %s:failed to attach controller couldn't establish power handler SMCSMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC Cardcorega K.K.Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11coregaWL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaFILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~usbevtusbrhxfer ???????: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hc%susbtask-drunable to create task thread: %s usb_create_event_thread task##usb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s couldn't establish power handler usbusb at %sunknownpre 1.01.01.12.03.03.10#,##4#4#6#4usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach usb_desc_iter_peek%s: bad descriptor %s: descriptor length too small %s: descriptor length too large addresshub-addresshub-portclasssubclassreleaseprotovendor-idproduct-idvendor-stringproduct-stringserialnumberusbverbose port %d configuration %d interface %dusbififusbdevifvendor %4.4xproduct %4.4xM?_?k?|??????????????? ??%d%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %d%s, %susbdlyusbd_fill_iface_data%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@eaQ@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@o7@O@R@T@a@c@q@}@@(@v@&@A@N@j@o7@gO@%@+@4@>@0@`1l703% bU bU b9 : %mZmw`%  2 @@watchdog timeout usb error on tx: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) usb error on intr: %s open rx/tx pipes failed: %s tx list init failed rx list init failed Ethernet address %s couldn't establish power handler usbnet|LwGh$?hub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d singlemultiplesselfbus : %s %s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s couldn't establish power handler uroothubuhubuhid at %s reportid %d   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u     u ;u )%u&5Fu 3 4u&6F  0 1  2 5  :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F  uhidev%s, iclass %d/%d couldn't establish power handler could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lockuhid_usb%s: was console keyboard too many Variable keysbad modifier sizemultiple key code arrayskey codes not on byte boundarykey code size != 8 couldn't establish power handler attach failed, %s PPP@V$V$`M$L$M$ This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). 5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;< =>?@ABCDEOMPJQNRK ukbdPNNLN#9_@_'T~unknowng$f$h$Tn$m$Lo$ %s ????????using %s over %s quirk init failed could not read endpoint descriptor endpoint not found %u/%u/%u %s: Get Max Lun failed: %s unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=%#x not supported bus attach failed couldn't establish power handler inoutINOUT%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s SCSIATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumass hs$ 4s$  % L s$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ fc 46umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbscsi}!{!t}!x!atapiF  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |%s: reset failed %s \$$$}$}$h~$z$z$@z$failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out if_aueusbnet|LwGy$@@aue %s $$2VZP~" `"'`{%1no union descriptor no data interface setting alternate interface failed could not read endpoint descriptor unexpected endpoint could not find data bulk in could not find data bulk out faking address if_cdceusbnet|LwG$@@cdce# # %s: reset failed %s failed to set configuration, err=%s $l$$ԋ$$Ќ$getting interface handle failed couldn't get ep %d %s: read MAC address failed if_cueusbnet|LwG`$@@cue@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0 %s $4$$<$failed to set configuration, err=%s %s: warm boot, no firmware download %s: cold boot, downloading firmware dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!%s: failed to load code segment: %s d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^%s: failed to load fixup segment: %s d%s: failed to load trigger segment: %s %s: reset failed loading firmware failed getting interface handle failed couldn't get ep %d missing endpoint could not read Ethernet descriptor if_kueusbnet|LwG$@@kue P@9WPurl_uno_mii_read_reg%s: %s: bad register %04x %s ,$$p$X$ $$0$̛$failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed url_uno_mii_write_regif_urlusbnet|LwG$%@,@url( B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn media change failed read PHY failed can't read rxmode %s $$$Ч$0$,$$T$failed to set configuration, err=%s getting interface handle failed couldn't get ep %d failed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axeusbnet|LwGP$@@axe$u$u$x$x$Pxmue_csr_read%s: reg = %#x: %s mue_uno_rx_loop%s: packet length %u too short %s: rx_cmd_a: %#x %s: invalid packet length %d mue_uno_tx_prepare%s: packet length %d too longmue_csr_writemue_read_otp_raw%s: not ready %s: timed out mue_eeprom_getbyteLAN7500LAN7800 %s $$($$$$$$Լ$failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints mue_chip_init%s: PHY not ready failed to initialize chip %s id %#x rev %#x failed to read MAC address mue_uno_mii_read_regmue_uno_mii_write_regmue_dataport_writeif_mueusbnet|LwG\$3@:@mueF hF  %s $$$ $h$$\$$failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed if_udavusbnet|LwGH$S @[ @udav42-# s%s: %d silo overflow%s, %d ibuf flood%s  !)com: unsupported I/O width %dl$$x$$x$$$h$674device enable failed timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTNXP UARTDesignWare APB UART, no fifo is_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO : %s txfifo disabled console Could not create workqueue: %d unable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%%%,%!%%%% %%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector %u) couldn't establish power handler %s: not drained %,%%,%%4%%%,%P%%,%476t3%lddk_subr|LwG%0%@3%@   +-/, ,Lucent/Prism/Symbol 802.11 controlswisysctl_wi%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed wi_push_packet%s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d wi_write_txrate%s: tx rate %d -> %d (%d) wi_start%s write fid %x failed init failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout wi_rx_intr%s read fid %x failed wi_rssadapt_input%s: null nodewi_tx_intr%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundwi_tx_ex_intrtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%x wi_scan_result: unknown firmware type %u .,@P,@b,@,@,@,@,@-@8-@[-@ [-@ -@ -@ -@ -@-@-@-@-@-@-@-@-@!.