08Phqj'&<  'hqje6P''`'%. %.hqj'&P@@<@T 08Phqj'&<  'hqje6P''`'%. %.hqj'&P@@<@TU hqj`'%.yAhqjhqjhqjQ$f hqjhqjhqjRAhqjhqjhqjfAhqjhqjhqjgAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjmK8Z%hqjhqjhqjX`hpx$hqjhqjhqj (08@HPX`U$hqjhqjhqjhpxeQ$hqjhqjhqjS$nhqjhqjhqj (08@HP KAhqjhqjhqjChqjhqjhqjAhqjhqjhqjAhqjhqjhqjmAhqjhqjhqjX`hpx\$ hqjhqjhqj$hqjhqjhqj$>hqjhqjhqj$hqjhqjhqj$shqjhqjhqj$hqjhqjhqjAhqjhqjhqjm hqjhqjhqj$hqjhqjhqj $hqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqj$Rhqjhqjhqj (08@HPX$hqjhqjhqj $hqjhqjhqj$hqjhqjhqj$hqjhqjhqj$hqjhqjhqj$hqjhqjhqj$hqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqjAhqjhqjhqj3C^ѡj}4f-S' b>WC0䥢pOk6_$O~SB_f^"Cso (W~q]axeyc20l3 JzdE 3#WR +~"lBp%. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF@4W%4 (@@""]]n$n-n-#,,n$n-n-NetBSD|LwGPaXUYSRHffffffffffffUVSa( o-9s 9r[^]UWVS5Z(]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*t]9nUWVSs(E@@9s{*J;9r[^_]UWVS2W(E u S.M |4QME @E -t/tuEUEt E$Vl$V o-9s 9r"$VED$E D$E @$薂$Pn-9h9rX-4D$ D$ D$$1ɉL$U$ͩB$SW(5u1ƃ5$tЃt^$k_[SWÉ(4uYƃ4t|$^<$^kt(?t<$AktЃ_[UWVSh"h"hK.\ A&1t:PwYxOvhK.j DXZ3h%hK.\ hK.j [DjOUEU MsMU HE]驀UVS1ۋC&tVPZYu C&C܍e[^]USPh"hK.[hK.h"|D& CtsPhב"hK.[jNNUWVSE tuhޑ"?URhc@5@T.+¡DT. t Ph"j苩u]#~#]]ܻ]#}~#U]#~#WVSuQRPh"wWE t]#~#RPh/"RW u5DT.h="EEEPhc5@T.轆 t5DT.h"j1UWVSSuE H1ۃv>PW荘ZYtCݠC&uދݤC&Eh"WdZY1tFEEPhc5@T.+ t5DT.h"j荧1e[^_]USu ShΒ"j<]UVS1D&tSPܗZYtFSh"jD&e[^]UWVS ]u} Sh}" } ~Sh"<}1{EFE} t!v"gR1UWVS`] u~ uh"Uȹ1Rhc@5@T.oE 5DT.h"jʣR.DPEU ЋU Шu>M9Mt65EE1EEEK>tt,uh"c91}}}}}E뺉t9Wuh"jU9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4ŀD&5DT.hē"P }t*}uuuuM9~VQuhؓ"j1ۉ]Ek]lSSEYu h"j1}E1҉Uuĉu܋uu}}UUMMPh c5@T.[ u EX@1}Wu[5DT.h"j訡EuPE4ŀD&h#"OCE rh+"Y^ElU9U|S.<ES.]"rt9U}I}s}u,@)1ɉMMf>hS.h$)OXZCtCPhm$O_Xj +N^CtCPCPh@"N CtC"PSha"N Cts؋C4ŀD&h"N C$Ph"NZYuVZXEw1e[^_]UEdU.]UE$U.]Uh"jUh-"jUhD"jџUhZ"jŸUE E EE]iUhjjjuho"rmxT.|T.Uhjjjuh"Gm,U.0U.Uhjjjuh"mlU.pU.Uhjjjuh"lT.T.Ujjjjuh"lT.T.Ujjjjuh$lU.U.XU.\U.T.u(Ujjjjuh"elU.U.T.u(Ujjjjuh̖"3lXU.\U.Ujjjjuhݖ" l0-u jBUWVSuU.1U.XU.1\U.>WXuWh"j=S4aY_u Sh"j衝xxuSh("]hjjhD&EP)Cuu뺋T.#H t uhB" PT.WPZ_T.t(#=t T.t hr"@3XT.ƒtuh"<t?%t4!t$t T. T.h"j譜&T.e[^_]UVSpT.uXDU.U.HU.LU.U. U.;U.U.rgjU.DU.U. U.HU.LU.X=5PU.uTU.E DU.)EU}t 13A}uke[^]ËHU.LU.ut U. U.UhE&h$j蹛UUhE&h$j蝛UUSË@4URs(PZYts$h$j蒛S4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@us8uK ]USQ09s SLZSPEPEMƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h"jȚC4WPs(Xe[^_]UWVS]uVh`T.j=C4uu s(P(蹙8jVj=$襙8؍e[^_]UWVSU.}t U. U. U.U.EUEUEU}uHT. t?11ҋ}9׋M} ytEUU.U.EU.U.ut(jRP5(U.4U.P Bu@u 5$U.h"MuShU.Ɖ 19|8uu5$U.h3"/蔘8t5$U.h$jG11U.U.utTU܉EE܋UT.T.5U.5U.RP0T.T.T.T.1ɉ U. U.5T.=T.9}u;9uu6E9U.u E9U.tT.T.|T.T.lT.T.9}u9utT U.t%=xU.uxU.5$U.hE"R.XZ U.t5$U.hi"j)u}U. U.+EUEUU. U.5U. U.9uEr uM}u}tURU.)P5U.q4 U.U.U. xT.|T.ut5U.5U.hU. ;U.C;U.7벍e[^_]USÉЉʹu U.xQj h]#RPS]SH6Suh\$>?(]UWVSljӃ=U.t%tPhЙ"h V=h PV蜠 =U.wwVPhؙ">w$w wwwwh">0wxww|7Phy"j>(wlwhw\wXh"K>ރ } U.@U.HU.U.=td=t=t.h=@uaU."IU.ݚ"U. ƙ"=U.t"U.P~ZU._U."U. I=U.t*U.P$U.4-8-hU.hU.TnU.Y[U.~8-?8-U.98-}8-=U.t.t h"j萎5U.h)"<XZg=U.u^8-h"Ph"P5U.Ph["VVhf"<(=U.t4-h"Ph"Ph"<h"EXGWO_)Ӊ+G(W,ȉ=U.!=U.th"hF&hJ=U.hț"hF&hKh"蜆uDžF&t1jj@P'wU.tM9މDžs,11RP)L1󋍤tM9މDžs,11RPF)L1󋍜t;9މDžs11RPww(1ƋG_RPPh֛" :(g=U.=U.t w>1W.V.tP蚳5V.j:1҉V.YX1V.W.W.1UW.t*PLV.ZtPN5V.:1V.ZYuv$UjhY.h`J.f2 tjV.V.V.V.U.@=uUSUE W.U. W.MU.Ћ] Ӊ)~U.@[]Ã06$G&1ølbXND: 0 &    t øUWVSӃu]1$W.28W.$W.@ujjh$W.h$W.Sthʞ"h$<Y^$W.(W.8W.tjdW.u dY.C1 mCE `W.9XY.؁}ULQM5dW.O*ZYMUuXr04Ph$hK.C%hb"&1XY.HXY.t DY./t1 `W.dW. XY.uDY. u dW. KF @t.'r0X4Ph$hK.$h"1ttdW. \W.}dW.8=dY.t=\W.te[^_]UWVSu Vǡ\W.EdY.E X.E1ɉ \W. dY.[=lY.t5$X.11҉UuhEYUUXY.5dW.ZUt"?tzD$X.PPj@ƒ u- XY.t DY.tjtj XY.u DY.uݨuE\u}}!9u„tt hK.hҟ"#=\W.t!9uu E dY.uhK.h"rXZdY.t=\W.19u!Ӆu \W.9uu \W.Mu5\W.} dY.=lY.t؍e[^_]UWVS];!uhiO#CPXZShiO#P"ǃ u$o01PShz<&hK.I"h"Ju WYXyh;!u7WZy4xo01PShz<&hK.!h "T.W<ǃ=LY.uVh"hK.! $X.+E e[^_]UWVSu] }9tSC=lY.t VPVPn ZYyn01Ph$hK.f!h%"-1e[^_]UWVSQu V[=lY.t1ۅtW;uRWZuZW95 X.u=dY.t =\W.u BRUPu! uËUF?륃=lY.tuX؍e[^_]UWVSPu]>!uh;]$FP Y_Vu P ƒ u$m0/PVhz<&hK.M h7"RuSRUǃ Uyl>!u7RZy4tm0/PVhz<&hK.hO"P,R:ǃ=LY.uWh"hK. tE)؍X؍e[^_]UWVSW11 dJ.yh`J.;^u`J.P`J.s=tY.9 xY.XY.؁}U|WQ$ZYUu[l0.Ph$hK.hb"&m+XY.HXY.DY.tjJ j! =tY.xY. XY.u DY.uΨu١xY.udY.1ۉ߉ uX.xY.0xY.pY.ulJ.@t?k0-Phh"hK.Qhs"*f%lJ.1pY.-flJ.9t{t xY.xY.pY.މe[^_]UWVSWpY.C{ u)ÃEpY.<TRP Y^tElW.9hW.XY.ށ}VRe"_ZuZj0 -Ph$hK._hb"&)XY.HXY.t1DY.tjtjk 5lW.hW. XY.u DY.uҨu١hW.5pY.ljD s} us*ExtxY.M| ths")[oElW.9~VhW.XY.߁}WRc!ZY=lW.hW. XY.uDY."%hW.25xY.NjM}t1s2PRd¡hW._YtD } )s!lW.9|X hW.XY.؁}tVQ ZYK5lW.hW. XY.uDY.svhW.Me[^_]UWVSQ]utuh"XZ} 9EueF95@-}hJ.h/%j^XP^w<\u7\>t.ˆUPh"},ZYUtF-"" /B000CL 1e[^_]UEH!DY.EPhht@jG x$EfvD-Efv@-U= X.uEX.E X.X.X.~9 1; X.~h%]&XUWVS$X.}t~} t 9 X.~[C ~K X.tIS P>ZYtF=dY.tj jvPjjjWu|u19$X.uh"%X؍e[^_]UWVSP]U u h%%XU19 X.~BPSYX%KM$X.uSwPux?]9tWsZu̸1e[^_]UE R.DBuh"%XP<V.uW.EW.1UER.DBtV.Eh"$XUWVS$X.R.pY.EDJ@t t E@pY.޹pY.0U?& } $H&}^@pY. R.8f|y@@t tpY.tQe18j hpY.5pY.مǍ vd8"uh"?-t^u1=UDQ@u-t ^u؅uh%#^{d1ۉj hpY.5pY.NÍ vPd8"upt@pY. X..l$X.at$1Ƀ/QPZYtpY.M:-@pY."FPpY.@PX3t(@pY. X.;u $X. X. X.9Et9 X.}؍e[^_]U1 X.$X.X.X. X. X.x$B X. X.X.pY. ,t(;t# X.у~ X. X.JuJ pY.:;u$X.9t X.t1]UVSW.11Å t]9W.u 1ۉW.J@։tW.[^]UVSujZu+db0$Ph$hK.hb"&A!FV CS FC؍e[^]UMU 19tz\u JRQZYUWVS=@Y.ujEH!DY. X.Pjh;]$hР"ykhf#|^tZPP[=wJ@ PYt:WPwXZ|3/t 3/D3hР"S5 X.jh;]$S=jUM=XY.tI DY.QU=@Y.ujEH!DY.jhY.UWVSE$X.1=`Y.u-t xY.| t7f%lJ.pY.;u1SЉpY.Bz u)؃u ;.u{ tՍ<XY.SZu# XY.uoDY.tj>t[j$X.t P&FXPPj/ƃ t9u\Y. XY.DY.u 른e[^_]UWVSSuX.X; X.|1ۋX.zXY.9t9u SEWáX.ZYUSWj / u XY.t$195 X.~FPVj. u)ϋDY.tj,jSX95X.M~WVVWYXMXABy X.19~X.)@$X.=`Y.t R3@XZ\Y. XY.uDY.FM1e[^_]UWVS}5X.RơX.X.)C=$X.Y99~ )C)E1ɉM1XY.VZu' XY.DY.tjtzjPE"YtEG$X.PPjY-ǃ t\Y. XY.u DY.uu6l$X.@PvX]1҉UH1e[^_]UWVSQ] XY.Suj, u3 XY.DY.tjj19 X.~CPNjEpVYZ=`Y.tW0EmXZE8G+]C) X.5$X.\Y. XY.uDY.t{1e[^_]UWVSu 195 X.~@PXEuM^_1ҋE9USYYUCЋ=Y.9 Y.XY.=}UWQlYZUu[[0Ph$hK.chb"&XY.HXY.ODY.tj7jn=Y.Y. XY.u DY.uΨu١Y.ЋKS Y.B9|^5Y.XY.Ё}U\SV_ZU*Y.Y. XY.uDY.OVY.f u u|Y^uoEH$X.XY.5Y.5Zu XY.$X.PPj9* tXY.H\Y.XY.uDY.t ؍e[^_]UWVS}5Y.XY.V5Y.XZuSZ09Ph$hK. hb"&XY.HXY.uhDY.tjtTj5Y.Y. XY.t NY.1#DY.uĨtɊ<\uGGBDtG9D3؍e[^_]UWVS1uTY. HY.t hנ"fjEP£pY.XYu -E Y.95Y.XY.=}U\SVf^_Uu[X0Ph$hK.] hb"&XY.HXY.zDY.tjbjhY.Y. XY.u DY.uΨu١Y.!L<%s=Y.9}p Y.pY.pY.x=pY.8\ux=pY.@1s pY.< s =`Y.u5!5X. Z pY.뛃=`Y.u 5X.5X.WZYu5$X.릡$X.PP_XupY.Hnt*ptlt pY.8 tK pY.̃=`Y.uu 5X.5X.Y[9$X.; X.@$X.=\Y.t =LY.] = X.~ h=" BDA@u hP"I1pY.Hnt*ptlt pY.8 ts pY.̃5 X.j_ZsBaK*t$X.PRPY[1pY.Hnt*ptlt pY.8 t pY.̃=`Y.uX.X.9 RP>_ZBpY.Z=X.1Hnt@pt)lt1 pY.8 YWiSP+ h pY.뻃$X.PP[^CpY. Znt1ptlt"pY.: pY.ă$X.PP6ZYX.U=X.Uƅ= X.Uu h"X.; X.X.=X.9|9}h"pu pY.pY.Hnult pY.8 tσʃ=`Y.uPS?$X.PP]^_pY. Znt-ptltpY.: t\pY.ȃ$X.PPY[pY. Znt>pt)lt/pY.: ^P5X.5X.1 pY.뷃1= X.\Pnt,ptltpY.8 tpY.σ1=X.u OuH-X.= X.H0V pY.wr 8 t ك=\Y.=LY.u qnBDA@= X.u X.X.1`pY.Hnt*ptlt pY.8 t  pY.̃=`Y.u5=@X.u;!t1hSh@X.Y ;u=@X.X.@X.X.PS_Z9 X.\Y.y1ۊgtR< tF0 w}hH10j hpY.5pY.;iY. vD$ptruD C@pY.3H8"uh"1ۉY.6%Y. tBpY.8 V=Y.uhá"Yu8 t 1҉Y.x uh"ҋ5Y.XY.tt6]ƅu+ XY.DY.tjbrj9Y.9t'tPP5Y._X5Y.X. XY.u DY.uutY.ƒ=`Y.u!hY.hY. ZYy؃1УY.t%Y.S<[t<\t.RfZÅu!h" { uh6"*[1C뵉) ,[.9=([.XY.Ё}UtVWeZYUu[?0Ph$hK.\hb"&XY.HXY.tDY.tj\jg5,[.([. XY.u DY.uΨu١([.5pY.ljpY.=dY.tj jRP9e[^_]USpY.< u h" XH< u=0[.u$hM"XJ pY.R8tڀ u ӡ0[.PKXu10[.t=X.u P}X9j0[.Yu(>0Ph$hK.hb"&eK1҉X.5PY.S50[.¡0[. t+h'hZ.PR{/50[.10[.R]UWVSVpY.PpY.M1ۀx%u8HuzpY.=D[.há"[s9}epY.PpY.D[.pY. \PpY.D[.2< @[.pY.M8 uD[.XY.ف}|WRZY=@[.D[. XY.TDY.tjXY.HXY.jDY.U5@[.D[. XY.uDY.<[.D[.D[.e[^_]UVSVu] 1pY. u 1ۉ<[.UpY. Uu 1q8u@pY.JπwEb;1ɉj hpY.5pY.5\ v8;8"uh"'1Zgu@pY.됸e[^]UWVS 5D[.]4[.=8[.}+D[.;<[._&M 9}y;M)9 ڋEEXY.}RUuZYUu]q:0Ph$hK.hb"&NXY.HXY.t %DY.tj%tj4[.8[. XY.UDY.uΨDϋ 8[.M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEWXY.}RUuZYU4[.8[. XY.uDY.t 8[.M9u}EMELE B19uu)d9|TXY.ځ}tVu7ZY654[.8[. XY.uDY.ad8[.Cw9|TXY.ځ}tVuZY54[.8[. XY.uDY.8[.؍e[^_]UWVS] SZ=dY.tj jsPӸCjPjuMt 1E1 4[.}t9U3 9XY.ށ}V58[.uY_u[60Ph$hK.ohb"&XY.HXY.iDY.tjQjz54[.8[. XY.u DY.uΨuك=dY.tjj ] 8[.NjEpSP  9~UXY.΁}V58[.L_Z54[.8[. XY.uDY.=dY.tjj S舶 8[.Nj󤋅  ?u9Ћ)ȉË ؍x4[.9<t ttjPjuJoXY.=}tV58[.&ZY54[.8[. XY.uDY.~2 u)u tha"HXDžS=dY.tjj S, 8[.Nj󤋅 8[.f Qe[^_]UWVS$X.X.H$X.1ۉ]1X.+X.9U$X.@$X.P藯uu PuƃU$X.PP[Z8[.3EXY.1SȰYu' XY.DY.tjtsj$X.t PFZPPjƃ t9]u XY.u DY.uuE$X.G$X.E  Euh"XE tu RR x1e[^_]UWVS$X.E X.E=P-t =L-uh|"FZo=H[.t \Y.j&XY.H[.EP[.EXUZk EtSu`PR@PNwFH uu^13^@p][sHZPJJ@BE48rE@E܋]Ek ƒ 9]}3:}z}z}׉u0}xupK Ń=`Y.t谻P-$X.EP-L- X.EL- XY.uDY.tjt j1e[^_]UWVSP[.H[.Ht7k X< u'ʣH[.B0Z9tS;SLZY1H[.$X.P- X.L-e[^_]USL[.9H[.}PkH[. P[.Eu-CkH[. P[.u CH[.PH[.k P[.ZY]dL[.j PhP[.* tP Ph$hK._hb"&5P[.r1P[.L[.1]U#.Ph"hK.j J.QJ.y ;J.| tJ.J J.UhJ.P"XZUWVS։˅t9u RPh"VPh"  tdt`{tZC<x1ҍ{t2Hs!t ,X< ϊG< ĸ>e[^_])e[^_]UPEEjEP5T[. U-h"Ph"hK.jUWVSf@8uVu1Q+.1҉hW3à .8#)tSWV e[^_]UWVS} 5T[.fDž<Y-1҉uJhPj^ uj-8\-8th7$-ÍjjP7 @u--8th"j-f8utSVW y,8#QhY%)AjWjfDž=X[.t fDž9DžjRj fDž9fDž9T[.jSVZ @uP,8tfu ftR.@ufDž=X[.uK"T[.@uσfDžftv@u KfDžMe[^_]UWVSQ}u VWb[ZÅuzjjXZu h:"j:,;s jEPWHLƃ ?tE8thhѥ"j+7+8"u wڍF=wfs؍e[^_]t@Ë@ tË@tt8USEE ZAR9QD[]UjL$qUWVSQ1-[.v=`[.ڞv]=h[.]`[.5t[.5p[.h"j5|[.5x[.h"j 5[.5[.h"j5[.5[.h5"j 5d[.5`[.hM"j5l[.5h[.hc"j{E$hy"jfEPP$h"jR u 1 ujeY[^_]aUhK.h"e+jaÃ=[.tUE Puj UWVS}u Ph"j3[.B9tT[.e[^_]UWVS$ ]5[.t(V$VD0Y^ugh." j0Pu N& ypWp4$0ZtWVP~ u WhU"5M&jj0։( y0h{"jju ։ƃ  Wh VN&ƒ jjWN&‰ V N&h _Xuh"jI[^jh h R(N&y RY߉RZ=t*w=bt%1=bt" =tu hŧ"11 Њ Јƃ{t u hѧ"jYu W\ƅ/ t jZW8 jZWP2 qkPƉ4W8Z_t t10h"j 9s1BFu h"j 1e[^_]UWVS\]ƍ}ZE5 N&(0l4a8VEPSe[^_]UWVS }EP8tGpBuEP\F-Xe[^_]ÍL$qUQ H\FD\F5@\F5-N&EM MuQQ$RPhү"蔺MɍaUS]CtS P S tSPSCr s ZS L\FX]USEPsH) 8\F<\F 0\FH1҅u0T\FZ[9t l\Ful\Fu h"jt X4CXtYZ@]UWVSu EEE#-P\F@\F L\FM11ɅtJA9~ʳ9M}#t@\Fh*"hM&hh9"}9x4u }9x(u9p$t버t@\Fe[^_]UWVS]uuu SO trNj@th["hM&h1GGWX9w(~6Gths"hM&hh9"bwVw áG [^WY0\F-;L\FX=d\Fu =\\FuBGWuh\FGWtP`\FWGtG4WPZWXL\Fj@jנVj͠G _4E UG$W(G,W0wE #-G8P\Ftz8GC GtWP { _ Ge[^_]USEM Puh"hM&h4h9"'P ʉPHPPP s E]XPs2H 8\F<\F0\F1ɉH X\FHX\F.1ۉXt h\FHh\F `\FH`\FP4JH8P\F9t!tXYX tAP]UWVSUu }uWVRcËECUtH\FRD\FEEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQN& RPWVQN&e[^_]US]C%CSjSZ1]UE UMQ1]UjBUU P\FPYtHJ \F@ \FUWVS] \FC0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdܿCο${s躿 ]e[^_]騿UWVS uE EEEE%\F1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP~YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCd<C=C E1C C$hjԐEhjŐM쉁jhj賐MAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE EpduSIE싀}@u jR]^_}E UG(W,}x0xdEtFVtRP|YY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u\FEE %\FS0tK0J4\F\FC4lFC(tS(P,lFC,lFމe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hM&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hM&h)h"K@륋B 뵋EEPEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"}t/EEtP1uuRPh"]9]tSuuuh"uuk} WY[9t$PRuuhG"u艬1҉U uwXEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPe؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"unWVh"a Z}t5EtC(S,C S$9Uu9EtPuh("! EUjuuWVSucE؃uju[X}t$EtC(C PWVhI"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPuEuuWVb9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPha".uH‰?9u*_YӉ9u9u :9r 9r}thr"nhJ.ZYtFpVtFHuRPuWEU}t h"{XtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"~lF/t `d)RPh޳"G tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jE1ɉHEMA8A9A 591ۉY Y$XZ}th4j誁ËE쉃\XZu u =-ƉE} t h"X-EPjh WVuh4j8ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4jfEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhK"茠X@Et} t#h"mXu uuS9u u辢X S赢X]tS蠢_13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhXSXZ؍e[^_]UE Puj- UWVS]FHE1RPuu ~t C|}WjuȃRPVetPu h"\ u~ 1RPuu }tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuR}€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhϴ" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuqt C|}WjuȃRPV~tPuh"u Ep 1RPuuptփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXlFt C0S4C(jj\0uu Se[^_]UVSUE 9| 19[^]USPPh>"hK.贉hK.hu"8-CtsPhR#hK.耉j |USSE] t$uhZo#sZY¸tr1EEPhvd5pFٵ @u35pFhS#j:]UWVSPu }t}~^h0#SY_DžtFhiO#S_Zt)h;]$S}ZYth"Sl[_t뫿}}uhQw$v=ZYuUEPhud5pF @u65pFhS#jie[^_]US}tQ,Shzd@5pF躴 @u5pFh"jRPe=vu8FUWVSQ5FAt t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$R.1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉M0F4FÉEE1RPWVSdE)Ɖ1UQh%uXZ}Ut4FH9u0FH99stBRWh"u e[^_]U塨-=FtvPh"[u5DF5@F5LF5HF5PFh#"3u 5,F5(F50F54F58FhL"u5Fhs"t Ph"th"0~HFLF5-5DF5@FQRP5PFh"t,h"}4F0F5,F5(FQRP58Fh*"jt 5 F5$Fh"Qt UWVSQƉ91ۉjEPV >u#ËE8u 8"u w܉1e[^_]USP?$]#Ph]#Ph]#Ph]#PSh"hK.Pw,jiUWVS ÉM衔-uhM"5- hc"j׉ljEU}jؙ#E#URPQ谣BuAtV--=PuRh 3P5uFRh 9-uNE!5uF}e[^_]UWVSEUσ}u "}t"EU@uSh"@XZff=Ut+=ܕFt fuuSh".Zff=u%Sthҿ"ZfLJ_f=Ut1=pFu Sh"YY^pFtSh/"YXZj(VPE` x0XŃ~X rFt\fLJᵃVe[^_]UWVS9FuF5F}1Xƃ"Fe[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEY"E$EtEm"11}=-E4F0FU1҉U܉E1ɉMĹEEUԉӋERPSQ^PE؋UEUuuRP^RPuuЋE؋UEUuuRP^RPE؋UEUuuRP^RPuha" p,"uuuuuuuh"o h`J.jdhF=X u h"jZh#hF+uY[F]슀F< <$u { Ћ R.DQu<-"j EPhFVƉ׋]h'?&SE؃}Ph"S tuh#S t I =-Ήʋ $F1WQRPF]Ɖuh"SR u` $Fω%$FƉuuEt5 F1Et 5 FEt +5 FEt +5 FEÉ]h#SsYZ؉E8 t,hF艮ZƀFuhFh"n 59uE|E9Ɖ]}.uuuuWVh"muЋ}u}e[^_]g_USE Puh"mdJ.HdJ. yh`J.{Y`J.P`J.؃ t7@t( dJ.y h`J.IZ`J.P`J.h"jǾ1Y]UWVS M -u h"j蔾Ɖ׋-ؙljEU}ؙ#E#UƉjRPQ'Bu @u--uhuP%a mR5uFPSb 9-uUjWV5-ɜBu@tuFKE!ÍNju5-R5-` 9-ue[^_]UWVSRáFu ƀA Mz΍F S}8PR8Z F e[^_]UWVSEыEU u1#ˀ Ɖ+5 Fu}};=F}=F"EUEUE9FF}=FEuyFKlE9t 5Ftމnʅu+ F9UE}M1E܋E9E܋U}t+}t}u w{ƆoC"n"ȃ[^_]UWVS EӋEEhF@PhF} E 5Ft h"jE9E|E9u|础F] }) VRPWX5F31fǂU }u@ F5F֋M)}CsKSCPKSs FSFEe[^_]UWVSEU} u }7M] M]9 @FDF`F19UtWtN}1E9ϋE}79}E }&"=F}u1BuEPrF]Ã}!؉˃u=Fu =Ft=FY}tF }mhjIoF[^u h?"j菹fǀUE𣘚FEU FFEUFFFt_}t E FHuF=Fhc"YK"vF=F;FFEEU EUEUMxa] FtEV1;uE |9EE}=F}tEt뚃}FE 9Fu;]t~FHF1+]9~ Fu%uF PPRT F * F1RPEU F+EFXZEU FFEUFF>"" %""e[^_]UWVSË@SuHt+5@F=DF9u9t h" MY^sǹ󥉍1󫍍@u({u "{t"Ph"XZߋe[^_]Ã=Fu x t!1UWVS|ÉסTFtPcpYj/Sy^ZuS5-h%hTFm S(TFYTFu h?"jjPeZXZy5TFh$^XxPSZY@tϋuи 9E} 5TFh"V 5TFh"Ah h uFSY 9t5TFh$]Y^4f=wFUt5TFh"cKSZZSZXtjYe[^_]UWVSá uFu1ҸgT$ uFf=Fuf=vFut#uF`F uFvFfFf^FUF1t^F[^_]UWVS áFfE4F0F8F`F11t;f}tFE F16Ft9r $uf:t@9Ezti 9tܻՋ FtFu$f}u=Fׅu F4=Ft u)h1"IY  uFuh1"h6%aXZ= uFt]f=vFuvFЅTF=FtPhf"5I_XPh"ZYt 1= uF = uFuLD%th%1g uFtpvF҅tSP5TFh"H=Ft!1f=Fu1 vFF"5TFhC"ZYu gT$ve[^_]UWVS ˃uu Dž" Dž"@uh`"ZYߍ1jhy"S t 1/9Cu苅9Cus Pj_ ;Cuă=Ft.{ t(s$s sh"_e[^_]UVSPE-;-u*=ܕFu!URhmdP蟏 y h! $X`F11@uh"B=uFu111H uF~ ف uF@uh"^EF01C;F}. FFF@uSh"FY[1҉U-;-u*=ܕFu!URhmdP輎 y h! $ Xe[^]UWVS(ÉEU EUE؉u=FE9"e[^_]4g11ɉt<u ȉhxjhhP&PT-$&tPQRhB"B] fu1k t Ph]#hQ"]WVh]#hf"\u =-RPSQKPh"|\Y[=Fu! F9u )ȃ11ɉ=j-_[j)8[XZt1Ff}Ut2,"J"Ph]#Sh)"ZEPhs"Z~uh]#Sh"Y =Fx@9uHh;&jjPRsRh"h]#Sh"Y(RV e[^_]UWVShEUȉM]t'BuUE$1ɉM$1uuuuEFE̋EȉEE ]#1҉UUE`FfE9F~5 FEE̋E,EUE$1}$&E$1ɉM$1uuuuE=Fu(}t"uPh"?UuuUEtuS&}t.Efu ukE }PEP讶 EF}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u FE1E EU EU}}E̋@ E1E}@FDF+EU EUE}5F=FFE F1҉EUġF19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡FF)9E]| h"u}ĉu} 1E} lj} F1҉EUE9EE |K} u}t?1@"Ft&&F19M} |*F9M} |1EEUEU U"Ft4&F1ۉΉ*F9u} }9M} |1}E}u@F9EE DF|=Fuh2"[^1>EFE }uEEjhjjjщ¸@"E FEuE1ۉ]]]] }t#FFEUFF@FDFEU11ҹuuRPQUM %FEU+EU ;E}EE}]u)։]u}tq=FFE9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령`F19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu hF"}u}tEEM9Ɖ}uM F$F1RPuu<ҋMu 9tۃ}u E9uWVjjRU/J$EUEPuhe"hn"Oh`J.jdhF7u h"jhFΏYvEHƀFt'F t9EEHPhFh"@O uhFEPd EUĉEU EE}tjuuu uUEKjuuu uUEFtuk=Ft Ph$jSPouN}tjuuu uUEjuuu uUEYt Ph$j}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE FF F;] u1;MtuuEU G_Z FUׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }Pb 2=Ft h" YuEft=F|=Fh"Z\E̊@EȋE̊XEȍE@‰8Fp1WVjjj" E1ɡ4Fp1WVjjj*"Ã(Uȃ?1ɋ50F1WVjjj9"}̊MO_U? ˆWGEȊ_EȍG‰8Fp1WVjjjJ"xE(1ɡ4Fp1WVjjjZ"QËUȃ?1ɋ50F1WVjjjf"-}̊MO_U? ˆW(}t/=FFt Kx Fu}ˍe[^_]UVSáFu ht"!TX1ۃ=Fu Shm#JY^jjڸ`FCXZu҃=Fu=Fth"SX1L=Fth"u Sh"[JY^ FRP1҉XZ=FtCF9FA=F~h" J5Fj5F5FRP믅<f=Ft3h"S^h"I[Ft=hƮ#IFY=uh""k Ph"`IXZ hn"RIXhָ%RX=FnPh")IY[=FFPPh7" I j=Ft>u ShY"HXZ9F} hr"-RX;_ FRP1҉u Sh|"HY^jjڸ`FXZe[^]ËUPh"hK.Lj>UWVSĀ|xtȚFwSh8"hK.Kja>SKEZuhP"+xƉjRP|mx9u9thb"~Wj>Su|= 9t"xthm"h"GWXj=1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4@V&h"F*FfEEEFF19E~[tP9}u1M;u&}_PaR@F4@V&h"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaR@F4@V&h"F }9sf}wfE@f*Fu4@V&h4"EY[|}tFaP4@V&h`"E ttt111E}4F}8FS6EXZEE FEe[^_]UVSSPPVu ujVSh%G,@uLt"t"08QZ"t"PSh"juj4UVS]u VSYZu Sht"jt;/t"Sh"l%XZu E"e[^]U%e[^]U Ph"hK.Aj3UVSPhiO#PPA[^t,PjPuV%V ct jP3ZYS[Xe[^]UWVS EEu EE}]EEE1҉4F2&1ɉ 8F@Fh"Vul NtJb$Y&1=@F@FDF#_t8⋅9t Phd"#Y^Ht2{{ @D0{{@D{"Zt⋅9t Ph"X"^_eG1t{${Q!Yt&EPh" t$h"hK.$Ph&"  v$tpPhB" ^_j Y@uh`")h")XZ1߭ڍWP N&WW$h"A 2‰-ƃJu 1 t1D)‰拵CtSC8S< C$D1 t1D1t 0 Y‰D2耽tC|PYBu@u p0=2Ph%l t `dutCPDž1v 1! t1 t19u9t h"Xu tH Ɖ t*?19|j jh"X$tu;tL> t1Ҁt&x|)CS\p)CDž+ƃu ,1 t1怽tΉ׉vJt\9Ћ}) t19rt+x|)CSp)C Vbu h"_‰Ju fr1 t1tCXS\\CXZ$t CpStCH\Ɖ)B9ƒu 1Ҋ t1҉RP@@ȋ+tC@SDC,:)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t Ph".