@".@LucentSymbolIntersil could not establish softint could not get mac address, attach failed 802.11 address %s %s: using %sUnknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d device enable failed yyyyyne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete THIS is A memory TEST patternwhere did the card go? setup failed 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT ##$atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1 atapiatatimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdy%s:%d:%d: setting PIO8_EN %s:%d:%d: failed to set 8-bit PIO (%d) atacnf%t%%%%atardl%%@ %%@%%44   @ @ @  0        @* Root hub ) 2\%h%|%x%%%+CP]j 9999:OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %X%P%%&%l &$%%%%|&&8%%%%%&%%%ohci_setintr: 0 interval 4%,%d&%L&&%%%%%&&%%ohci_device_isoc_abort: early return ohciabt2WARNING: addr 0x%08lx not found , legacy supportohciabtohcixferOHCI version %llu.%llu%s unsupported OHCI revision      SMM does not respond, resetting p%&p%%%4%%%%reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so/libexec/ld.elf_so%s-%s%scompat_util|LwG`&5@invalid AES nrounds: %uBearSSL aes_ctAES-CCM overflowc:@2:@::@,&9@c:@2:@::@n@ 9@c:@2:@::@Jڧo9@c:@ 2:@>:@a9@c:@ 2:@>:@Q?}-9@c:@ 2:@>:@@ZC˔9@S:@I;0&X9@`9@)dÐ=*oVQq-=F%p{]#NSen>hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6cryptoaesselected ,;@=@ ;@L>@ <@?@ AES is bustedaes: self-test failed: %s AES self-tests failedaes: %s  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN%s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed    !"#$%&'()*+,-./%s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed 1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }%s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed   !"#$%&'()*+,-./%s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed cryptochachaselectedchacha: self-test failed: %s chacha: %s |LwGd&I@expand 32-byte kPortable C ChaChaJ@He&q&n&v&e&}&u&@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[xchacha_streamexpectedxchacha_stream_xorjUS_&)ûIt~._dyz,(4y:b,ia /A&chacha core 1"3DUfw̻wfUD3"-chacha core 2  J1AY'A;B'{BP}sՊtS.&hchacha`]@]@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q`]@\@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH ]@]@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH ]@]@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@ ]@\@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rieee80211_crypto_newkey%s: invalid cipher %u i@i@j@j@j@%s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s ieee80211_crypto_setkey%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! ieee80211_crypto_encap[%s] no default transmit key (%s) deftxkey %u ieee80211_hdrsize%s: control frameieee80211_crypto_decap%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckipieee80211_hdrsize%s: control frameccmp_setkey%s: Invalid key length %u, expecting %u k@p&d&&&&`&&[%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEVk@&&&&&&&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize%s: control frame0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-out of buffers with data_len %zu tkip_encap[%s] Discard frame due to countermeasures (%s) tkip_setkey%s: Invalid key length %u, expecting %u [%s] missing ExtIV for TKIP cipher tkip_decap[%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt r@&&&&&X&&TKIP0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt ieee80211_hdrsize%s: control framew@ &&&@&D&&l&WEP333,*,**F$(Kc & = ieee80211_hdrsize%s: control frame[%s:%s] discard %s frame, frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: %s[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed null nodetoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6D:too short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xdatamulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued WEPPRIVACY offmulticast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xrereassocassocWPARSNshortlong, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d authdisallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s  JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 maccompat_20link-layer statistics and controlslinkIEEE 802.11 WLAN statistics and controlsieee80211ieee80211_sysctl_treetop%s: sysctl_createv failed, rc = %d client/peer stationsnodesdebugieee80211_sysctl_setup%s: sysctl_createv failed (rc = %d) vap%uparentinact_runinact_probeinact_authinact_initdriver_capsbmiss_maxieee80211_sysctl_attach%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done %s[%s] %s replay detected [%s] michael MIC verification failed ieee80211_load_module%s: load the %s module by hand for now. operating mode %ubogus aid %u, max %u_ieee80211_free_node%s %p<%s> in %s table node_reclaim%s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u ieee80211_free_allnodes_locked%s: free all nodes in %s table ieee80211_node_table_cleanup%s %s table %s: %s[%u] still active , ieee80211_reset_scan%s: scan set:%s%u start chan %u ieee80211_next_scan1%s: chan %d->%d ????essibsswepno! %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s _ieee80211_find_nodeieee80211_setup_nodeactivepassiveieee80211_cancel_scan%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULLieee80211_get_rate%s: fixed rate %d (%d.%d Mb/s) not in rate setieee80211_tmp_node%s %p<%s> ieee80211_find_rxnode_withkey%s: add key map entry %p<%s> refcnt %d ieee80211_find_txnode[%s] no node, discard frame (%s) ieee80211_find_node_with_channel%s %p<%s> refcnt %d ieee80211_find_node_with_ssidieee80211_free_node%s: %p<%s> clear key map entryneighborieee80211_create_ibss%s: creating ibss stationshortlong, protectionieee80211_ibss_merge%s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s ieee80211_end_scan%s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %pieee80211_node_delucastkey%s: delete key map entry %p<%s> refcnt %d [%s] power save mode off, %u sta's in ps mode ieee80211_iterate_nodes%s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d ieee80211_node_leave_11g%s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble ieee80211_timeout_stations%s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivity%sstation timed out due to inactivity (refcnt %u)re, QoS[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated ieee80211_node_join_11g%s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s ieee80211_node_table_resetunable to setup initial BSS nodeieee80211_node_table_init%s %s table, inact %u scan$$hhu Penadis[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!ieee80211_encap[%s] no default transmit key (%s) deftxkey %u not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!ieee80211_compute_duration%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuPPPPPPPPPWPA IE too big, %u > %zuPieee80211_send_probereqieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u null nodeieee80211_send_mgmt[%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u ieee80211_mgmt_output[%s] encrypting frame (%s) [%s] send %s on channel %u ieee80211_beacon_alloc%s: cannot get buf; size %u no space for 802.11 header?ieee80211_beacon_update%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued >{4%$$ u@u@u@u@@u@@wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl"%c0x%02xieee80211_newstate%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%s(%s)TODS %sFRDS %sDSDS %s(%s->%s) data %s type#%d WEP [IV %.02x KID %u] %dM +%d   0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x        ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparams%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon miss%s wlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtsctsackcf_endcf_end_ackassoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocauthdeauthreserved#13reserved#14reserved#15linkieee80211rssadaptdebugexpavgctlieee80211_rssadapt_sysctl_setup%s: sysctl_createv failed (rc = %d) %s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d -> %d %s: dst %s thresholds %d-byte, T[%d.%d] = %d @external%hu.%hhu%s:%hhuigmpplinetigmpstats.7}>]J)JJJJUJJJJ ??lla_lookup: new lle malloc failed inmltplinetmulticastipsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinternetLb}(d(P((LbCU(0M(,M(@P(Lb)(M($M(l@X)Lb( M(M(ԫ@%)6)P5)Lb8(0M(,M(@LbCP<0M(,M(@<Lb)CP<0M(,M(@<LbsCP<0M(,M(@<LbC'0M(,M(@d'(T(LbC8(0M(,M(@L(.PPUPP*}PPPineticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutstatsbmcastechodynamic_rt_msg     ICMP: redirect failed to register timeout for route to %s, code %d }E#(Dicmp_errorinetipforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumstatsdad_countanonportalgoavailableselectedreserve(@AAA==A*28;OOOOOOOOOO  ;% ?????HC  .   ip_output%s: refusing to send from invalid address %s (pid %d) inetipmaxfragpacketsipfrenplrip_abortrip_acceptinetrawpcblistк(Ⱥ(( ((( (о(((((x(H(((t(((bqA  #9L7Ptcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULLtcp_output%s: no template%s: %d < %dsackholeplS tcp_inittcpcbpltcp_new_iss: unreachablesyn_cache_respond%s: impossible (1)%s: impossible (2)synpl @@@@@@@ [)])_)`) 1DW]e_ace!!rfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlavailableselectedwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localidentdo_loopback_cksumpcblistkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesmaxholesglobalmaxholesglobalholesstatslocal_by_rttdropiss_hashabcaggressivemsltloopbacklocalremoteremote_thresholdvtwentriestcpinettcp6inet6ܑ)))),c)4))ؘ)D))q)@c))))P) )h)h) )))h))renoD)))4))newreno)H))p)x)cubic""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwudp_abortudp_acceptinetudpchecksumsendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunction)))t)))p)))x))))X)))|)))@)@)@)@) @)@$) bsdrandom_startrandom_pickhashdoublehashrandincm_pulldown malfunctionm_pulldown malfunction8BZ $>FN2:BJRZbjr/7Um%Ybx[<<(src=%s dst=%s tgt=%s)m_pulldown malfunctionicmp6_redirect_input%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_reflect%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d _icmp6_input%s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) inet6icmp6statsrediracceptredirtimeoutnd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknd6_gctimernodeinfoerrppslimitmtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtudynamic_rt_msgicmp6_error%s: ENOBUFS in icmp6_error %d NYIPv6 address: "%s" is not on the network lla_lookup: new lle malloc failed in6_update_ifa1%s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s in6_get_llsol_addr%s: in6_setscope failed in6_join_mcastgroups%s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlin6_if_link_up%s: %s marked tentative in6_if_link_down%s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headerin6_ifattach%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback%s: failed to configure the loopback address on %s (errno=%d) get_ifid%s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal%s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6db)$*)X)d)db:C8*4*0*@H**db(+,*(*@+dbD)$* *ԫ@*6)P5)db+4**@db<@)db+d+db,)dbC(<**@<db)C(<**@<dbsC(<4**@<dbgC+*@*dbC+*@+?Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %d3!inet6ip6forwardingredirecthlimmaxfragpacketskeepfaithlog_intervalhdrnestlimitdad_countauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyanonportminanonportmaxlowportminlowportmaxauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsstatsuse_defaultzonemcast_pmtuanonportalgoavailableselectedreserveneighborgcthreshmaxdynroutesparam_rt_msgip6_initm_pulldown malfunctionip6_input%s: packet to an unready address %s->%s ip6_get_prevhdr%s: off < sizeof(struct ip6_hdr)ip6_nexthdr%s: m == NULL(@AAA==(A*/1inet6pim6statsregister_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctioncW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aassumption failed: hdr not splitip6_output%s: refusing to send from invalid address %s (pid %d) m_pulldown malfunctioninet6multicastmulticast_kludge ))))))))%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timernd6_init%s: workqueue_create failed (%d) nd6_options%s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt nd6_resolve%s: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest%s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 nd6_na_input%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %u, NA packet %zu) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_ns_output%s: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer%s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_input%s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %u, NS packet %zu) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) nd6_dad_start%s: %s: starting DAD for %s RSRAnd6_rtr_cache%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: src %s is not link-local %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, %s packet %d) &.3;CKS[cksinet6raw6pcbliststats`++D+++ ++L+++<++(++++4+++m_pulldown malfunction  sa6_recoverscope%s: assumption failure (non 0 ID): %s%%%d in6_setscope%s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s @&@+@+@3@+@+@8@+@+@+@+@+@E@interfacelinkunknownsiteorganizationglobalinet6udp6sendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunctionudp6_output%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket +++̨++T+++p+@+X++D+0++++++*&Rik  $ "BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d d@P@OX@P@Z@B@7@P@O@ @Z@P@! @A@vn@P@F,@@u@@J @Pj@P@ @ @ "@@ @ b@ R@ N@H>@X@ v@ `@ v@[@|@U@o@ 9@ P@ Z@aAcCeElLBAnNDCoOsS[ZuUxXzyzZ|{"5% mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0), --_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\5$#"12< 3>!(4[")5]#@6^$+7%-8&/9'*0-=.%`bB|_pP&oO`!vV  dDlLjJ/zZ0wWaAuUiI eE ,;' cC' tTsSrR3nN4mM2\yY{xX}.:kK~'?qQ 6gG7hH8fF(, _d/^ q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ 5 12 3l#!4>"5<#6$$7%8"" &9""/'0""*----.' xX.vV_lL[cC]wW^kK!hH<7 gG>8fF=9qQ&+/f-0uU\iI/aA{ eE} oO* sS? nN(4rR)5tT-63dD:,4yY@.#$ |pP~ zZ`bB+:mM%16,-"27..'38jJ;;2 9 d .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>|  9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm +x+ : input=%d, output=%d, feature=%d uhidreacouldn't establish power handler H+++++t+4+6+46d:c addr 0x%02x(unknown) ()%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlisti2c-indirect-probe-strategyinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-bytenoneunknown probe strategy '%s'; defaulting to '%s' WARNING: ignoring bad device address @ 0x%x : I2C bus i2cdevstcouldn't establish power handler i2c-child-devicesi2c-no-indirect-configi2c-enumerate-devicesaddrnamecompatibledevhandleWARNING: ignoring bad child device entry for address 0x%x iici2cexec,i2c_bitbang,i2c_subr|LwG+-@1@++44+476t34i2cexec|LwG8+@iic at %s bus %di2c_subr|LwG+@     mii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4x OUI 0x%06x model 0x%04xmiiaut!A  !@@@@mii_phy_setmedia: MASTER on wrong media, no media present HomePNA1%s%s10baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXauto couldn't establish power handler RRTRRRRRRVh@@@@@@ :@ e@ @ @;@.@@7@Z@}@@4@@@51@6V@ z@ @ @ <@ ?@ ,@ -7@ Z@ @ @ =@ :@ @ )@"M@6q@$@@ @8@P'@##   1 @,P, ,,, ,,, ,,, ,: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX  22     * #hhu hhhBCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyA L@: Media interface : %s, rev. %d &,H#,&,DP83840 10/100 media interfacensphy) 28@W@ v@@: Media interface : %s, rev. %d X+,*,@),DP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyter) 2@: Media interface : %s, rev. %d $/,,,.,QS6612 10/100 media interfaceqsphy) 2U@U@U2@U3 @U1-@: Media interface : %s, rev. %d 2,P1,L+i82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphy) 2@U5@: Media interface : %s, rev. %d 5,3,L+i82553 10/100 media interfaceiophy: Media interface : 3Com internal media interface 8,,7,ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexexphyM V x@{ @4<,,;,4<,H9,;,: Media interface : %s, rev. %d 100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphy) 2@@@@$@: Media interface : %s, rev. %d X@,=,?,ICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphy) 2}@}@}(@: Media interface : %s, rev. %d C,A,D,using Seeq 84220 isolate/reset hack C,A,L+Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphy) 2v@v@v/@v M@v l@v @n`@: Media interface : %s, rev. %d G,PF,L+DM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphy) 2X9@: Media interface : %s, rev. %d J,H,L+Am79C901 HomePNA 1.0 interfacepnaphy) 2: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d : Media interface PM,,L+ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyxor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zeroh[,T{,],HZ,|t,f,^,],Z,H^,4%s: emergency X server detach screen %d-%d added (%s, %s emulation) wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted dmux kbdmux %d: console (%s, %s emulation), using %s wsswcouldn't establish power handler wsdisplay at %sloadedwsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDID =( dumbdA,,X,P,,,, !!!c        BBB257#A^bgejzuxwsemul_vt100_output_c0c1%s: ESC in kernel output ignored ܎,Ȉ,,,,,8,Є,0,ԇ,؄,\,vt100A,,,<,,<,,W\))GhntLAu  "$&((((((((+=????????B`/[>24;20;0cP2$u%s%d\P0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" AAAAAAAAAAAAAA,A2A AAAAAAAAAAAAAAAAAAOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_versionwsevent_copyout_events%s: unknown version %dwsevent_read(,T,  mux %dcannot load keymap: console keyboard, using %s attach error=%d couldn't establish power handler couldn't register as input device connecting to %s disconnecting from %s wskdetwskbd_detach: %s didn't detach ,Ľ,,4л,4(,6x,4wskbd at %s%s: event queue overflow wskbd ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmuxconnecting to %s %s: disconnecting from %s L,,,4,4<,6,4wsbell at %swsbellrasops_reconfig%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported rasops_init%s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary @`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????cwccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not lockedb&b&b&$A $Ao&A&A                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~'AU(Aag(A)(A2(A#)A$)Aͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠBoldfacecd9660nopl.0679 &..RRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991APXL4-7-TF5-4-PN3-RR43-CE3-STl3-NM`6-9-CL4-0PL4-0RE3-@RR43-CE3-STl3-SL:-RR43-CE3-STl3-SPERx<-CE3-STl3-cd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] :CD001%/C%/@%/Eroot_device0AX/A-A|LwGH-,A cd9660_strategy: spectag VT_ISOFS, isofs vnode ..d-AAj94A:PAti:lAti:Ati:Ati:Ati:Ati:Ati:Ati:Ati:Ati:,Ati:HAti:Ati:Ati:Ati:Ati:Ati: Ati:(Ati:DAti:`Ati:|Ati:Ati:xAti:Ati:A:Ati:Ati:A\-Al:AX-0AS-LAti:hAti:A:dAti:A,.-AX.-A:A :$Ati:@Ad[-\A$:A879d`/AAj94A:PA:lA:A:A:At:A:AD:A:A:A$:,A:HA:A:A:A:A:A: A:(A:DA:`A:|A:A8:$A:xA\:A:A`:AT:A:A\-Al:AX-0AS-LA(:hA:A:dA:A,.-AX.-A:A :@Ad[-\A$:A879d0AAj94Ap:PA'-lA:A:A:A:A\-Al:AX-0AS-LAT-hA:A:A:A:A:A:,A:HA\:dA:A:A:A:A:A: A:(A:DA^-`A$W-|A:A,.-AX.-A:A :A<&-$AZ-@Ad[-\A$:xA|[-A:A879A`:AT:???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥmsdosnoplmsdosfhplo-o-loadvnode(): pcbmap returned %d :Ho-:Po-:deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld updatefats%s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. .. msdosfs_rename: updating .. in root directory?P--آ---|-h---h-msdosfsmsdosfs_sync: rofs modRRaArrAaUmsdosroot_device7A|LwGX-6A   msdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu .... .. `d7AAj94Ap:PA؎-lA-A:A:A-AT-Al:A8-0A-LA -hAt-A:A:A:A:A:A:,A:HA\:dA -A:A(-A:A-A- A-(A:DAH-`A:|A:AHy-Aw-A:A :Aо-$A@-@Ad-\A$:xA-A-A879A`:AT:AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zbind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d BDZ\^`bdfhju_acknfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpw6.6.6.5.nfskqpollnfskqdetnfs_sillyworker%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_init9.9.|:.:13/nfs send error %d for %s nfsd send error %d nfstimertimer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s  @not respondingnfsrvdescplPAPA|PAhPA\PAJPA6PAPAPAOAOAOAOAvOANOA,OAOAOANANANANA ?BEF   build > MLENF''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  nfsumntnfsnfsstatsiothreadsbuild > MLENnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%u/nfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootPVATAPSA|LwG.LQA build > MLENnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)dXSAAj94A:PAti:lAti:Ati:Ati:Ati:Ati:Ati:Ati:Ati:Ati:,Ati:HAti:Ati:Ati:Ati:Ati:Ati: Ati:(Ati:DAti:`Ati:|Ati:Ati:xAti:Ati:A:Ati:A.A.Al:A .0A.LA.hAH.A:dA*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffs_snapgone%s: unexpected snapshotffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptdd00:0:ffs_newvnode%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mountingffs_reload%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2H0 0 0/$0Z0^0 %s: options QUOTA2 not enabled%s root_device%s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' ffs_sync%s: rofs mod, fs=%sdgAeAcAufs|LwG#0 aAcAffs_read%s: unexpected snapshotdcAAj94A:PAti:lAti:Ati:Ati:Ati:Ati:Ati:Ati:Ati:Ati:,Ati:HAti:Ati:Ati:Ati:Ati:Ati: Ati:(Ati:DAti:`Ati:|Ati:Ati:xAti:Ati:A:Ati:A 0Ad:Al0A00A0LA0hA0A:dAb0A|0AY0A:A :APx0$AH/@A0\A$:xA0A879A/XA/tA /A/A0A(0A: A: %#jx (fixed) uao_putuao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultt0ubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object udv_detachudv_attach00 0T0flt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmemkmemkvauvm_km_suballoc%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainfltagain2loanzeroloanuopg(1Mprocuser_va0_disablevmmpepl@41l41vm_mapuvm_unmap_remove%s: kernel object %p %p uvm_voaddr_release: bad typevmmapbsyvmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressguard_sizethread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %dhnAoAzA$oAemergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! pooldrainfork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slabuvm_page_physload%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.uvm_physseg_unplug%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG  U]rr:r$swap_off%s: swapdev not in listswap_encryptswstrategy%s: vnode type 0x%xuvm_swap_init%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedminirootswapctl: miniroot copy faileddisksortswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiodswap_on%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d done 4 4114476t3414p1444uvnfp1uvnfp222222copy-cred-on-forkbufq_disksort|LwG8"2{Adisksortbufq_fcfs|LwG\#2H{AfcfsNetBSD-CORE%s@%dELFNetBSDexec_elf32|LwG32{A#!exec_script|LwG D2{Avmcmdkillsextendscallsinit/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path|A}A}A}A (default %s): haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d pgdaemonfork pagedaemonioflushfork syncer%s %s (%s)%s %s %s%stotal memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/init  maxvnodesmaxprocmaxfilesargmaxhostidvnodeprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetroot_devicefsyncipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timeconsdevmaxptysmaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrlwpforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetiddumppathownergroupmodeno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionversionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvmvfsnetdebughwmachdepuserddbprocvendoremulsecurityA,@A#7$wx@g`8@O@Accounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptcv@|2444deadcv" """usersystempid %d (%s): %s write of %zu@%p at %lld failed: %d %s%d%.*s%lldcoredump|LwG\2AToo many CPUs. Increase MAXCPUS?cpu%d 4 4 4 4|2 476t34fdcloseincrease kern.maxfiles or MAXFILESfilefiledescfile2dup224444476t34entropy: ready entropy: best effort <cpu0entropy softintentropy intrdropentropy intrtrunc<WARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) <WARNING: system needs entropy for security; see entropy(7) 22seed(3entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategatherneededpendingsamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)filt_timertouch%s: invalid type (%ld)$A44333T3 33 33kqueue3d 3org.netbsd.kauth.process333|3333 33x 3 3,3 3`3 3`3EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTYh383P-34 3:AIO/*fexecve*execargsshould not happenexec_init%ssigcode kernel mapping failed %d pspawnwaitlwpwaitnetbsd`pp\dphrinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCprocforkmxforkulimwaitlwpwaitidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated ???AA A(A3A?Adopowerhooks %s: %s (%p) dopowerhooks: %s done resumesuspendstandbysoftresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx idleinterruptsoftintpserializeassert_sleepable%s: %s caller=%p_kernel_lock%s: contended ???Kernel lock lwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %dmodule_builtin_add%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%s/modulesorg.netbsd.kauth.systemBuilt-in `%s' failed: %d moduleautoloadautounload_unsafeverbosepathautotime|LwG[Amodunloadmodule_start_unload_thread%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dnetbsdmod_hookauto%sLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.kmod.