^_@ tFC8S8tGpBu EF-Xe[^_]ÍL$qUQ FF5F5-N&EM MuQQ$RPhү"MɍaUS]CtS P S tSPSCr s ZS  FX]USEPsH) FF ؠFH1҅u0FZ[9t FuFu h"jkPX4CXtYZ@]UWVSu EEE#-FF FM11ɅtJA9~ʳ9M}#tFh*"hc&hh9"H}9x4u }9x(u9p$t버tFe[^_]UWVS]uuu SO trNj@th["hc&h1GGWX9w(~6Gths"hc&hh9"YHwVw G [^WYؠF-;FX= Fu =FuBGWuFGWtPFWGtG4WPZWXFj@jVjG _4E UG$W(G,W0wE #-G8Ftz8GC GtWP { _ Ge[^_]USEM Puh"hc&h4h9"GP ʉPHPPP s E]XPs2H FFؠF1ɉH FHF.1ۉXt FHF FHFP4JH8F9t!tXYX tAP]UWVSUu }uWVRcËECUtFRFEEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQd& RPWVQd&e[^_]US]C%CSjSZ1]UE UMQ1]Uj9UU P,FPYtHJ ,F@ ,FUWVS] (FC0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdC${s ]e[^_]UWVS uE EEEE%@F1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRPYY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCmC C 1C C$hjEhjM쉁jhjMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE Epd u S IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u(FEE %@FS0tK0J4@F@FC4@FC(tS(P,@FC,@Fމe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hc&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hc&h)h"B4@륋B 뵋EEPEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"/}t/EEtP1uuRPh"]9]tSuuuh"uu } WY[9t$PRuuhG"u 1҉U un XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPe؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"nWVh"w Z}t5EtC(S,C S$9Uu9EtPuh("7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhI"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPlEuuWVY9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPha".uH‰?9u*_YӉ9u9u :9r 9r}thr"ehJ.ZYtFpVtFHuRPuWEU}t h"rXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"DF/t `d)RPh޳"] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jE1ɉHEMAAA >1ۉY Y$XZ}th4jËE쉃\XZu u =-ƉE} t h"X-EPjh WVuh4j/ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4j]EEp }}M쉏\P P jP4ZYutCHSLC419|} tMhK"X@Et} t#h"dXu uuS9u u X S X]tS _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhSXZ؍e[^_]UE Puj- UWVS]FHE1RPuu t C|}WjuȃRPVetPu h"\ u~ 1RPuu tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuI€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhϴ" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuu讶t C|}WjuȃRPV~tPuh"u Ep 1RPuutփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXDFt C0S4C(jj\0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RPY_}ÊtBRtUWRPY_}ËBht1UWVSӋEU ΃tt RP覟Y^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRP蛵 e[^]UVSuE H$X(1y9)tNp1SQRPD e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDž Ep 19}5uWSh " EzBD1H)CNjE_dE@ EDžpđ-pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G``E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hd&h "jEÃd$S\DpTtt RPtY[B^UEMhSQEjXZSbdtuuY[EUEUDpTtM]19 }9Erp@dxÉ1 t1RPuu誧1E URjW1RPVEEtH`Xd EH@E_Ή)׋EzEtIu EEu1 t1RPWV1RPh "E‹EE@ EEEJEtp`xd @@ƉEӋE‹E"EE.E؋EE)߉ЊM1ҊM t1RPWVG]K!E؉wEtp`xd @@ƉEӋEB‹EE܋EcE)߉1ҊM t1RPWV˥1uk]ӃK 1;{E@ r EFE@4uPEBHEMQjPjjRqt Ph"k[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋E1MIdQ}u}u E M̉H}tZCr{<uؠFCFFC@CC sh"hd&hCh"jS1[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋENUr,z0 t1EtpHxLp4DF6AM̃HEEЋE1RPuuƉ׋EƃEۋMtEPjuރWVQtPuh" EEЃE̋]s E1RPuug€}trzuЉ}#Evkk BEEԋEMq,y0 t1}trzrC4SPZ}u }u1dE ]Ћu)։]ЉuԋE‹EJu EjEu1 t1WVuu褑EЉUԋ}ЋEFHEËE1EURjS1SQV]tPE1RPh "PEf‹Mq EJu P! 1k}t)؉}u"}uA1 rEF1ۋA r EFA4QPX؍e[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVoFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh8"hd&hh]"MЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuhY"hd&hh"GuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQaӋEE}tEEPjuȉERPu"tOPQh" EE@ EEH1ۋEtGW SQRP蝋*EEG1SQRP|}vkk ]Gju蕦h#uVuh#uVuy(h]%uVueh%uVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jL觊Ɖ<W苊FYZuWhp"1=FPE fF81FF&YtO>~]hh:"Pƃa##lao1ɋu1҉ijh#PZ cj2WVf2 9uE1ɋtWuh?"Cy PPh"VuPZ;v.Phh"xaPWh"x@Aƃaa9tRPPh"xƃa|#a^u 1ɉ]uh"KVhVo uVh"#x V"j2P2 9~#1ɋKthH"{#Zt1CZ9{~`1ɋtWh"oVhP o uVWh"Lw j2P&G2 K{#_tuhf"vZY1ɋTt h"a]PPPPh"V\\\\\]t h"]e&t8tp SPà Rh"%蹬Xy@.؍e[^_]UWVS]CjPo _Z1uhd&h2"[^F9~?{jW7 ZYu Vhd&hO":19~DBhiO#u 菑Y_uu hd&ho" z"‰WWZt uƄsh"hPʋsh"hP豋 #R7$RWg DžuƋSS9VhQu u RWh"CPPPPh%QGtRWh3"t ; ȋC AEVf_4V]^19s~4袗 FY蓗 Z1e[^_]USRÍEPjhjjj jSyU tShR"Rj]USPhb"hK.Sh"hK.Sh"hK.׎$Sh"hK.ĎSh"hK.贎Sh8"hK.褎$Sh["hK.葎Sh|"hK.聎Sh"hK.q$Sh"hK.^Sh"hK.NSh"hK.>$Sh"hK.+Sh@"hK.ShW"hK. $Shn"hK.Sh"hK.Sh"hK.؍$Sh"hK.ōSh"hK.赍Sh"hK.襍$Sh"hK.蒍Sh0"hK.肍jUSRhPKi u Sh$jW]Uuu u @uuhG"jWUWVS(`؟ԟhY"Rh*rPEܟП119П~7̟hW؟ ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟. ̟u ПԟEܟF`벅u؟hl"je[^_]UWVSlj։1EEjh}%Q t(jh"S tjhZo#S u Ejh"Su uEjh[#SZ t}~Eh"EPhrWh"EPhrW =|Ft="}t"PVh"Y }uE4Lh&Vh"; e[^_]UWVSÉ`dhPzlb1󫋅dhx|h"VhrS`h#轆|xh2#蛆0tplhi#|"u"RPh#Th#8DRPh#0Ph#XZ"4t"Ph+#߅84Lh&h>#Ņe_XV薽lj$茽Z;}rhK.h: #FjBsSVwY[ tB/u:/uB@x/u@;tXS׊Ã=бFthJ.h#说XZCtSPNfc_X[u릾1;5FFWV ZYuыXtCtNPPH xu SbjSXjPPiPfc[룍e[^_]UWVS=бFthJ.h-#ɳXZ1;5FFsJWVKYXt3fSЃfC{u ЃfCft hF#SPXZ[Ƀ릍e[^_]UVS]S^uSh\#hK.c 1Ouu Y[19Åt 9t@uu h#$O ~u}t hv#V!PXZ؍e[^]UWVƉjhRPG`Ft9xu9pte^_]UPh#_ZY8u"h#h#5Fh#hK.bjbUUVS@fC5$F=~D F)fDF5HFjhh@FuHt -X1$F1CPS@FP.M5 FC$F e[^]USjjj0+CC]UWVSƉӉ9tR)ySh4#hK.a j%RP6褎^thF P6SF e[^_]áDFt#UPju u(tHt -kUWVS =رFuu 9uEfftcB1=$Ftf҉jEPW*sWĝYf E1;] }߃=$FtȉGffG=(Ft?t=$FuGGG%)ƋOu9rG9=бFthJ.hX#ٯXZGt=бFthJ.hl#蹯YXGW9s=бFt+PRh#hJ._=бFthJ.j GXZ?te[^_]USjh -RY[th X_ Zu SSY11҉P]UWVSX=бFthJ.h#ݮ^_5F5F5Fh#hh -:ZF߃uFh۳%PZYt1;=FFr%=ԱFVhK.h#¥$f` ?E11E5DFjLjEPR5DFF @t&h -h#hK.h2#e  ]9~;~ u] XSnU E_߅ujSVv> DF@ @uV1VSjuGRDF@ @tjh -h#_hK.hS#ӤhK.he#Ĥph -hv#*hK.h#螤hK.he#菤DuuƠFZY@ mVZX=ıFE}tPuPuS3K uSGKEZY~/9jPuSjSh#h#hK.TEPS'EPS&E=FtPuuuhSt%S#E PSJY[ff~ u[ Z5DFwnXe[^_]UWVS}E U9ÅuWuu h#!?hhWEƃ y@Whh #hK.?ShK.0n蓠0b Ph'#hK.S 1S ѡ@F@F0INj[Yځ~RQWE @u55PF5 F5Fh#hK.R0b PhJ#J=ıFuURQVmC @uG5PF5 F5Fh#hK.DR袟0a Pht#hK.(R$jD%WEVEXZe[^_]UEU ]U:= -#tjjh -Ih - = -#tjjh -Hh -UWVSƉ׉˅ut;5FFrWVhT#= FRPWV5Fs{ S$=ԱFt [$t9{ u9suhn#S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh}#P=XZUWVu} u1tC;5FFs.FRPWV(5Ft;x u;pt@$e^_]UWVu} ut;5FFrWVh#; FRPWV4Ft H$9x u9pu 1pp P$WVh#; e^_]UWVSujj[_ÅtJNJ/t tF@PW3ZZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P_Zu1,VeY/txtEVh#:XZEe^_]UVSuFFF9s%)P6S9jj&9tC/vKSh#:XZ؍e[^]UWVS}u h#j:[umYƉ<FuE5F\N Zu h #3:X)F F9r FFFuS2؍e[^_]UWVSuFuE5FM Xu h(#9XFLءF19r _$(uËC$F 1ECIDžuQ}u} ujjY_t VhJ#@9XZVV<_C[ٸ1Xj/V^Z@PPC{G C_ Y^Et5uu YZYƅu hc#8_E UCS FC^5}u} t)uu ZYt h~#8XًE U7؍e[^_]US]SpZFF]UWVS]f{t h#SG9XZ{u&{t h#S.9_X{ t h#S9Y^CS utcRPl_Zuh#S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h#S8ZY3FC$FXe[^_]UWVS]E 8ƅu h#Sa8_X9stsF C^ j/u ZYx3WƉWC$19VPfSЃ߅uЃ fCe[^_]UWVS`=бFthJ.h #葚XZ=ıF(h;]$uKK^_u,80iZ Ph#hK.Juh'#g6fc 195FFrIMWVZY‹Mt,AEJSBPj2U\UR̓1E1}E9FFEuuJZYDžttj$GPEP4uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP?\눃EUU1 F9~(F1tBESjjEP[G΋E E̡FFEUMԉuСFFE؉UܡFFEU䡸FESjj(EP[C @t,X0X PhT#hK.Huh`#4ScXe[^_]UWVS=бFthJ.h#.Y[}uXjj5F5FA.FjP>L F_Zu h#4^jjjhָ%fHwjju:ƃ y,脕0W Ph#hK. Huh#3xPV/mY[y,E0vW Ph#hK.Guh#t3EЍXjS}K XZu h#Q3YSWV9 y.0W PhJ#hK.oGuh9#3j(PPV9 xV:FZhFh#5F>$5Fh%#DXZF@ @t hB#jŌ]UWVSu }=бFtVh#hJ.h> EE]99ru4=ԱFm^#;]u]#Ph#hJ. > F{5CPCPh"hR8=бFt R3C4,-h#hJ.=t}t?SHK))PDPPCPV諞#uSHK))PDPPCPu蒞i#<SHK))PDPPCPVx#`@{h #P{ZYth #Ps{ZYt^CDtu%Pu2ZY#$PjV #PjVb #@uY{toCDtu%PuZY#$PjV #PjV  #@t=ԱFt/Rh#hJ.; =бFthJ.h3 #YYXg=бFthJ.j #XZe[^_]á8-x=Ft2UP/XUWVS}u 1FF=@Ft3}t hD #&_=Fn1ۉ1F=@Ftj-Ft̃~Íe[^_]UWVSRE(F $F F9| 5F1H (Fh P9~ 1|@u5$F 1ۡ F؃=Ft VP+YXVP58-t'ǃ =@Fu5F9$F}(~$=ԱFthJ.h"#莄XZF$F@Ftu؅y1މm~WF 9t)P7t=бFtPWh ##hJ.4 =$FމhK.h1##FZYftCftfHthK.hH## hK.h_##軃_X85PFhx##hK.4 5 F5Fh##hK.3=̱Fuh#[ujc&F = F1=Ft1jS'+ZYy>00C Ph##hK.3j&jؙRS58->`Bu@t…=бFthJ.h##ւ[_=@Fu F@1҉F$FPYctF PVh ## +hh F5 FV (Fh5 FuFF@ Fe[^_]UWVS8Ã=رFFC=TtP=ltIʁlt=Tt1#=$Fu$=бFthJ.h##ǁ_X$Ft=$FWȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPOZYChs,s(?^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉCYZye4a0e# PVSh)#/u;=ıFuASV YZy4a04# PVSh)#hK.1EWh*#+XZ=бFu&"u)#VSPh!*#hJ.@Ӎe[^_]US]u h8*#hK.SPh_*#hK.s PhG*#hK.C tPPhW*#hK.C tPPhi*#hK.CtPyPh~*#hK.C$tPYPh*#hK.i#{uR0$Ph*#hK.Fsh*#hK.4S8E E*#]UVS]s s:Y^1t 9tF@h*#SXZs sVh*#h*#hh`F `Fe[^]UVS]C t h*#ShXZfK SnPV3S\PP(NC$;PV$e[^]UVSu~t h+#VXZV X=ıFu8hSZYy'fN@e^0 PSh-+#hK.=бFtSh>+#hJ. e[^]UWVSuj/V3"ZYDžtDt>yE-qlFe[^_]USu uh8-#hSpFMڋE]Ã=pFu U@-#J#e1pF]UVS u hC-#j]SGڸ7$/Ã1x19}-)PEP5lF;  hr,#jVω؍e[^]UVS u VhH-#j]SSyE$S5lFVu5lF(Y%e[^]USPu uhM-#jP]S{ڸP#c]USU x.RuhU-#hS7ڸ]-#]ËUEPhc-#QXZUSSPhi-#hK.hK.h-#RW- CtsPhR#hK.hK.h-#W@-XZ CtsPhR#hK.bhK.h-#VjUWVS]} t~C7h0#VEYZt:hiO#VEYZt-h;]$VEYZt#h"VE^Zt1 @uhQw$w}EZYt|1j}Wjj5Fe?E? EEEPWS5F5$e[^_]US}thjEPjj5F]F?wPh.#XZ@ҵ"@t]#RPh8.#f ҵ"y]#P5Fhc.#D ҵ"}y]#P5Fh.#  ]UWVS(}tE 0'iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5Fe[^_]UWS}t&]U1E5jh'jjjS5Fe[_]UWVS ]} t~7h0#VmCYZt:hiO#V\CYZt0h;]$VKCYZt#h"V:C^Zt뮾 1uhQw$w CZYt|1j}Wjj5Fe?E EfEEEPWS5F$e[^_]U }tjEPjj5F7MFʃuPh.# XZB]#tҵ"RPh.# ҵ"Et]#P5Fh.# ҵ"}y]#P5Fh /# UW}t?U1jh'jjjR5F}UWS}t]U1Ejh0ujjjS5FVe[_]UWS}t]U1EEjh0ujjjS5Fe[_]UWS}tc]U1Ejh'jjjS5Fe[_]UWS}t]U1EEjh'jjjS5Fme[_]UWS}t]U1Ejh'jjjS5F"e[_]UWS}t~]U1Ejh'jjjS5Fe[_]UWVSEEu +EBU܉EP XۋUu h3/#jN1ߋMEfEfS1j EP6 U:t6hX/#jNTTdDG9}ujh0uuSjEP5F]e[^_]x UWVSEu h Zu hq/#jN1 1ۋ9}J jQh"= ujQh/#= uCu 9}OjSh%o= ƅtIjSh/#Y= u'jSh/#7= u4ƅ7fDžjh0uhj P5Fƅx9t h/#VYX$t h"VkXZt#t h/#VMYXh/#V@XZh/#V3YXu h/#V!XZV5F5F5F5Fh0#@t6t`f@fÆh&0#VGY_\f@fÆhC0#VXZ&-f@fÆh0#VY_u h0#-ZESh#Vh$pރV׃X9uEe[^_]W e[^_]UVS ] }t%3h#V;ZYth%V;ZYu E'j EPVkE U:uy 3h0#Tsh#Vl;ZYth%V[;ZYu E-j EPVjE U:uysh0#j_JEPhU5F( t h0#jcJe[^]UVS ] }t23h#V:ZYth%V:ZYu E'j EPV,jE U:uy 3h0#Tsh#Vy:ZYth%Vh:ZYu E-j EPViE U:uysh0#jlIEPhU5F( t h0#jpIe[^]UP}FE 0aEEPhQ5F't h1#j&IU}tjhQ 5F' t h 1#jHU}tjhU 5FT' t h1#jHUWVSEE܋] h? E^u h$1#j_HU 1E1E9}t3VhB1#8ZYtNVhI1#8ZYtAVh%8ZYt4jEPV U:u=v3hS1#jG1EGEEjh0uhuj EP5FC E=vhP5Fhn1#E1E܋}9}t}E܋E}܋}]܋TʉȉljщÉ1Љ1 Ӊf11 Ӊ1 SQ5Fh1#Q{EEe[^_] UWVS] }~j PW5F Rt$Nuj@EPjWU0Ph1#jpFj$pPjj5F EЃf=t Rh1#XZ91׹󪉍,ƅ8fEf;}~lj 0P3ƒ 08t3h1#jED,ƅGʉLj Vj5Fp ƅ9141}u"jh1#s5 u ƅ5jhtj4Pj8P5F <h1#hJ.#[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5F# @u h2#jDE<u 5Fh2#<u5Fh*2#hK. ~<tP5Fh=2#hK.o_Pu󥀽_y-`9j&CSh^2#hJ." j !RZ<hf2#gXe[^_]USUBBPJ R Phu2#( uE~2#]eSh2#XZ]USUBBPJ R Phu2# uE~2#]Sh2#XZ]UWVS } 11;]}#j4h2#3 uCPQ1󪍕JƅPƅTJjh'jJRjS5FQjPj!gW,jPjAPjRjVR VRPW5F5F5F5Fh2# oQƅRjh'hVjS5FffЃf=v1RLhW HLRhW LHtmQƅRjh'hVjS5FffЃf=v1RWhWh2#Wh$LgQƅRjh'hVjS5Ffff=v1h2#X1G9 5Ct9C LHD04r2jPRU Utj@uVRPV3hS#[GjEPjhFRU; Uu}u7}u1}u+E9Eu#/tj@uVRPV3hS#j&GM1EEe[^_]UWVSVUu=FˋF Fu'F Fh@FhS#hY[=Fu %tDhJ.jSuu5Л-Ph% u Phh #XZ=F~tj XڋEe[^_]1vs9}E8Pho6#IGYXt VhS#5XZE e[^_]AN@e[^_]UVS]EjjEPuVuuF @u e}t ShS#j_$F FtjYY2=Fu Shh #XZuuuuuh T#te[^]UWVS]uEEU E$EF F=FJF Ft}jjEPjuVe @tdMt]QMY XtMMMjjEPWuV0 @tM;Mt W _j@F`Y}e[^_]d }tuh@FhIT# = t)tu*ShT# uShT#ShpT#ShT#XZe[^_]UVS]E jjEPuVuup @u} t ShS#j"EUEU F Ftj sXP Fu EPPP5Л-Sh+&&IuRPh$ uRPhU#pe[^]UVS ]EjjEPuVuu @u}t ShS#j!F FtjC=Fu5Л-Sh% =F h uul t PXuuhU# e[^]UWVS,EE̋}uu<=Ft3EjjEPEPh'U#\E܍Pk((U܉UȉMQM XۋMЋUuwM1Bt(jjURPVWI @uEԋU1Ƀt();EtuhS#jJ uދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhԛ-uh/U#jURUUСF Ft6j(EYU܃(t Gt9|]e[^_] =Fuuhh #XZv$v vvvvv vv6h6U#,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph'U#,|<Dž|tWY XuCxjjxPVph @ult9xt ShS#j$l%EpuEjj_X=Ft=19|Whԛ-Sh/U#jUR EjjUG ŋ=F =Ft jL=Fu4Shh #Y[%t hg#Zt4WhvU#G9|j Xue[^_]_ e[^_]ÍL$qUVSQ$EjjEPuVqq @u}t ShS#jF FtjYd=Fu Shh #XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hU#eY[^]aUWVS@]=Ft /Dž SюXuhTt&h$j1h %ROY^t{&18jPS衩ƃ t 9u 8"uShU#8uv ShU#jp h %jx 1PSPVuu @u1;t =F1ǡF FtW EZ)P <$PUEIV tRF Ftj ‹EX+aP3 $PًUES e[^_]UWVStx|h@Fp@F$FYlFl)ȉp)ȉt lt|uH1ۋx9t担t]#tָ%RPh%PPCC뿃} t~|P]#xvԛ-RPh%PP|P]#xvָ%RPh%PP Dž|-|-Ã=F=FthFhh #XZhFh@FhU# EPz$w,t&PhU#_X}uC|@0|9hsPhU#Y^P|p4hU# |p@hU#}|0 FXZpu hh]#h F(hhU#0pt ]#6hh]#h F(hhU#h F( %ƀt2hWh F(hhV#h Fm( %s2hWh FI(hhV#h F5( % s2hWh F(hhV#h F' % s2hWh F'hh!V#h F' % s2hWh F'hh)V#h F' % s2hWh Fi'hh3V#h FU' % s2hWh F1'hh#h F' %s2hWh F&hh7V#h F& %s2hWh F&hhAV#h F& %s2hWh F&hh%h Fu& %t7VhZ#j VehWh F?&hVh F/&(h F|h%PhHV#m|@H t PhYV#R_X|p(hcV#=j W } =F=Fu }y|xXDž1DžtxThj`SPPQt @hu\t|@9uߋ|@(9uΉdQh ^dtNjh󤋅|@XPwP Y|XX=FuE t|@XhHw9=Fuh@Fhh #XZ|@XPvhlV#PX}|@t E iUE/Ã}tP@uj-y Ph@Fh}V#j]s u|xtjhFh@F|x@u^jjPjxt6 @u<F F=Fh@FhV#|@@EHs$@s&|xt|@8dF dul-t.s j|xtjhFh@FS F F=Fh@FhV#׿tx \b|@4h _)jjPRhx@Pt @ht*|h`t5|@4`$R ^K 8 ]kЉX1ɉh`9htkh`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXhsR X1Fd1ۋ|;X4,F\sF Ft%xQuujPtAC`jjPSxt$ @jjjjPSxt @UjjDžjjVSxt @uIB8 u3 XjjVSxtq @u jٺ@F|^_9S [DžjjPSxt @tgjjٺ@F|8uݿ Yuh@FhV#5؛- KjjPSxt @u jڸ@FS XZlƀFpƀ@Fe[^_]UWVSƉLHFj=PY[ƅPt9sx?u @ƅPGh#V[Z.tԛ-՛-8 8V tG=^jho$S T F<=t:ԛ-  ƃ=Fu hV# 41Dž81ۉh 1tpƅY1j,VZYDžtG1ɉLPDžH1ۉ<1ۅJj=WZYÅu 1l@llh#WZYDtj,S9ZYDt @Dh%WXZYLt6V#Lu%PVhW#2 =F8j 18jlPS-u F0j PV" x;3ue[^]UVS@Ë5 G=X-tjtSv!ZYuFl6j j5SHFS$PFSh%P脂 G5 GF Ph_#j@]S Sgee[^]USQtP =X GuSq Z]UVSÉu=X Gu VS ZYe[^]UWVS׉΋]Uu E E!UuUg%t]#[^_]USt<0„!1=X GuS]Z]UWVSLEӋu>h_#VtZY)ƒ?EljDUh3SPEUDEj URPEU:*u%jjWSRPEP{'tEuj>u跺 E9h3SV e[^_]9`-t3UVSRPjuV`-e[^]#` Gt ú G=Fu GUWVSƉӊ>uuVFHtB1T GhE5FV^=T G1҉T GhE5FS?9=T G~؍e[^_]UWVS,E9P GF];S5EGUY^y#FFF=L Gu G L GS跨Z=X=&wAKw2ifO[nRfOD=,w$==!fO=XfO=KwJ=w$==` fO =%fO ===fOwfOlfOafOVfOKfO@fO 5fO *fO fOfO fOEۣFEݣFEܣFeẼEfE1E G 5EG識Sj5EG"EP Ge[^_]USEPhht@j% 1ۅu E]u+h_#_ZtPFX|%V~Fh_#_YtPWZyFF1ɉ \-=F FtF0h_#T_ZtP F[e$~Fh_#$_YtPZyFF=F FP]UPUEG1J$@w&(fG U_#U_#g{U_#U_#U_#ۍU_#эU_#ǍU_#뽍U_#u.fGU_#ufGG1UWVSVh`#^PL^_ZX-h%]Yu-$&1҉X GPhGY[Ht X G`#t X GF#F`#F`#FV &F'2#F`#\ G"…y11FFFFFFFFt17GEF]ڸ|%tOڸ#u]#| Gڸ*#u]#x Gڸ!`#gFڸ$`#Vu_#t Gڸ0`#u Ge[^_]ËFt G}Fp Gm=d Gtg=X8Gt = FuMU=7Gt=8GuFx G(=8GuFh G1҉d G]1d Gá`Ft 1=d Gú GF G G GUS=X8Gt = Ful=8Gu<Fl Gul G8th G8t=\ GuF=8GuF| G0=7Gtd G=l8Gt9F~j CX]6]Uuj5 G =t8Gu G8t FÃ=x8GuUjXËF G GqUWVSu }1+uG}-*u:Vt3st!dt1k1uUE 0e[^]UVS h]#j ha#Ch Ghx Ghl Gh` G GX G G\ Gx GP G| GT Gl GH Gp GL G` G@ Gd GD Gha#C1[<=:tjha#jq FWZPÃ$w&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu= Gtw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU= Gu~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US]@ G1u7H Gu'-zu=d8Gt-[]_[]US]@ GI1u7P G5u'0-%u=d8Gu-[] []UE= GtE] G]USS]uh7b#h Gezw2SYt'؃@PZu@Sh;b#S5 GS-YtS5 Gj h Gf{"E GySEPEXZ G]US]X G-uH-[][]UU 1}DuЃ=%" ]UWVSSEIuRPi^X[RVZY1uEVLXt S:Y-h GjEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhf#9hf#9Shf#P&Nucjhf#VNǃ u.hf#P9Shf#PMu0Shf#VM Shf#PMEWȆ Ete[^_]UVShf#8P99ZYu3h#V!ZY1t=hdx%V Y[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPV7Y[{%=ehiO#V~V̅ GShVTb #jhg#Vl  1҉p1ShWb t t u@hg#WϻYZhg#W躻YZh%g#W襻YZt<"u5vptp~HpSPV O tu QM;ZYMuGCQ| W| _Xu s ZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á Gt);4-t!Ujh GP G@ UWVS]= Gu G GuD G GÀu GШu[ШtSS G%uF GA G G9~1Ph GZYu'1 GP1 G:Y= G1 G= Gt 15 Gs-f] G9L-  PS.Y[@$x&e21҉ G51 G 1 G Gt G8 1 G G= Gvx ugx V G= Gw1 G G+5 GX{1= G G8eu15 GQ1ۉ Ge[^_]1ɉ Ge[^_]a1҉ GT1 G G= Gv6x u0 G= Gx ߀x z G= Gw1 G1 G G8 u G8  Gs G]1 G Gh-y G Gh-Y[ t9ىM{ RUWh G UMuʉY15 GzWh GJT G G_X G8= Gt  GtPw 1ɉ G[V<EPQZE Gt Gtp G G<9s; u Ce-Ed-E11E G9stub}t6E9s-M܉UuuW UMuE|1}t8EE18Et < u_ 1EG눅 G GtPv Xj G)@Pv G G)RSP蕀 GMe-8uCS;XuS%A G_WA GWZv Y[ GM Gtxt/ GPh G-1҉_Z  G G G9 Gsi Gu,15 G G1ۉ Gpu5 GCYd G= Gv d-8Huh0g#'Zu۳%1 G Ge[^_]e[^_]UVSQM1uu GEQЀ w[jjjj uuuVtjh>g#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1 G9 G| Gá Gt @@@ Ã=BEGREr XE=@u$HGt t7tut g ]UVS=\-u=X8Gt = Fu$t/LFPFu ujjj5TFRP*V PGu =\-u>5l8G Gl8G1҉ Gu 4YX5l8G Ge[^]UU]飪UWVSt eYƉׅt‰GG G=EGu0t;5GG}jjjG 1 GEGld2t8e[^_]UWVSVEj)ơDGuDGǁt#tj11u|%DGSu5DGáDGƒDG@G t?x1 rjh^g#FY[t j0j1ZtՅtVk1V(Xe[^_]USTáHG$N   tw #58GjCP7tW6%I/f5$GS5(G5,Gߟ1,G?E48G؋]aDGDGPSy<+u C< uhFtPn Z;u 1hFSehFX58GjPCP9=>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉GYYuG ыuUS]t CPX]UPGPEEUWVS@DGF@HFe=HGt1HG/18G<G,G=EGt[=@Ftj3_Gt x@j荭GG苝Yu*P:t!u5\FBZujǴ_=X8Gt*p:t!ku5\FAYuj蔴Z1X8G=Gun1G=0Gtjhg#訣[10G:at hT#耣Xt?uhj:Ģ_X WrY.=EGweu:{1$G1 G&\P菕Zze=EG+ejHG/t.7iCЃ .jSP_Zdteh4G8G<G^=HGt1ɉ HG_=,G/uy$Gu_uh Gƒ@+t t;!tA-Ҹu u ‰$G@@$G3= G,G  =trSZH?E|a<(G1EЍEPEPEP,G tD,EĉE-=(Gu Pw P_ E@Ƀ}}uEЅEPhg#x 15 GY=,GS,GYuS艒EЍEPhh#6C(G$GHt!5$Gh]#5(G5,Gs 5,GMZt5,GTj1ɸ/&C$Tx&*t@tS; u݃=\-u ̾J5h-j+Y =HGt)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=HGi j1ɺؘ%i0S{ aFcx $x&j1ɺ$n 8G19<G}(8G1;8G<G|8G<G= 8Gt5G5GLF^_j8G19<G}(8G1;8G<G|莍8G<Gj1;8G<G|8G1ɉ <G= 8Gu+;8G<G}5G5GEXZjj58G1;8G<G|8G1<G jjjj57GVjj57Gv1;8G<G|8G1<G= 8G;8G<G}ze1;8G<G|8G1<G|jj58G1;8G<G|8G<GF= 8Gu5G5GyD_Xjj= 8Gt5G5GTDY^1 8G19<G}HF= 8Gu5G5GDXZjj5HF6 8G19<G}HFjj5HF7tköUGA5$8G1;8G<G|8G1<G$8G5<G58GE5$8Gf8G<Gy 18G,d9ѹ|u$du=4Gt8Gd1<G4G54G58GG_X8G<G19|,fFhm8G<G19| SGFRP0EB8G<Gy158G5<G115$8GRPFg8EȍEPh$=\FuEtEP1Z9tG G Gd8GG7Gj(Y{j87G7GDG1;8G<G|8G1<G DG @G@GDG1;8G<G|8G1<Gs8G15@GЃt+Ѓ$5@G t DG1;8G<G|8G1<Ge8G1.5@GC1FP踳X/b"' GG15 Gd8G G1=d8G7GG17Gh_#맃=8G19<G|8G1ɉ <GPZ jhi#45\FV1_PrYt VV1jPb1$G Gj1ɺ" =^ ƒ Sp`?lj1ɺ&i#5LY ƒp glSp"j1ɺ2i#%RZ/ t u.S}o_Gj -f%% j1ɺ:i#^8G <G19}8G(8G F‰8G <G GEƉ9Љ}58G=<GE)`8G<G19}8G"8G F8G<G GG1ɉ G` GXZ=T8Gt0G_UE= Gt@]US]SjšZY19} B]UWVSu}t UE  u ^ZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:= GHE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt QtV{m_u pm|$Wm4 XZtu h۳%Vh+&WS+}tjS"Y^y S8 ZP#X؍e[^_]Uhf#juPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'\F<%tXFtRFPlY^CGjCSȃXZutKH݀u=9us8Ft38Ft1 \F<%t XFtQPSSOlÃCFe[^_]UWVS]S臡^u1jjjS\Bu@thVSm! ~ˍ19= Gt)RPZYu FSWk_XSjWƒ =08Gu9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=u Vd5 Z S[5 X؍e[^_]UWVS}1ۃ=u!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+=7Gu= Gu 8Gu$Pk$GRPWVWVځƉ׃WVʼnZYuu؉}ܡEGEut u EU<uu uuqE؋U܉EU9uE}}EG!nEuuP)&ÃEU ~'=8Gt(} t} uEU' t tؙ)]Ur'   EEGEm tuTi'}Ɖׅ}t( GEtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉUEG t uΆƉ1ɉ X8GE8GEu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI=8Gt' t u}tƉECuЉ}E}t = 8GtƅRPj # j}]!Su%uuwW=8Gt&WVuuRPE؋U2=P8GtH}tBy uEGt t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1= GjjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%=7Guk$G9EE}11S 8GuEU)juuRPQEURP[^y=P8GtL,'83 t u, uEG< u@)EG u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@EGEy} u#"Å>H  G-CMڂRPu à Hu = G~1X8Gu}E=8Gu~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ=8Gt!