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d mutex_vector_enterlocking against myselfmutex@[5[543MutexphysiodphysioDevices without power management support: %s %s: %s is suspended by %s (delegator %s) pmfdebugeventsuspendsuspensoridletransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classdriverbusPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.self%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: giving up done Suspending devices:. %s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuețA؛AЛAAAAAAAsystemdrvctl**** RVY\`cacfailed to reserve PID 1 for init(8)procplorg.netbsd.kauth.processexpose_addressprocproc2proc_argswaitlwpwait@@ @@ %s (pid %d) changing logname from %.*s to %s reboot KKK]UKKkorg.netbsd.kauth.processcurprocpaxflagscorenamerlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememoryusememorylockedmaxprocdescriptorssbsizevmemoryusemaxlwpstopforkstopexecstopexitcoreschedcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x rw_vector_enterlocking against myselfrwlock`[5[54j4Reader / writer lockcrashme_sysctl_forwarder%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashme_mutex_recursion%s: locked once %s: locked twice %s: initialized crashme_kpreempt_spinout%s: disabled kpreemption crashme_spl_spinout%s: raising ipl to %d %s: raised ipl to %d, s=%d crashmeselfdebug_crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s crashme_remove%s: unable to remove %s from sysctl panicplain old panicnull_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabled!!sigactsksiginfoorg.netbsd.kauth.processAD 0  trapsignaleventswitchpid %d was killed: %s sorry, pid %d was killed: %s sigexit 1sigexit 2pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) sendsig: bad version %d proc_stoptrace4z4z4Tx4WARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s/%usoftint%s block/%usoftint_init_cpu: cannot allocate memorynetbioclksersoftint_picklwpparsediskhaltrebootuse one of: %s[a-%c] %s none halt reboot none%s%lludkswap dumps on %s%c genericmdmd0nfsroot device (default %s): dump device (default %sb)file system (default %s): ?use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured root  sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesleep@Ȫ4444kpause@Ȫ4444 %pWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU\sched<4P444A  ( *$/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_lookup%s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content version %d type %d len %d: %d end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings %s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destruction/%d@%dpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone ,5callout@Ȫ4444calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system todr_gettime%s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! todr_settimeCannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcntsbsizewAA AAA%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%ssched4.4BSDnamertts acl_posix1e_mode_to_perm%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %dconfig_devdelete%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachrootlocationev: %s %s at %s in [%s] deviceparentcfgmiscbootstrapautoconfdetachallconfigintrconfigrootconfig_finalize_mountroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namedefaultlocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported swaiting for devices: %s done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-registerAA"A%sconfig_detach: forced detach of %s failed (%d)detached root device %s not configured detaching %s, success.failed.unable to detach instance initinit rollbackfinifini rollback not configured unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected range NULLbufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcpu0%s/%unist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testkernuserurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? corepkg1st%s %s has %d %s siblings: %s GAVE UP %s first in package: %s ureadc: non-positive residureadc: non-positive iovcnt   device-get-propertydevice-enumerate-childrendevswbdevsw_attach%s: block majors exhausted cdevsw_attach%s: character majors exhausted readwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorgeometrytypedisk-infodkopendisk%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%c%s%devcnt,%d/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extentextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not found hashdone: invalid table typehashstat KMGTPE kMGTPE %qu%s%c%sB Bdisknamesiostatnamesiostatsiostat_free: iostat_count == 0kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS (A3A>A IA(TA0_A8jA@uAPA`ApAAAA¿AͿA@ؿAAAAAAAA A@Akmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pP6\O6klogmsgbufsizemsgbufP6O60R640Q64P66PS64runoncepcu_lwp_op%spercpu%s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) poolpr_phinpage_check%s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u pr_rmpage%s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocatorpool_init%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s pr_item_linkedlist_get%s: [%s] page emptypool_do_put%s: [%s] page header missingpr_item_bitmap_index%s: [%s] %u >= %upr_item_bitmap_put%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pBjfqTqVX`bCd ݻ*,,,,,,,,,(null)0123456789abcdef0123456789ABCDEF%d[% 4jd.%.*ld] |/-\%s: table is full - %s %s: table is full %s: Skipping crash dump on recursive panic panic: %s autoconfiguration error: mismatching pserialize_read_exit()pserializeexclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecific66btallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehashvmem_rehash_start%s: workqueue_create %d static_bt_inusestatic_bt_count%s/%u%sInvalid IPL: %dposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_pool7`7787L7 7l7!7aiodoneaiost_process_singleton%s: invalid operation code {%x}naio_process: invalid aiost state {%x} aio|LwG6A"*FI8;07.7:78797D87A=7;78720;7:78:7d9787efdreadefdwriteeventfd _X$&( $fqabortfutexXB7B7I7?7invalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit WRsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s nist_hash_drbg_instantiatenist_hash_drbg_reseednist_hash_drbg_generatememfd:hAg7f7tb7f72\e7|b722d7b744\d7memfd compat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgpl}7q7t7Px7x7w7<77X77org.netbsd.kauth.systemA2222Hp7o7Ht722mqsendcvmqrecvcvmq|LwGu7Alwp_parkȪ4444parkedpsetpsets_maxlist%d:1,%d:2org.netbsd.kauth.systemdirect_selectselectXselect@Ȫ4444pollcompat_16pauseposix_schedschedpri_minpri_maxorg.netbsd.kauth.processTR"OsocketA7772d77l7877,77t77 77A$72728777X7@7tfdreadtimerfd5&.17&%RMEb%s @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@7777ttyrub: would panic c = %d, val = %d found only zombie processes not a controlling terminal no foreground process group empty foreground process group iowait ] load: %d.%02d cmd: %s %d [%#lx/%d%#lx%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreforg.netbsd.kauth.devicetkstatninnoutcanccrawccttyqsize/dev/consolecompat_60compat_43ttyoutttyinttybgttyopnttyclsIAQAVA]AbAfAlA ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlc,"8\"8!88increase kern.maxptyspty@'8(8$)8D80+8888674\%88<8d80+8 48 86h!8444444476t34putc: required clalloc b_to_q: required clalloc T:8 498\9888 4d886$884inetaccfaccf_localstreamseqpacketdgrampcblistj sockaddr_copy%s: source too long, %d < %d bytes(null)unix: inet: inet6: link: atalk: (unknown socket family %d)%sbad family %hhuWARNING: mclpool limit reached; increase kern.mbuf.nmbclustersmbuf %p already freedmbufmsizemclbytesnmbclustersmblowatmcllowatstatsnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)m_prepend%s: len > MHLENm_copy_internal%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]m_pulldown%s: m == NULLm_copypacket%s: no header (m = %p)link cAw8Lx8Hx8w8y8y8w8y8x8y8y8,{8x8y8y8x8x8 x8(x8y8unix8 c<9pA8 c9pA8 c=9pAԋ888$888H8̏88Ѕ8X8psemorg.netbsd.kauth.systemposixsemmaxsemcnthÀ822228822semksem|LwG8lA9;=?)'RAAsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %luorg.netbsd.kauth.networksopendfreesoinit1 %d84888Е8P8Е8Ԕ8socketnetioAsbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lusbcreatecontrol1%s: message too large %d mbsonameacceptmbcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdata%A,A3AA 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_statsB9B9ncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table ..vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultgenericfstypesmagiclinkstimestamp_precisionA\AHAorg.netbsd.kauth.systemfailed to attach file system '%s' because it shares the same fstype (%ld) with %s #lf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../machine_archmachinezaurushostnameosreleaseemulkernel_identdomainnameostypeuid%uruidgidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags AAAA%s: failed to start extattr: error = %d syncing disks... giving up done vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system ?root file system type: %s WARNING: No file system modules have been loaded. Supported file systems: %s no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncdelayfiledelaydirdelaymetadelayinvalid specnode type: %dILLEGALAAAAAAAUNKNOWNAAAA AAA'A0A:ABAJATA^AeAnAwAAAAAAAAAAAAAAAAA AAA%AAAAAAAAAAROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd) %02x %slrulisthd %p %s: vflushbuf: not dirty, bp %pvflushbuf: dirty syncerACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADVT_NONVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFS@` !.AS]issymlink-targetXA\A`AdAjAqAwA~Aufs%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %d%d syncwait/99x9 ffsnfsmfsmsdoscd9660fdesckernfsafsfstchgfstcntfstlwpvnfullvnodevcachevnode cache hashvcache_reclaim%s: cannot reclaimdead but not cleanvrelel%s: bad ref countvcacheplvdrainvreleholdrelel%s: holdcnt vp %pvcache_make_anon%s: cannot lockvwakeup%s: neg numoutput, vp %p  *,.024vnA_:^:p\:Q:Q:4\:|d:R:2Y:HW:V:V:P:U:xattr-listsystem.user.security.trusted.xattr-namexattr-valpA|AXAhADAPA 0A p_size (%llu) fcfs%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) dkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d wedge:NAME=%s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dkswap%s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFSaBBqBB%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfsEFI PART%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC (s*K>;B2IчHB|nQn- q+BZIчH B|nQn- q+ BSFU0eC BIчHBIчHB-чHB-чH"BSFH0eC&BS'@ )Ѹ*B*1@ )Ѹ2B1x )Ѹ7B3Dh&?B=rGy=iG}DB|nQn- q+KB%s: wedge named '%s' already exists, manual intervention required %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTmsdosswapffslfsraidframeccdcgdhfsvmkcorevmfsvmwresvntfsext2fszfsfictitiousmdidlefcfs(J;3couldn't establish power handler %s: cfattach_attach failed md* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ezyund_set_timer%s: invalid timer type pfilB$<B$<B$< B0%jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG`B`B`B`B`B`B`B`B`BaBaB aBaBaBaB!aB%aB.aB5aB:aBDaBHaBMaBVaB\aB`aBhaBlaBraBvaBaBaBaBaBunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs  gntsq=s=4s=q=q=bBbBbB%s%s%sstring"propstng"e bB%llu0x%llx%llicB}=}=rbmn|=,|=`{={= |=integerpropnmbr$e( cBstrtoull%s: invalid base %dstrtoll%s: invalid base %ddBh= dBT=dBT=dBD=dB=dB|='dBTz=?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelUbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlaniflA[VLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersaveSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchanSIOCS80211CHANNEL%sSIOCS80211hidessidapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragIEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableffs4.2BSD%s partition type is not `%s'Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointO}'$8X6V)userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s: %susage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s &S{*Sskc/S[SKCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood @aSalaaaab,bLblbbbbc:cZccc%s: #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: %-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s UGHRBD M@dmCLS1@2plbunspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260718NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260718NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverUnsupported redirection Location `%s'Too many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%cٌ421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) "&*.26 ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEY_mcmpclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS./1%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgzFTPSSLNOVERIFY1/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.7 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.7 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.7 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.7 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.7 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.7machinezaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxyH#z#,4،#54#AJ#[e#v~#|#ɐ{#֐ߐ#4#4#4"#x#N#"0#,4#6?