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU=8GtWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5H-=L-4@w Hr5P-=T-e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S= 8GEe[^_] pWV9EZYt1E E m#e[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuEF)HP6WVƉXZutE21ɉ G GE)SjjWVFHPxFH9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2=l8Guts1GWV]jjWVFHP e[^_]UWVEU EURP)ƉYXBut1WVYZu$= 8Gt WV XZ5$8GWV hM9ȸ}|6Du-5$8G(~VRP[ 1ɉM E.m#e^_]"XEUEUEPhOm#XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjhmm#W^_~}ƉסFHP[Y9u9u e^_]d0o\WV FIuuQjjf *QRPYFHPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃= 8Gt WVmXZ]u} e[^_]|USZtjhm#VXZ%q|9} FIQRPa ]UWVSSEE] wBu@ujhm#V~ZYwƉ׃uu1E Em#e[^_]VSuWVO9| 5$8GRP e[^_]Ê t u@UWVSƉ5G5Ghm#hS =wWV)RP GSXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPhm#jRQ7n#"j PRM 9u]#^n#; G<=t#; G|:j; G; G9 G 9 G҅5-,1 v#u t|\u@r;yj=SZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=t]#n#;8F1< t#uً1V‰8u$]#n# t tu䋅t3RPtEYZűPn#Pd(8u‰2ʀ‰w8t1lߋ1MW GZe[^_]ËxG;pG~~pG G tG‰xGUS\GX\GGG[]É19-t @uUP?kYtFtFtFtFUWVS$GUjS EjS }tUuuN YXtP5G} ljE5G5G 5G EGEG$GXZ1e[^_]UWVSÉ։9$G~GG< +t[^_]UWVS׉ˋ5GVGЉ[^_]M=7Gtt*ttt t XÃ=08Gu[USjm5PGqZYG`#t:t1ɺNC=Gtq#t1ɺ*C]Uhq#PGPUYZt PG"hq#LGP0YZt LGq#jh9WGjh(WG$GhGhGhGhG hG1GZU1}]áGGUG1\G1G9G~"GGG1ɉ G@1xGtGpGGlGhG<GdG`GHGGGGGGhG hGhG~hG~hG~1҉GUWVS=<8Guu uqƉ[X118G 7Gu=<8Gu u$ZYt G@;P- T-9U] |%!ʃtM9 H-L-U | G@=8GtGu a7G9\Gh1Ҹ WVY[u1ۅtj ]SRPlDS=Ã17G)9~1Ҹ F19tD5ݺF1Ҹ \GxGe[^_]á8Gt7G=<8Gu 7GDUSG9G~$G<uGPhG}XZCԡGG\GxG]UWVS]u }Eu@0tj$zYEe[^_]<= GtWZ= Gtw/Py_uS[ۃG~K1S ~YuSW_ZVGt-fZYuGGDVe_tWGuVd^ƒt FVGteZYt tFtFtFӉ؍e[^_]UWVSEUMЃthG} u}u=GtG}EPjEU RPu ueu=7GtVGtM EGGU#U ;E} „t!؃tEU GGHG]=HGtT1ۉHG1G1k àG9{~%8u u1ɺZYGFu1ۃ}tOG G E1~RjEP{ G1҅~ GTRPuuCÃ=08Gu}u9EEEE55xG+5GE;5F'EPw_ G9GuY=Gu=GuEU GG1=G~+9=G~G81ɺ>GhGyY19}E81ɋUG G9G|1}uEPhGyXZG9G~Չ19G~=G   G<<@B)5GGG9 G}1ɋ7G Kݸe[^_]UWVSƉ׃=08GtCP8[xG+G-;F~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ198G~ @Gt 8G)C1[^_]UWVu} =08Guщu} 1^_]^_]nG,GxG(Gá,GG(GxGUU1wR5PG< ZYUS]1w%SZ1uS5LG ZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;&9tu&ـuH &uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} lGE=08Gu#=GuSGZt G1lGG_SPEZYtIWVM^_t RGxt GShG%vWVMZYu5G 1GShGuhGkG GPvhGUuG@}G$G G9G}%hGPuXGG= G9=G| GG؉ESjEPuU$ t9r)ډhGt5G 1=G[^7Gt d8Guuu} UG~7;G G|t GD0te[^_]uuu} 1ɸJt1tqGЉERj]Suƃ GE9s=)УGRjStNjGG?4WtV)xG~뫣lGz}GG= GulGP8rYG G M9u3_u(t M.hGt EMMb_uMGUL_uGMAt?S~tZt hGE*GGPqSPuE u1ɉ lG 7Gt =d8Guuu} U e[^_]gxG+\G4- G~9|0-)ș); G}s$G)WVؘ%U KYZK= Gtv =08GtT)PoZtu} UK= Gt+SsYtStZu} e[^_]u} MU؍e[^_]e[^_] UWVS]u }`Gt4 u t`5\G5XG1ZYt 1`G ud7Gt d8GuR=<G`G 5XG=\G1^0G4G@8G1ɉ <G4뷃= Gt<Gub8G@GÀuWV1҉"[^Шu%ШtS'n<G50G=4GYf%ul 8GA8G@G90Ph@GLn50G=4G[Zth@GnWV@G 8G1ɉ <G<0G4GvP8G1҉<G8G= Gu]ue[^_]Ã=<G~U0G4G1҉<G]1UWVSQu} EE`Gtt t5\G5XG1XZGtl=7GtcF;xGpGxGtGG7GFD;xG~ Z7GG=7GuF;xG~1N=GtxG@F9}Թ ۃ=Ftt =Fu =08Gu 11Ҹ *=Ft&}t 1Ҹ 1Ҹ11ҡGe[^_]TUVS]G Gށ9G~tu ډ@[^]UEGE G]USEM =dGt)=8Gtu ~JH1҉ ;\G9~GGG)ЋGG[]dG1GUWVSQSMQyq uu RPy^ZYu]ƒt1ۃ tt EGtI]8$GH9U_Ut )]G@]C뮋 Gt GteY[^_]UWVSQMQyq 19| RP]ZYu$GXGD_E t$EGu}tjU$GEt d\LGUL$GT1;Gr H$GE)KGUz11҅t Gىt $GeY[^_]UWVS} ]E1ҋE}~[9sWUSjMQ-lPUt!SMQPEgEPF E1jRjV)E뜉+E)Ѝe[^_]UVS G1 GutFjjP$ t G@11ҡG Ge[^]UWVS5FFjM9Y119=F~"!уtRP xG9}G։5F19|)e[^_]UVSu Eu=V)Y@ w>uV-SOXZ1jjVsP u뾍e[^]UEo1҃t -]=1Gt&1GtUSJZ P+JZ HX[]Ã=pGy-U=<8Gu G1<8Gjhq#3ZYápGxW@dpGUWV1ɉ pG5hG=lG+9Ɖ}jhr#=4pGXZe^_]øG @=@1Gu1@1G1GGtG`1G1G1G1G1G1҉1G1G1G1G1G1ɉ 1GUWVSEEE E}M1G1Gt"C 9{}E9Cu E9C֋s1Gt 1G tG1҉tGpxH }xUPC=6/tGub1GxHE0u1Gt,puX9} E}EE}ًEǀ}t EtG‹ BA[^_]ÍL$qUWVSQ QEU=<8Gt E]!؃u 111}9Uй51GFV 1Gt]9؉׋]}69Uu9Eu N^})hGlG1=pG~GW 1GtBN^ M]M])ӉM؉]܋M]+M]MЉ]ԋ]9]؋]܋MRPW[^$O_w E9ƉU}XM]jjWVƉ׃EGM]t u M]M]WVSQM]]9uEM]uu#WZYlN^~ v9uE}RM]jjWVƉ׃EGNM]u M]M]WVSQM]M]1pGȉڍeY[^_]aÍL$qUWVSQQEU}9}1G,s{1GtE9ƉU}9}u9uu CS K1GtEU+AQ+u}9}cq qMU[^Mt qyAQ ]9މM}jjRPEGuʼn!уts sqUZYus{CS 9u]}0jjRP\EGr!уeRPEUWV#EUeY[^_]aUWVSQMSN2ƉOEUXu$ux9F~ CS!2Ɖ܋u}WVY[M9u M9ueY[^_]UWVSjj{T^_uxjhm#1.`GZY1111҉1ۅuuRPEUWV;EUjjRPpEGu uu1`Ge[^_]UVSEU =7Gt57G9|)11[^]USZKJy ;J|< t Y RPhZY]UWVSuE E>-uF"4Khf%'V'h4N#z' Ej5YFR&jh"~:t>u R^8_UV輱Xt̋URU É<$ L$QM8*WPURh%MQS W _usV7YS-S jNufu>jTj;}t&uA&hr#7&*j %% EGuGX1҉Ue[^_]SUWVS]EEEEuu QZYt jh*r#h;]$S"YXujhHr#*XZ8Ihf%%S%h4N#~%oDh$j:jSjj S-}u}uCPÃtNO@u,E UM;M MM|E UƉ!@tt t OÃuVjj ,jSj:DGj`Re[^_]UWVSu6EU_}u }tcj-Ɖ[u u11j-Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k1GGPw'k1G16G't'6G#tUEEPh[r#(YX1ÉUS.w$tX6G'^\F1G11G1G1G1GtP X11G1GPt jhmm#gFN \F 1G1G1G1Gjh1G-\F1G1GY[뉉txux ujhrr#'XZ1]UVS1G1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP,UEY^u uB2M5\FsS CKCtP Z1C1Ge[^]UEt*xu x u]zB@ @1G]U Su]jEP>,UEYYut@ \F 6G6G6GE6G6GtP Z16G1GUWVSPEf=6GuJ=6GuA=6Gu8\F6G16G6G$8G6G6GtP_ _156G{u#j;PsiCs5 1ɉKs {SC;\Fu RWV UPGZUte[^_]UQMt\F9Ptjhr#.%XZP@ UVS]u \F1k91Gu$91Gu91GuPa~#4t P'@5u1҉[^]UU191Guǀ1Gǀ1G=u]UWVSu`[11Gt:P葰PV uE1G1G 1҉1GYS Xue[^_]Ã=7GUWVSu h$u|1G C Suu6Gue[^_]j }WRPsu s蔾Xh#VZYtVWsPhr#uUWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=FE8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtPp Y1Cu>/CZe[^_]USE] =Ph^s#j ]SNS~P|0uD]EPhes# XZ]á-x$Ujh@BRPFRP"8GUSEtzE 8.MU u4@E Qh-#R- }t jhs#}Qh-#R }t jhs#k8G-a-y8GEEPhs#>Ph^s#j ]S1S~P|0uD]EPhs#xXZ]US] }u!jS萏YZt]EPhs#BXZ]US] }u!jSXYZt]EPht# XZ]UWVSUE t tP]+6G^w=7GE7G*7G#tRRJYEEPhv#XZ]UEtHw1E Ev#]8F]U}u=7Gu]i1]S1]UEu=7G K7G]UEu*=7G~!EEPhv#7GXZUEu*=7G~!EEPhw#7GXZUEu#=7Gt=\FtL8Bu @u]]UUE t#u?-^u2@t+-!-PHEEPhLw#N US E1ɉ 7G 7GE 8,t)EPh$E P }t jhfw#37GE 8,uf@E EPh$E P }tjh~w#XZ77G057G57Gh$j]S]܍EPhw#]UVSE] F1 RD+~vQQ r/Qd~ wG$x&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhw#1CSPi7GY7GE sEEE sF@tK@sN@ sR@sW@sY @AuU9uE-EUEPhw#XZe[^]ø= 8Gu=7G 1=7Gá(8G F+7GUWVS }8uMEPhw#Y[1kÉUP$@PƋUXZt@=7Gt\u Ct C$t!tˆUPWEZYUtFVC؍e[^_]U@u0hw#j*h 7G0Rhx#j*h 7G 7GÅtÅt%UE'x#tx#URPXZUu6EPhw#h`7G`7GUU1t 1BS]UU#t B tB]U}ou>¸r#u1]1=7GU7GEEPhw#ZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM7GtFPtu)QjP_XA7GZjPEPH 157G1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr7Gj+UjEEZY];+u$hFtP _CPhFYSJfh@ fXZEn=7Gtz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPhCx#@EɅu&M}EuPhmx#}XZPhx#1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u7G9{jQEP C]tSjZYPS0 XDe[^_]UWVS ]u }翅u jhx#Cu@t:EEPhx#lusEEPhy#JƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjhy#5t)u9EPjEP }uSjhGy# Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjhky#X Y^jCtF XZtC tGte[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á\8G=7GtUShy#n~P~Y[u 7G@-;t CtS C t jjSXZ$ۋ]UM@-t9tBt 9t$1҉]UWVSEE1EE111E@->~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uh‹#|YtPZ~-øUS =8Gu[h8GۓZtL18GE܉EEEjEPjV E9EGuEGۃ`[8GEG;EMMEEE=8Gt=`Gt=7Gu-=8GttPjEP辳 EufE= Gu);P=-9u EG&Pi^Xʃ=7Gt ƒftըu18Guu u(à 1ɉ 8G= Gtx*It 1҉8G졀8G@8G~+jX!8h 8#ZE9EGtt 8G؋]Ujh8G4UQEP|)EUUWVS 0 uÉ4$|$WVuhS#WP ؍e[^_]US]S ZuShҋ#h8G2 8G]ÍL$qUWVSQYq AQEU}WRPq1gӉщE؉UM܋EuƉeWuuRP,u؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEPXZUS-9Gt,-9GSh9G5-= 9t G]UE-]Ã=8Gt 18GB$U=-<%!hWVSjubu Z D8Ge[^_]U4tPw @rP:UXUWVSu} 8GcuWV3XZE e[^_];=7GuldhFWVh-TF\S%g9F Ge[^_]WUEU E ]#E]##]UVS]u Tuu ]e[^]-P1ZE #E#؍e[^]\USQtu u>31YZt[=F Gj ZQujA X؋]UWVS]uE %=@8Gu>t>S$PhPj jjjSPh$9t|V躾 Xsuojjk 1=@EG1҃=4F PSW t"Ww _}u)jh$#[^tPB6H ZY>1e[^_]US]tPnB3 ZY1]U1}]UWVS|}ue( u zZE E@8Gx9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWuB ƒ1Eun؍[|yu19E E H]9}/3{yMu$]#[<:N<%<.uFu!1E1ۡFH9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v + V% ZY1CCC EGEGEGEGe[^_]UhlEGXUS]DEG-t-=lEGujh:#XZ]1=EGEGE]Uh\EG'XUVSu] <t1ٸ\EGt;pX[^]UWVSEUE|E xFp+lFh5$8G duu8EU =7Gt4 7Gș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1tEGixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x=<8Gt )ؙ1)=~WVuuuu [Zt}뚃=7GtEPEP57G轮t @EGt ] 7Gt d8Gu=7Gt =d8Gtu=08GuSuNPEjEURNESEPuuuNXEG(Eu0EGEG9EM|!ЃtE;EGEEG|lUsjjEPEPR`us3^$`t2EUEUu}9uEbU\EGP[uC<ujj]SMQuu5HEG5DEG$ EMt%tEUSQuuMM}=7Gu(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ GM1ɉ GM)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E G GG}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xu u [^}t}EUW1ɉMuΡ uơ XZuXEGtWsS Zjj1CCCj @u]e[^_]֟ XEGCXEGGe[^_]U €u1=XEG1]UWVS4u}EGEGEU血EGEGEԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUCࡈEGEȡEGE@u}t0E9ƉU} !uEGEG]9؉ӋM},#u k$G׋E܋Uuu  9}%k$G]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}k$G9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU LEG>MjMQjujuWVY 7EG EGEUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEKEGEG!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEU裈EGEGEԋUأEGEG]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU1EG=7Gu]]USj5L-@'YZt4jٸDEGZt =7Gu=EGuW1]U=PEGu @8G@EGDEGLEG]|UWVSU EEt :DM@RtE3LEG s,jhY#E"u jh:#Ht=7G=8G=7G1ɉ EGE]3Ɖ׃u}5$8GP"ÉXZe _=7G=8Gjhx#_XE+j,^@=EG@1ۉEG.EPMDEGZ@t7G 8Gj1EGX=7Gt =8GU.}Ɖp8Gu1Ʌt1FH'uM@uu5$8GcX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; F| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujj jj2XZUWVSEG1҉EGtkjjj(jjjjOjP$h-bjjxG tD=F5FXF9=Fu9t@HF贳̴Gt=7GtjXe[^_]UWVS E։ϋEGSRUA$EuURo u.{tUM tuWVޢC SXZ1e[^_]UWVSSE։jju$@PCuPUqs {E C}u1C%u$@PCuPq؍e[^_]US--t%CBs豔 s詔 S裔 1EGEGEG]UWVS5-YhiO#P薌I Z1ɉ EG[ÍhVp R!tSV uNJ< t< uvZ8tPt t=_8dPjP u1wHx^u Hȋt.8t&\uG@P9tWPΉ1Ҁx$‰uH11WQщ‹d--P-EGZY6X=EGt-EGEG1e[^_]UWVS ÉJtu i1ɉ EGu--`J.&h#bDPD^Zu&S5WYuoZ]lj4$S$L9QfVh#P`9tV~ XhiO#WPuWj f;?SFYS7jjщ‰--P-EG VhPm th=EGt`J.tV#yXDPE_t u Ƅ@t V[ uR. u`J.DH@ZutfLH@tCu) ʍLHt@u C@tC fLHuDPttDP@yumDP@tG VDH@dBVxZt1EGEGEGP--tEGEG1e[^_]US-h#SZYuwh#SZY¸t_h#SZY¸tGh#SZY¸t/h#SZY¸tjS;yZYxP/zX1]UZu E6 ‹ENt Hujh#jhʌ#XZÍL$qUWVSQ EG"p xutWV ƉY[jj講EUXZEGuFEPEPWVĕE؉U܃}u}tEU}u}ujh#QY[=<8Gtuuuu =08GtEUju{7P7ESjQjEPuuS7(Euc S] XZEЅu u؋}eY[^_]aUWVSEG EG]11~1t2-t AFKމt EG EG[^_]UWVSEG EG]11~1tr-t IFK݉t EG EG[^_]áEGáEGËEGtUrLZøUjc[Zujh#vZYyjPvZYxUEG]øUR~jEP5EGU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tP\ Z1CC]UE1҉P]USUBt XZL[]UE]UWVS}wSKS Kr{3[^_][^_]UWVS]E EC9C|WƅujjWVRPCPt& HP5-P覽^ZtbShVc Nh'?&P#^Zu @׀8 uSYY2#h#P#ZYt @׀8 u SX8t%8,t8 t@Ћ8tH5XLGREGPY^EGt S衘Z@EGP I#u#e[^]UDMGjjXZUhDtj8MGXZU!@MGjh JGO J.QJ.y ;J.| tJ.J J.UhJ.PQXZUWVSREƈEj}W5dMG $ f=-tk18MG5-jW5dMGnj=8MGt.VV"Ph_#x KtjhFG5dMG# 럍e[^_]USQhv#jjjju ^Åt4EPNZ9u5 h|#輁jjjj]jj{jjr-j/SlڅtPjRSHhK.h $9h#jhK.h $h#jUSQjhf$5|MGjl f=\-t#<-;tS $S5tMG=l jh4N#5tMG(ljEP5hMGWm}nu5<-h#bwXZ]USPjP]Sh#4 t=E tPE X+u}f= -t WVh{#WVh# jhxLG5tMGNch NGjj+e[^_]UWVSEhVh#^ 'jh"5|MGbjj|jjshMGjj(jhxLG5hMGc%Tà yh+#YwX11ft#jƉXPCDY9tGAj5dMGjjjjjV# Vh#mjcf=|-tjZ)RPh#}jhxLG5tMGah NGjjjj~ jjrXZe[^_]UWVSEzhVh# 4jh"5|MGajjjjhMGjjS(jhxLG5hMGbRà yh+#uX11st#jcƉXPBY9tTNj5dMGbj5dMGUjFjj}jjt$VVh#,ljUbf=|-tj)RPh# jhxLG5tMG`h NGjjhjj  jjXZe[^_]US,]S5dMG訔h"uUС NGuUУ NGSj5dMGh NGjj]US,]S5dMG:h"u荭U؃%u ESj5dMG ]UShSh# S:E-[tE-jh:w$5|MGE_ U-tU-5-t5-5-t5-f=\-tz-t$-f=-th"hq#qY%-t%-,-LG5-t5-jZE-t$E-f=L-th"hq#|X]Ujh{t 5dMGjLjhzt 5dMGUS]e1u.jP_XZ]0US]CCtu P$ZYt1]UVSEh#PZYtP^yhr#[Ph#hPgdƅul-u4%_$_XbZ_$_1ɉ $PhXl#SS.9ju*hO#XW_XK_X18_$h FG]à _XPH>Y9ut thK.hȎ#XZ댅yh7$VxuPh׎#uPh#hK.k Cƃ FGFG8 u = FGvH@ FGe[^]USEjPhLGh# uxhLGhhP]\MGyhLGh#fZY?hSh8# t hLGX5|-5\MGS ]UVSjPhLGh/#q h`JGhLGY[uE7#e[^]oHu `JGdJG5dJGhhP>\Ãy5dJGh# fXZ+5`JGhP#hVdh\#SVe[^]UE"jPhLGh# uXhLGfhiO#Pi uhLGh^#eXZ)j5-P f=-udMGE hUVSjPhLGhp#) h`JGhLGY[uEw#e[^]Wn`JGHudJGRhiO#Phà uVh^#dXZ@dJGf=-tPh#Ph#hVLcVh#S! e[^]UhK.h#蜷jZUWVS}<1ۉXLGlLG8LG%1u~11Ejh -hr#u ue=JGuhK.h;#jZt&`'FtrE96/ kU DЉE8LG뉃a$&nEtPt= OWӣYvh#Z?95 Ojh"V jh"VӤ h0#V}^Zƅhޓ#j襴 Oh%STZYkh$S?ZYLh0#S*Y[Åh#뫡 OXLG OPLGEm=lLGt h#s Oj/RUwYZUt lLG5RhH%hlLGlk EPjhjjjj5 Oٍ8LGU P5 Oh#R28LGtehS#tM,LG0LGLG=JG1vldZRC.E)t8HuR}t h#KE hSt%RU裣YZUtPLG",LG0LGLGh5j<h5j0h5j$h5j 58LGh#j hJG|_hJGu h#@u h̔#jhJ.]VXZtKth% h$h0#& Xt 1N11҃=JG1-L-=-1ۉ|-=LGt ,-=,LGt58LG9 Yu.t h#j=,LGu"58LG Zt58LGh֔#jie[^_]UJGjhJG5U4h_jέEXZu5EZt1JG=,LGu!uj蟭YX=JGhJG4Zu+j 5X=LGtPu=UZYdMGj YdMGyuh$XZJGV=JGIjPrXYdMGtPUYdMGURP襇XZ=LGuM@EPj5dMG  jh t 5dMG轎 jj虬YX1}UWVS]=JGuh#Yu h#j蹯h*#oZt8/t P6 ^x-|-1#Sht-EP]= ƃ 1҅=lLGt7lLGXLGuUVQPI? U-Euԃ=8LGu h8LGhhT$PiA @u 8LG%h4LGhA6%uGA @u 4LG=0LGxj:h#u_5 lj=0LGlLGuSh#!t$=XLGuXLG=PLGu Sh#jj:hL%u5 LG=,LGu3XLGt0LGtR5lLGgZY,LG @u15LGh LGh#u> @u1ۉ LGhLGhJK#u= @u LG lLGJGJGJGtj,S\nZYt@lLGJG؍e[^_]US讨Phܕ#hK.\Sh#hK.\jOU=tLGthtLGhtj jt dJ.y1Uh`J.xZuj=0MGt!á`J.P`J.=0MGt!Ujj萦!S 9X<uY8C L{ t VW虑ZYtAEPuWZ YVC Zu h6#gXXc9s ts tC Ke[^_]UWVSƋPGC!wKPGXPG"8J.HJ.y;J.|J.PJ. hJ.j }TY[뵋>WZÉPGF<w <tj<t<f~ u=CPGJ.HJ.y;J.|J.PJ.!hJ.j!SY[6h$NXZ|Wh#MPGF ^_tbP<PGv WhC#M>Wh#MPGF Y[t'PPPG$h$M =PG"~1PGhO#VZe[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@K#t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]h%Sڎ^_ug@-; CtcE.ƅUB@tjgEPhf@5dMG(zEu9jhxt 5dMG zjhyt 5dMGyKuhv#IX1^(~(Ph PG5dMGZ?Ej0h PG^u(jOh PGx^ZYtjKh PGf^ZYn]UWVSE1ɉMhjME[^1=PGh`PGZtuj'^_1j5l-٦$EP5dMG> j蹦[]]1uY9sE:0u}FEtjj輖XZEe[^_]Uh#nHPGjh`PGDUQjhxt 5dMGxjejhyt 5dMGuxj5dMG8J$jej5dMGJjh#5dMG<#<3t<0th#Gh֘#GXZjReEPhf@5dMGwjh#5dMG*<j%e j5dMGIjhxt 5dMGw5dMGv>UWVS,]1of=|-t h#&GXhJ.e}W5dMGpM@Wj5dMG~j5dMGI jh##5dMGq;O#O#jh)#5dMGK;؊t =u,@S$S5dMG ;jhO#5dMG;O#2.#؀1uj5dMGZH[_=PGthah#"FYC<w3$&hy%hZ#h4# h?#hN#EZSSh[#E h#EX1e[^_]UjhO#5dMGH: KUVSh~#c-&X-&1tlRPh%hK. ICttHu)hK.h#hK.h# hK.h#cYXg#uz#FhK.j 0XZe[^]UWVSfK.fuURhht@P!u Pu fEfth#, &[ -&tIt>UQMY9MU~ z#QRh%hK.GÃg#hK.j /XZe[^_]U̓PPPh#hK.GwPGt@thPGXj(:UWVSSt Éֺ &"h#h&hh̚#u :u!USP ZYUu=PGe[^_]VSh#Z+j9UEuh#h&hh̚#@0h#+1UEuh#h&hh̚#܍@0h0#*1UEuh#ht&hh̚#覍@0hW#*1UMuh#h&jThǠ#s11f3A@=uUVSEu ]uh#h&j`uh#h&jahǠ#%t0ffPh#QBfPh#=Bfe[^]Åt$1ɀ8u"UJRPRP  1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4@&謃ZYtdG (uhڡ#)h|%h$hK.D4@&h#hK.DC uhK.j m,_XFD&EsR@8t54V?@W$WV @VEPBMU1e#sj@HEP) susuh1#B@uhG#5@uhT#(@uh_#@uhj#@U$19D&t@ uRh¡# 4@&hΡ#?XZ}tEPhv#?[^h0)uuh#p'Y,01e[^_]UWVS]uh#h0&h{uh+#h0&hh#11{ u.h>#h0&hۋ=߶xtgtEWVhPsL:u s hY#n=ts hf#&ZY1uh#~&X䍕uu-WVhPs9us h#럸"=thPs h#&xe[^_]UWVSSljUQA ^t#u uSuW"9Ãu VI ZHW4u uSVW?99uSuV u VI XVI 贎벉؍e[^_]UWVS@]uh#h &h8C@uh+#h &h9h#{ uh>#h &h:߃uh#h &h;ŋuh#h &h<몋1 9Ɖ} PQh#9|(Ɓ tPQhJ#$ 1jjh V7= tS h fUtts h#a<_X1jjP79u 9t-uRhY#蘨yPRhx#u to@u h#qmu h#S󥍵Ѷx Զx9t PRh2#\)#5,hX#50hv#44h#4 8h#4@hר#4Dh#4Hh#4 e[_]UVShǩ#4[1H9~D^Ph-&i4CZYj]~3Xe[^]UVShǩ#D4Y1H9~)D3Pho6#'4YZ9~j:33ZFh#4Xe[^]UWVS ΍1V'tYv h;#jOffDžVsf4$sZڋe[^_]UWVS։ˍ1ffDžfCf+[^_]UVSfxjRhVHVhiS)c@u hK#j蒄e[^]UWVSDjjjH @uh&0jDSe[^_]Ë J.QJ.y ;J.|< tJ.J J.UhJ.Pu/ZYUyPPh#hK.-jVGW|$wUWSˉ1҉VGM]m N&h}fU fUm]mURp pSQh-0h#hK.,$e[_]g_UWVS]E }܍p(}p4EPSY^tSh#JXZe[^_]UWVSP]} CM% CSCt RPW8" RPh-j! 1t)8y18th-h#ϔ^XcCt2PW"ZYh-h#蚔Y^}uzPh-!YZu΁}ti=VGu\SlUx1҉UtRW!ZY@u\x8-tRh->"ZY@u"{lth-h#Y^uSh-l XZ }ye[^_]UWVSVGXt.h-h-Epƃ \h-!jjEp\ @Euph$i[^xP=VGtVG VGt1=VGƃ}  =VGh-h#hK.)dJ.HdJ. yh`J.à uj\jPI1=TgHXZt S+BY:=4gHuFHft&wfHtWSTCYuftftTVh#XZv "# PvhS#xgH멃~Dt~T.u =PgHtm=gHu7=gHtvh9#}~vh:#gHYXWSH‰EXZ=4gH2U'jVSG 5`0S A(`0!`Z8t hʰ#j`e[^_]UWVS}E 0h]#j jo7t;EPhht@j? uEft-HgHpgH (gHLpu PgH1۹Mh|#u W^> M1G$4&(gH1gHpgH1gH(gHLgHlgH땃=dgHt dgHLgH1gH(gH1lgH1pgHYLgH15gH5(gH5lgH5pgHdgH&gH1҉(gH1LgHlgH1gH(gHLgH gH1tgHtgH1 gHgH4gHDgH PgH}1HgHjj h]# SQj]S@u hƵ#jDYShֵ#rXZ=5gHFډWVRP#=\gHt#RPQ4 e[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.P XZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPXgHtvv Rh#EÃ=$gH=`gHtBjj h]#v\vXjUR @Uu hƵ#jWRWh$à L gHAF`VdEUQRuu:#=\gHt#RPWQÃe[^_]UWVS]C=XgHtS D=$gHt=`gHtS(SDgH gHlj?;-(C ;-~:P5gH ^Zuj+mY]e[^_]1S -gHgH1txux tF@-E-}E}E1҉U}9}~j}1EM9M},=`gHtK(KS gHk‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=XgHtS D=$gHt=`gHtS(SDgH gHƉa -69~] [^_]șEș}E31tZ~u~ tIE9| 1=`gHtK(KS c9U~U UBGv뢸 [^_]{UWVSP}XgHtG X=$gHt=`gHtG(G\=gH71Etn~u~ t]}~9,EEF,;-| 1ɉM =`gHtO(OW Ev뎸 Z[^_]UVS RPuV! u1;8 uhZ#j(1ɉ (-[^1;8t ;8t;8u%{xv$-hH=$-u Ch#_u5,-h9#j誚 y,-:Sh#0j肛,8IHt u hܺ#jh#jZXZe[^]Ã=|hH:=(--UWV-whD#j_XhHt hHhH yPt 15hH(fEEEPhm50- xr(-yhH5hhHujjj50-x3jWVRP)WV50-1ɉ hH=(- hs#h#jXZ1e^_]ÃUWVSPE1҉P1;EE (-hHjjj50-*Ɖ׋ hHxoEU uXhH] \hH9É}EjRP50-y%i8h׻#0jO(- )}Wt1e[^_]ÍL$qUWVQ1y(-rhHu9Dh#90jjj50-0y(7h6#0j蛘(- )y11҃=,-~hc#ojRP50-W7h#` (-롣xH19MQRPWVU}uth#j(-XZUfEEEPhm50-! y)u6Vh#0j託(-(-1eY^_]aUWVSJ.=-tK.P7R+5gH=gHXu u1=8I=-OhD#WV5dH5`HwRPVhμ#hW5dH5`Hh#hVq0WVh#hVV}}t^=hHtU5H5Hh#hVVhhHh#hV(V$$Vj =-ubh$TH1WVRPRPVhμ#hVV5THh(#hP0hD#hHlH`HdHWVRPRPVhμ#hR.5lH5hHh#htW 05dH5`Hh#hVRWV5TH,-HP8I0h9#hP8}uV5IhS#S{%V2#$Vjg }*e[^_]Ã=0-y1THhHhHUPI It@=hHu7=It IR5Ihj#5I5I=gHtLhhH50- ZYu6hH%=u%=\hHu=XhHu5gHf1gHX=-w= It -~ jP'YX50- -Z~jURP I It.=hHu%5Ihn2#41I5I 0-hH hHu 1TH1hHhH=8It,-I It̃=ItI1I=8Iti5Ih#H#ZYuS`HdHutjhRP?jh5lH5hH%RPh#5I0j5I1THZYUVS ShIjT yI1h#0j/ jSj( y1hƽ#0j 5|hH=$-B 5gH6=Iu5Ih#R[XgHhD-S "ZYjh<-S "ZYUhHC,-uPSh#h:#PSh_#h#ۏ-wh#h4N#躏[5IhϾ#詏h#蟏h#蕏hE#苏h S褏xhָ%SI!ZYu5|hH(-5Ihh#>1I[^|tFu=|Ht5=~~ h~Ph4#thPhb#jYw@5gHXZx%xHHHH1`HdH1 yHHT-~xH~UWVSIt h#jpxH=|HT-u|HySH+HEU EUT-EEuuuu8u})׋E9ƉM}u}WV!ZY+u}𡌓HT- M19}kHUH;Hs#5xHPY_HH+HRP_Zxk H1HT-щ H}=HHxHEU)`HdH1ɉ hH lHo-h#j\uXZ؍e[^_]Ã=P-US=-uh#j%uXZyx1ۉ`HdH15T-5HZY~%HH‰H`HdH1+P-~C9}Ph(#jt Iu뙋]ÃUWVuM H)ȣH^_]UWVS$]CDž$$ x$|$x $=Iu15xPu ^_y狳VhE#0jtPuZYud%hN#0jvtۉ15T-5Hu 4ƒ H9|Ru -WQQRuk9uUy%Vhv#0js79|$u9x$t h#j\rZPu )ZYy9Vh#0jsNjE49}u;0th#뗋9}3t)1;x$|$}Ru ye[^_]Ã=Ht1US5T-5HZY~'HH‰H`HdH=u.=8IuH1$x1`HdHI]ÍL$qUWVSQ Q1ɉMMu u15H=H)9}Ή5H)څutċxH]؉}܍MQWSRPƉ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u}`HdH197H+Hщ9|`tt%u؉}9}M؉]܋EH+u}럸eY[^_]aUWVS] ~EH+H U )څ~'#9~؋5H}5H)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu Y[uEl*DžlhhN#0jo֋ltE1҉Pd19} H+ H } yjș9Ή}hlpPtPQ5Hu ƒ2E0x} yE} Gpu5XH=I td@9u HЙ).1];x$|$}Rhu  19x=It, u&Ed9$thh#jm 1e[^_]UWVSV pHtH19|1`; hHlH}h%#jAmZY1ۉhHlHT-H‰H;E~ 1}}])1u5T-5HZY9T-uGhHlHE𡌓H~$5Hlj=HT-9H~?EhHlHHE)։׉=H8IJt[tTA1hHlHx,T-H‰H;E"])IEEe[^_]ËH9Hs.UWSH)1H5T-EXe[_]UWVSu] ~;H+H5T-Zx 9~‹=H=H)1e[^_]UWVS1;EE }PH+H5T-Zx5É9EE }]u 1=H=H)]u 1e[^_]UWVS]x$|$ $=IPu z_Zyz VhE#0jok[H+H~b9}P5Hu  )H19|5T-|^yt7hh#0}94tVh#ji 1YuxPu tZYy ShE#0jij;Eut\ ShW#֋U Ze[^_]UVS]E xz$usP5Zy Vh#0ji$tAP<Yy$Vh#0ji$ 1$IZe[^]UVS|]s|PV\uXYxS=(It1F $M9$$u0;|u(,$U90$u;EuVh#j2h 뻸e[^]US|]EPStZYy1=(IuOE%=@uEhָ%SAZYu\SYy} tSh#0jh/S;Zy5I*Sh#0jrh̋]UVS]EUdh1ɉlE Upt1x}=-t =-|PSs^ZuZ=-u#EUdhEl=-u t5IShz#0jf]US]E %PSZYt"5I_Sh#0jf]UWVSĀ]C;/tDžtj/P^_ƅxWS6rZYuF/hSZY@u/l=Ituu S jScZYy.WSqZYu!E PSjW)PSQIF1t1tu-xPSqXYuE%=@؍e[^_]UWVS]3t/|3/u(=IuhSh#jodI I} tjh Sn V詶 $Yu.Vh #0je=ItIsVh"#P$蜱$7yh8=Iu<$8$V @u5I:$h,#Wjd1I$G 1҉$Qe[^_]UWVSĀlj։ˍxPQpZY=(It1|9Nu*;xu"F M9Nu;EuWh=#jb BE%=@u8hָ%S=ZYt'SYyTSh[#0jcjS6Zy-}tӸRtvvS uSWqZYu1}tuSWhl#Rj@c둍e[^_]UWVS|]($1u(x$|$9ȉ}$9$U  xWVnYZ@t$E%=@uVh#ja KjAZe[^_]UE$tH $E] ]UWVS]E 9$usPcYy:Vh#0jbIt<$8$V It u($L($($u=Iuj IPIXZI!%PVY_- -t%jjL$H$X$T$V$tG{WVڧYZyPWVh#0j4aV)4$ 1$IZe[^_]UWVS]Ct($$t!Njt1lp$H $`&5Ih#ZY=IxPVSlZYum%=u[hRV u/GtVh#0j&`pƄWVZYpte `D$@$WV:WV茦Vh#V P赥ZYVh'#j^ lt lt(w$VGpZY@tDžl=ItVh,#Rj._듉l<$8$Vr @ltDžl3It<$8$V Itu($tYX$u!($u΃$5Ih#YZjVYZxPV-jYZy+SthM#0j3^WVD>$u! PVXZ=Iu ($jI - -t[j $P3V%A=-u =-t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSuou he#E18}t}t:|ItIE|I6SVu{ 9u h#ixIpIExIҍCtPR XY Pӭ Yuhu#jP[XZ>CPVЉUP EU 0j\̍<+E e[^_]UVSu] }u1NjjjVVy Sh#jhIVe ySh#0j[e[^]UVS]u x@P覠X=It*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu ٞ ~ pt1@9uNjt9|$up9x$th#jY xPu hZYyxShE#OT$9X$u;t h#jjju y$'Sh#0j Zp1$1e[^_]USItP1ۉIIXIum1 dJ.yh`J.Yu9`J.P`J.9-uu%1S I t뭅u oډӡI<IuI BItϋxyRZV붉Ij5IhIII ,1]U=IuI=ItI=It I@=Iu'h  IYuh#jWXZ1BtIt9UVSut>uh1#j © XuhL#j?WY[FVZH~ 8/u3E ؉C1C=IuIIXI1e[^]áIt@= It I=Iu4=0It+UE$uItjP5I US=It8I1t6{u+uhs#jVVXZ3h$hK. [Ƌ]UWVS]=Iu =I<15I @u=Iu95I"IYu @uЋHHQf $|&@PURURpp p0]9xjjuuuu졸Ip ph#jfUph#h#p jDV Qph#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=IL$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RP裘 y$IpVh #0jTƄ  ǃ$h IpCPHh IrP&5Ih# t1I@=e[^_]W|$wUWVS<ÉUMMQEPWu}j 9ƉЍM}Qh$#Qh.#j@S)>ue[^_]g_UWVS\]u=ICEuPh$V+ ue[^_]}W($̧ET$X$(j8$@Ej<$BUu]#u]#PjRj4$Wh:#V詤$ w'@$  R%PhL#|$x$hW#VZuEPhg%VE$Pw Sh^#u Sh+"V Vj ZYVXe[^_]UWVST]}T$X$uV($肦SWVhf#Pe[^_]UWVS]u fVfuPtZt%t0SRjP}W裺VWCۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=I!u%UIho#jLXZ1ø1UWVSSu] E}MM1҉ O=Iu)SI:-uI C.=IuA IQIu IIUWPYZYtAU:uC7tMM}E] ue[^_]^E] ue[^_]W3h#(x:u9C.9} O@C.W3h#hK.T?e[^_]1UE E EE]W|$wUWVSjEPSƉ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uh#P]_DžuBh#jPJY[8zx1҉P=IufIItc߀?t\j,W1[ZÅtj=WZYuh#Ej S YUuh#jIV蘤 IB1e[^_]UWVSQÍEPS~^_uC I%Ƌ]| tC]Sڛ ZuI1 KDe[^_]UhK.h.#fjb-9t BtU-UhK.h#2hK.hb##hK.h9#hK.h3# jUWVSPuh۳%S3ZYh۳%S$_ZÊEhV(YXuVh#0jeI }t/1e[^_]UWVSlj/E 0._ZIt@E Ih#Pe[^bI#II1҉U11ɉM11Ejh`-hC#u uKzX$& O!|H5 Oh#f |H렸1P-덡 O8-uxu1gHEjgH[IQgH-#B(I3I$1-=-u3#`@}1II=Iu II-c IT5 O;_1Ip,Ia -HgHl%9I OI$IEx9~/pPu[ EZYuh#jEjEMȋ OIP}gH2$1III5 O,DgHl#ggH-XgH-IgH-:gH-+gH-gH- - OgHI1=x-1ɉ I5 O5CZ40I|IC.E 4-umu}t IK.IJ.Hw49Uu }uj5 CL-8IIt HuI1E`hq#jC$h#P[_h#SZYFII}tE8MMYEh#WZYE`J.t&hiO#W;EZYuWh#jC1E1EEYE}tES詝 [h#u+ZYuIu肝 XEjh#u> u@It EtSL [EPUu5 XZ1ɉMEHjSu E&EE]}t EtS؜ [h#WaZYt uc[=IlW5E.j5ISs ^E6~tIC}1IExM}h#SZYLFLjP[_}u'h#P|[_u^ h#S]ZYE`J.ur1҉UE5DžUuzuh#S'ZYt u)_=ItSh#{E@u}jPZYy!hiO#SzEY_vS6tj.h#WYZt2jh#W ujjW_Z*jS1ɉ P-}CgHt 81h&#2gHZt 8gH"I"11jh`-h#u uz$&1-ă뿃 O|H5 Oh#4I0Ix OgHf,I TgH-#E(I@3$I΀ I  O@ OtjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh#j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 5Ih#5[_Vh2#5hb#5h#5h W5hQ#W@ZYuh#W-[= u h#:5Y덊uh##5ZX<.uuh#5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDhJ#j2|tHL@t<uDhm#hK.+ WDh#hK.t@th WD 0 1e[^_]UWVS]t K΄u h#R<\u FFu8uSh#j1 Dž~j> Xuh#j1[^GjQPٰ t5hVPSVh#ji1 W/ YpV֊t\uF8tFGW Sh#yRDZV1u,Wʋ h#j0GBGtVuhC#j蠂 XuhX#j0[^C31CVmZC 1ɉKECE C=IuIIXI1e[^]USI1t6Cu+uh#j/XZ3h$hK.5 [Ƌ]UWVSuIt$tS= Iu S1u=0IuSu $uoFPBYuh#j /C_Zt/1s\Ct/1ɉK;WGZC Hǀ?/uC C$lI9tP@uh#j.Y[CS] 1$Z-e[^_]UVSu1ۉ$Iu,= Iu1=4IwC |/t[t0CuPFP3 KVPYuɡ4Iu #$tV^Zt 1$e[^]UWVS]=x-tes{.u{.u Ct:u h#j/V [_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh#j% RE@j=x Xuh#j%Y[.t;u GM1GtA#jb%W+ Cj&GW WZ>t+@uVh_#%O}tgE8t_W@uuh{#j$W bGƒWt+G 9OG}Vuh#j$W 1G=HIu=HIDIx=DI1 h#e[^_]UWVSM=`ItPÉֹ=1:t9pt@9u9U}tjv ZUuh#j$[^1p1ɉH xe[^_]Ã=lIu1Ujh Sz lIYZt1h#j#XZ1UWVS}lI$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uju YtGGP}6Zt0 $$$CSEC ECECEC1~S} Yh;#j"XZdUh 3 Pk $Uu-$CHCwC3>} S8} [^̍e[^_]UWVSMlI4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3| X]e[^_]y| e[^_]UWVSS=lIt51ۋ4t#1ɉ v0EC| EP:| XZuC u͍e[^_]Ã=hIUWVjhGw hI_ZuhY#j!Y^C#=I5I-5IZ@uVh#0j! VX1e^_]1Ã=dIu1Ujhw dIYZt1h#j XZ1Ã=`Iu1Ujh=v `IYZt1h#jP XZ1UE$$ $]UWVS(}u=`I0 $$$EUE 1҉ẺUЋ,$0$1!!ډEԉU؋E9uE9t1!!ډEU 1EE11ɋEUƅt6@ ]9Xu]9t@P @ $$$NEU#E#UЉE܉UEu1Uu1  O $$$ƅE] tYE]1؋U]1 uEjQq X1ۉY $$$AQ F AN tX1-t"PITIPITIuϡPITIM̋]!!9ur9unt`PITIutLUjp Zt=UMHUPX N HF $$$EԋU؉,$0$Wh#jhU#j1e[^_]Ã=\Iu1Ujh='t \IYZt1h#jXZ1Ã=\ItDUVS1\I0tjjs sss3[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ \I=1Et#؋M9Hu9p u M9Hu9xt@$uj(*o X҉UtMu0UЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R3w XE #Ee[^_]Ie[^_]UWVSEEE EM}\ItqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3v S{v XZ1e[^_]1UWVS]}E=It,;/t'PS^ZuSh#jT |j$m Yu#Sh #j2 tXue[^_]u S.ZtGFG4W8F VG(W,FVGlFF XIF5XIe[^_]USXItvCXI=Iu{ t s3賴XZ- -tjjssss 3=|-t s3YX3&u S u XIXZ놋]UWVSE @~}DE@Eu119}1Ҋ LBuEC}t#]1ۉ]Mэu9s F^BE1uZY[^_]UWVS u=hIFhGSPG <9tjww 5-Ƙ;Wu;G t Eh=#*SR5-{ 9؍thU#0j SR蒩 yT$X$G9__W1j%k Xjjj5- G WxNS5-J{ 9u)T$X$GWhIW8Jhm# >h#0j$ Wr Xh#jZYe[^_]UWVSQdIuh#jXZohu u Eޅt6uY_tcvj j ^t;u*ƉYt#u*GZt _E81QV1r XW*r _h#jN[^0^Su蟨ZYtSq u*F_Zuh#e[^_]UWVSu} dIt=h7V t&3V>ZYuusV [֍e[^_]UWVS1ۉ]U]u tu} 1҉EU]t} t} u^ <^4^F (Ku0CEUEU}t9s}u9rKC0E}1 ۉZY[^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=R.ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh=#h SbSyEVhE#h SbSy=VhP#h SmbSzyVh^#h SMbSZe[^_]USSˋ t%RQP.E3/o 1U1ɉ EeveRu P ]URPhi#j Ujh豨ø1҃=It1UMU1I1<u @=u3} u( A=ItIAH]UVS]} ~;uqjh#P  u%=-u -h#j@ZY1-jjPƺ 9؍e[^]UVSZÅ3h#VFZY[uh=#S2ZYt)SVh#jh=#h#h#j -vSVh0#jIo1e[^]UWVS]u hV_Z@ub- 1{ǃ4$K<vCVhtI|I | RhpIxI Y jjFdP(%($jjFlP8$jjFtP<$$jj F|PdEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1҉$$$$ 2t8,1ǃ$ǃ4$($Qv`ǃ$($ Kt $x$|$ށ1$$$$w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%1҉$$$$1|/uDe[^_]UWVS u$Hwv$&=It_hV#j h#h#h#Ń d~ Ph#뮋XcV~Rh#땹1jdRPֿ1$$$ u#EƄ/ojj 11#Y[1u9E2jd PEP|ojj 11wE1Ex$|$ƅz ӍynHʃ0Pu uo9uhA#9rH@0%1҉$$=Iu = It 4I8I T$X$W($1jj_Z_8$1jjZYg<$1jjY_{jj _Zud2M1jjhZYuDhSV[_y>jh虡ZYx鋖$  Ѓh#'e[^_]11UWVS}} ?jh#V& Åulh^#VҝY^¡I I uIhf#jE XZjjP虻ƺ- 9tPVh#j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPW_z/@E K<vM E)VhtI|IMȉ RhpIxI  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)PyjjFtP<$ Ɔ(8$P PZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2hiO#VT_Xu$03c PVhg#j[`J.1EPSKZYt/G}vEVWhz#jEUt`J.u1 SmXe[^_]áIt UU RuP5ImUVS]u F5ItRPS7 tD3j S:dZYu1e[^]US]}t II It=IthK.j O:1IZY5Ihh #hK.KRSu hK.UhK.j : ]USjh#DY[xEh;]$PhIYZt&hiO#ShIYZt135IlZSQEX=,Ith#h#j ]UVS] u}t II It=IthJ.j R91ɉ IXZ5Ihh #hK.MQVuhK.W~S` Phm$hK."QhK.j 8XZe[^]UPh#hK.PjCIU؜Ph#hK.Pj[CUWVSƋ=ItPuh#hK.P=Iu ЉˋQtjPYZt轝8tɍEPs SXZ=ItVh#h4^Xjsjsؘ%} u]#VWPREPh4#hK.OhK.jdJ.HdJ.[yh`J.'lY`J.P`J.؃t- t( dJ.y h`J.kZ`J.P`J.΃1Ylje[^_]UWVSAօu"VPq _ZtDžF%=t1jhA @txP&tY[x^9|u,;u(^9u;F u%=tW8}AZ<jjj3{  ׉NX^\19ȉ}{ 9}Dž 1P> 9+{o>@ZcjjjZzG? NX^\19ȉ}{ 9}Dž 1P > 9+{=?ZjjjynfNX^\19ȉ}{ 9}Dž 1P2= 9+{<>ZjjjxNX^\19ȉ 9}Dž 1W= 9PPW +^;>_jjjw~\vX19}p1҉f u݉19} 1QPn; 9u#);=[@ Ih$,ZYu=Xe[^_]UE @E E@E]闈UVSutYS} u C tCI@IRQ sQ SQ IHI uIte[^]UVSuI@II؃8t VPjZY|Iu IuIt e[^]e[^]UVSI1؋tJ9tFjPZY|Iuԉe[^]UWVSI@IƍPY11ɋItx?tBA'u9t h#~ IuIthʧ jVSQ19}Vph#p-HQP yP@-H Z J GSXe[^_]UMtA'1I]UWVSu^Nj7t#vuUY[Åu jWXZ ׻؍e[^_]USh %ZtaujY1"4hItP{ ÃhIX؋]UWVSP}U UWRW"ơI@I$իW C1҉S URCIHIuIt e[^_]Ae[^_]UVSuV[t#sV;ZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY1hI8u&S;u0h#5-XZhIPhIuj=CP\WY_uyjS5_ZDžuSh#5-e Sh#lwM-xWP yP-H YlJ ]@PS3XZKe[^_]UWVS5IʍAЃ wVjEPVyII] &2KȉMA&uV)PRh#&tKI|IC&u)BUPINjU󤡄IX/<1t &wlҍ~$&"v?F:w;$&&R|t[~-^tC IQQh;#!ÊV=>u,Ƹ^ À~|tH;= ÊV(,)%%#$Ƹ Ƹ^Ie[^_]U5IPhk#UWVSQ5D#I|ID#IPÉ5D#I^=F-t #uKt;uK5&豏1҉jEPSvƉ蘏 8uE8t+胏8t#`& tBUUue[^_]W|$wUWVS ÉUM7Hw$4&# uu #!uME5 #tރ uWVuu* WVuuG, MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=I%1  UU6EU=I&t #2E衄IIMQ  xWUEaYutu]ƉӉڍe[^_]g_UWVS(ƉӡIIEЉU"tUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh"j]S9jSu e[^_]US7=I)u n[]W|$wUWVS4É։MЋ?E1EăH3IIV]ЉE뭃$" "tCك<E4EȉU̸#=I# wEУItV!EȉŰEЃ'wFiIƒ}'u1EURPh"j}W8jW6 EУI IIV]U]IIVWEnY1 M1ۉ]IIVWE7҉EȉUX}t # yIt VEȉUUIƉ׃ƒ'u1EȉURPh"juV7jV5I, !#닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sáIIEUUV0IKw\l&8l&}GVQIYYuRPUMY_Kw#l&9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ IAZwSjƉYX=IuRE졄IIMQ  SUEZ  !1e[^_]UWVS}USFƉX=IuQME졄IIMQ  &SUE щX 1e[^_]ÍL$qUWVSQ q}WG5IXjLPKZYt5xIu,xNu&1҉Uj PbKZYUtB@)։5I@뽉IIv1=It 3#EЉUW`EЋUԍeY[^_]aUWVSRE} ]#_--@I@IHO;t(@Isx&GP ωʋ7@Itx BMP M҅xJ H+ -QX5D#ISƉRPh$l e[^_]ËIЅt /tt@1I @IUS]u1Z;/uPhָ%ZY@tEPSZY@tҋM9u;Eu3E3U ]UWVS}V&VP tSIY]e[^_]鬝S覝Z8"u뺅u0G PhO# e[^_]UVSu=IuE=-t.1҉-hf#PYZtSZIXue[^]3e[^]UVSu4t =IItP? YI@III1IjRIHIZuItG =It,j5Ihc#] j5Ihf#K jhf#[^1Vs@$螛IVP--@I >/t[5I>t'@IH@IFxFC+XVԀ~/u#@IKhQ#VtZYu$-9r :ƅuh@IK;/u>thָ%VdtZYt @Ix/4赝X/ 訝XV>t@IH@IFxފFC9-u @Ix/C hX/=@IuT@II@IItP.= XII5-Ij5Ihc# j5Ihf# IHIu Iu@e[^]UWVS} uI@IuYy IuIttj;áIHIZuIttt hj# Y0t$=-u =V-t5Ih$XZ1ue[^_]UWVS-hƅdh#HYt =I1=Iu 1I= It VW= ItVW_X= ItVW8= Itwww+1ɉ IzjwXZ1=IIfjw_X=ItQIE= It\WfY(jSW Rh#h- EވE1URZEPaX It=-tIt }tPFtje[^_]UWVS} E E܍uVc5D#Iju^1jY=-tKt>=-u5tUXUt E PuRXZ=Iu V.X^V胉Zu1Itje[^_]UWVSWE} _--@I@IHO;t(@Isx&bP ωʋ7@Itx BM6P M҅xJ H+ -Q/^IPS|ZY1IIe[^_]UVS]I1jshXZ=-ItKuIHIt1IuIHIW1ۉIMwE5I=I; ut-t)E Ps5IIZY[x I5Ie[^]UWVSu=I=-u1EPE؉E܋^Yt$hPSO =Ib[E؋E1҉I]؅6FD#I=-P#IP蚥Ph#v -xWPyPQ-H =_ J=s~-xWPYyP-H X J 5-_jsv ~E Pvk=I=-uJIt:uIHI-1ɉ IHu IHI1҉I I=IEPXe[^_]UWVS]uVBE؉E܋S D#IjPsbM[tt=Iuk{t_GD#IEpWRZYt@1=IuA=-u81; u{CD#Iu s ]IZYt‹띋[1IV9Xe[^_]UWVS]} 3EsdX=-{5D#I#IP[Pmh#cStj RU5-KUR h#3Xu h##X-HyP-H X J 5-yYI@Iu"jSwhEPSRU&}tUt&uguu IuItjsWs$UuRg1҉I RrIX IuItjtJ=-tA{t;5D#I#IPPh#-Ee[^_]he[^_]USDIEE1EEppX=-tlExtc5D#I#IPlZYEPy$#m[EXtj S5-W [h+#B[5-XjEPZYtlEIIjXEuKt&:EP$2#X5-mXԋEtIj5II@IEģIj Ep(XZ1ɉM It5u EpY[I@IEIj?X ItIt뻡ItxEt"EP&$<#X5-Z]UWVS}] 1CCC =-EP蟀I@IE^@u hD#VjWGejWPyu31ɉ IItu jujWuv E؉s IHIZuItpEP薀Xe[^_]UWVSE 1ɉ #I8@#I<#I1ۉ@IEP^1=IE@D#IPTEXt7u!CD#IhPPSG 1 sZtҋ[ŋT18Ep XX\EXtCD#Is豚^u\1ۉPjXPSG [븅tB닅P}YPtJH 䋅1҉4=-t"=Iu~@4)Љ=-u&fDžhDžp+ 5D#I#IP^_PXX1ۅt--HyP[-H J ~j=W(ZYÅt?vX-HyPaX-H = J={=WX6 ePt@t--HyPX-H J v=_6 뼋Ep -tRVP t vHyP^-H J 5-F[oXsjh`&V5T u 8ԁp+  @@1H))t`8t38@QRhR0!fhMfhtM^Z:-rz-uzuXpu CSu1Džp @t fDžh= Iu Ext2Jhftfwp= t=+ t8ŋh@ft5I@Iju_ZYE@ t3 tDž`@u hD#=-fhExt x DžtDžxDž|E$I(1=$IEPtPj( IvÃt tOa15IjEPj ItS# $hU#wItjEPqY[t.IuIjIuIP-_I EIh!XwXZ I]SQRuP_5I1=IjEPj I($IujjS  SRuPqdRuPr C  1ɉ IIt u  AIt!`n$dXZ1IItcȋhft+f9p ! t ODPEp F[^}lIfpIHlItI1=xII@I$I(IL1$IpHPX IuItkjEPZY=Iu EPOXhlIBXlIu󥋅DuQHP0X($I@#I<#ILI IjPjcX륋I UIpt+lfjtB@#I<#IIh XF^_I@I=~ hg# p<$P[XZ II@Ip/Y($I@#I<#ILIhlI߅[lIu󥋅 IDu It j<_졬It=Iu15I5I B:-uJt-tuzu8t Dž1ۉ Dž u+1ɉ ----@Dž0I$J,I 1R8t4R8t*R8 uxPWZY@t RWkX뀃 h u tCƒv~ IPSP6hS#jUWVS]} Cfsftf$ftgS#I$jV$PN PDjJyӅtsh#XZ bXth#N_t h#=YVh$XZt h#XVh$Y^tqI@IsSP$PfbIHI uIt!h#,Ph# PVh #[{ t--HyPj-H *Z J*-HyP=-H X J e[^_]UVSu&t"8u%uCVP~AZYt؍e[^]UVSu&t8uVPLAZYuCݍe[^]US,-1ҋ ItHft fux@ |u[]UWVS}I@I It,Pfu9x fu9=,-| P X҉΍^It IuIt e[^_]ae[^_]UWVSu#IXE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVh(#sZYUtU~:uBC렡,-U҅y E,- !WE,-Xe[^_]UWVSI@I It!f{usS XZٍ݉wIt IuIt e[^_]6e[^_]UWVSutA%< I ItCVP?ZYtdߋ} tXI@IV<$eÉ1fCC VCP^IHI uIt~=I؍e[^_]US&tjP)f@SPXZߋ]U塰I@II P IHIZuItUWVS] j/u^_t[EtFxPuڸZYy L8tvL8tlLffCf1CrƋM#I9tMEth'#QY_tM ju_Zt@HftftfuEu6Eu E u=,-yƀx u1E\tE Dž\u =,-yuGYDž5DžXt,-f~tFXDžTDž`juEP` WcIZu?/ugX9`Y@Ph(#>pZYtuYDžt5Ih0#pYZuzX9`hxPWYZy.J8BJ84}JT"E%==ItlEW9Lȉ`+-$bWaju+ƃt fx`tWuh5#QWeXZI@Id\ujuY_f~udfF`FDžT BtEt$jT8Puhz<&5-f`zI@Id\uju=XZf~udfF~ IuIt;F FfF CfF fCFCe[^_]UWVS(EE1E11E111EhJ#xEZtPE܃bw$h&1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEEhI: E؈E1 ItIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5-^-@hT#W[EjWVZYtY@ft8*fuu 8u7E<=tu*It95lI|tIDEtt8u1e[^]UWVSu] 1}ǡIt!9pu 9x uX)jUIYII1҉pXx e[^_]UWVSI<-8I@IPIII4`VV<+-PU@PuV+WIPI4IDE} !ш3<1Hyq@ IuIthtP@ǃ x"I@IOHt =8u벍P4u 4i~ t9=@I2FPW_21@I)Dž~J@I @y1)Ɖ؉ƀ3tي"& vY w J@Ip @I^^@xPUYDtP ZLt PDIX} u"j+-P<8)PH I IuIt e[^_]UWVS=IujS}x}WGE-$Iu $IE]1uEIE}xuEF9;WHx< UWusZYt1UtWh'?&[ZYu^^뱉EމE}u;tjQXuVFXe[^_]áIu1IUSIBIP~ IIHIYuItϿIu1҉I]UVSuV(@$RQVPYjBQXIIe[^]UWVSSu E~oщ1ۃr?1ɉ RUPËU)VWƃ}svB*ZYy7t؉։݉ ߋu3Ee[^_]UM1t@PQ]UWVS@] }E1ɉMЉM̋ExMր*$}|}ۀtVp}t e}[}\tX}?ttJ}t;u{t}LC;uV}t;uCEH88}t;uCE@8uCEx\}t;uCC;t>AE@uF9utm&t_U9UčvsՉ‹EĈ@ȉƃEM9MMPA YPEP\ EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQAxZYx>EE1EE׉E1҉UURMQxYZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=IUqxvtu@r t@;}u5I[xP5IϟZYy9tt1t9s'@ZxvttE]S@ϡI;EtP9Uu8/t]C ָ%۳%PL(X E9It@/Džp>t F1ptJxw@tu@oItSYpF/S>Zt؀x .u o.ux jWtJ tptWu5I@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFuIsk^<*Uh#1UUM 0-t 9PuH]Ë @I1-0-B t xt 1z1@I 8IUWVS}u ]I@I0-z tj}.0-J B ZB$B 8IP@IP<IP XtK =8I5@I IuIt e[^_]̜e[^_]UWVSQ50-^ I@I{t-WRUZtUD< t< u -Hg C8IC@IC <IF $9tS X IuIt e[^_]-e[^_]UVS0-H @ItBu y8 @Ixxh-h-XZ=<I0-X8IhS0-p8 qu@I<Ij58tġ0-xu 8#ujjjϺ xtPjj跺 xhA#Xu<I0-1p 0-B8I8I1ۉZÊt u&)‰@I11ɉ <I @Ih^#C<IJ<I)B@Iu3=-t58I)5-譐XZ8IP8I~e[^] @Ix8IP8IU=~u! @Ix8IP8I]]U0-@IP <IP8IP4-Pj8+0-@1҉P P$P0-YUVSu] I@Ih' VvjjVtt0-@~PvY0-s{uh*CZ1@I<I4- IuIt e[^]e[^]UWVSĀuI@IjV軷Y[y Vhx#5ÍxPS[_ZE%=uxjjjSueuajtWS u"jh#W' uS:Vh##jjjSvutSVh#蕘S8t^9uSh#zu PlIHIZYuIte[^_]UVSu]I@I} t58IVZ@I<I4- IuIt e[^]酗e[^]US0-I@ICxP&tXCtP Y{ t~0-S 0-P @IP<IP8I@4-IHIZuIt ]]á0-US]0-=It 9tD9t h#]Á=0-IuU=0-Iu]U}u"0-@~P4s0-1҉PYUE9-uE -]UWVSU`I)i5rO9-t5\Iu1#-(9tC߉9} }t}tVǁ[-t?iӀu.tiրu--XZ[^_]UVSu95PI=8I2-tPqYjh#-[Z1@tI5-q-h/ Pq5-?TIy;"Sӷ-Z@uCt SYth#k-X4۶;TIt jj[Xjjjjjj訶¡<I9t Pj2 ZY@u 0: hd5<I5-Y[@ 0 hPhC#o?¡TI9t&Pj[Z@u 0 hPh#5TI5-誽ZY@ut 0 h5-dp-jj~jj~jj~5PIe[^]UWVS]u+`Ii5rOCShk#I@I19~Pi@t׃u=uFjRZY@u tP Ph#.9+`Ii5rOCSh# r*JփutBƃ IuIt e[^_]Le[^_]US]I@I9t P Z1ƃ1҉ IuIt ]]UWVSTÉUMt&uPh*#S 6EE"EtM }~EtEtyErMB9tMtEttt t tM IuɋE0u(EE@u[EEEHE\EM9u[5`I)i5rO-+9t# ti-;t Q@Ph#jEPhc5#jEP謈 }WYEtNjE0h#jW胈W\ƃE@|5uh#WݠXZƒu*tRh#jW=]hw%jW+Ku =tR j WP.E@t$Wƍ|5@)$Wh#y. WƉ$EPӆ_XKyS P Y P F~SEP蜆XZEu EL}tzKyS軅P _ P KyS虅P|^@P|4M}tVhf$S iEM0EKySAP Y P EEESτEZPe[^_]UVSI@I5\I`INxtSX IuIt e[^]e[^]UVSMt0t"119};ivuC⋉11tJiD} u&ƒu=t uă[^]UWVS utF>%~W,[tW},XY#*Ft~uH<-tB<%t<+u:-#-i`I #`I\IE1MxdtS~J~?Hu(UFPQMYZMUt UQW+YZUu뗅uV+ZtjV+`I\IXJxRt~i90tM΅x29\I~*i`It"# #*#1ۃ} uVPC؍e[^_]UVSh]#5X=XItYh8#r-HP*-H Y{ShIZ8PhIxjhI0Y^u hH#袋P+`Ii5rO@Phj#- 9DiPhf$FXZՋJ ;1e[^]UWVSQ111Uhr#4ZUt%jtptg Ժ;ƍ7H~hv# hItyt h#贊UjPYXUt 1t+`Ii5rO@Ph#t"Ph*#XZ1tnHi0i0h#ف-HQPFY_y/P'X 9~ -x99z 9~ z8 ܉e[^_]Ã=XIu!UjuZYu11áXIu!\I `IJxu 1øUE=-t@=8It7uR+`Ii5rO@Ph#5-豀UWVS=XIt} ~ 1XI\I`IJIBIuhViPË\I`Ii߉_19~i9uFP} ^`I\IiƄDŽIu\I Iu$It蟇t I@I=N-1ɉfǃ} ~-PI} tiE PmZ ƃ؉ IuIt؍e[^_]UWVSu]=8Iu1ɉ 8IIIS8SxxXZ=XIt u>juj\ u1PI}=-t u -t0Vj)_X}u-V5-"ZY@u0 hPhC#SjzqSjrq*}uHSjUxSjMxtAt8t$=-tSj2qSj*qSj"quIXI=-_ujqjhdx%e thdx%hx#څ}uke[^_]US]U M=-ut u1uEM E[]UWVS}tE1ɉEPu EPE t!I@I`IE1f~8 Itt;E܋EEEEi}9r(}i\IM9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉@tcu tQ=8It1=-P;u uEt tEu-> Iu2It)"}upuEe[^_]UWVSjjjà ~ jjj=-tQCtN5-_p^9t7UpP5-fZY@u+0\ hkPhC#辂1`I95\I|btPu=XIu>SX5E t t&tt M ڋEF떍e[^_]US1h#+Zt$ltptZu⻀ۻԻ͡hIu t8t Ph$݉^jԉYV=-u =V-u@t/jP‰١-YhIPhI@YZuS5-DXZ1]UWVS411ɉMh#*EZt+}nt}put h#>=dIE1Eă}uhI8Eąt2jjW| uWh#jWOY^t Wh#ۀXIEȅt}E`I5\I hINx.}t 9u1҉1ủu؋1MjVmE^ZMu u؉}tKE؀u?MjPZYEԅtjM1WɁ =-ut h_#CX6jsjs u7{t1h#Xhy$jshW-&1~[(hc#js u hD$_hv#js { t&u hD$^hg#js T u hD$d[hn#hA##hr#HXjsZYu hD$-Xhz#"js u hD$Xh{%h#s h#jswhy#js h#Cph#s t=jvihUk#jv U; uh#h#]_vh#sEh#;sF#1I#%1_#1L#1O# C#S9tRh܍#j}WmWVC [w*yh#:Ph܍#j]SmSjPiZYh#hz$rXe[^_]UVS]u t3u hؘ%BXjSZYt{t hؘ%#X[ɍe[^]UVSEXHI=-u=-u25DIju XZ=DI D3...HIe[^]UWVS}]58It/1}t3=-tޅttVSYX}u-t?Hi@@} t u P XZ؍e[^_]UWVS }EEEEuVEPjer tÅu6VjWu u>:jVj-S` Ph#sjVjSWu uÃ؍e[^_]UWVS]t I =IdPX#Iu #I #I`[1\\9I~jh&`P à u\IdP_QP^؀;48t@x/t@xPS^XZYy1EЉEԋ\ńI\u94IE[ Iu#h1:tt@u"=@I jXh#S^_19-T!T-5I߉SLi-xWPYyPh-H X J EЋUԋ\II\he[^_]UWVS}WY}E1 Itc=-u5}t/j5- jh-g-1PHZ=-u;1u{=-urnu=-t`=-tWh#6hXF+t'=-u1҃=LI‰LIjPzvY^1WUZ*uxWTXe[^_]UVSU:I@IjR؎Y^x jPNXZ IuItox=f-t01=-t -1ۀ=-t-11j?jVj1 =f-tt-t-e[^]e[^]US]I@IjS ZYxjPIHIZYt Shx#koItnjX]cUu}~E p Pcxb1Uu֚ Zu h#oUu u͟ ZYu h#nUVSuV@$VP؍e[^]UVSEX9-}]ށ}I@IFPb-P-5--IHIZuItmI@I5--)- IuItme[^]UEuj h(#j輽-)--UE--P-P@IP DIPDI]US]I@I-9t-P薡 XC-C-C @I IuIt ]l]UUI@IBDIR~IHIZuItlUWVSW -\ kI@I=-5-`IthG9ua-CPW¡--J -+-@I-DI^^t5;8u1H+pp X@MSNjM󤣐--X IuIt e[^_]ke[^_]UEIBI-)- IuIt]yk]US--@I-[]US-+@I-)أ@I;E|ꡐ-[]UU-)---+U У@I]UWVS,ME 11˅t MPZMwDGƋ܃}tE0v h3# kFPFE0u _E1t0wLG VYMVu!{MM̋3XZ̋EЍe[^_]USPjEPjՈà ttC8uE]UWVS<I11EE hP#E_t/}pt}rt}duܡdIEЋdIE뿋=hI?u hV#jE^tt S=aqd[Ejh4"AoEZYuE'?&EP5--@IX1EE؉EEEljEÅyCha#ri\u7}\}u0Åxσ uI}tj0P`[X9EtptSu虦ZYt"Sh'?&舦ZYn}] @IxF p+-E1ۉ]:E=@Iu @I}ENE-9r.SuZYtSh'?&ZYu}uă}tjuh4"j j5-7j jh&P}t}Eu}x @IE @Iu#EI @IxFIp:Mh4"7nZYMu.I @IxV P+-RE^)u@Ij5-7"i 5--@I1ۉ]}"E/EPEԍe[^_]UWVS1hf$E[t硰I@IjqPiIHIZYuItJfhI1rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPh#]Vh#]Y[ ȃ0 wF1҉U1ҍpЉvSh#&T1 EGuԃ}t{Sh#eI@ISpXtҁRWoW| IuItdu0 PSh#'eҁRY5-ZZ-@th#H\XEEe[^_]UWVS$f11h#QEYt(}St}at}Hu׃Ҿˋ]E&E؃8t@9tE Sh)#hIMԅuxt h"Hduh3S#u^Z|u1ۉ]܉]k] EډӉM܉]FFHЃ w!̋U9и Esuh=#ct uhP#EX 1RShj_uu9UrMˋEÉu&11EPC P~ysCP3h_#[tWEUE܉U}uM}uGh3S#ZY t Ph#%ZXZu ;u EUE܉U1C 1RPuuvtRPhu#mZ 띃URE@ PxZY@Uu0 Ph{#G}t]u]u ]uuRE@ P}[^y0ĝ Ph#+bE؀x u_j`I*tEUEUuu h#YY$}O 1SQRPsRPh$Y 5-WZ-@th#XXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSM 9t#t9uƉׁvSh"#Sh #`e[^_]UE0 w @8u1]UVS]1tS\Z1tpVhI%S ¸tVVh[#Sn ¸t<uh"S˘ Y^¸t0 vShZe[^]Åt2US-t1:-u-Au-[]È-U-PR-PXZ=ItM=6-uDPP7IXY&u-#jPh:#a UWVS}] Fh>#V_َ%1ۃ<-u,-R-#RPhV#Vg#Cuġ-HyPU-H ^ J 1ۋ-t#q#<-t"RPh]#jV Cuhg#U[1-:-t2-#t RPh#-RPh#V Cu-HyP_T-H YJ vu&hiy%W^Zu-@uK1-tPWZYuډe[^_]FuW#Phv#]e[^_]USMU 1-9u ]R@uQ#Ph#`]UVS]Ct&st Pb XCEe[^]K e[^]UWVSP]1ƍ@uPXtUPUBX1hlIrpI5lI=tI1҉xIYe[^_]UWVS }t15\IEE5hI9N hIBE-uB<-uzu+t 5hI1ۉ؃EEE@tcu}t\IIӃouUE8t E!Pu"Ft5hIU!RPuSjGY[+#Ph#[ru"}th#`Ph#-u~u C $t hw#-B0+B8PCXe[^_]UWVS4-E蔶=uE8t h(&35--@I} t u YEu P9!E@E%Št 9u u4--PP GӁt uu 訲jE)WP觲 @IH}t @IR\uG@Ix\F ^p\菵à u! @Ix F 9p 4-> @IxF p u"4-@4-;=$=O A94--PP @IxV P-)RM-X4-M)ȍe[^_]UWVS@} -B ]urVY wVh#Vh# 4&h#j"SFS请Z؅tWh#}xM4&h#jPFSUWVS]S5-M EZY9-ulP;_H=I9s<wDu 9rMW5I' ZYt%I=IM܋=I5I ##Se[^_]ø]#-ztLUSItt #u*]###I#I54-PIZY]UEIjZEDU\uH޲ u"4--@8xtjjX聯jjh"耯 雲UVS-Xt 1ۉXX8x tjb-1҉P Y1p84-P0 @Ix8IP8I0Kƃ)c t,~tŁF $& 4--PP @\ |td;Z=t 裱 uh?&u-@1>-@d|u-@-@)&t;u,-@ -@ 譭-@-@r-@_蝰=t0 u74-@4--B0ztjj`Y-1҉P$jhb&Vtà ؍e[^]UWVSSá-@tuy =-,uyGEt7`&t,O8uQP/ZYu`&^_8Et2jw/Y_t XS4$PSi Rt -1҉P؍e[^_]UVS-p$ t jj-ubX(x,u{ upVDZuh%#P: uBPV葑-BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um-B]US]V9tjS]UWVS3t u%j 48XpZʡ-@؍e[^_]UWVSS-@}%11EuCPw C u j X1҉PYt8uj 1~^Xj x1҉VPXFYƉ}t'}ug4EwRu E}twu}um-@-@}t_&t<}t jjG-@#61ۀ& r؍e[^_]UWVShEӉM-@E1EIEE+-]jEP3DZYtuj0Y>uVZ0VXs;5I};5I~5I}>uIy>u |u &u y1tm&ups1ɉK-djadB(-@(X4-Pd¡-@(Y-u @ 1҉P  s-X$z-@ Ù-`H,hP S]-p3-@ Y (\u: @I5@IVXO"D3 )f*hjډU@IH\^{t &@I\+-X @Id\@{1#Tþ}Ttt&u!KЃ vtQ}TuVھ @TBIIjjhI4 T1 T銂&tJ @Ixd@d\Xd\ &uJЃ wK @Ixd@d\Hd\ƒt:@Ѓ v0t' @I\d\P @IxdX=d X=d%:t #u%¾Rdh &rYZ&d@IH@Itx:C X:xCdjXdt\dd9‹\uADd(d1 u#}t @Ix#C X#1Gfxufxt΀Aw@ ȋ-X2dUNj@f@f@dw@b&1҉Pf'uAW|b&u1@I\Nj@@"&f@@I\$@IHNj@@&@f@e[^_]UWVSS-1ۅtXC1-0x tj-1҉P YF8Pv vS‹FP U8tSj-pәrjhB&P-HUJ@ B ]e[^_]UHu+]UWhPTIlSd-`I\}1󫡨-X1pjEPo.ZYEIIE-Tjh٘ ujhB&P -B t$Pt=^- hppDžt1ɉxR|T}E-jjtP -pnX-`-dZlI\IIu jl-Džp]#u^jW/Džp4#X-`-d觘XlI\Ipu hpp}UWVS -@1ۉ]}¡- u@$xl@4$&jj|CjjkCPu;jiF Ej?UBjj+UB뻡-xu j F Y1҉V @jaj ^ -zu jCjTjCjC-@C u-x,u p[u hL#Yj胿 -PS @0C>-Yx ubx,u\hi%p趘^ZuIu¡- up0,pY1҉US@PvjjfHu? 8j@-1҉P P-J0HCBHYvB-@ttjjjsCV-@^Xjg -B0+B8C j -p0DC 5- ~ uhi%v舗ZYt hi%CEF-xjƋE0FEY-xu-x  jj p0‰EEU表-@]Zu UBE밡-xt jj@0Fj9F -@Yt-Pv jj u -@FEM1҉@{j jC1҉SY^tNjjX=V-tt3j!-@X&}t-@uWf^_VjjI¡- u@$x@1ɉutt;tj 5XZÉs؍e[^_]UWVSP} uE E1E1}-X- u+p0ƉxXtӡ-p][뼋H up$E0FED럋]K9u}} uwj- 4-H4^SZYuhb#Sqj/vug t h# -4-+A8FF-1x4M@u} u jj[1E1҉j1ɉHEFE F -@0F[e[^_]UWVSS-@1su=V-tt h#KGܡ-@n@uWj Y1BUjBËUBpXYUj)$C^Ut1ɉ ֡-@tj)pZƉe[^_]UU-1ɉHHPtjjX-1҉P t/Ht3-@jx-Ytrrh#-(-1U11ҋE]DUU Et 9Pt]UMItPt9JuB]US]j袸SCU PUPUP X]UWVSEPe[y hD#'u;5-~5-ExWZ=w PWV `jjj uNuFjj距jj讝jj襝jj蜝$jj 萝SEpujuZFEe[^_]1=IUWVS}u ~}th@VWߴà VWZY}t9u9t:WEX19t-yʟ0a PVWhz#SESVWh#P&9-}-؍e[^_]UWVS]{tN7Gu I} t} t&Wxjw PR+GxP[EYWY Z1Ce[^_]USII@IuSwISY IHI uIt ]%]UVSIt/}u jS$ZYstFxPDX6͍e[^]UWVSu] -9}5-9~-9t7SxDjjSV+9tB8VYDWl` PSh#$؍e[^_]US - A - ~.CPjjC x9-}-PCX͹ؙ } I]UVSuI ~;I|p5Ij V?Cà x9-}-9t8tjjVB ؍e[^]Uj 衴ZtIIUPU PUS]IIt9Xu  PW X‹]]BUUIt 9Pt]UWVSĀu} ^I@I $@&vMQtVrAYXty$I6j0#PVhg#&jWAPjWAvvhh=-trvjV@XZu hh nxPWsZY@u諛WA螛$E%=WA|YVvhh vhh Vm@ǃ "N xtQqZuQtYttj :   <t?j}WSQy"ך0] PSv h#k!S@Z II VXq9=-}=-~~EuxV-9t1jPSW0yG0x\ PSh# rjjW? `I j0!PVh# 19u1e[^_]UWVSƉׅu#P[u VtYt ukj jVi?XZut蘙0[ PVh+#/ jV0tV誂YwN9I~>}u}1ɺ<ƒu,EEptVk_9I}Vh#0sssru>躒1UPjSc8 @Uu薒0T PSh #> !9t'VjS 8 @uV0T PSh@#}!ju܋MZh_# Xe[^_]UVS]u M1P1<&t#KySPMX P<&<uFtPh܍#S S4<&ZYt vVuQShQ#MShs#EF y)KyS P-Y P-Ph܍#SL Sv{XZۍe[^]UVS]א= Iu I1Ʌ0I…u%t!u IuItR=| IuINuV ItK I8t?!I I@ I=-t1t-IupIjSRS肎 0e[^]US]SĵYt ]]MhL%SN YZtSnZu]US]#t%S^ZuSh܍#j hd IJ=d I]UVS]} tKyS> P ^(P ?u3Sh4N# ZY?tH!VmPh$Sr  uKvyS P XɋP 뽍e[^]USI@I It8t PI 1҉Y!Iu1 II IuIt ]]Ë Iu It9u=!Iu 1UWVS ]} 1uԅu!IEԾ= Iu It8t=8I…teu`tM t$tAW؃u>=-3=-u,=\Iu#=n-t=-u Iu^EPjSg @}tE= tM1E@=-tt$Sv=-<u 9uuS-ZY@t^u Iu jSY^1҉U܉UUUK>v 軌 DjEPj0 }u}t1!I]e[^_]܊e[^_]UWVS] }uh &s}^_t}sh3$V}ZYuh# j5- xh#VW}^_Eur ItFI@I IPF 1ɉ I[t jV]XZ IuItF@u1 I1Eq}sh1$V|Y_th&"V|_Zt CE1#~puM} CEh &E0u|ZYƅFMEu}}(th1ۍF~u Iu6u h#XVPh% C ~ h4N#zX1ۉ@ut h4N#bX11 ItB I8u6u h#8_VPh%C ~ h4N#[1F@ut h4N#Y1ۋ It7 I8t+h# IP2 SPh#8C@u91tLu== ItE0nZu)E0>-u~u1}tE1 111ECh#]XECu\ It IPh$Y[E PÃEX?vEph^#5-A h# IZu h#  IP XSPh# zCuuiI@It VFX It IP/C Y4 It jSXZ IIpEO111Ee[^_]UWVSS]1u5 I I1E ItJ:tCIBIu IRTIJIXYuIt !Iutt e[^_]ze[^_]UVS]u Iu VSYX I<vjSbXZuƃ Ie[^]á I= Iu t8u1UWVS| I1ɉ  I!Iu@@u | Ie[^_]1҉!I= Iu‹ Itx I}W.5ISQjPSEA .t }wW.5IXe?!IuHuUS]9` It$jjjjjj` I]US\1ɉM=t Iu'=| Itx It EEIp Ip II ItjEPg [Zu EģIjEPI ZYtI@IjEP- Y[uO8EģI= Iuы Itǀ;t1 IjSXZ몍EģIWju[]yCvo1҉UUUUEPjYXjSXZ1ɉMMMMK>v 躄 DjEPj( SX5p I/Ut IEp IdUWVSh`&P8ZYj'VfH_Zu <)ș19e[^_]áI@I-t,UP> 1--Z Iu It IuIt UWVS]~;1Wu uH' ~ )Dž~E u F ~) 膃8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu"ICfKS u>I@IsyC CCIHI^uVItM Ffu9sI@I6CPRIC S)SIHIZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9-u]e[^]e[^]U5-uXZU5-u~XZUPuu EP9E u hx#quPJu< UEPu u UE Pu5- UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'V"E_Ztt~tnh#VkZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h`&V4ZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9-u]e[^_]se[^_]U5-uXZUh-Ih-?XZU8ruPh#Ph#>UWVSEqE Z9t8ug-=-=@II R 99AQ>Y9BR.ZىƊ=@IO=@I=t t @PCˉ] ue[^_]7k1e[^_]UE1@u,D#I+@#IRpp h#jh$It+$IUWVSu} ]t t9u t1141&Ft9t&!@t)[^_]UWVSS11ɋ"ItZuA=u܍PEY1"It5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#SZYSkZ9u;Sh$j'S@Y^ƅu+Shz%XZ/<'uh #sXuS)Ph# e[^]UWVS]} sSt"CtS҉XuEs1Et Wh.t$:Y_}t5uh.t$%XZ$-Jy Ry -z9 _F>=u y:Cu}thkx#FPZY-HyP!-H X J e[^_]UWVS=,$Iu($I h蔒,$IY11"ItJG} tE t8tEt.($I9P5,$Il,$I%($IXZ,$I/ YCuS1/ ZӨ@tsCcX뻍w8#It묍e[^_]USjju u1+ËPu@t s SZuۋCS D]UWVSuIt#{VWhZYtj=W7Y[XIjjVxƃ t2@u+ƒ U t!Vt s VZu FV \؍e[^_]UWVSE :rtE11ۉUh#aEYUt*}nt}ptڅu&}u Džu뾅thI8u(3u hIujSVRu1EhIPhIEPjSfMM у 1Ҁ9=uBtHt !H)u*@t$USuhd# EUu0넅u* pxtuS耦ZaSh#VRSv FEe[^_]UVSQujEPV Ë@M t IBItCUKS |uujh&V E ucCƒSu u s", ZES, X IuItr1҉Ѝe[^]UWVS$I$Isu s --s + 誗_XCƒJujvY^?StuVPF K DP҃ F u vk+ ZCFC FCFSR+ X`e[^_]UWVS111Eh#蓠Xt1vt%et1f EփxuѾ뾋E E=hIt&}t Pq* Y}t V7 XZԉ؍e[^_]UUE  E UKt h#`jpp 1UWVSUUu I@IjXU:-u0zu*5- -Ǿ-C 1s_1*jEPRUǃ UuSj=R?3ZYUtR׆VPdVjRc E81s C1C@C O u 0Eu 0E% uKOKE tGG <=uRU5VP tjRUZZYU wH#IuT#I<=u <#IH@#I1@#I{$I$I IuIt e[^_]+e[^_]US]tu s,XZ]US 1ۅuh#TNtxtIuh#ÝYu hIPhIt SPXZ]UEU )]USME )u AR)[]W|$wUWVSm1҉j EPSAEUl 8t1l8"u'EU9sShI# E9u ShZ#JR.U8@}DW@tE9tфu͋EUe[^_]g_UWVSQƉUukIe9Fu[~9uJjjY_UP薃PURߢ Hx N9 uW& XF!؍e[^_]UŠH8-u>1tfzuh jjh &1zuHh jj h&BR.uh jjh0&hk#P\ZY¸(&t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&PB_7;";f xuWS[^1WS ZYuNf$`&)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!]]肠9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$&SVZY[SVZ_ZYSVZ[^SV|ZZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PV^_xPSZY04]E9uc9u_E98PVQ^_uWxPS>ZYuD04MU9u9uE98f9]PV^_t1oxPSZYu鋅|9u;xu͋3E 3U $=~t08u9ut1u u]# 9uMƉPՃ t6R.DBu)S$I+$IPh#.$I Ug11e[^_]UWVSÉUMPF^pǃ@v!Sh#$IXZFPSh@$IE숆=$IE@$IƆ?$I@$Ie[^_]ÍL$qUWVSQ01Y1ɉ $I $I-f`~Aj%s_Zu1h"SV5 tLu $IۡC.)ƍN;EȍCẸ$I$IEȉEEpJ<\uBU1ɉaE衸-HyP-H U[븋JE<%u}%u?-Jy$ER -ZEYui Yh#V _Zƀ>*uFEEh#V Y[EEE8.u(px*u Eh#V _ZEEu uh!#EffEƋE@xWBtG,%A[A< $,&CCA<2hIEܡ$ItPi ^uC$ ǣ$IYE܋E܊@<<~8Hw0$&b~<'tz<\tv<"trflnhrdt`v\ru R.DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС$ItP6 Z1$I$ItP X1$I$I1ɺ E5$IFP £$IXLx׉2Es}t"tRSuuh$I 0RutRSuh$I Ruh$I  @$I$I Ek5$Ih$`$I1t$I1҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPuJ_XMƉUйjEV}t uWVuPhWVStWVSWVN$Ith؉EM܀"t'uEЉUmЊM#[^E@EEf}f8$I5--fBYt*fBhZ#j$I}9tǃ8뼡$IhT#$XPeY[^_]aUE E EE]@UWVS}0uho j jh`&MQÅu$Mho j jh &QÃHxu Vha#EZY`&EF{}iuLh"Sh>ZYu EZh#SM>ZY`&EPh#W藅EF$x}lu!h#S>ZY`&ugEF }oh"S=ZYu EFh#S=ZY`&u EPh#WEF( tPM:uUPS=ZYUu݋BwUEPh#Wτ UBML:PSh#jL`&떍e[^_]UE@K@M@PPD߃CPD`8@,]UEH8P$w0ƀu@u߸=$ݸE$w. sƀuD$߸K$w, r sL$R$tw, s rQ$X$Pw. s sY$_$,w0u s`$߸i$w2tu߸h$ݸp$w2ut߸q$ݸy$w/uu߸x$ݸ$wu%u$จ$ u$]w`$wtt)$u$%wܸ$w6ut߸$ݸ$wu@1$u۸$كt$wt8 $t $$wu u$uwg$wt $u$B%=t"w uv$=u$ z$~$$ s$ w us#0$u $$w׸$w,rs$$w, rr$$dw,r r$$@w,rr$$wr|r$$ r$uSn$&`&;t3C7P3hu$jd,Vu 111ɾ`&$tVF8 ($h~$j ,(PFPh~$j E(P A u,PUEPLYX1Ƀ Qt,P0EP'XZe[^_]UV;Ph$hK.JjU塸$I$=$Iu53#PRPh$hK.jUWVSQÉb<10;#uCj EPSE< 8t Sh$j<E8tWSh$j<e[^_]USÊt%<#u53#SKZt@$I]UE E EE] -UWVSÉU}utj VS, @t 9E s ;8"u"3O;t):EttR.fDB@fO1e[^_]UWSPh$UZu$II.j URPà u ;8"u h$j;1ҍe[_]UWSPh$=UZu(II.j URPTà u:8"u h$jp;1ҍe[_]USÃ=IIt =IIt?II9t6t2 Z#uh $ Z#=uh $QRh0$ II1IIII]UVSƻ &t[PVn+ZYuICƒ II$IIC(IIC$IC 1f‰IIte[^]% VhL$jM:e[^]UVSÉ֋t8uVhe$MjUR1YZtVh}$9IIXZ1EEe[^]UWVS11Dž=0II~ Vh$XZ1 RPhSK =t=0IIVh$wT f}Ut=0IIVh$z[^1ۋhJ.h$46Ea6WhZ$hJ.vWhb$hJ.sF (twu1h-&SY_ujh-$&VR< &t"VP_Zu&fdII&uhP11҉zY[th}$vVh $ fdIIhh$SF_Z1ɉ>ÉhJ"V_Zu hU"VZYu6hZ"VY_u Vh $ eIIh $S~_ZDžum>jP11҉(Y[th $XZ IIG}Ɖ듍Wh& $S_b HuEt9$Is(h5 $B$IfIIY[fIIuƅhf %S^ZujhhIIhR%SjZYujhxII hR $S?Y^uAjW11҉_ZIIPhs $SY^u.jW11҉_ZIIh $SY^u.jW11҉t_ZLIIh $SoY^u.jW11҉5_Z IIh"S0Y^u.jW11҉_ZIITh $SZYth $SY^u.jW11҉_Z~IIh $SY^u2hW11҉d_Z<fIIh"S^Y^u2hW11҉!_ZfII~h $SY^u2hW11҉_ZfII;h $SY^u.hW11҉_ZuwfIIh $SY^u*jW11҉__Zu;IIh $S^ZYu9jW11҉$Y_tVSh_ $uIIwPw{tSh $ F;$IrSh $O~!jSh2 $(‰CIIIf‹IIIIh#V\_ZƉ>uhe$萻Y[ &;twWZt ucPVW艑 uT- &ËJIWYƀ>th#V_ZƉ>1&tR.DPt7hP11҉,ZYt$h}$詺[_ Dž"!y v5VhS $ph $f1ɉƇpIIpII$ &IIIIIIIIWII16C-fCIIIIIIIIte@IIt>16C‹IIIIh`IIZe[^_]UWVSP1۾ &< &tCtg1}jSEPr th $莸Y1@E hG jSP1E4FZ9uuGXe[^_]UEU M= -tMU E]F!]USÃ=DII= IIu1҉Dt%Ph`IIXZz u= IIt =HIItz ux=8IIu=,IIu7jh`IIhedAS/ tHh`IIhrdAS u/h $j!h`IIhedAP y h $j!]USQ`IIWEVIIWEVfIIh`II:fIIX=DII=HIIu2h`IIhfdS y8t8t $rE=HIIu2EPhmdS? y h $2Z$-h _X=HIIt1&h`IIhgdS y, $W]UWVEu `IIt `IIe^_]UhIIhmd5$- UEU 19s f3P]UERPZYUS]EPu -h`J.hSƒt$t< tj SdZYt1]US@-tsPh^$X B `E Ee$]5U"=JIu"Ph$P: Hu9Y[u uVh!$YI][<1M9Y<}Ph0$荿Y[1jPh} t5$IuhJ.=JI~E1]9^~ t)t;FtF5$IWuhJ.+FGVhH$ܾXZe[^_]USBHBy;B| X RQXZ]UWVSQ]u uh"SF fw4`&h"Ph&"S FPjh0"SFPjh<"S Sh_%&XXZFXt ShI"EY_FXt ShT"2XZFXt ShY"Y_Sj hv(hb"Stv,ht"Sf v0h"SUv8h"SGv4h"S9$vu8t/j} tu Sh$ ShZ&u_X뿃} tu /Ph$W 벍/PhZ&A[^띋$t $PDYP7Z}t E1_jPS膹 y h#X7ƒu*t=tRk$u hS#ؙ e[^_]UEPIE PI]áPIáPIUE PuhK.v-hK.j 8jUWVS]8ށu=PIt5PIhh #~YX=LIt"=PIu5PIh$Z1LIXZuu ZYyWoPhm$/ t7=PIt.j 9X=PItP5PIh,$j!e[^_]UE Puj' UE Puj UE Puh UE Pujj輦UWVSt1ۉPIPh۳%m^_y h\$YKhVu }t Ƅ1ۍPWhmYZyWhk$NXZ]%=`uz 9u;uPIWhhLI à uWh{$뜍xPSl^_yS끋%= Sh$e= u0t,WhVI à t ߻Wh$+W3Y#0hV蓎 à uhLIh$BXZ멉؍e[^_]UEP3/ZtPRPh$ u uh$hh LIi LIULItjXj AUSj0h&j LIjja]USNjjjsjjj.]UWVSÉ֋x CPww wwփt=PI~j XPIe[^_]UWVS1=PIPIPI1PIPIPI1 Džou/h$h$P[^Dž SUYu Åu@3hV躌 ǃ uVh$XZPXEtVh$ Eu {u{wu"Wh $hK.^ DžQCC jhPjV Ãt'$Phzd@S @uSt [WYD R.9rDYt)PHPIt4KRWQ u <tPȉjS W踓 C1ɉK C C1{;PICPIPIXZ{ t%VwYZuVh2$PXZ?j VF G8 G * GG1CG8{Dž*Ed@DžTPIEuPI} u:E 5j YtshN$趪s _Xtvh%蠪6M 9~=PI 1ۋ9}IU: tE 9}?C9Ft16uPhW$XZPvZy5PIы1Ҩuԉ ^ EtPs sshf$ҩȃƒt.t&Ps ssh$hK.(Dž StPVS t"1PICPI ssS 1ɉNPIHPI~ X PI9;PIPI?uǃ tuU E 9|qPI]#:tf$h$Ph$hK.PIt`4N#;tg#Ps ssh$hK.蹫ͅjsVsUE u ( )9 _ TU e[^_]UWVS]fU ffCffBCffBfCffBs s}Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss|Y^} GWss|Y^GWs$s |Y^G W$CDȉGDs,s(h|Y^G(W,C@ȉG@s4s0M|YYG0W4CHȉGHsf}3EE܋Eؙ}E)9EE у}uUuG=xSI=8SI }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AERI1}fG18f@@XZtA 15HSIRIC,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=RI9E9UʋMou{5RIC,)֋C,C,)s$S(;h1$SNjCSMEAE@ufFZ[tA 1HSIEe[^_]UWVSu^8C@Pvu uu uhPu uPSI )P@1ɉ5SINP t1҉ 91CtCS OtNCSWVwy +QCSLCS >WV)y +CS yP @1t|u!<|uxuxx u xv8|^u |txSI=PSIXT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp RISIH0|Ãx} RIx5RIf-sSIB0C9sjh-V{5RI C =PSIt@Y @[ JPdh t19}#8@#BLlp>Ãxjh-p?{Phg$j=XSIt h{$Yh$OZtWC jjSI@0 RPJ P^_DSI@0Ɖ =PSItL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|21HSI ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jjSI@4 RPjjWVv f-RIHɉf- f-f-f-f-E-=`SItE-]E]C WV XZ=PSIt CpSt C(T1ҋ SII4 xtWV`([^11tjupEx RIf-UJ SI@4B9s$Ujh-QMwM RI UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_#f@tԊ#Ph$$\=XSIt+=PSItC CC C u#h$|Yh$ڰZu1HSI1nu t3f@^_PIPIjj ¡,-ƅDžb Dž1 PSIX[tBBp tBBtPR^_tPIPIh$Ӄ[=XSIt/5(-jjjjPIPIuh$蘯Yu5,-RPjjtSI=XSItoh$b5PI=PIut(jjX@[ZHfAWV$1PIPIXZ=XSItj Z_PIPIut!jjRP!PIPIuu h$RPof%[^f=@h$sh%$臮ZY5PI=PI5(-jjjjPIPIutRP5,-jjEhjj5PI5PIYƅDž WV}@@PP WVaf@5PI5PI5PI5PI6^_8th0$x1ɉ HSI[SISItCjj RPm u{C9s#Qjj RPi N0ӍS19r)#u 5PI5PIiu"hQ$蠀h4N#I1HSIXZ$fH^_f@t !5PI5PIhQ#fu8!t%hQ#5PI5PI5PI5PI#@Z[@fAs5PI5PIgf@5PI5PIhy$$u th$趁 =XSIj XeY[^_]aUWVS}u w wN@fEEZY9uc0SIt=XSIt =\SItj jjjw wu0SIjh$W[ w wNYXG PI9O u,-;PItOf%Ԋ#f=@u#Rh$d~w wE)Puh$莀=XSIus=\SItRyNj h$~XZ=XSIt2h$褉_=XSItfE)fCe[^_]q h$ݩZHt1ɉ HSIx밍e[^_]UWSáSIp8ѻSYu1ۅt$ SIq0RPkáSIH01{ ؍e[_]Ƀ=$SItf‰Ã=$SItÃ=$SItUWRPUY_}UWVS,u} }SISI9]KM])9ȉЋUSIH8UUE9|"A!!EUM]9]}=|SItuI!QWVh$~SIMȉẺMuuWVm EMEЉUԉE؉U܁\TtCЋU!CEUԉE؉U܋CEU܉EUEUEUE9ƉUCEU܋]9؉Ћ]ظ=|SItduuWVh*$} SIEƉ׃\TtAЋ]!A׋ARPuuhB$}ZEȋUEUԋ]9؉Ћ]ظ};=|SItuuWVhb$M}SIuuh{$2}$럍e[^_]ÍL$qUWVSQ8QEU}9Es9=SISIEsuuh$y(QI,QISIsx1u؉}܉Ɖ׃uЉ}ԋ}9}Ћ}}sEU9E}(\1ҍMQRPuub EЉUԋEUEUċ}ϋUEȉUḾTt'$DG=|SIt1ShR'$ZJ!PG(P8=PSIt 1GG1GhX5SI(PSIxgș9rT=SIt;9ظs1ttht)t 9sw Dž1H~A^tڋNtftH붋 5PSI 9ظC tIDp Dtt=|SIu0D(PShy'$?Hd|(븋DpTtuRPSh'$ H/ SI119ЋAt 6 C띋RPh'$ZG t uC~3|X=|SIJuDXVPh'$G[^+W-pYRIRIG fFf[j *JZu01ɉ HSIh'$MDh&$ap[^u-ju~j<XpSISIf@u;u tWRI  F=PSI=lSItzGf@t`@ GpfGGGtfGXZ Gf@u1UIUIUIUIFV PSItGGp}FDtGGtcFHtGXGdI F@VWR[^=PSI=LSIt =dSIG\u&G`WduuGhWlutlh($Bh0($1nu 1ɉ HSI&'1G\G`GdGhGlaf!qXZ=LSIu]SIP4 @0ȋ^4É΋X0p4=PSIGW SIW\t@@I0D115SIuFu=G\#8t-@DNL!!ڋNT tF8F D`Tdu#u@DžVCSSS[tGh19u9VSRPhX($:@=XSIt h($KYh.$lZ Ë@0V4^_=PSIt sCSZChVx@jjp4p0pHpDӁ h($_?h!$jkH6aZY=PSIt `QI@ `RI #he[^_]UWVSĀSIE1E SIE;A,}EEU}\TtAЋ}!AEUAEUEU11}tAu}׋E9ƉU}4Ѓ1SIE>HLY4DEUE9ƉU}4Ѓ1SI뾍U1EӜ 1RIRIRIRIESI];X,W}}1Euu SIU׉e^_\Ttq֋}!qSI SQh TITo5tFPh*$s4Y_)$Pn`ZFfSPV % wh)$>`_tr<Fo)efFYPVW$GfSPV$E@0P4p pihfH DžU;B0B4wr r@Y[=`SIƅhhQ#PY `SI $SIufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFhQ#PwZYucA1A =`SI ~hC*$Ep pFhA,$^H1HSIEHX P@uuȉh[*$SQRPVFD9)$>tFPhh*$y1_X)$P][tguE@0P4=|SIt h*$<YP1҉P FfPh)$#]_u@@ uE@0P4=|SIt h*$s<[H1ɉH F>ufWVc! C+fFPVS@!fWV&!uDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uh*$ ~ .u)h*$Ep p֝1>hA,$[EH0P4 19SISIs h*$=`SItuHu<~t6h*$1RPEp p蔜=$SIuHt%~u븉FhA,$&[[H1f1RPcXY,t#B<v^uM;A0A4o h[+$1RPEp pЛh*$ZW1ɉ HSI?M;A0A4t!=XSI=\SI)$)$R1RPEp pPh*$ZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0Ph*$Ph+$-=XSIt h+$8Xh*$XYU;B0B4}R AAQ=`SItTVC9tHh%+$1RPEp p™CFhA,$~XHt 1҉HSI DžfKPRh4+$>+u Dž 1 e[^_]UWVS\jj`_ZP$&hP+$+h'$W[^u 1ɉ HSI}hjjjj8h+$+h%$W_Zt5jjhjjjjآu hg+$X*1ۉHSIh&$SW^urjhej#h+$+h%$,WZYuhA,$W_>jj%[^@%@3fs Ph+$)=`SItjjY_fXZh j5SI5SI91ƅDžb 5SISI9T=RItD+SI=SIk#)WSPh+$hK./1RIC$w0h+$ss RIA 1C$hA,$ RIQC SRPRPhW^ RIC$1҃=\SItQRPWh ?$h,$a)QRPWh ?$h,$b)=XSIt h$4_ RIC$D1C$=XSIt/ss CNjC$1~YY=PSIu$GW 萷h$TZHt1HSIGWڍ@1=PSI@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=SIuSI_5SI1ɉ SI9s؋{$@1=PSI@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =|SIth+,$SQRPOhQ#vvvv 蜓fOWhE,$SQRPhA,$Pu 1HSI,v vOYf@fOFVFV RPhQ#vv 訒SISI49s$;ww Y1҉WWY_8u؋=SI9s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=$SItUWVSXSISIDSI9=RItA=SI))Kkd"VWSPh_,$hK.h)1ۉRIss WZY{u { <{u{t t&5XSItC=0SIt8=\SIt/u*CS 9RPWf@1C SCSut+RPWW¡RIY_:u9|Css菰FXZ95RI|)js s賜Y=h,$E"h$YN /ss^1ƅs{Dž  PSI^_tBBptBBtVRPZYu h,$x!_Pss觛tQDžՄ ssvVPtUf@Y[5PI5PIUfHXZ4e[^_]UWVS EP@EUSIESIRVuu EEƉׁ\TtCЋU!CQC RPh TIR5DhB/$P7_Zts󥋅ƀƀh 5SI5TIm5SI5TI<=$SItTIPP`Y[5TI*TIZ1HSIe[^_]UVS1;] s8Sh'%&^X1E0Ph#0$sFZYuj XÍe[^]áSI!UVS1ۡSIsrؔu <=XSIt40-hW0$YX"?0$u(0$P.Zty=XSIuɡSIt4肣SI1ɉ Lh P5TI5SI5TI;=$SItTIPPh_XZ5TITIX15HSIC SI=XSIt ho0$y [h0$-Yti=XSIuۡSI h P5TIe5SI5TI:=$SItTIPP^XZ5TI"TIX1HSIj-Wj$WYXuj\Zuj\Xe[^]UEYIE YI]áYIáYIUE PuhK.~hK.j jVUWVS]T8ށu=YIt5YIhh #YX=@UIt"=YIu5YIh$1@UIXZuu .: ZYyWPhm$ t7=YIt.j X=YItRP5YIh,$mje[^_]UE Puj' UE Puj UE Puh UE Pujj1UWVSt1ۉYIPh۳%(^_y h\$YKhVuq }t Ƅ1ۍPWݾYZyWhk$NXZ]%=`uz 9u;uYIWhhUIyà uWh{$뜍xPS`^_yS끋%= Sh$e= u0t,WhVà t ߻Wh$+W9Y#0hVà uhUIh$BXZ멉؍e[^_]UEP言ZtPRPh$ u uh$hh`UI`UIUDUItjXj OUSPj0h&j HUIjjNP]USPj[jjMjjMP]Åt3USӃ=XSIt+Phh #yYXSh0$XZ]Áu=T=Tu =Tt=Tt=8 u<,SI=tu 1ɉ $SI1҉SI SI(SI1l$SI==T=Tu = 8uB=,SIt $SI1$SISI SI(SI듃UELSI hSIt,\Tu ǀ\8 Tu ǀ\ 8=dSIt,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC[^5TITITIY SI8<qH։9u9RPh7$SIBHЉ8< =XSIuhA,$ ZHuqh6$tX=XSIth 5SI5TI{5SI5TI=$SItTIPP=_X5TI8TITI^ SI@DqL։9u9RPh7$>SIBLЉ@D =XSIuhA,$ [Huqh6$Y=XSIth 5SI5TI5SI5TI$=$SItTIPPhSP5SI5$\Iu< =XSIt h6$蓻^hA,$[u 1ɉ HSI1!EPT@P}̉WE1҉PPPTeY[^_]aÃ=$SItUWRP Y_}UWVS$EԉUMQƉ׋EESIH0ș9Ή} EE9EPWVuSSIJ09u EÃxth6>$XșRQWV CuWVPuU tUB EPE܉UM9ME9u9t)MЋE@ E܋UM9Mt7}t1a+E9Et }tE`M؃PESTCPƉE9Eu1E`e[^_]UWVS,E @XEȍ]ܹ1juȋEpG ޅtPEp[_E P@"EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hM>$n,=XSIt h6$YhA,$SZu 1HSI1)V] CSFV rC8S<e[^_]UWVSPhjjIƉRP 2ÃfCd;EPjjSPSI;B0u UztWVM_X5$SIu  SIQrRP E@ `SIM ȐȔh P5TI$5SI5TI[^=$SItTIPP] ZY5TIЯTIXe[^_]UWVSE XChSlDEU}}E=PSItP@P @ Ɖu5REXuh>$耫1҉HSIYX5$SISI@0RPWVqSx E@ `ChSlEU}u}u h>$2SI@09EUs } }AEPuuuN¡SI@09u u~th>$XRPuu? FEPT@PChSls}EbUBXEU}GWEU G8W<5SI#uTGPWTEUTE@ U B 9t`1e[^_]UWVS<]uE@%E0$E53#E0$5SIf SIEԋސޔuRPAESIؔؐY^uNw9$d&1RPuh>$jRPuh?$V1MQRPh6?$%j謡RPP.f%^Zf=t-SIڔڐuPhf?$EPjjQL5SI;F0u Ext%{rt4I5SI1DXZ@F^=$SIu^F9t'ޔސuh?$iE`'P9uъSI8PufHEf9ue=XSIt h!$Yh!$Zu 1HSItSIؔؐH^_5SI1ɉސޔ{rޔuL<uFuh?$豧XZ=XSIt h$9^h$YuS5SIpXZSIt4,EEPjju!KSIZ09u Extuh?$j蟟@EE=PSItP@P @}ԍ @E\It$uWVuuuuuuhA$N(EH,ESsS{0thA$hD&h h@$9r QMd‰C01׋MFC4Ex8p<@0EE@4EKE1}uY9uG}uS,EPMEZC,E=NBAW?=OBAWt=MBAWCEMEEEE};x|EEċE}ċD8ME1}̉}ЋEUEU}9}E}ċT8D8 uuRPQ EUЉƉ׉‰t,;x u;pthB$h &h u}px6jpx UMPH#s4S0 ^tAPC8MUEU.EKEEE};x]EE̋KE}̋D8E119u~wEM̋TD uuRPI щ‰t7S8h@$h &h JS8tHJHPJXENEUKLM̋My t*{DsH1{LKPtE؉UQ1ɉKP^E؋U܉Cu6G뭉EuYEe[^_]UWVS}]O,uhCA$h&h` ؙt,hfB$h&ha h@$U Msu)u؍e[^_]UWVS}]O,uhCA$h|&hq ؙt7hfB$h|&hs h@$tUMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}\It58SIWVSh|B$BSWVu58SI01e[^_]UWVS] u}\It5G$}t th[G$~t $1z RSf_Z@uhwG$Z}t1ɉMUt $1~ VS5_Z@uhG$)}tϋEx $1uS Y^@uhG$SXZEe[^_]Ujh`'PB UWVSPUu }]t uUkPhh #hK._ UtRhh #hK.E WVhK.N t]E !#EK.e[^_]E K.E e[^_]ne[^_]USU] Ӄ9tBJ13@&[]UWVS E 1҉U9Et]Uf~jjhH$SjujjjjjS iytWVhI$S~WVh5I$SjujjjWVSE ,EEEEEPHME@ uWVh+I$S`~0E1ɉM܉EuuuuRERhGI$S EԋMQуt;t6juj1RPEURPS uiMPBtruiu`thJ$}u}uhJ$SY^,(So @u,(hK$S EjjEP11ɉ6 @SjjjS1;t-jSRYZtW@ P$@ utS9sKjRP jWVS@u/tPk ZSX1 $ ؍e[^_]USQ]tdҀBuCu'EPhd@ @u%h3K$SXZuShRK$S E]j ]US]jSZYZuhK$jS? YZuhK$SXZ11;VF|~$u~,u;VV | F_8tZu[tuxY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ||t2@|jmURj$O8QpUR|PtijWRs, uYjuWUu@uuZYjuPUu@v0shL$u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0hL$S? 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uhL$SZY<$E܉E1EuuWVY utuWVhL$SLEPuuuugW Ɖ׋EUutuuuhM$뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^h %5 Or _X1td1SщU&M׮YZMt/UBuShNM$u h %jbr XZ뫋&&  Vۉe[^_]US1&&uhjM$l`u܋]UWVS ]} Wh]#S 1&&EԉU#E#Uut7]#;tg#WPS>W&S1EԋU!E!U`u}u}t;uuhxM$juV j]#;tg#WPSWVS؍e[^_]UWVS]u tEU E UuuhM$SY[ SZu E@P9sPVhM$SۍFEPS Y_EtVhM$SV 뭋EU҉EU#G0#W4 E UG0W4SZ@tuSZYEU#A0#Q4 E UA0Q4S_@NVhM$S Ee[^_]UVSP]u >u>j EP5 OIU ߃ Ku;=?v5 OhM$S A BEziuUŠu 5 OhR"뱍e[^]USQ] ;uXm1҉j EP5 OH U:u1҅u.@8u 65 OhR"u Ћ]UEUitstau+u P uPeZYUD@RhM$P2 UE t*u 5 O?ZYt5 Oh%N$u@ US] ;u#5 O,Y1҅uh@N$uXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~hRN$PdY[E1eRP $RPP[Z/@8Zu%S5 O>ZYQhdN$P ֋]UWVSu }jj h]#WVj]SU^ yEWVuh}N$?g}t Shm$+gZYj CfXe[^_]UWVSQ]M tu E"E𿭴"QhN$S'M $j.nXZM uWhN$S 9jVQjjuuSU 1ɅuWhN$SV8r‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_ZthN$6jSY^ujjjjSTEU}u&}u h O$SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt h%O$PP @9E}}EUuu hCO$'EUjjjS@ $uJlY_u h]O$jPjuujjS8 uVmphO$SU p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PSg<_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS <ZY@UB߃}uujSr@jp juuuuS u hO$b @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9C.tE @&1҉Ue[^]Q,(hP$&$hP$b$1RP,(P RPhP$ hP$kjS\ uh Q$kXrX CRPh#Q$&bs,s(hAQ$s4s0hUQ$$C8Ph܍#hxV7VhhQ$asPhzQ$a 1e[^]UU E$E8E U]UWVSQEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^ht tN-}uA1h 1hM RXYS}uMQheV$S jHJ8QRUP0(Ur 1B$E1r(z,ꀃEE}S_@tPS^@tFUȁ¾1uuuRuSz@uhV$SZY1EEe[^_]UWVSSÉЋt""""Ujq Pq qu uSU uWhV$S &PSZY@uWhV$VWhV$S|1e[^_]UWVSÉu uRP@ }}t}ME"E쭴" UMEE䭴"E"@ Ur $Ep PFVEPF V$EPFHVL1Fv VFE0S@uuhW$S uuh#W$Sb1e[^_]UWVS]} tE &1ue[^_],SEUjS thCW$SjSrjSd jSVjSH u uhZW$SY[z uhW$݅t)I }9y$uu9q twPhW$S 븅t*t u5Xu}+rz WV tjj _Z@ultjSY^+uu tjjr_Z@u)jjjjSuu hF$jjjS4ƃu hG$1fdžUjuu썆PjVjjjjjSC0PSY^@uhG$ShW$S0XZ1e[^_]UWVS4u ] 1Et#h'X$uVS{ tPSu @u95C.th&jZYjh Suee[^_]UWV`'}^_]UWVSH]u }1ɉM܉MMMMMMEhmX$WVz Eԃ @t=}buEPS^XZ׃}qtuԍEPEPEPSv@uE95C.th&jE1;EE}1SuMu_t xuPt9pu 9uU@uuuuuSsẺUЃ}u }E܋UEĉUȋE؉ES|ZEHEPSEjh`'PuuhM$S\ g$1RPuu7 EUSXt E;AtIhwX$S_Xqy 1U9ЋU}`9u\9uuW}u}t,1U9ЋU}=MuuWV5 ҋMu#u}t 1uhX$SY[uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,S'Z@tJup(x,S:@t$uűMq1uhX$S>Eԍe[^_]UWVSH]u }(,EUEh%Y$WVw t(qtsu&jsEPjjS@uzE95C.th&jG_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuh)Y$S Z$1RP,(5 Ɖ׃uԉ}؋M9ȉЋU}WVuuh@Y$SjSEY^tPE܉U}u}t h|Y$Eċ@ EjS_Zu hK$pjSY^u hY$Rx G EG$EjSg jSY tu hY$SXZE9Eu"E9Eu}u hY$S_X1E̋p GPGTEE܉EME9s3Mjh`'V MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuhY$EԋU+EU9E| hZ$.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u hLZ$SZY^ U܋MHE܋U+EUЉQ}u hhZ$SXZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uhZ$S @ r $󤋃p PF V$1~PF0V4j\V\FSv H PAQPA Q$PƉ׃q0y4AHQLS4@Eu}UԋEhZ$S[^MffuSZY@hZ$Íe[^_]UWVS]1uuuuu11hZ$uu r btENtoat%itClh-&UY1EPS&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9C.uEU t th&jHZYWVRPuSwe[^_]UWVSDE։ϋ$]$ẺUMЃ}u}tE uan"]t2[$WVPuu ?;E] er#E =[$t6[$WVRPA1E%EtEE@u}wERj h]#uuPu 7 z*E }\8En"EtE2[$ű}ED[$EBE@EtjhWV(  %1ҋMIM˄t u tfRPuj MQ>ƒEE 9shEčDU)ÍMQS'EʋUXY}u ED }tjhWV) Ɖ Euu EʈE}t"EˈE}t t ű}؍e[^_]UWVSXE׉M]u E]u t4jj h]#EƉRPj]S6 y&E j@URPUME[ƒ u묉ډUuuuhL[$>U:t Rhm$>ZYj =Xe[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.PQDXZfx8tNUVStjmuVj$8PhU[$jNjVEPZ$t SjMXZEe[^]1UWVS΋UM x$&Ek[$u 1ۃt hr[$=XhF$=Xuh 󫋆Rh[$@=X&8Vh܍#htV=Vh|[$ =Ãh[$E[$e[^_]<E[$~u1ۃ>t hr[$<Xh[$<؉F VX1ɉ9u 9Auh[$P<h[$;<_t6f~8t/sDžuQzjmWj$8VҸ6tt tVh܍#Vh[$hWWh}[$;ÍtY^99WVGChF$;Zumudha[$d;E E[$e[^_]L;X=߸a[$u PPh%;à ]#ى؍e[^_]UWVSljӉrh[$:s3h\$:s sh \$: tsh\$:XZ{thh&\$:K Cs31| C "C 8Ph܍#hSsSh\$A:FPh܍#htWFWh\$:Vh$hS$(Vh܍#hWWh\$9WS3| t Sh\$9YXVh[$hSWS|t Sh0\$9XZF0V4ut!RPhPPh?\$k9ÅtPh]$P9SE e[^_]UWVSxƉ|PE_|t 9St[RhO\$V趸 T{ sډ5Rhg\$8$1Vs3щ¸~\$A$1Vs sщ¸P$(Wh$hV Wh܍#htSz SVzZYuhh-$&V SVh\$$8GPh܍#hS7 Sh\$8$jmSj$G8PŴSh]$7h]$7G0W4uu h\$AXRPhPP@1e[^_]UWVSxpPYps'2N xR vh%x h\$(7h/J$x h\$ 7h\$X@x \ tDžl=[$pt Džl6[$p@hhh lv6x l6v vx lc6 Fp `Ph\$'6N Fv61 f~ Wh$hS Wh܍#htR tRS&xuhh-$&So Ph]#th\$5~tu-h\Ih܍#hS Sh]#th\$Z5*Sh]#th\$B5GPh܍#hSU Sh]#th\$5h]#th\$4ƅhj h]#FN x$$RPjS+ (x Sh.t$4XZd]#tW-&FN x$$ʹ]#dty$SRPQh\$T4`t;FV hQpщ‹x t Ph\$4[X ^jmSj$G8PưSh]#th\$3 h]#th]$3G0W4 uuh\$<YhRPhPP<Ghb5#u3ËN Fv61Xd `FV hQpQщ‹xǃ ted؉W`sZƒs\I\L 9sHt)))к WRh]#Ph!]$2 Ftw]F 8P%V 1󫋂Sh܍#hSxSh]#th\$;2 ve[^_]UWVSX1ɉMMM \I11h,]$uu a ǃ x`HttWtA}ˠ뼍Ol$'뤃럍EPu EPuE_Z@u7skc [`SKh\IuZY4hp'jɿY_! F=\Ih_#aZufJ.ft)$URjh jjj jPJ }uEPhht@Wa u E\Iu<ttu$\IP"\Ix\I \I@s tE 9C.thp'jپZYju8^_uEu h=]$j9Y؃tڋEn;EE}3uMuZt xuPt9pu 9uU@܋EEtى‹EniE ǃ>v> ÀtGu_1tq EVj@MQuщ‹E t PoY9sNjFV j@MQuщ‹Ex tP\oZ9EsEv뎉}E?v? E?vE?%EuFs}sEh%Wh\$.h/J$uh\$.h\$7uY}vv vv6hg]$=.N Fv6" yv뼋VOQMQSщ‹Ej tPWh\$- FV MAQMQSщ‹E8 tPuh\$-  FtLPhs]$-XZ N Fv6^ vXZ7 hd5#D-Y1e[^_]UWVSD] }1`'}E]$uh]$uu \ tfitJTt,Lte[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh^$W 4 uEyƒtv$j] juVENj] t>sVMZYu+C xu"t s srEYXj ! Zu{%Xe[^_]UWV։P Zt hOf$je\ jwMQE 0Xe^_]UWVSuE @80ƅ77Ph3#V^< t 7u][HVH ,Z3V _t h}f$0x jWh( Ttg81ƅ9(@󥍅8Phf$jPS0Phf$jPuV͌ VShf$j<[ S[t h>v$jP[ T˅tdS zuW$(,sKZY(u1$zu%B v$jU juV>Nj] t>sV5FZYu+C xu"t s s>YXj Zu$Xe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u hl'hRe$u+^uhl'hAf$jT sP3ds Wsdh %u t.Pv Eh$u E tZuT EYLEPh#u4 }Chs@Pu2 @qhg$u荫 XZt V Yhg$uo XZt Qɹ XMEPh#u4 E Mu {hE EEEM؍CU`EPu u @Muhl'hg$fEftft5fu6t2C t Whg$j3S }tC(Uhg$C0ut3hh$jS t C0sHtS4KL9sщ}t:s@shuw1 us@s`ub1 @u;4R81t/sl`}t$CU[s@s`u,1 @uEsd6CptSuZY@u s\h/h$s8sXu0 @u s\h$te[^_]UWVSPu臧 Zu1du 訨 _tLV Yt4W EWu ש tPMQS uS [1V ZtSW X؍e[^_]UPEPh$u> ƒ 1tEUWVSu\Phg$V6 t\Mfnj4Zu\VXtd$1jRVnVhiS/@tt}f1RPhg$u = 1e[^_]US]uu S? @t ]]1]UWVSu u [^u OPA Y9EsO?VK Ƌ}M)1Ze[^_]UWVSu u赧 [^u OPڵ Y;EreO?V Ƌ}M)1Ze[^_]UEPh+#u2 ƒ EuOUWVS8uEPh6h$V2 uh%h'hh?h$Hhh$V _ZtPB ƹ}[E]ShiV4}ĉjS] Phh$u G ƃ S Yt:EUu؅y1ӉM]! EjEP XZuVhh$u V He[^_]UWVS1Rhiu54 @t|j7RPhh$hSހ>tVhh$V<t j7RPhh$hS;tShh$QS<\ e[^_]UWVS]hh$SH Y^tVPz Zthh$h'jVh?h$FV耳 ƍUܹRhiS<3@u hi$jM e[^_]UWh%1󫍅hPhiR2 t|}UWVS\Ph6i$u/ uh%hD'h0h=i$EdShiu2 tT\`ty1׉\`! ftShiu>2 @؍e[^_]UVSuV|ZtÍEPh$V8/ uh%h'hh=i$0EuS#1^Xu hi$j$L CPS) ZYu h'hi$Phg$u  uh'hi$jK S1e[^]UVSSu] EPSV @uh\'hg$jK hi$V ZYuh!&h\'hh=i$fDg$Eu$PRSl He[^]UVSSu] EPSV @uh'hg$j&K Eu hg$jJ hg$Vg ZYuh!&h'hh=i$CPhg$S He[^]UWVS}hq$W [^uIP8 pY@vhi$V%Zu hi$jqJ VPhq$W@u hi$j'J xtdPhiW/ thj$뮉`SX`e[^_]UWVS}hLo$WR ZYuIrPv pVpYXuh!j$DVShLo$WK@u h6j$jvI 1҉Uu]EPhiW#/ @u hOj$juI SoX1e[^_]USÉЉʅu ]#t#QuRPSh\j$o]UWVSu1j+Vhxi P'@uhhj$ UЉUPXۋUu hj$jH U]Vhxi WA' @uhj$ڋE9E~E19u~tj YWh$FXZj SojUVSPuVZt"ÍEPu V @u Shj$j2H @PUWVS$ƉUЉhbn$P^ [ZtP躭 ƹY1@]Shvi Vs-j S٫ Phbn$uß Ã Vy HZe[^_]UWVS(uEPhj$VZ* uh%hP'hfh=i$R@MԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EP" XZtVhbn$u  V He[^_]UVSuV[th %V ZYuh!&hl'hh=i$?P] ^fx PSr+ZYu hi$juF PoX1e[^]US]EPhj$S#) u vE&juS-,ƒ 1Buh4'h$`XZ]Uhj$1US]dPh%S( uh%h'hh=i$>d|lPhiS8+ @u hk$o`X1]US]dPh%S<( uh%h'hh=i$4>d|lPhiS* @u h$k$_X1]U1EEpPhiu* t hj$jD 1Uhi$u! ZYuh!&h'hh=i$=Phg$u 補 HɃ0 v+BwBÍBwBUC]UWU1ERhiu) @u hOj$jD 1}W|$wUWSÉЄtGjj h]#QPj]S S % z]#t#PSh/k$ h/#¸g#@Xe[_]g_UWVS\Aޗ uh$'hGk$jqC jLh-_Z]#t;k$jmh-ZY¸Ak$u]#WPShbk$hK.=h-t VW?Xjmh-VZY¸Ak$u]#SSSSSPSh l$hK.$V j2UEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-IYZt A=CЃ v؃߃Av @h-J0Z>u@ -1]UE1҃t ]I]UUp-t H9t@]UWVS41ۉ]܉]E䀖bIEԅƉbIEPj͗ZY@u hm$EU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=bI}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EP/[@u h>v$jz@ }‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEPh Y[=bItSZusuj1EPjrZY@UEM9u]9uE9E-9ŰMh 2#jM? UWVSÉHP]ZtP_D 1D1V!LY@u hx'hRe$&RPHSƃ uhx'hm$j> R1RPhm$hWWVh*n$ jVWWhiL)@u Wh7n$vYt PhHn$XZjVWWh~iL@tt PhSn$xY_j pHZ@uhx'h[n$uu =`-j:RPhin$hW,?tWhn$WS,| j:hin$hW?tWho$W ,| tHSW?YXjVWDž@WhiLuho$GXZjS9#jVTW+Džd1hlWhiLQ @t|h\Xu h"o$l@1dWhiL  @@u hv$jX9 u1EVtRUW)ZYU}tRUu)ZYURh$S]& tFE=bItFtj=bItFu[=bItFtL=bIuE=a]Iu+!Hu)}tj XhJ.v9ZY U6"=a]Itj XS) u! u jUWVS,ÉUPb^uhEf$@hr$Su ZYucU̹ Rh8i(S @u$78t hr$j7 jhr$uH uh'hr$j7 EܣbIbIu Vhr$jm7 e[^_]UVS։P膽VSPhs$jG7 UWVS]U hs$S诎 ^_uh%h'h2h's$!0‹bIށ؃E u %ERU蠜 NjUR轜 WPըtDPEVZYUu I$9ERE ËE ÉbIX1e[^_]UVSP]U Chhs$Sڍ ZYu 5WP S VP7Ãt7EPS5bIƣbIS,1Fu#UbIe[^]UVSP]U h~t$SH ZYuh%h'hh's$.Pa S聛 VP虧Ãt7EPS5bIrƣbIS1Fu#UbIe[^]UWVSS]U h*6%S詌 ^_uh%ht'hh's$.ƋbI%EV貚 VҚ WPƃt1PucZYuss$EM ÉbI1e[^_]UU EkEPh{s$uu uh%hd'hh's$m-bI%у uсE ȣbI1UhK.hs$5XZUWVS]h*6%St ^_u3h~t$Sc ZYu"hhs$SR ^_uhs$SA ZYtPbI bIbI!‰bId$1󫉕tVh7iS; @u hs$j3 e[^_]US] uɹPh$E tPFYt Phs$XZEPxYtPSh%e %܋Et Phs$HXZ]UWVSuV%[u hEf$/VYu1P{4Z@u hT'hRe$p 81jS8P8Ph8i(4@`%1󫍅`PhiV @uhT'hs$jA2 tWpht$\X 'Ht#8tuP9u QXVh t$!XuSht$_XjPeY^u h:"j1 \8Ph8i(4 @uhr$H~Ph&t$hؘ%HH9Tt$hx$|hؘ%Tj)j |P4Z,H%(ht$$ '_1ҋ0t`'xtO(9u 09t4#HɋL ]#tg#QPh% ,딅u h-$&^j YjmZti 119X~M%9u>uW2Ph2t$[ hHt$NhQt$4j [F뫃 u]e[^_]e[^_]UWVSӉϋuu 0 Zt2tVWP诇 u3b 1ɉ [u1VM ZVD . Xe[^_]UVSu]}t .jV NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPu-BpW轒 Y_u - ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPƉ׉‰ 9иr E8tQ-8"uoB-;sC| C 9s} !-"WVL Y^u - 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPU X1e[_]UWVSÉUMU1}E;E t[ztMUj8^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1ۉ@}u +'E@u E@ u*PE 0 ZYu6PE 0Ƀ ^_u獅LPh+#E 0& u 10 L0t 1󫃽0 00_0nu脞[[Hh %HP践H,ZYu Dž,K5&EXtj/V q[_ÅtC`1DžT0XDž\@PTP,V}ǃu@xuPqT*bTt/0u#xPV$ZYHufDžtt,Ttt *T]1Dž,tN(j DPSJ,D (t8t1ҁ,v )"1҉(VJX(0tDž,1ۍ u)EfEVh9iS=ƒ 1Bu hv$j' e[^]US]ڋE6@t*EUfuu uv$SPhv$ ]ËPtB w$Pt8#Pu+w$ø+w$Pt#Pu w$ø&w$ËtO-w$tE&w$t8#u+w$ø+w$t#u w$ø4w$UWVSljӉʋuFEE9s]19tc  ^w@v|USh$W#K 1UvAE9s:2UFPho6#)ȉMP M UuRW# u9utD7...}e[^_]1e[^_]UVS ]uVhiS @u he[^_]j-ݶXUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEhy$$XE1e[^_]UPEPhy$u/ uh%h'hhVw$ME\UPEPhZy$u uh%h 'hhVw$MEUVSjjj"{ y hy$L#\1ɺuBhPSV y hz$#ZuufiuS` Xe[^]UPEPhy$uS uh%h4'hAhVw$MIE=@u h z$j 1UPEPh%u uh%hP'h4hVw$dM E@u h^=_]IGPh{$RKStRTRPh{$議RPh{$蜰 F뗀=_]IGPh{$wY[Gd<G=PuZh{$h$FXZ=_]IWGPh{$(GPh{$_ f`Wֹfz$d5t-\PQh%̯K "\`f\TddTz$tHkz$Ptxz$Ptw$Pt#PQh%CK "봊`\d<"\TL=PuEGu:h|$h$^X=_]IGPGPh|$ t#=_]IdW|$h|$h$肮Y[=_]IGPh|$dXZ1t D ҃L dd`]#dtz$VRP`Q4@'h-|$Cu_h\|$h$^X=_]IGPh{$ǭGPh{$购wW ÉTӹfz$\t-dPQh%wN "dϋ\fd`T T`z$tHkz$txz$tw$t#PQh%K "d\kT`Ph{$詬ZY=_]I)w '$ 'z${$txz$un {$gz$`z$Yz$Rz$Kz$Dz$=z$6z$/z$(z$!z$z$z$ z${$OG)Xsj pp)hXh'"e[^_]UpPhiu ulha|$Xl$Eu hu|$j EwE11 -USE UUXt=EEEE1҃UjURP 뺋]UE Puj8, US]SPh|$j6 S>hcIPhcI~ UuUE Pujٽͽj UE Puj跽諽 Ã=lcItMUEE EjjEPEPjEPYƒEBuh}$XÃUSP, jhh' jS؟ uSh,}$6jPZ@uSh>}$j5]UWVSd@u~Q1}=lcItC&;Et7EE jEPjjjV蓹@uuShh}$O 1ۉ]]]]]E}W]SjVSjÃjh}$  ZYu}$}$1uuuujEPj蚝 E"1}jh}$h#, EPh4%a h4%h~$j ju6h4~$r[jjjm jWj#jVj\1ɉ -jEPj8 u8tghc~$Z(9uV,Ph~$jWjjVj D EҀu+=t$h~$DjS = -m = -tjWjdjVjZ -RÄ = LEEEEEP Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh -thLR#utcIZu h:"j< jjSPjh -u‹EpcI]USPhT$hK.˩hK.h$OShF$hK.謩 j8UE E ]SUWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9t''  9$t' '11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t'/ $ 9L$t' '11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]' $09tu' E'11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t' $9L$t' '11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t'9T$'uwy|$y|$L$ ˋL$ ˉ$4$19t'9L$tR$$9T$tf$ '11 [^_]UhH jjh@-u1҅tPUWVS jEPJ Eu_X1E9}2uSPZYt!SPZY tG1EEe[^_]UVSQË0tRVhƁ$EP8V軬ERňZe[^]UWVSQ1:nuzouP藈X1҉Uh %P輦 ZYt98nuxouSP蠰ZYu}SP莰ZYuE1V%Ee[^_]UPPPh́$hK.ӣjbUWVSÉ} u,PQ !I ZY u Qh<$1t V軇Xt*hc"WEnZY1u"su4h۳%,P^_u="~u M }jP ZYt1ih7$KjhJ$W uU jZP,P_ t% 9|\ 뭋QRS uPdI TdIu17hQ$Wj Vha$IEtZo#Et#Et"Et6%%\'u0P,P)v ZY@tjj@^_,t#jhJ$S4 uhy$V肅Y[0R"tSh$Sh/$hV0 ,Dž@h %,PxXZ9 PWNjXZڄtVB L<-u.1j=V迱Y^t$S@$S4Q ,t1|=TdIt}t=XdIu}uD]h$Y19~4h%GXZj Y=XdItc$PB Z@u hHr#bXt t6hO#>X t FXP9=XdItj}t0$h ja j(4 @u h$_-,W3h%h,R赙P,R 8tV,Rh${ ;u8uWVWh$YjQ t X[PKY}u, Ex](j jj y WS$ ~)t}u2hJ.,P1XZj P$ȏ ~j,P @uh#iX,Ѓu ƀt&qttPPVhS#RH}TdI PdI0SVq Y_@uVhƂ$XZ e[^_]UWVSj Phт$ߘ;11to`'tZd't =TdIt>h'Fg#ux$QPh%o !ǃ 끍G]#t#Fg#ux$WRPh$tGg#ux$Ph$DŽ t 0h$ h܍#ƗXZF=TdIKtSpg#ux$QRPh$蕗=TdIhg#h$vsds`sTsPh$`slshs\sXh5$J0=TdI~chSjjhc"ju.t%j S^_tShT$ޖ hW-&&Y4N#t($Ph$赖XZe[^_]US] 1t-tPuZYu\dI1=\dI]UWVSEt48nuxou \dIPZX1uh-#X1Y,u@B uPu_uh:"S轡[^ljxj,SZYt X1e[^_]URPhk$hK.FjՋUWVS]!11҉tE1ɉOC.111plh$u u: 0r=dhWlSh0" ,@uSVh"j n@t(RPh'hS蚉Sߛj谈USP]jEPSRU :9uySu h"j ]US]SyZt@ h53#SZY]US]S_~Zt@ h@%SsZY]USP]jEPSU 9t :uy Sh"jT ]UVS]u VS: YZu Sht"jU ;/t"Sh"MyXZu E"e[^]6ye[^]UPh"hK.jqUWVS EEu EE}]EEE1҉OC.h"Vu t4ouBjWh '5 Oknu h"j PnY붋C.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVShɍ%M ,@uL#t"t" 0>Z"t"PSh"j{ jUVS]u VS8 YZu Sht"jz ;/t"Sh"rwXZu E"e[^][we[^]UPh$hK.j薅UWVS]E1҉#11ɉd111lhhl$u u HuLf$M,9tQG.C|g$"'UC| C|C|C|5 OCpXDžlL5 OCtXDžh.5 OCxX5 OXjuh`#'5 Oku h"j PTkX5 O轳YDždC|C.P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPWJYZ@u WhU$j ltECphtECtNtE%CxdupVVx@$XZK|ǃe[^_]UWVS SVdPhWu u&hWdShr% ,@uSVh"j( f@tKRPh"'hSCSh~$0j6USP]jEPSU :9uySu h"je ]US]SsZt@ h53#SZY]US]SwZt@ h@%SsZY]USP]jEPSDU 9t :uy Sh"j ]UVS]u VSC4 YZu Sht"j ;/t"Sh"rXZu E"e[^]re[^]Uh$js Uehֆ$h$h$h;$hk$Ph$hK.@ j̀UVSQÉj EPSl U:uVSh$j e[^]UWVSuEE@t"`dI 1VFe[^_]PN_u h-#j VP ZYuj1]e[^_]鹕UWVSQ]E10u1-h$u u詹 2F$$'=eIteI뷃=eIueIc뛁K뒺a OC8K t eIhK\cPD OjC@K@2K&g O@Ps4K ,I OC(KK@KEPuh&'5 Ofƃu h"j0 Et eItctKtK@tKsK t=eIeI s=eIgeIc@tKt1҉,-sc sKsC  sC sh!3#VceIY_Eth%VcC$KXZEth݇$VcC KY_Eth$VcC$KXZEth$VcCcZt@ h@%SsZY]USP]jEPSU 9t :uy Sh"j3 ]UVS]u VS YZu Sht"j4 ;/t"Sh",^XZu E"e[^]^e[^]UWVS]fU ffCffBCffBfCffBs s)LY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssVKY^} GWss@KY^GWs$s -KY^G W$CDȉGDs,s(KY^G(W,C@ȉG@s4s0JYYG0W4CHȉGHs$+' t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh "jٽ 1ɋuЋ} t1M8"t$M tM9uM9t Suh,"맋E9ƉU}7=e 9t Ӻ0}PWVhו$ij"_e[^_]ÅtUWRP?Y_}Ã=8jIUWVSƉˡ$jI=@jItQuiIPW M׉ΉRPSu5DjINd 9t *0[|PWVh$ij$B_e[^_]Ã=8jI2W|$wUWVS#Å=tjIupjIBB4PjItjI $jI ;(jI,jIؙ=pjI;|*9tjI_1)։ؙ5TjIpؙQ Y`-'JtRz!9t !9t ҋ1҉ؙ=$jIQ ;Xe[^_]g_W|$wUWVS4EU؉M܋ pjIA Id t15XjI/X=iItXjI5pjIPPW XjIxU th$$pXXjIH xU t@\U؋M܉M؃=iItXjI5pjIPP pjIA Id t15XjIpjIljIJH,1_9M؋}ruuh;$vf pjI\Eȋ1ҍMQRPuuL Ɖ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuuO K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05TjI#5pjIFx1҉$PuuM iITjI\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu"%ClÅt]SuOXZ1Etttp:Y_DpTtF u1E:Y_Fu @ߋu%CPpjIH05TjIEЋUXe[^_]g_UWVSQEӾ=iIt1}=L-tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='She$hK.f ]W|$wUWVS uuDž1WV8 9؉s(WV= ȋƉϹ19s11ۉB,$1~ ȋʃƉ׋ȉډЃ1׉11~_H` tӃȉډЃ1 ȃƉ׋@0)Y+؃1SQRP6 1Ɖ׋ȋʋRPWV/6 9sv Dž19s Hȃ1ɉRP: ORP: ȍy)׋RP&5 ؍CGȉ1~H`9}d))GSWRP9 1RPo4 ؋ÍG1~H`9}Sh4$J pjIC`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=L-(C|HL!ЉjjjhjC4Pj6£ljIuj'?pjIH41pjIH\jIljIhjIH4 ډdjI)ʉ`jI@`#PL ~ PhH-P<jIPXjIP\jI1҉PTX Hfǀƀ4pjI%ƃC4D8<KC,ș)׋C)ȋ)ƃC8HK` tƉ׋Й)׉##11ҋ!~ ) 1҃1)׉@D04=L->C s(H1iIt ǃ^F=0jIs0Kd t1RP߭ڍ N&VV$hR$\E pjI ؙy8PۅI4N&WW$q,h$E pjIA0= @ PjILjI=@jIu\Tu k‰LjIjjjhjRj2£TjI LjIuPjI9uhǙ$Mj&:1=8jIL(jI,jI9|RPh$SD (jI,jI5TjI $jI-'[t?  Lș)Ou뺸=iIt?jj5iIS=$jISb $jIuPؙV jVuؙ=$jIVYTjIpjIXlj=iIt PRCXZpjIxTjI\=0jIDžh$ LX=0jI~݋ pjIA,XƉ׋ǁ\TtA!AƃAId t1RPhP[$jj@fJ.ftRhht@PWr DžPu ft0jI=8jItu 11=pjI1w,1pjI;x,t hJ.` pjI1҉牅8^9؉<}Ë\TtAЋ!AAA)uhy4D1ҁTtqփq9Ћ|h&$I(u^pjI1=XjI5XjIFU F )É^=pjI$~O`^p=L-u*VtGx9sЉFx^fFxG,H9ufVNfFFTVXЉF\KN`ȃ$~:=iIuFh$\^lO`؉Fd9shu$H%[5XjI=pjIF t/)؋É1ɉ~U uF\XjIH xU u@\€ 5XjIN J~U uv`G`YpjI$~%XjIBl5XjIF=pjI=L-~&_89rOd1VT~U uVTP~U t FX1~JOd1111f# pjIA8P!tm)D4A8)Љ9s?~U tv`у >5XjIF$B1ҋ9r)=pjIO`艅FW897~U uv`G`apjI$~%XjIBl5XjIF=pjI=L-Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5XjIF$뵋pjI$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹hjIBhjI;djIu^=iIt`jIs4PPF \jI@\jIpjIZ4Jd15`jI`jIhjIpjIH41[pjIZ0 } TjI؋5XjI=iIt5pjITjIP5XjI pjIX05TjIދvxx pjI\t4Tu%Fl%CPO붡TjIPjI𙋝ڋËƉ߁TtAЋ!AƃAId t1JpjIY\Tt=0jIYs8LjI){0ƉK`Cx1񉅰69s)9sTjI%Cl뀡TjILjI9rߋ pjIA01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==8jIj.U5X܋ pjIߋƉ߁\TtAЋ!AƃA׋Id t1]#tؘ%WVRh$59|]=0jIDpjIP,t,=8jIt hQ#F5X1j G4X1x~j #4X=8jItj;_u=@jIth$v5pjI04=L-0FF4+=_w h$jޅ TjIX󥋅`1=iItR5pjIK[^TjI=4jIt ǃ\8 5pjIx\$jIRP," SY=iItljIpjIr4PPG pjIX4HdLH t15ljI`jIZ;hjIsE=iItpjIr4PP \jI@\jIpjIZ4Jd15`jIaX5LjI5TjIWpjI@4P5ljIAeY[^_]aÃUWVSu]tV{ _uVh"j# `1ɉPhd@u c tGRhedAu {b @u!8tuh"趞XZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(h.U% ƹ ߋSh"V&f CPhF"Vh C Ph"Vh CPh"Vg CPh*"Vg CC,$C,Ph="Vg C0PhR"Vg tP X}!uhzd@u (a @RhedAu a @uuha"jj 4}1󫍅Pu^_@4ȋ9.9t(Ћ}1ۉ1E1ɉ [Eƀ*PGj PEP芑 1e[^_]UVS4]jhPjS(uIjPjVSV& u؋E ʉʋMQ؍e[^]UVS]u VSH YZu Sht"j ;/t"Sh"XZu E"e[^]e[^]ÅtUWRP Y_}UWVSuuuu É֋EU)jj`RP Nju 1ۃ`9}1EPl@hFVk`EUȃM ~MAhQlCȍe[^_]UWVSP]UpEM1^F}tF^ECS}tffCCCCC 1 :}u: 1҉C(S,C8C1ɉ C |I 1( |ICXwI=|I$|I9$9rPhx1'h̟$vvID 1;|Isi$wItЉtF$9rhx1'h $vI‹ ȋ( |IGB돋$9(1҉G䋅$9s1 @RhedAu > @uuha"j_ 4}1󫍅Pu`^_@4ȋ9u 9t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPo 1e[^_]UVS4]jhPjSuIjPjVSV" u؋E ʉʋMQ؍e[^]UVSuVE Zt0Vhh J'à uE t+h JVhS#jQ^ Phh }J  tÉ؍e[^]USXu t%؋@+B1ɉ pJ\-hJ.%hK.%xJ̆JXXZe[^_]W|$wUWSøthKh$XZ5Jh$5JhӢ$Kt Ph$_XJt?J9} h$[()N&MMEuQQ$h$` j wJZ0KKEEJsH~-J]PP$_ @N&RR$SJQQ$SEWW$S h-PP$Sh0$<KJJ"]𺜆JJEzuN&ٞzuN&=J\$=J$hh$e[_]g_1Ujj.SXZ1=JPU=`-u =Jujh uRJZY9 J~ JKueUSátJpJxFأtJxJJN&wN&r\-y1]X]W|$wUWVSJJff‡JJ=ІJ9=ĆJu ;̆JJJfJfJ]fJ1Ej]Sjj5K薚 yh$[jhKjjhJ5K yKt h$p_EjSjj5K9 y hۣ$jT hJj蚫 [^JJfJK s$ ̆JɡԆJȉ ćJȇJsćJ̆JK}fJBfJhJ4fpjhȈKjVP5K Ã9t:y h$nYSVhKh$ hK. Z1`-J% J KJ@JJ̆J󥸨J=Ju(=JuJ̆J̆J̆JJ=v.}fE fEm]mEJJN&5J=JJ]u}fE fEm]mEJ JJEΉ߃ɚ;~ʚ;Eހ}J JJ̆JJBN&؉JJJJ Jى Jɚ;~JJʚ; JJrW JJ JJ JJJJJ=ɚ;~ JJ-ʚ;JKt 1Kte[^_]g_UWVS<ÉUMKtUUEčs}uyMăA}9}fE؍t E;JuJ1JĆJu5}t4Ku+?EPuh$ Ѝe[^_]W|$wUWVSEU܉M7C]KMQURuh+$t hI$XWhO$yKY_t,sE @N&RR$PhW$@=Ky"uCK.e[^_]g_e[^_]g_US,5&=$Ku]#MSPh$hK.sjUWVSƉP#¡dK_tEtPhw$E xK9U|} Vh$jO su4 1C@C1t )уȋKAPEFCCp1}~CpMуt[}D;19Ue[^_]USӃ xK1҅w =w"=wj=w:=w R=wA=v=w.=w "tft uȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs PVh$ S赂 PVh$BhPSj0!PVhǮ$SgPCPVh֮$|hJ.Xe[^]Ãt"¸$7t$tURxZø$USљRPQhS"hJ.S:N] J.yUhJ.j XZáJ.PJ. UWVSDuhJ.Qe[^_]ÉÉh$5'a_E1ҿ!Es,s }uCEtHH1ɉ B u1ۋtЅ}t2}uK]1ʉj.hKEPj:]1ʉu VPh$j.hKihKh%XZT5XKVPh%C 0=DK6UWVS$@<tPh"$EY[ C 8'tRhh #PhM$^_PhS$ XZCH<$3'h]#C Ph\$C6' Ssshp$C! `6'<t6'<t8'CTS C ACPh$sCZYPfwk$ 4'h$h$IX1Zh$h$hƯ$h"%_3h˯$^!hӯ$Y Ph$XZ뢍A9shگ$+6EEEEEEEԍsEԈEӊEՈEҊEֈEEUMfsfhw.ffQRPEPEPEPh$ajfuVuVuVuVuVuVuVuVQRPEPEPEPh $}tSyM9)sxEt  Cy;8-t8-PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth#h#ha$tJ.HJ.$yhJ.j BXZJ.PJ. }e[^_]e[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һj$~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(USY3Phq$hK.KSh$hK.;Sh϶$hK.+$Sh$hK.Sh $hK.Sh$hK.$ShI$hK.ShW$hK.Sh~$hK.$jQUVSƃ=ėKudPSf^Zy Sh$K밋l%=`ƋԗKt:h!B$RP0!ZY hk$PR!ZYu\t_X/$.tXRPhq$rRPh$hK.\`-tRPhø$ RPh$hK.Dž`t0P _tPh $ZYDž`9t SxX`tjtjjUWVS TPjhPjT11ۉ`d`Ph|dVr  @ h;lu\1ɉXSi9dsW`bXZuh"\PY_t X\X;lrt\h"h%hW,EPtKt+WPh$t+WPhø$/ lSZh`PhedAVM  1ۅ9usCaPTh"h&hWcEPtK.t-!+WPh$t+WPhø$f CiVs Xe[^_]UWVSV1}jj}Wjh :'2 uTEEP|jjWPh :' t S[!hؘ%S ZYtQhؘ%je[^_]UWVS]u CV9t)=Sǃ4$Z9t9su ]e[^_]e[^_]ÍL$qUWVSQHYADA lAhAEjjjx< j_EЃhg$T Y1iƠPPEZuh:"Vuj *< E y h$j+ t}th[huutCtQt_}uEPEPr ^XE#t[OEE]#P$:EY$"$@E`$"ER$ƙ"EWl[E؃hƒl ˆOEXu1ɉMȉME r!S#Z9EsECEÚàھ}ujEȋU MԉSQRP  T9ѹ |+ɚ;9ы]þ |9ы]þ |9u}uh$h$h"Vh$Vh"VWuh$uh$4 E Ex1EEEȉẺEEĉxM}DtH9G_GEGE|EptEEE|PTOu;xptM]ċM]M]̋PTM]pt }Eݝ`EݝXEԙRPSQ^ PuWuhȺ$Mԉw݅`ܵX N&PP$EU)Й SQM]RP PV|mЋM]SQRP PVEU M]SQRP PVhӺ$jj h]#SQjEP' @u hƵ#\jj h]#EU RPjEP @tjj h]#|mRPj]S @tjj h]#EM)ș RPjEP @xEPuWuh$w݅`ܵX N&PP$EPVSVEPVh$X<ǠqlMȋ] }tajj h]#SQj]S @jj h]#EU RPjuV @VSh$ ZMȉ]̋uԉuEU WVRP PWVMȋ]SQ Ph,$h"M] }jj h]#SQj]S> @jj h]#EȋU RPjuV @jj h]#EU+EU RPj}W @WVShC$YM]uԉuEU+EU WVRP PuEȋU WVRP PuWVM]SQ Php$UxEU EU}m]m]jj h]#RPjEP @jj h]#EȋU RPj]S @jj h]#EЙMʋEЋ}EeRPj}W @hjj h]#EU+EU RPjUR` @5Eu N&QQ$URVWVSVEPuh$uh$EԉEEEu N&RR$EU+EU uuRPd PVEЙMʋEЋ}EeuuRP5 PVEȋU uuRP PVuuuu Puh$uhͻ$m4u)XeY[^_]aU Ph$hK.jaUWVSljU΃=Ku'jhK KZYuh7$=[KXi K}u-WUPZYUujtdWUPZYUu=tRhhKƒ KuPh$j" K c1e[^_]UVSƻ@-tPVyZYt"VhC$5iL8hLMC St8tPRhV$x Rha$xZYuj 3h_Lq1 C_L_L e[^]Uj{X=hLt%iLfPftjh4N#P jh`Ke UWVS=xhL5thLÉDžu¿i$RWhw$5iL5iLPhPh`J.!$y'1=KSh$5iLQR.fDHfn,f?trfauHthLSh$5iL (fptfqt#1҉xhL5iLh$m!Y[C1KShM$5iL &SShӼ$5iLe[^_]Ã=KtO=hLtFUVS5xhLthLxhL1ɉ thL1U5xhLthLu1҉K[^]1KULKj]Z=`hLujX|hLt\hLjуjh KJ UWVStEUtj1]ut=tR.TS!@u$EE%@ R.t R.fBuӃ}tghhL [ƋE]tC1ۊhLt8u9s&HhL CuݍHȋ])=~ E봉EE} Uй 1u1dLtltf$t\uDS8uOCDC<0~2S8u0x tF8tutt 8FtC1DЋEǸ`L:[tL\t$HWыu)@,-x$uvXR.DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2R.DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5R.D^tS@0uU tZBGO])ف~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP+ EE 5iLh$hEZYFbEe[^_]USEU uMߠؘ%@-iLtRQh%P_#PhNe$8hLZY2t!h_Lh$5iL@18hL B]X]UVS]u9_Lt}5hLE phLu1hL@-8t 9XtShս$j @u=^Lth^LPhV$p Pha$pZYu_L5hLe[^]U}u赟8hL]ø$]U}u萟8hL]ø8%]lU}uk8hL]ø$]GU}tFh _Lh$5iL 8hLU}th`_Lh$5iL 8hLU}tޞh_LhB$5iL 8hLUWVSEuEE PPu 脞Ht 1}6hw$E PEP uh$E PEPq t}E px_E څuPm$8ath$=PhLtr$1Ʌt1Ƀ=@hL1=DhLƍQV1M Z^9Yu19ARPSW0S 8hLe[^_]UWVS0 Eus8hLHuh$E PEP{ tKhj}^_jh`K ZYu=`hLE 9E ;u"1ۉKjju à u=|hLtՃ=Ktԉڋƅtō5@hL5DhL HhLyZY9u1Ƀ=xhLκh$=PhLtr$VPSRE =Kc=hLVxhLxhL1ҋtKxhL(=|hLt=hhL=Ku"C9]j)[^1=KE ƅtˋE 5@hL5DhL1ZYU 9u1҃=xhL‰ֺh$=PhLtr$VPQR=Kf=hLY5xhLxhL1ҋE tK5xhL( 14RjhE 4 u uE 40h$ƪ^_=|hL=KE [Dž5@hL5DhL1ɋQZY9u1҃=xhL‰׺h$=PhLtr$WPQR輁=Ku5=hLt,=xhLxhL1ҋE tK=xhL2Pw Xe[^_]UWVSEuEE PPu蝙`Ht 1}6h$E PEP uhw$E PEP t}E xptYu8hL1St&1ۃ=@hL1҃=DhL1Ƀ=HhL111ɍSRtXZ}=x^Lu5iLh$[^닍xPS$~ZY}uIy,8tShk$a-[^1ɉ hL hLOhLhL6u2jE pZZutL9¸}9U 9zu19ZVPuWSh$1҉hLhL1ptXpe[^_]U=hLu %=hLt$Pju uU=hLu;]$=hLt$Pju uUWVSEuS8hL:Huh$E PEP[ tK1=hL=hLth$E 0ZYu*=x^Lu5iLh$2[^Džthj p^_jh`K萓 XYE t ;u&1ۉKj5`hLu 读à uK=|hLtу=Kth`ZLSDZYuSh$5iL 멉ڋE ƅt5@hL5DhL HhLYXtt9xPW\{YZuhLhL Whk$*XZ9u1=xhLƃ=hLu;]$=hLt$jVPSWh$q1ۉhLhL=K=hLxhLxhL1ҋE tKxhLpj_XZ1ɉ Ke[^_]UWVS u }t hiO#vZYuvh'$5iL~ zj h$W > =hLu;]$=hLt!$tVWjVjjhRSySX 8hLe[^_]U帥"}uq#]U}u hB$hK$hV$5iL諿18hLUWVSE]uu1҅‰uTpuCE xh"WZYu u0Hhq#WZYu1t/q#j u븥"PVhf$5iL e[^_]Uhn$hlhLu uI8hLU}u 8hL=hLtiLE Ex$]9]Uh$hhLu u8hLUVSE] u1=hLhLu{"yt 苒sh"VZYtBhq#VZYu 1hL4V^sh$5iL 맣hLhL노q#Phܿ$5iLν =hLt5hLh$5iL謽 5iLh$, hLY[t1҉ iL8hLe[^]Uh$hhLu u8hLUh$hhLu u8hLUh+$h iLu u8hL= iLt1hLUh8$hxhLu uM8hLUVSE] u 1=XhLbu.sh"VZYuBhq#VZYt1s\,VL^hsh K} ThL K 뷣XhLThLt$t:u5iLhI$ 1XhLZY4,VL:u"#q#t"SRQh$5iLXhL8hLe[^]Uh$hhhLu u8hLUh$hE[Xjh`Klj XYE tE ;u1ɉ Kjju à uu=KtڋetSh$y][Zu ^L=Ku=hLtxhLxhL1ҋE tKxhLtujsXZ1ɉ K]UEu 8hL}Ht}6h$E PEP uh$E PEP t}E ph$\ZYu!E ph$\ZYu ^LUWVS}M 1ME1=hLt5xhLxhL1ҋE ¡Kt@K5xhLujxZY1ۉKEM9t EPXe[^_]UWVS}u .jj*ƉXZS CYujjh#* à u4%j/SF _ZڅtPhRWW =phLt65iLSiLHQPY^y Pj SY^ J }~j5(hLhXl#WS  jWS Sh$8hLjB~Pd Z9uWjZYFu h($X1ۉ8hLe[^_]UWVSPEEu蕆8hLHhO$E PEP蝺 EwɋE phX$FW_X}h`$ ^u ]E XShk$ WS1 uY}hs$h Yu ]E X Sh}$VSQ1 tA5iLh$XZ<u}u"E X Sh}$VS 1 |hLe[^_]U8hL}tK=@VLt =`VLu#耰=`VLuiLE E$lh`VLh$5iLİ18hL U8hL}t܄=`ZLu#iL=`ZLuE Ei$h`ZLh$5iL^18hL UEt~{8hL{Huh$E PEP膸 tӋE ph$6UYZu9=8hLu<=hLt5iLh$m XZE ph$TZYu ^LUEt~ރ8hL{Huh$E PEP tӋE phQ$TYZu9=8hLu<=hLt5iLh&$ XZE phP$[TZYu ^LUWVSu huS 9}1hE4S F 9~hhؘ%S GSh$SY[Hu jYNZ^Le[^_]UEu躂8hL/HuhX$E PEPŶ tu uh]#- UEun8hL/Huhm$E PEPy tu uh$ UEu"8hL[Ht}6hI$E PEP% uh$E PEP t}E pph$R USEu詁8hL8hLhLHu h$sRYE ph$`RXZhL]USEPvL8hL8hLhLHu h$RYE ph$RXZhL]USEu8hL8hLhLHu h$QYE ph$QXZhL]UE} tu蕀8hL=|hLth$iQXԣU} t}uY8hLÃ=|hLt jjXZj^Y=|hLt jjuXZjoUjjj\UWSREEu8hL=uE Xh$< Xu]Sh}$PS/1 e[_]UVSEu0HuHhLX]USEu/w=Ku5iLh $j XZH~}~h:$E PEP u밃=xhLt5iLhE$! Y[j E pkKKP K u KKkPkKBKkKdJ.HKtzdJ.y h`J.|Zu!5iLh$(`J.P`J.< u$Kk9KuP{{uPKoC닡`J.P`J.8 t dJ.yh`J.Y t@) dJ.yh`J.Z `J.P`J.8 u5iLh$KkK18hL]UWVEu iuhHuh$E PEP{ tjE pڜƉXZutWVE ph$5iL֠98hLe^_]UEu tsHuh$E PEP tjE pLEUYYBu@t)EP\PPE ph$5iL:M;MU8hLUEU uHt8hL]Hu E$]EBE E$] EUS] h;]$jSu1tssh$5iL訟]UWVSVEus.Huhw$E PEPڧ t݋E p[u 8hLzh$!zYt8uՐ"RUÉ4$|<$薬WURP' Whؘ%S WVS (S< 18hLSV e[^_]UWVSEur8hLHuh$E PEP th$ZyYt8uՐ"S&Ǎ@$۫|GWS@Ph =hLhLhLEUhL1hLhLhLhLjjh$M qVh$*b=hLEUhLhLhL(VZe[^_]UWVS]} t q7h$VZYt.h%V ZYth#$VY[t뷻wZttKtK5K5Kh+$5iL-18hLe[^_]UWVSPU} uRUwZUuUE V$iLEe[^_]ܜË@t P1ɉKXW說CZ=hLttP3hl$5iL蝜e[^_]USEU 8hLt tt<]p-t8Cu]#PRj h$5iL<jrr 18hL]UVSu 8hL}t e[^]2pvvXuvhV$5iLӛ,Ct P1҉SY3h$5iL講18hL e[^]US}uo8hLB=l^LuiLE E$] hLhLh$u@hLX]USEU Hv_o8hLV=t^LuiLE E$] hLhLHu h$@Yrh$?XZhL]USMU Avn8hL_=l^LuiLE E $] hLhLBuPh6$?XZrPh>$r? hL]UWVS @Eu} tSn8hLAHh:$E PEP[ tЋ5K} 19~j kKPw t*Cu%why$5iL誙8hL h@h LP 1ؿkKX 9XrR.DP@tC L<$t<\CFC R.K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP VL)PE 4V E 43߿iu6CDžؿ9}~) VL)PE 4Vw E 4 ƃF;pK0mXu 5iLh$u!5iLh$ 8hL^X~ t=|hLu 5iLh*$΃=hLt:5iLh LC iLHQPYYy Pj YX J j 6R KP5KV =lhLt3~t-iLHQPy;P| J PjrXZh@Ph L* oKEKE 9XCؿt G9}ce[^_]USËt Pٞ1XCt PǞ1ɉKXCt P贞1CZ]USdLKjwX=hLt>QPh$jd]S\~!iLfJftPSR! jhKg USdjOwX=hLt>Ph$jd]S~!iLfJftPSR迆 jhK g UWVSÉ֋:j:WYZuWh$S蕩 :WfP蹜YZtj%WYZtWh$S_WyF u FfP HuFf=tPh{$S, h $SXZe[^_]UWVSQljUR[Ë7 <wsBSuRU u8Uӊu <wrs C <v1e[^_]UWVSË@t P蘜1s_stVY1Ct Po1CZe[^_]UWVSljӋuhLu<MPZuEPMQSW蒭jBu>y8E8 u@EPh$xXZ H< ws 1e[^_]Å8UWVSH%Pty=R.UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu h$j jh$W uW1ɉK fCPjh $Wu uWC fCjh'$WO u WC _t36v CvCF C FfC (Wuh/$)v Ei$:j/RUH^ZEUu R蝟8)ЉUHQM#ƋMQURP { uEudCYj@VZYt_{ u1҉^LMq@P4j:Ep辢 t@PMAYE@yE@tj>[urVj]RUyYZEtH:UttWuVh?$)PERV{MVu WuVh_$fEPx:t1j:V YZtP>t3tJj EPRUVl U:tM9u HvWuRh$mt?fC*C tt0VLt4VLt]#RCZ{uܳ%{ t۳%PÝCX1e[^_]USZKJy ;J| t Y RPXZ]UWVS\fDž1jh $Po _1Dž1jP$AZY@t(t 8tt 8uSh$r7(8j;P" ZYƅh$PؚY_t>h$Vǚ_Zt4h$V趚ZYuh$]r_SVh$Sj@Pp t%1ۉ^L@P踛^j:1ZYt+@P肛XDž11Dž8ta8tVj/P [^9u*u+pjh۳%S! ts11ۃu t*hhL1ɉtf1҉uPt ;th$SkZY1ɉt >th$V?YZ^L=|hLtjjXZ^LhPR. u11ɉdhL1҉dhLQPpdhL|hLYZuu*##Hu9u uPh$xo Ou PjɿPj蚿_Xu1t ;t1j/SnZYDžtG9hh%&R 1^LPj=^Lu,;u=8hLuhK.hE$ ^_W4t3hSSB hh۳%S hVS $hh$R 1ۉ= VL tSxhL1ɉ xhLt hh$ hh$R Pj?xhLG$VLuj/V [ZtP1ɉt PjPjXZ8hL-cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jhKX ZYWu P$Y[@.S.^<$Zffu/t+;^h{$SYZYIh$*t?u+$u =$VLuh$jWsY,,$VLt <,j/P _Zt@,P-Z PY$VL t 8uh$c1=hL=hLhLhLDžtDžx= VLt0 tRP]?ZYuhLhLOhL$,hiO#P^_44u ,4P觚t$PtY[u/txhLhL5hL=hLut84PC1҉$WVP袱y,Ph$_X=hLu=KK,Ph3$5iLu hLhL iLuu5iLj 2l[^RPh>$Q;hShKH h^LK$stdT*$TtR$Dth$rZX%$$udh-$@P$tdd$ƅuj$u}tP}_V藃YZt:j"-,r)=hL5=hL(h|$t;u h$jh'$S u Sh$KPK~ h$hL1u>u$Pڋ _Z5Sh$5iLt ƅu#SugY^ >Sh%$5iLbt ǃth7$yXXZ hR$kXXDžDž<|Xu tS(|Y|_uRhp$DžDžDžDžDžDž 9$VLu h#P-_Zu Dž8J.\ 8|uQjj TZY h;]$@P6_ [^88u @Ph$JDž0G8<hLhLu!t9Nj}5uPuGhL hL!΃9=hLD5iLh$ ^_-u t=hL=hL9u 9t Ph$8V h % h;]$PIrY[88u PhE$Dž0 hj/S[^hB[jS_ZKt9KtKKtPyYKtЁ~=}KP~ZK1iLiLhL@tPjR^_DžjR[4P5K5KA u h$ 1ɉjP5Kƃ K9u h$ҽ8"ty-Ľ"KR)Ph$Q  u @;u‰Њ Bt th $P轮_Zt h $=^Lu ^LșuK1jP(Y[؉|tL𙋍|9Ή| ||=hLH|19=K|19lj||Nj4PWj5Kjǃu4PTZ1iLiL|)ډ|8K@DžftSb_ u趻tڃ#u)uË9 Ph#Y= iLiL9iLiL|#hLR迈X`)d=^LtYjP[_++y @B19|@B)R?/Y맋aY1u7V4P5K5K脅 uj@N$2$h $5K蜫_Zt hT$P|ft=hLu4P^tcht$Q= iLuڋ iLiL19}NjhL9|iL 뤋iL#[#jN8$,Y0= xu tjSmXZtx1ɉ08R18 $P5 _Z@u*tPS$\j$h$5iLk 1;iLiL|hL hLy )jFXhLhLiLiL9؉|1=iL=iL1@u @u"PjLY[㋅Pj wLXZ@tPj^L^_@tPjELY[4t4Pހ@t P^ Z0t8t08RX ;$VLt t Prr1 Xsh,t,P'r1,XtPr1_$t$Pq1ɉ$[(t.(Pq1(Zne[^_]UWVSÉjh$PY jh'$SA tsh+$S4ZYDžt$jh $S tS)Wh$j uhR$C_u?F t u8t,jh $S uVj11҉ ZYe[^_]É؍e[^_]US1EEjhhL9 ZYt-=|hLuEE@EjjY[hjI[Xh(j IXZEE;EEj:M 4yZYtw1ۉK=^Lu ^LEU 1oE$VLt%h#S膦ZYt;|tSo1ɉ $VL[E~E@EE@E\=|hLuE]ËE@tjjXZUWVS$} j h$uVr uE1ۉ]]u!uÉEPD8hL[11ۉYKtЁ~=},KPCZ(Kj'X=hLt= iLt =hLyhL$1$_LDtBhLhLut/(f{t (IjRPQb5^L,K (K(fxt (P0ft 0@$VS u0͂8 uiLiLh$R^ڃD =hLu =hL(jjjP:\11y4E Ph$Y[,RPCA[Zt׃ t;5hLhL(|jjjP[yv뚃 $iLiL04RP@XZ th(,RPj A @tv(@ @uju04RPx@^_tA gL@L Hu (,RPS@ @um$uwPT95iLiLiL#5iLlNYPThLډPT롃iLiL#PT95iLiL|iL H0@ @tNiL#*L4?8 uiLiL h$ǛY݋(@ @t,E Ph#蝛XZjJX8t8(R^1(0P'M1ɉ0 $[LuiLiLy3dLPh$5iL2 5iLhL$菁 XZ뾋D(uu=P ZPu uh$8hL@thPhuh@KҌ h^L@KmSj j VhWss t hh#Wx j h#Vk =hLt6xt*iL{u VRh$VRh$P .s js| yVPh$ <=hLu 1{Pss6y! X[sKKCKp 1KPhK. @uGu uh$@ Bu uhK$M8hL 1.K=Ku%DžjPjj% hiO#CHKh;]$CDK=HKtuh$HK^4=hLt5h^Lh$5iLU, j[~"HKtPGYDKtFPFZ=jSjhj jShhR h^L(8hLS Xe[^_]U5iLh$C{ XZUE }ut8hLwPPPh$S4+]UtjQP UVSƻ-tVPz7ZYt1ۉ؍e[^]U@qLu"~#u hw$jx @qLuq$Phh@mL.@mLU mLu"|$ku h$jrx  mLu]#Phh iL. iLUWVSS1}tS11ɉM1-t4U C:Kut0Bu+U9uE ։Eƃ}Z[^_]UWVS]u t>hs$WhZYEue[^_]:7ø#=`hLt$Ph$5iLl) -t$=`hLt~ tP27PS7 S*YE ]e[^_] QMZƒMuQWh$5iL(KSu QWh $ދ}u#Uj PMQ MMEPjUR rPj h$5iL(릍e[^_]áL K!t$uCDqLtJu6DqL(hL%DqLPL-8!u-UVS t t @DqLtJt DqL1&DqL(hL tGtBB@"u\uXu@!@B؀"@tՈBut B1KLu/DqLtHt DqL1DqL1(hL[^]USL LKK1ɉ DqLK1ۉX1KP5K4XZtK@ڋ]UVS =hLt2iLSP^v 0^Z8tPh.t$5iL& 5iLAjh@h Lh`J...y}uB5iLh&$t.=hLt iLHy Pj (Y[ J ^z=K?K0ZÃu 5iLh$+u 5iLh$x t =|hLu5iLh*$eu [^1ɉ thLj 3uV؃ K0P5KS =lhLt3{t-iLHQPy;P| J Pj'XZ{ qhjh(j e[^]UEt]1]US]u hL$j s SZu Shs$jr @]U=-u  -iLfPftP" Z9-ÍL$qUWVSQ0hL  iL XjPؤ+ \qL`qLZ^+dqLy @B,N&ڽ߭ݕ iLiLhL19}l؞vK߭ٽf f٭߽٭؉Ή߅u]#t 11#RPSQh$hPtٽf f݅٭۝٭Q~DQ#u]#RPh$)PPÃt PhM6#)PPÃ<RPh$)PP؉19}t  @~4h<'%y)DžkddʉӉف1 Q%1 RPh$)PP8iLiL19݅hLhL5hL=hL9Z)߭߭ٽf f٭۝٭׉h$)PP\à t!VhM6#)PP7Ã<RPh$)PP Ë+PqLTqLXqL9}9}&h$)PVà h4N#)PPh؃ uiLfJftPVR! eY[^_]aUSjl1;iLiL}6=hLt%iLfPftjh4N#P jXl]UWVEE왉U1E}ujEPjD~ e^_]U0E E1EԉE؉E܉EEEPEPujƒ xEÍL$qUWVSQ@@u5jh\qL~PqL\qLhLhLHqLLqLXZjPGhLhLiLiL+PqLTqL_XXqL9}hL9=HqLLqLsEPqL󥋵5HqL=LqL1~x9؋}lhPh$hSiLfJftPSR jjj%jhhL = iLuh jjujjj = iL|NihO#P{hLY[tPh$hP xhLhL19߭y0N&ݝ݅ N&߭ٽf f٭۝٭y1d~dVh4$)P=PXNjiL~-hLt PWZ)Å~:ùdh]#)Sh;'Ph;$)P=Pǃ119ʉst  @~4h<'SQhE$)P=P+\qL`qL+ dqLy @B,N&ڽ߭ iLiL19ظw ȉ߭LN&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4h<'%Ƹd PSQhR$)PPáhLhL19‹iLiL)ލ 19‹݅99}ht$VQà +hLhL߭߭ٽf f٭۝٭?~~hg$rtPhM6#VQtÃh֘%VQaà <ЙRPh$)PP(Ãuh4N#)PPà iLfPftSVP eY[^_]aUSdjidX]áqL@ `t1USqLHyP2Yu1ZJ ƒ,uɍPv"u|qLqLHyP2ZuJ"\u%qLHyPZ2ZuJCCqLuh$ YqLqLqLHyP 2Zu ZJ ,„t@Pv8\u"qLHyP1Yu JCCqLuq-=qLthqLPSZYuC ߸ ]UWVSQƉUhqLPo![_tHj.V`&[_1ۅt6uPI!ZYÅu#)WhqLVu u1ۀqL1ۉ؍e[^_]À=`KtUWVShiO#h`KqL^_u"a8th`Kh$X}Y[1$hS_ZyƅEj.S%[^pu Džp]#1btH uuzG uҋph^LuSpEƅt1;4 3*%u_3uGE uhqL"!} hqLPQZYtE th$PQ[_tBqLfPfttRP!8ZYx|?th$ h$w$xAE85hqL| }X qLfPfttRP7[_x"|?th$ h+$x E8hqL}z=`hLt5qLPR.Yt u qLHy t u5iLh\$JɋKu5iLh $XkKKÉKqLHyP-Zu@JR.DB@uGG9u uKu3KK=qLHyP~-YuJkPkKBKkKKqLHyP,-ZuJ< u6KkK9Ku@K {u@KKZChqLh$ _XqL@tR#+[5iLh$_ XZ5qL+Y 5iLh{$ۍe[^_]1UWVSƉӉ1ɉJJJ JJj:Pm!_Ztj/V]!YZ9ru G)C>/u,~/u&j/FP3!_Zu VgLYCl)Sj?V!_Zj#V!YZt(9ru$)S t )SWL^C!t)S PLYC VKZC e[^_]UWVSEM] KE@D}G BU}GPxEE0H}‹EBUr2JB}ww7O B Urrr 2JBsss s3KSEe[^_]UWVSƉBRUEljURE^_Nju <.u;FZYu x^L8hS&S!ZYu |^Lh$SZYu ^L]USZKJy ;J|< t Y RP ZY]UWVShL=phLu hLh$B^tIh$hdKf ZYƺ9¸} cK.uhdKVh$5iL jh%$hdKj 5`hLtjh$hdKj uSt `^L d^L1_Lj h$h_Lug t\h_Lh$5iL7  Bt 1`^L1d^Lt*j h*$h`K G u5iLh5$X ^_l^Lp^Lt^Lx^L|^L^LPKh$ЭY1uDKt-fPftjP` 5DK!1DK 1ɉ |hL1\hLj蠹PZt Sh$jT S0e[^]UWVS ]uhhL=Kt =|hLu$u 1ۉDvL@vLPu+DvLtÍCDvLC1ɉ DvL@vLh5^LWd /thh۳%Wd hh$Wd W*yWh$nXZ1qP =hLXأhLhL iL1hL iL} t1=`hLP-X;]$t!jjRPPh$K %֡8hL-cvt`K} t1=`hLPǷX=hLhL iLhiO#S@vLS@vL uuh$ ^$Phh@rL8 u5@vL&1ۉ@vLj h@rLZYu@rLe[^_]UVSQQMqhL=phLu hL=|^Lut95iLh$rS Ph$YZuBj h`K>^Zuj UR@PP M te5R.DN@tVu=8hLu=|^Lu1ɉ |^Lt=phLu5iLh`KR iL XZzhLeY[^]UWVSQ4MY=hL}=8hL}=phLu hL=p^Lu}5iLh!$]R fPhJ$^_j hdK%ZYtj.hdK^_thdK=?YdKuKjhR$Ve@ u7VhV$5iLKfeK20heKh$5iL-eK }1V>ZtVh$5iL EPh$V{ tEEP_uu phLu\]hLgu=8hLu=p^Lu1ɉ p^Lt+=phLu"5iLh`KQ iL XZEhLE8hLeY[^_]Uuh$j2hrLu h$jO rLUWVSP}u jj; h#j- Wh$Vz ƒu&Wh,$Vz ƒ uWhF$Vz ƒ USj Ee[^_]Uhh`ZLB ZYu`ZLUVS@VL5hL8hL=phLu hLhf#oZuQj h`KZYt?8t:x"u41Ɋt t"u P"u @`VLA@Ɓ`VL`VL5hL8hLe[^]UWVSu huS] SV hָ%PZ>u]WS YZuSh\$|hXZ19/uV<É$VWM= uڊ/ e[^_]UWVS}GE119ut4;Z9sFSUiL9r1uÍD1EkE1Eu9uE1E9]tzMt5iLRUN YXU;wriL t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=|hLu E]#$=@VLuM=|hLMtE`VLE}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL湼#=|hLt h^Lu#}mډ)Ӌu N ty.uup9swBL帼#=|hLtjP`u+‹Y_+y@Biy1fDžRjP uYA8u=hL~{A8#tLVjS ƒ 1BPPh"nuA< tQDžPPhhSv @u;A)A e[^_]UVS]u SXu ]e[^]w UWVS]} KyCSXu?C u8@t4@8ufc @8#tt@ P0e[^_]UWVSu }EÃu3F u,@t(Y@8uff H@8#tt :@[^_]US] h|%S|1YZ¸t,hK5&Sd1YZt;uEuh$[XZ]US]S=Zu Sh$j@ ]U| u h$jm@ US] Su ZY@u ShC$jI@ ]UEu hd$j@ PȲZu h$j@ UWVShuE ]E1҉UUUt PEXt SE_=^LtIEt P1ɉM[h$nEEZt P1EXhI$CPGE[_EPEPEPVy$8hL5`K ZEU`KiLt\RVh$P1ɉMEPjP]Sh`J.}yhN#uhI$5iL8hL1 Vh$P Sj=XhLtVRU?-É4$5-|<$WURP|N Wh$SPO WVSHO E(tPcX]RhX$U^_}u-h`$ Yu]SES,1XZuhk$ËuV,1 uq}u-hs$a _u]SESV,1[^E8uh$ YPh}$藔ËuV,1 uŋEtPh}$e_ZuuuC,' 68#usxZYCEЉC{uMEЉC 1{UԺufU؃=hL~;jEPhE+E‹EY^+Ey@Biy1`51҉VjEP] u C58t958#t/5C(935hLPh$5iL4<C(<1EЍe[^_]UWVSQ} ]{uh.CZC{({,C;C C1s sSjjEPu{(uT{,t Cu`E KSBCEC9Cu3pVsZYu 4 C(1E2Cs} z뙋s )9|Gs}UC Ee[^_]UWVSSu] }VuS u-~,tu$t$1ɉN(YS"ZHˀ; u9UJ9u1VjjEPat} ut\$1ɉN(t1҉e[^_]UE PuWj<UE PuWXZ=HvLu HvLUE Pu XZ=HvLu HvLUWVSSƉ׉ˉʁv )…tRUWV+ tUu؍e[^_]W|$wUWVS||xˋ7GEGEhE_u h$hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}t }}uetWuu EE)PEW|Y u h$_XC1Ʌ}lj}EU1EMu9}uh$A^_EEu1ɉMCw$<'E8tJ1M9ȋM}uh$XZFh$HvLXEE@EO}jjjhE 1}Ett h$O@EO}E8t h$+@EO}oEU@EO}O=E.E0@EO}E @EO}jEu E8u$ Eu E8u @E"u  NEO}~j8h2$jEPg]u [h8$1RjEP8_EZYwP$<'}tR}uL1EhN$XEE'h`$hr$h$uh$_X+}t?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuVH tVPPh>$HF98Ls8Le[^_]UWVS1ɉ /t($Xtd+Y9~T\uw@1ɉÅuhK$_1Ҁ8IuC1tmF:2>uj RP« F hk$m؍e[^_]UWVS ÉUE9C#u~nu ЈLL@ ,L,L5L_1,L=Lu8#uxnu ЈLM 1M I tLLt]Ut @uKf L-tL1ɉ L=,L9G ,LLt1BJM pЍe[^_]UL@ t=Lt/= Lt;HyPBYuԋJ 5LP XZ1UWVS|u=LuQ(L8u==Lt h9$j{ L`J.ȈL$܈LJ.ĈL"LLtQHyPZt@ J5LPW 5LhLhL$ Ã]FL=`J.u 1~1P[= Ltdh L>h L5ȈL t$j$ Ѝe[^]UWVSEpLlLz %&\u.rER.Dpt zu0y_<\t<&uGL5pLV9r0MLP5|Lã|LlLpLXZM pLC14LxutyPx utkL)ʋ pLL 9r2U𣀑LP5|L蕛ã|LlLpLYXURU4LM 0QSUpL L=pLW9r*LP5|L+ã|LlLpLXZe[^_]UVS]uCP9SsCPsCZY}u1CVu CPss0 e[^]UWVS15L4jhLMZY01ۉL`vL1ɉ LLCSuu xK u L)9BmuB5Lj1ɋL_Zu L9B St1s LLC8u L9Hs1ɉK 1tu*@5Lj1ɋLa_ZtЋCu,u L9Hu׋@9Lpu x_LC \u@5Lj1ɋLY^u L9HYCt t G ? C=<>1 $=''o_ZDžtE;5-r5܈Lh/%] Y^>'$Ph$5܈L襯 _L<;5-r5܈Lh/% XZDL<Ph$5܈LMG 9tE8t1:"u#C؍e[^]USP#Yt@Ut‹EBu ShL$j: ]UWVSÉk<`.AfEE19E~6Q@94:u9E~֍~@kt~UCuBEsT})EKʋEC _9~M{fufSf9} z)f{)MS9|M9~fK)y1fsf9|MS9~/E9}(CPuyRuFYXCuE9}ys(ulXZ1C9uf{th$uQs/9Cujjsz uCuS)PsJs\e[^_]UE @]UE @]UE @]UE 1҉P]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE 1҉]UE 1҉]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]!U1Lj]A1U1LjHA1UE uU]UL 1]UL 1]UL 1]U@Lr1]U@LW1]U@L<1]UL!1]UL1]UL1]U@L1]U@L1]Uh賧L1Uh蝧L1UL n1]U@L S1]U8Le81]ULq1]UL1]US] L)thvjMXZ*ƀxj3PMjj35 Lg]UWVS ]u t/{u)PvPN t6vW\C 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P}C ZtsP.fs '1C sKvs'1CZY]UWVS`.1AfEE1}9}FQF @tf~uߋ}9}֍~@ksCf;ssfF ]tBwC,t{uu S_XC0tu SY^{hC E{CE܋Cut 1EEuECutiPEZt[8tVU1ɉMj RU觎YZNMUt)9M}MԍPuR边ZEM9}MtFE1ɉ u1uE$CЃEЅy 9}NjC fsfufu EfC  ̑LM)U)9~(f~CDuEԋ}))y1E+E)fC M΋U9|C@tSf)uu5̑LWuCPC PhC$"EU)E)9~fS }}E}t'E܉E;USBu2ZuEC9E|Pu^9E}EEM4ȑL9~*u5ȑLuuh$hK.s{jn}u)MUʋM9})EK ȗL}))ȿuWVEQ_Cu3uuWuuuC Ph$hK.z$jumjP dZYthsޫhs)CtuuWVC }Pm_C tC tOP5O`XZ?S{B99fSs C9|)BfSU sV_#@$?'2=.=9=R@Kщȃ$?'C*hK.jsa Y^\sF "HSB ufCf;CfCs$uhK.ja 5OE5OEjjWP]Etwru5O^5OaV ƃ11Et9}} < uEF5O蔇h$jj5O]+Vjj5OM+$jj5O艺5O蘓5OY=5R.DBxqz>tKdtF<-u(=t5=t,-v3=Rt=Su%t!+=̑LS>t̑L|@hK.j_ XZV44qCfS K)y1fK)y1fC\{f}}S׍ MQ9UK fMU)y1s9~fSUʋMM9ULfKsXxut fCfCjz `~x~Ja (EC99C@ 'fS?u ? =St=VYvt1ҡR.DPIhK.j1^ Vj oesC Zt sP[_XskY tjF t!u S_Zt Cs~ft^F uMs蘄C ^tsPI[s 1ɉK sfks1CLXZu W_XF s4C Yt sPZXZskXCt2PX}1s_$uCD0tP9}C1҉T0YEC9E|ӋC4tu S_XsQ1ɉKC ^tTP>1C ZFu7uju5O聃eE9s$[ Xe[^_]UULU fP]UU1x9đL~L]UWVSP.5đL9B  MP5LxY_Mu11L6đLL4uj^tj 5LY[=Ltj 5LXZ1LܑL뀀 uY=LtQ=>^tj 5LY[j 5L1LL1LܑLXZ615LЉLf)؉E1=ܑLuu=LtQ=UЉE5L=YZ9E|,5L=ZU9~j 5LY^1Lt Nj PXZuSP0/GH߃ 1w  @L15ܑL_=Lt05L=[tj 5LqZY1LܑL5L蛋Ee[^_]UWVS,]E EЋEEEE܋EEu}tu E1}uoEj5L_tVSjE}tPE8tHEtuPu 1hS$5L!u5L!h#5Lp!hَ%5L]!uXZ5L;E5L;E5L&<M)HE1ɉMEЃEM)ȃFE9u ؋M)ȉE}xE91EF9~؉‹M)ʋM9~)ȉE؋M)ȋM9~PEMPuu5Lw"5L;}th"uu5L_!EU)Pu5L葰5L蠉5LX tM u 11ۉ1't!7u/ R.au~()PEP~EPXKqEH9hK.jU ZYy//gMT9DP@tOUT:DP@uO)PEPEPWX)) !~딉 u.1ۃ}uuu^ uÃ~9PR.DP2UȋE 0)PQM̍~EPWM̋UȈCi}t/j E؋M)Pu5L>1LܑL}t2EЃ t EuP]9]ttuSu EEe[^_]tUWVS}5Lt`=LW8W8C_X9Ls-SkYuLtP3tZ=LL1LܑLe[^_]US].t5ؑLP%XZ.tjjS)^ à uhjjjP^ؑLjjSjjPjU.,S^ .YthV$SYZt jfZ뤃Sv ԑLX1]US]w>.t.t)9ԑLr!DP: Zt;ؑLs ..؋]U5Ly1LܑLZU5LH.XU5L.XUS]uTu P{SPjh]US]u+u P{SPj?]UE Puj& UGuPh$ UuPh$ US ]uuP{Suuu jPQ$]Uh]#uuu uUWVSu5L965L6XZugu,u4u(PzVPjj%dƃE}t'E8tE$9}uYtEE$t9}=2}Et,~(E8t P覥ZU$DE9rE} u)@E }y$u{[Ej PzZYtE@M}})ȻEE9~)ω}u uVQM5LsJÃMu$u uVQh^$5Ld11MaSSLXMtW5OMZYMM5L%PS5LPSjjSv$SւE @PE@PVMQ5LIP0S˙ P5L蓘SrP5Lu'u(PxU,Ru$u uuP$t6SvXtSWLW S\VPqSke[^_]Uh]#u$u uuuuu u3$US]uuPwSuuu jP/$]Uh]#uuu uUS]u5uPwSuuu jP$]Uh]#uuu uUS]uu PMwSPj]Uh]#uXZUS5L25L>2؋]UjKXUS]S hf#] P $譄k =$Lt7SχPhr%5$L^e5$LN5$L1$L=Lt8S菇Ph+r%5Le5L5L1ɉ L=LuhK.hBr%x XZ]UWVS hiO#P.e_ZuohRjP͋Ph$hK.dSl jWh#SSf _Z؉Ph $uY[ @'tCVhSI uW$Ww t ;u뵋Ct{ tዅh#Re ZY€:=uZh#Se ZYhYr%S ZYWS ;VU~Xe[^_]UEPE 4UWVS 1ɉJ Pd ^ Zp j h^r%Vn uՃ{ uC WHG h۳%Wd VWd WujƋ;7Pv yC9C u=CPWvg_Zu艙 YaCPsQg_ZtۉC{ CP#GC V"Y^e[^_]Ã=Lu U塄Lt uP躽 XZjTUhf# YtPU Zt h۳%F YRhjh}YZ hZjXUWVS$1ɉM܍}14Lj5j†[_]߉j jPM =4Lu:SYZxEPj w_X}`jh蚏[^14Lno|j LPjhXj LPgyjh5_X=LCS<E^ujh Y[S=Zu L1$Hun=| LPh$jXj胅 L)t]SU^/}EEjPcY[EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEPNe_1;}s7klE@0 t(Pdt!ztHhr2p8p4jG19t4EPZYvGVf_}uSY^ujST[Yhj]jYj詒uBj]SDZYu1h"$*d SVSCjj^EPWXe[^_]UWVShPV1 hhgv%V hVW $hh#%Wܼ Vu1EW~Zt/SSSSSSSSSSSh #h4jjDY[ WVXZ뷍e[^_]UVShPV聻 hhgv%VQ hVS_ $hh#%S, St VS.XZe[^]UWVS}11u܉54LjjM_Z$yjVP^I p] L$*u u^)uYjhc'Y[7u>tPZt L$PX L$S_XESObSY^St]Znv%yv%SE_5Ovjj5Oǝ5Oj5OvEPj  }tNhj_jZj衏u7jS?Y^u)h"$%a nv%yv%܈HZS]Xe[^_]UWVS}11Eܣ4LjjqZYHwjSPG xpu L*u$tPVu_XEV \[u4EPj ZY}t!hj`jj螎u qV臗Xe[^_]UWVS1HH;E E8u EH1LEL0< t tLEL8P贖Y$}1ۉ889E S苖Z9$PuS贗 O]1<%rA <%t)R.< u"DB@C8Cuj PPS4 P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uR.DP@tC8u$C<lRpSPËE YXۋplt 3F늅t 3}uWfW.< Xu#$LtRhB'hw%PKe[^_]R UWVS0u 1EEEPVEPoP ] 1EԉE܅ukVhx%E܍t0SE)Ph"VP h9x%S ƒE؀8'uE؋E؀x*hؘ%uL ^_]EԊk<'uMCj'S:\^_E؃}u SiY؉E؋Eԍ4VurOE_ZRSh$x%j衘 j 벋E؍J9d<%u<@Q)IB*B6j/V ZYDžtVJ EXuЅt GE/}!u_HEuݣ M܋}ԍYtqUĀx .tx uuW· uˋU;2tEԋEԍRUuNEZYUWVE)Ph}%-wjhI}%h`L貕 jh`Lh`Lj{hh`Lh`Lj}@Lu:1ۉllPj諸^Xluhh`Lh`Lj|?`LXDžD`Lu DžDv$`L=`Luv$L=Luv$L=Luv$`L=`Lux%`L=`Luv$DVSQRhLPhLhLh#hE,`Luv$`L=`Luv$L=Luv$`L=`Lux%`L=`Luv$VSQRhLPhLhLh#h(jjjS x%x PA) Y@LRh$h hZZ?H@P=hT}%jtj^PL_V=`Lh;]$hq}%5Y^u>=$Lth5$LP裄 hhK.P苄 j'h}%jTpV V3WPh}%h}%ST =LthLh}%ST =`Lth`Lh}%ST h+z%jtTjoOS@O=L"XhLhLhLh}%jh~%h`L hh`Lh`LjjFj jhMhJ9$V3M=`Lth`Lh~%VM h+z%jMYX@LLtdFSPh^%jL=`Lth`Lh`LhLhp%VLh`LhLh%VLh+z%jLXZh %h%lYXǯPh%jdLhy%SYLhy%SNLhy%SCL$=LthLh%S'L hLh%SL =LtPh.t$SK hLh$SKSFh+z%jKh%7dZu/h`Lh%KY[h%KhLh%K =`Lth%KhLh/%K tV;FZj\FXe[^]UWVSUʋM2uBIu$ttyt ut< }]9t` y_v4mtN\ 0H2N0H2N0H\umtf\\Mt@BXZ[^_]UWVShƉE1EE;F URuVPLà t MUt]at*tjuuVЃt؉-RPURWtjURW  ]E]bEe[^_]UVSUE 9| 19[^]UE UJʋ HRP]UE p1]UE @]UWVS lj֋tZRUeÉ$URW,g u6EPjhjjj EPSP? E t8u }u1e[^_]UVSMU ZLALttbU M[^]nguEY,t:r,t-9r&9rY8r89r9r9[^]UWVS ƉjR ZYjh h PW W  uPP=Tt=Tu<x3P9$u%SVh%hWSVh%hF e[^_]UWVSEM܅t5Rh %EP - E tjP Ƌ}XZtW/Y1hɍ%SfYZu UE}tPuPh%VuE/t}u9Vh܍#}Wi hǻWSujPTP$jILZqe[^_]UWVSË@@kPhPs&pYhaPp 1҉ll;Pl tVqdPRL t{50L1WVxt RPWVu| RPdph$%uVY EtjPpVل hVpĄ l?s -pC Xe[^_]USExtjjUXhHSPhS#Ep!]UWVSEU Ћp$RVSPL @t1҉ t VSЉ ^_50L1WV($ RPWV0, RPsh9%hTV 8t'hhؘ%V蜃 h8pV舃  t$hhَ%Vl h V[ VaY‹E@9hQ#DP XZVh$Ep  e[^_]UVS]u {t5F fC ][^]6[^]UVSÉ1ɺɍ%%ujVPh]#ShhO#pe[^]UWVS\ƉUM1ۉ]1E9tXE 1;Y sHFE1U9t; u;Zt(@URSQMPL Mt EԃUCGju&EZYu 1ۉ]Eju&EZYtMEEE}E9E1ۋE;X skFE1EE9EtE‹E;u;ZtAE߉MEURSuPL MtEuE_E@ $EC덃shjjhejhj_ZExN1jSEp>~ S}WS}Wttg`PR{_[^tEPPR>ZYtU6m8t,m8u"E@t$RP_^_uhɍ%EP+^Y[tEXt p$l(h,`d04t:$VS^_Zt'EPV4PhJ%hSEpFjhU%< Y[@+$ha%hp%SsZVh%WgZWh%S$WgPh}DS4LSG ?Ph%xN‹ t ?tPh%P_Zu[h%PbZYtލRh-&PX tjj h]#04,,RPj$W S:ZR. tHLDJ@tSPWVhƁ%hFPO' L1󫍝DžƅDžLDžDžShQV[  Lf=tfyfLf=NE1f=FX!ʉ׃11ɊLLt 'w4$@'w'$@'wt$@(u$@| uu1Ƅ$jj h]#04,,RPjS' $PSVhԁ%hFP4J1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VY j!?jAm.jUjj h]#04,,RPj#W (S?PWVh%hFPqLjj h]#04,,RPj$S SVh$hFP#0E@8@ue[^_]UVSPjjuVjjh0C'&@tbuXtSjjVSjh0C'c&@u S!Y2hؘ%S ZYt PuU ^Zu S![ hؘ%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhdEP%ZYtE1UWVS`NjEw1hڃ%w Y[uF h۳%w lW[ZÅt#hLC'6XWZYGEt똀\t @BJu Xt@wL L$t)tVP҉[Xt L$1҉9 LPSVYZtXP,40Sƒt/t#VRЉXZuTRY8puo$uVP҉XZtً$HjjjjhSQRPx jjjjhSQRPx ۍh?%S h LPSu h"P h LPPuu W(R#S^pT`~a9fhGPS&u hwVPu ;h?%Sa hwSt h"SB hwSt (uYh%V hVt hwSs Ph %S譩 à ƅG1ɋÅth"STZYu!Ph %j] à uh$SSZYth#SSZYth$SSZYth%SSZYth"SSZYtt hh% hh %Vs hSVs ƅGw PV3à wh$jƩj9k؍e[^_]UE1҉UMU ].UEEMU ]UWVSQ]} E10$hnj6Su E%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVSE 1ɉ1D󫍕D1҃=4L5Op.h`J.M 5O=4L GuujjRAXZ1Ҁt,DžfDžDžLDž=v Dž1ۉ11119tD5fDŽ5DŽ5LH5=fDŽ=DŽ=LBC8[ty1t1DŽ[fDŽDŽLDŽBt1DŽYfDŽDŽLDŽBhjjjjjjjjjRPj蝜Ã4uDžRuh$j DžPStuiu5hjjjjjjjjjPjƃ4t@DžPV蝑ZY^Hy VÜXS躜_u?t6h辤hPh$.m  L$.DžM=4Lyu4LDž&1ۉ4L9i8511ɉ9=4Lt9i85Lt(~SWMYZ[ڋ`L Lƀy1҉LPTXjSPl hCP L"Pl jSh8Ll 5 L,, 0$4(804DH$u"u $1҉DHQ,RPFP$ L()n,, 0$4(804DHu u $D1H$ 4LHpuDH9jj h]#RPjVd jj h]# L$P@ RPjP1 $L8t$ LVHDPh>%R  L$p^ơ L$0HRRVP LPjj:5Dž1ɉ$Pj蚍^_u65 Lh`1Z7$P1$Xu@P4LP5 L Pw^ L$HXDH-1ۉ,048DHƂ(48<=4L5`LaL`LYtu Lh £`La1X@_yuƆy$tP,40Wd$͋e[^_]UMw1vB ]UWVSDž1ɉ L*)Ph%hSɍ%#t+hg)/ZSh%h/ juh۳%] LPhH%hSh۳%Sh%Yǃ(h۳%ShjlE0p11R蒊ZYtsE;klEX{41 Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQhg%h葼ǃYcLubXZ=4LCLS聋SRV融ǃSRjj\0jj!6?$B'v=IC`,tPh %hV7Vh%P C`,tPh%hVCXtPh&%jWWV C\tPh-%jWWVl ST"tI%t|%VPh4%P CH@ɍ%%CX,tS\tPhM%hV<VhS%P %%hf%Pp _Xr%ł%hx%PN Y^%͂%h%P, XZ%ׂ%h%{Tux%PP ^_%ނ%:13ɍ%%$tt1=161e[^_]UWVS L*Pƅh%ňh;]$h$Š'Ph%j$=$Lt" LXSPh%5$Lu6hi$LYt Ph% T XZjj3_Xh;%WQ$ LY[1D)SPC^ZmPdRq P,V^ dRh%W#TPVCL$TH\@H1ɉD@9DtUh"%觾C C$$C(ɍ%C4C8P%hV%~C hhLSP%x%ƀLhc%hLT ZYj/P[ZPL]UVSE] ut VSPFX Ltu] Ee[^]&Xe[^]UEPu u UVSh %hl%eZYt6u cPhy%jVuSmSh+z%j$e[^]UVSh %h%heZYt6u bPh%jaVuSS*h+z%jE$e[^]Uhƈ%hl%ZXZU%t"t "]1]US]SZ1҃vjh#DP: 1҅‰Ћ]US]hrB%SwYZ¸LtSZ¸Lt@L]US]hrB%S<YZ¸LtSiZ¸LtL]UVS]u vv9tWtNVSjh5O+h5Lh5O$$h5LXZ5OGm5L; j V t.r#tC(PV5L5LhH%hve[^]UVSh6%`hPh L: h LeZL5LZLPh Lh%hhL (jhLhoO#<] hj&j<6 hhK%jjhjHj j j jjjjgÃLx +.jPp]+.Sh jG6 jj{& xK5Lhr%hV hT%x_hPS9 S\SV e[^]UWVSutrFF=LSWZYtMSXtpWqLSh L5LhZEv\URuh@LPVSuh%j蛍¸$KEtVS Veà E)ËE9th҉%hD'hG h%Ee[^_]UWVS EUϋMMjWY[tK1MU9t FRkSVPNƃtPEV7XZ]e[^_]&e[^_]USj$ubZYtD1ۉ]XEPjhjjj EPSU Vt;M rj$S뱋]UEPM UXUEPM UXUWVS Ɖ1uPkƅ茗Phi%Wu tPkY6%t%Phx%kXZ^%t)%PhL Vj&W Hv|=Luj^1+.Dž&.DžjhhQ%jPj(Vu1hLh&.V藢 ]#=+.u3h).hn%ZY]#u~%=).t]#VWRh%h.WS =LujXDžjhhQ%jVj'U(=L+=@L=Lh%Va V hLVh%SJ Vh@LhLh%jX$WShv%j?Vh%j,V3 WS Y^DžVj)TXZS=8LtZ=LtQ=LtHh%V蘷 V hLVh%S聪 Vh8LhLhʊ%2;e[^_]USڸxtjSk5 ZYuSh%jH ]US18tjS+5 ZYuSh%j ]USSJ=tswg1EEPj%SEZYtt`Huȃul"hָ%gX t&j hָ%gYXKuh %jTfXZ1]Ã=LuiUL"K`L$%<M.%-dL `$Mr%Lr"M]USE] tPgYSjR[fXZLE]DUWVS18Z1Dž@DžDDž<jj&V ZYt"hI%V ZYthO%Vx ZYu?=LFLhgbSjPjP+VtpLh-bSjP~jPSlWf tlLuQX} t{uhW%j蓁YX}tuVh%hxƒVh%haƒ W@/ WXZt-ttLVh$hajj0A=Lt=LtVh̋%j C`Lu1 xLe[^_]UVS]u St tuhҋ%OXҋ%۳%2u܋%jjPVSfe[^]UWVShh%踅L_Zt Ph%C [^hL1L1۸,.P/t8t`Lu ҀuAلt hLDž,.{5tL/y;h`L[lLu1uSZYH/lL5tLj5O5OFZ5O3|LxLP5hLh%ja`1LPj Ktu`L|Lue|L111t0u@/u#pt1`LuƆ`LB뷄t/|L'tju_X`LuxLhLu9uh_j 0VR5lL5|L5pLPh%h^ jj[^1ۃ}t_oLtVh %h}ZYHu%h-_j^_thB%j}Y[hy%j}h%j}lLt}h%jt}XZ }h۳%LRPo urhڌ%pLxRPQ uT|9u;xt8hߌ%h%Q^_th%j|h%hI%_M>6W}uuh %jT|Y[juXZ1e[^_]UWVS+.{t0u1#W3PYZtWh$h-] ك1ujhPXZe[^_]UWVS1hl%5KPh$P ytQPuXHh[%JPh$P xhs%JPh$P y6륋tPXuh$h4G\jj}0H_xP5h$ à tH^ySTh;]$PiXZ1ɉu|S1W۹uh$h4[jjRh#W ZYu$u t*Wh$V ShW詪 u<=uDžS|Vv_Xtqj[^uSZYtCh19[j^_u2Y[tjh3XZ1 jh4bFWF'؍e[^_]UWS]S 1E CM [_]Uu uUWVSW]S 1EE @u1ou tkl1ɋ}9x4uAl9ut؉KjlQCY^t11҉Uu ;s'klM q}9~4ukUlSE@Ұe[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtCڍe[^_]klCx4uFtWXF 9sklS9z4uB4@s{XCEe[^_]hUSQ] =&.`,.t!1҉UURhbtP`,. h&.hbtS uk`,.=&.u\jh&jɲh&.hf@ug=&.t&1&.h&.hbtSD`,. &.]U=&.ujjjh&.h&. V&.tP5&.XZUVSjhPjuڶt)uu P @uU0SlH0Z1 SZXe[^]UWS] 1Sh|duw t#S;S t%iSR3qZYt3X1e[_]Uu hzd@u)UVSujhPjVt(ju jPV,S蛳y n 01e[^]Uu hedAuUU EHJ Ju BklsM9N@uLM9NM+KQsPR` u&y j#Eu qtfa EfxNA t @fFFf9ߍe[^_]UWVS] u@(D=Lu jNLXklhNA0 y80L1RPq1l覤Ɖ׋lAdP9QhslhnNPlRWVhK%EpEXfC u>LufC ;^Q8tWRPQL }E8Lu.XfC uVhD 0 tfC txPT0L1҉`dRPTP聣HL|]d`SQX\JlppX\uX\lt4PTd`SQX\tj2 t j3LXtj4uu2Y_FhD8L`}Du/E t)E8u!LuhZLLZE}`th9LXGFhD0 thLYG@PtэL)QWNht18RЃSZL9sL}uFEt8u:Spl\XLHhu%Ep@$f]#`tEt8u]#PEPLPSRRpl\XLHh%Epز8e[^_]UWVSXu} ]=LhJLPZY9L}LhJLPZY9L}LhJLPZY9L}LhJLPjZY9L}LhdJLPFZY9L}LjGCJLP%ZY9L}LjH"JLPZY9L}LjIJLPZY9L}LjJILPZY9L}LhILPZY9L}LhILPzZY9L}LhtILPVZY9L}L1ҋ;Q$s+k UA(0=IP$ZY9LU}LBʃLF@ t_u {4 H A#EE#UjEUt(qt h]#5Lh%vf t85L0L1RPs$s yRP5LS4C8u%uh u h8H_hPR軑Y[P5L5L0L1RPss RP5L.5LC S$CS 0L1SQRPڝRP5L5Lh%vaP 2u1C( PGP5L2u!SH1BLPcGP5L.2uSH1BLP:GP5LlWu'CHpX5L5Lh̎%v躮 WuCHp\5LρsCCHP`u&hFP5L5Lh%vbOEERh"&jP߬ hFURjPà P5L5Lh%vS蹹cfx5L5LhՎ%vCH@Hth܎%v̭XZCH@Hth%v购Y_CH@Hth%v蜭XZCH@Hth%v脭Y_CH@Hth%vlXZCH@H th%vTY_CH@H@th%v<XZCH@HE %FEe[^_]BuCHP5L5Lh%-+{jPMQKQWsPRdk B(0E}WP5Lh%v詬0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4H8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhCH SPXZ1e[^]UWVSu jFHP}W jWWjjjjj GR.E܃,11ۉt}DW@uu@tA~Ht҈Uth#SXZYUu GFH`L+/tG/jSFHPjSW FHHL1e[^_]UVS u vDh"&j ]SE j SSjjjjh)G0SFDVHB`1e[^]UWVS jj%躱[^8hBC 03hBCC03hBC C,03 E1҃t^tZ @F'tOE4F 03}Ou/UDEjh谋}EZYUMB"t}$vuhAF 03X}$th%hD'hh(% jjjjh2hjj jjj%SjM8ƃ4xu P#.Vi9Sشe[^_]UWVSQE @4tt3t.t)=t" u E x8uu u\XZjj ^_x 1҉j4 F'U荊G 4UBXYu؍{sh@h@Ch@C h@ǃCjjjjh4hjjjjj SjMR7ƃDxu P,V38S袳1e[^_]UWVS] B({119tuklKI0΃@jj h]#BJJbRPj!Wc jj h]#CKJbRPj'P9 8uth?jPPV E@ tPs?jPPV ]#u hO?Xp@?0/?'QWMQVRPpjjAL,jB>SPh$j -P* LjC>SPh$j :P L0j->SPh$j GP jD>h> bYÃsLDZ£LTٰ-LƄT 19~-@VhZ%jPhLS j. >hLP5L5LGP:P-Ph%hhL DhQ%BXe[^_]UWVS] L$DV4Y_(V0(C<@8jPM@ x 189}gGwu CP@@<2<9s SklLT<R+A<Q@+QP$@ 09ȉЋ(}fF돋<@} Ehvjjh7jjjAjjj8@h\3E4URP(u=4@觯}j8H0<_Zj $^DPRH04EZ1ɉ(,~!klSLQA<Q@(,1@8048;HHD88`VpWRLV7uVP 9jj,(40EU+04RPjPPQ,PTEUjVP @V PRLk@8< 󥋽 x08x4@u}u} 40WV蝎)׉(,8E@@PEp _Xs$Ep@f E@fx@CklPsܩZYVCU<8kl4@0E@)Ћ@)P880PxCUk@l( 9s)klPVPM 180(󪋅<18@98tNH0N8HV@8 QPWRL 脨B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhv;h(6jj7jjjjF +ƃ4PV [V+E)PB89B4<联PZufLW WPF8PP8 WRPQLP $AEX$뱍EPj-EZYD(LD0Lse[^_]ÅUWVS5,Lt/uujP S vthj6XZe[^_]UVSE X(uNpvƋ0kVPsjhSà uhCjj ؍e[^]ðUE1Ҁ=,Lt]f]UE} t=,LtA1]U 轍h%h%j{!EjjEPEPjhP/.y$@t"EUu=th%j6!XZøøUWVS,]EE15(L5,LuCSEUCSEUURURSЃ tԡ0L@EU L;\`|.}t1hjQZYuEP@sKut9։}ȉ(L,L 5(L ,LEEЋEE̋E E11E܃}E,1}ԊEYDžPjXZuCU @=hLhLhM/hMhʓ%hiuhMhۓ%h%|h%h?tVh,%h# jhN.Y^thq}%4PXZCU @<1e[^_]UEK]UcvEPE LP1]UWVS] E8pWZYM%tX%VPREp[]e[^_]US] CPhLG'jhMm hM3jh ]UWS ]1E PJ EUjS4 e[_]UWVSdEEj2]Sh]#jjjjP44G'7}E p EfxuM y}wV@$ G'S) -lU B7S HM A(S } GS U B S ] C[uI YBu @u }1e[^_]UVS4u ]w>E$ G'Ph+#Ph"Ph܍#Phd%Ph7#j2S 44G'SPhg%Ep[e[^]UVSu] hj9ZYt,hs%hkZYFu @9@W1e[^]UVSu] FPjFph%htF@W1e[^]Uh,hs%h UWVSp]H1t=u41ɉ 4Lh6jPJ SJ_Z`/.1ۃtqQtVhj PE PhLG'jhMP /.MGtq|L/.)hLtPe_lth%hhLj  }Ph%hhLjhL/.$thܔ%Rj $3,WPh%Rj=$Lt$Rq$Rh2%W\ WM<$dYv /.9./.>"FtPZt F:F;CThLhLhM) 1`/.Ct@t!1C F zuʃ5Ovjj5O襝5Ooj5OvhLjjhhqj&jFjjjPjÃLPSS e[^_]UWVSX5O>vjj5O5Oi5OvH1DžfDžfDžfDžfDž fDž0*fDž.j uX PsB ƍ hvjjh;hj&jFjjjjSjÃ8PSS e[^_]Uh]#1UWVSQƉh`%h;]$PMZ uA=$Lth`%Php%5$LY h`%pPhp% /OuPh%Ph% _XVh%SvY SBt]th`%h#%Sj7 h`%Ph%Sj h`%Pq$LZYtuVh3%PY 5$Lsujh"V V aX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝu1ɉM] u]u]܉uu9u]{ u ;}}w1] 1ۉMԉ]M]x(Ã}t*M 1]1 uM ]M]U9uU9u {;u U| 9u܋U} U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]áM"UWVSXE؉UȉM]E EUE} }}$}}؋wu}9UM}։lj]19؋]| E1ۉ];EE}LuuWV?ut4EUuuWV?);uE}u}]؋EUCSE܉U1ɉM̋EUEUE9ƉM ]9]E؋P@MAQEUEM])M]EE1҉UЋM9M+}EԀx EEԋ@1҉MM]]1Éً]1Ӊ]ˋM 9u]9ƉE9Ɖ]E9E܋Eu};EEEUuuWVF>);uE}u}E9ƉM1EEO)]9؉ӋM}EUEЃEE9EE]|Eȉ0xUMPH EE̋EU׸;EEu}uuWV=);uEu}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UVSQMAQuRPRPjjjjO IuEU11ҍeY[^]UE]US]shA%j ]]v[UWVS]} j/W ZYƃth)PCDPW ƒuMV`~Dr9s6t'19ty u9t@e[^_]Uju EDPdUEvPEDPu 褰 UWVS]=Mu 3MK$9C |b5M9s sW}jjjjRPRP t39r,1tu{(u t @9|1e[^_]UWVSU}119y u 9;] u}t uz(tt}hW[nЃu"9uǂǂ1J Z$1ɉƀJ C@]tQ%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVSL1ۃU U]UWVS]u=Lu1҉U1ҋM9bx u 8D;U +}ߋE싃E苃E}t }u{(u1+FV C S$FFlN(1tF$1F,MPFtk9t jPRm F tV"}uM9MuǃǃFt$9th%hG'hdh%F t'uBK 9M sM 9rE1e[^_]US]=Lu!w k L"1;Ms k4MC([]US]=LuS1w^G'E[]UWVSSÉU=Luv!v=M M1k LB9tp4;u(}u1BRQOZYtMMk44BMV 1Sh"&jRUE F htW~ SPh%jWE F'F(UV,~0F((e[^_]UWVSPu]=Lu1E1M9z u :;E  1}1ɉKC1C CkEt CCEC S(‰C$EPC,}u uK9Su;u tK }u0~(t*u!K @N 9M sM 9rE1Z[^_]U1ҋE ]USR] j EPu$ U:tt huX1 k]UWVS0]{Tuh3%hG'h{XuhK%hG'hh%u{\uhd%hG'h߃{`uh|%hG'hȃ{duh%hG'h뱋CjCDPV u h%VD, XZ{4uD1ttʋ5R.DNuT4@׀{4ujh^"C4PY ؊LD tB:u JNPh%W h;]$WG ƃiWh̗%jgPhۗ%VgsXs\s`h%Vf,Psdh%VfsTh'%Vf19aW 4H'PwP7Ph2%VtfG P u"OQPW RPhJ%VGfH9~h/%h4N#V fZYZh+z%jfV`PPVhY%hi%jkÃ(V Xe[^_]UWVS@E PẺUЋE @EE @ EE @EE @EȋE p@ E1ɉMMMMUjjuujjjjE u}zhM]EUEԉU؋EP@9ȉ|YtTtOM܉]}ىΉ߃SQWV-)׉M܋]))EU؉EԋU؉E܉UU9UEU} EE܋EEE̋UЉEU9M̋E}M]ċEԋUڋM̋]M]9ȉ} +EUĉE܉U=Mu %ME1҉U19~W}]Exv(*uutu Ex(utP} tƃEC ƃ1EC fǃ؍e[^_]US]{Tuh3%hG'jg{XuhK%hG'jhh%豄{\uhd%hG'ji{`uh|%hG'jj΃{duh%hG'jk뺉CKUU U@8P1RPPjhQd]1UWVSPEE=Mu111ҋt]}u=G'u B8 t88  Ӌ9H' Puuu jju҃t-Ӄ띉uhG'uuu jjuH'e[^_]UWVS] ߋuE;Utf1Myt]J8{ sStWVPщC u5EuV2P4CZuEPDCuEjP4CXe[^_]UWVSj LG'9 LlLjn;_11lI't;Gu܅tT5MP,;M^t7;t R'{t X'{t L1҉SKCYe[^_]US1ۡM;MstCPCX]UE p 1]UE @<1]UWVS]} O4u Cf` 2@XtQRЉSfB ^^uփfB f{ufC4CEs1EU9U~*Ex ufP ufP E΋OfVJt Ѓ9tЃfFJ1;p$s4Vw4RP`EG8CfH ʃ}ufP FÍe[^_]UE @1]UE 1҉P1]UE @1]UE @1]UE @1]UEPE ]US]E UuhHPR0Yu hZ@EE $CE]5UWVSu} ]=hvjjhyjjjAjjjRVh˺E4URPhu謻V7}51Dž<Dž@;us<`RVSPL t$hl`d<@FjHH24A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV[)׉<@8ڋE"C t @]fCEf@ DP7Xe[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(4y8WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3薤C S1e[^_]UWVS0] K4Uus 0RQPVL Utss3蹛CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅tLNt*}y$}tctWURURSЃ tEtc}WSЉXZU}uOpYƋ0NVPjhp9Ƌ0.VPjhSSOYe[^_]UWVSuEhEZY]111< tuB9}΄t1AC}11t u,9}ȄtB1uuh%jjjR9}AGŃPjjhD%1e[^_]UWVS`}1E ]Ejj1-E^_|@1.0.x@SPHEU LLPY19|E }1EjP4E̋M9jjVSuu0L1ҋu950L֋]}EURPjEPQƒ01EUEUEUEUhjjhhhj6jjjjujÃ4u uu0ZmEPS觩SuZ0}u#EMQ}WP @u uXUE EP tBUfBe[^_]UVSR] 1ɉMS4t&uVRP u uaXfC<1e[^]UWVS] E@fHPR0_usCthpW^ ƅhWWjjjjp' t%RWP@ZYuX붉Ɖse[^_]UWVST}1E ]EPUUE@$EjP`*EY^@1.PE q$1ɋU9tED8\AEȾ1. ;S sMQRSPL hjjhhhj6jjjuuj跱Ã4uu.ZzEPS@S膲u-}u-UE;P s"]S]SRPu u\X1}t$UEEx ufFe[^_]UWVST]SSPHEU LPLEUZY1}9M|EE1E}u} jjuuuuEUEURPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M oku0}u jjuuuuuujURSЃ,Hu1Uع1EUEĉUȋEUẺUЋ xt!UjP4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|] Ltf(xtuhK%hI'hh%pjxJ54Lt\U,PLhjjhyhChRjFjjjuPh`L輮ƃ45PL+Y60謷Ep蟷|7蒷xw脷jj h]#jh0jUR ,jj h]#jhjMQ MQURW|xu LPjhK@hQ%4 L$0E L$pEEEEEU׉ u11MQMQSЃ UtEfEE EĹf@ @ @f@@,=Mw@ f@*@,=hvjjjjjjjjjQRhǃ4t PŬ@,SpEPWWŭEt11!UMQWSPL UuG;{ r&}u}tEuEȅtߋ҅t1hhjEY_u$LzPhc%o S"ZujhN_XO:jS[^sjhs< L@u ǀ@>U1]1EEPV-XZ}y1Q1҉Tu1Hùxt%| q1@ 4SJ+|GEE;xrB;Us E11ۃ}t E;]sP:*C_PY'YVݫ5PLG'XZ}e[^_]UWVS0EDž}uEmMjS"ZYt jSr"^_u&Y13jSK"_Zu&&[^ƅ1;MM} tE 9duE(u)tURYu0; $s{ЉuE, EDEHʋ9Ɖ}fjj h]# WVjW hqƃ 3WVPh%Vz V Nj8ƅ3迱P Nj8XZЉ8@ NVw؉1=u5ho)jj h]#EDUH,,RPjWz E$hpΰRjPCVX$XYXL9  $vVP V[Xpf $V $S?X[f V #WXÃ9r$h%hI'hh%GbuZ1hjjjjjjjjjP趦Ã4tPSL^X19s 419t4"@Y؅ttW"Z""" tS Xe[^_]UWVSljfDžv/ƅujhָ% Y^yhhָ%S&x zDt&;8t1WPh%hS hWSw =Džp!j/SA _Zt.xv9tH9s8/tQ{ YyߍxPWYZ%=puf>hQW4  iƄ/u%:QPh%hS $hQSv =@uW,{ ZuhWPv =hS, Y_1Ҁ;/u 1Ҁ{‰hSTp<$TZlhЃpDl=w4uhh۳%Sv =whWSv =v (e?VQ _y eV% YdVQ ZV dX1e[^_]USÍEPSYZy1]EtjS XZxj `PSr  t S YS `Z=vf u]UWVSEUPZ ^ƃ}t11ɉMVp Zt{fx vX jhc%ST uSuh%EP @u hu# 3Et}tESWuh%jut[zVCM XEEe[^_]Ujh+Dj UWVS hÙ%辙11tY+ڸ̙%xuڸי%tu#WS_XZuWSKY^1yahי%KhPSs WS1u hݙ%%PSh%jSh%j75hS%hҙ%S莘hPP5s WP8u'h%S]PPh%jrh%蒘hPSr ShT%jGtPh%h%j#uhę%ShPWr h%S˗PWh%j,hI%S诗hPW\r h(%S蘗PWh%j,hę%S|Ph;%jMh%SYPh;%ju*hH%蒗hPWq hI%S PWh%j;(hÙ%XhPWq hę%SythY%Sǖ Ph;%j hX%hPWOq hY%S苖p141.Ph%hW  ttpWh%jdC utjh,eAXZte[^_]UETLfP]USE@k I't!I'ShWE 0?CXL ]UWVS$hƍPhW@j>@1jh%_ZRhW@P> 1ڹI'1!tT9u Dž0AVPJPZYu=TLB 'G jjjjhjjjjjj!ShÃ4tjPS芒SНXe[^_]UHXLtPPRRRh)%jpUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ0L1RPSQ0RPhP[$j]SS ]СLEԃ7x6PURjP<7jPPh`L n S% e[^_]UWVSĀE@klu Fǃ~u~uu?u G08uw011ɉM1uEPj XZ}E MQw8P uEgP[[G81ɉME u;p{k]lE X{8tIC1ɋu ;Nsklu ^c0AO0}u}u ]u]uutu9]}UEG0uW+EUu FV}t ]U]EUWE `1e[^_]UWVSd} E@9E Ek] lEpF0tP}G؃Ph%,1 t-hPE@Ddph%j(EP6 1҉UH4Rtu}GpTpP^E^_@8tPQ҉EZYtыE@DLt$h藝Puh%j(uV uhsURjP/EMYK0+u@u={8u PREPh%Ept u`X} uEe[^_]UWVS] j){X1119tklKA0u y8 B݉t+ut8j,蚜j+葜SPh%jPV 'tCj+rjPPEP j,bjPPVe h4N#;j*EURjP0hQ%Lj-SPh$jF^SM j. hK'PSh%hhL( e[^_]UWVS8Ë@H1{$C$EsCM19tklD>0 tfA A B}ljK'fG G5G`G G,SG01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{~S(xE+C$PRwXZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP;DYZuk{8ueEC8EC4FV SVCPpP4x_j0Pp4[^uLEe[^_]PPRHHLY@@ @O9O$u;Gu1҉$(HL$(4DžD1,HLP@9,k,lPGP0Dut ,Du|0xH8t5@t@(SQPRLP@ D0u+s{ 19}2LHWV)$(,0)9D@P$@ 0+$(P+GW kDlO,ϋ _$(19}t~8uklHCBVPDXHXXe[^_]US]5O=5OwYX{$ujCP C$XZC($h`LjjhhhRjFj jjPs$hLtC(4ys$1҉S$Y1-C,SP@js(us$C(1C$C,]UWVSuVs[t$V%Yt&jP&K S uue[^_]UzhjXZ1e[^_]UWVS L$)t uiVu`j(PjRƃu1O LjjHDjjPÃt͡ L$3t j LPLSЉƃu11P;^ s-URSVPL tEuEt 8uPC΋ L@u <@TXuuDHTX=4Lpjj h]#,1ۉHL,ËHRPjXPjj h]#jhj^W8jj h]#jh0jdSpI{H 07{ LDP&$WXRHQDjP pzH0zSWXWHRP LPjj'p(hQ%{0zlpzpltDžxDž|}1 EPt!EfEEEDžPf@ @ @f@@@ f@*@,'PW=Mv~(u@0f@:@<BhvjjjjjjjjjREPhpÃ4t#Pbp@,SptPSfS_q|Cwc LLPdhTXlpF(t|lQdQP҃ fVYexM|AEAEA Q119~.u2FN<uF EuPEXZC΅juɋEtY_1}z 9u}Wڹ\fB EB h<jjujjj(jjjuSjVeƃ4uPZV;fSEEEe[^_]h$jXZe[^_]UVSuE ]wi$ N'hOn A[4hP2[jhPWy3 hhَ%WI4 S0pz t7z(u1hhؘ%W4 hRW 4 ,9u|h-ihPW2 hhَ%W3 S0pz t7z(t1hhؘ%W3 hRW3 ,9uWh$v [[$h.:[ h/0[h0&[h1[h2[h3[ h4hSPh%ve[^_]UWVS ƉӋ}ɉt,h)hQPSh%hS tWSh%V.6jj h]#EU  RPjWWSh%V,e[^_]UWVSEkE <EXp8V$N'|thxuhhgYP"Sh%ps8P@xu!h#P& XZ+jjjjhQWRЃ tQWRPLt tt 8th h!,g_謰‹ Y^tASRPh%hS. @jى$P҉t5hhx$W0 hRW0 hhW-&W0 $@j1S"@1uDHM] 1ɍe[^_]];ƅsh%W詨 S0pƃ 1z td‹@Rjjv@j  ;{@u-hN[dZEE $@Ee[^_]s%RP hMPR7 F8yMD(~&PhF%hW hWV MD,~&PhM%hWݶ hWV MD0~&PhT%hW誶 hWV PM؃PVh[%ho1Dž88Mkt1;8 8tuÃuTMB1L%hQ u+t4;t1҉|Y~H|e[^_]UVS]sjh"V u*VhP%hLQ P@?jhx"V u3Vh`%hQ 0|1jh_$VN u$Vhp%hP uetV1҉POjhu&V u$t9VRh~%hPVh%hkP u ƃy1e[^]UWVSt1=D2.t=`LuhpjClMZYu1`L=Mth8j0M^_u1ɉ M=dLujHjM_Zu15dL=Mu;hjMZYu1MlM1҉XMPMTMp\M`MPdMhM0M1ɉ MMM8 M$MP(M,MM15<M4M8MH@MDMPHMLMMM1MMMMB M81=MpMtMtxM|M8MM1LD2.1󫍵MVh#jhhXhjRjKjjj@PVh(%ƃ4u L{1=L迧+SVV% =LuP LtG$t>Lt5xt$ha.jY^tjjXZǃ=L ؍e[^_]U=Mtuh%jP M UVSuu1r$ugjjjV_yÃtjjHDjjFPt$ LKS;DH} DHe[^]UEx8th#hP'hm h%@UWVSQ} E@E19u~aEX=~u8u?G8.=}u8u/Gx=xuWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$蓥$zuubP?sYtWWZtNjE@ u WV_XWPV tjVSE@ t VPZYVuXjjS7ƃxL e[^_]UWVSuXYƍ}Ĺ 1uVZt틞$S_xt,jjjSǃtSYt$SPHLPd 1Z} w#jM P'RjP8x u0h#h$P'h h%R1t4Q,1t9E t @11tt:[]UVSQMp@19|hz%h Q