#Cy#M^x#jw܍#|w|#~##‘ʑ#}#ߐ# 4#4#$#)##:4"#ES$#eߐ!#q4?#}4>#%sFTPSSLNOVERIFY/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7FTPSSLNOVERIFY# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed/dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula!%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalida%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:863: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF ¢̢ /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS$+5?HO^ekrzŧ˧ϧקۧ unknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%   "#$%    "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmd%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700modulesbaseetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugxdebug  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s 5O1LcAs5%zu%llu - %llu %s, %s/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSAHMWajq˴дմٴݴ!-=//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD11/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/etc/resolv.confpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%a, %d %b %Y %X%Y%m%d%H%M%-30s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s%c/dev/r%s%cr%s%c%u%s (%u)fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sghxa  ""{!KIu+1$}"')*3%unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSн׽ܽ#+08=BFOZ_dhlv|̾ %s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %s%s%sUser answered no to destroy other data, aborting. %s [%s %s]%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------   "#$%@//tmp/usr/var%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s !"%*s %s%llupartman%s/%s##<##rrwlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s%draid/tmp/raid.%d.confwCould not open %s for writing cat <%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sgpt destroy %sout of memory-a PY`it~ ,gpt %s %s -b %llu %s%s_%lli@%lliNAME=%s/dev/%s/dev/r%sr%sStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1181: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnused Pri GPT tableSec GPT tableSec GPT headerGPT part - gpt resizedisk %sunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs !)-37@HMUѱ=uYũQ)?Q1cu+ͻIgI-windowsefibioslinux-dataappleraidvmcorevmresered $3*/H6 U!biosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLSFH0eCSFU0eC Hah!IdontNeedEFI(s*K>;$(|nQn- q+3?|nQn- q+NX|nQn- q+en|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(YbBRuoqr3Dh&\ M}-/@@Mjy֬Qb-чHsw-чHZIчHIчHIчH2IчHL6 %?aS'@ )Ѹ*1@ )Ѹ491x )ѸEPST.qBHo6֯i`k/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/%u%s (%u)%s_%lli@%lli/dev/%s/dev/r%sr%s/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal error%d%d%d%d aI3a g9u+E5mQEaNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition 2AIVaqAv usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s| %5lld %-3s `dhlpt %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA ***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiB-%u %uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x ?%s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu %c\%03o. --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms pollrecvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: unknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)%s%s (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Host UnreachableDestination Port UnreachableDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededFrag reassembly time exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr8, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %d HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid maxwait time: %sBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -s%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initsplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogbcdefgh_ijk!l+m2no9pDqrJsQYtuaf"vlwsxxzyABCDEFGHIJKLMNO P Q S T# U- V7 WA XK ZZ 1b 4k 6t ~ | ~ }               ( , 2 9 B J R \ i s              J     , : F  y y w w (null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt_new0addingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedx x rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deleteyw yw link#%dcmv} - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%sAFKRU[protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt lo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)h#o#u#y#~###if_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %sN/Y/e/t/}/ %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s/////,(g' /BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %sipv4_deladdr%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics ---   % % : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc   : (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B.5 5 5- 5I 5a 5y 5 5 5 5 5 5  alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646tolowertoupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~6I 6h:pB6h>xB6"6(6.646:6@6F6L6 R6@X6^6ĢASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincs_path CXxC bc_base_maxxC bc_dim_maxxC bc_scale_maxxC bc_string_maxxC coll_weights_maxxC expr_nest_max xC line_maxxC  re_dup_maxxC  posix2_version xC  posix2_c_bindxC  posix2_c_devxC  posix2_char_termxC posix2_fort_devxC posix2_fort_runxC posix2_localedefxC posix2_sw_devxC posix2_upexC stream_maxxC tzname_maxxC atexit_maxxCUnknown error numberUnknown signal number%m (%s)L LLh L L  LT &L ,L 2L@ 8L >LDL,[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%ld ,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!  HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C059N13xfr?tZunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`K #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.2 Copyright 1995-2026 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.2need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist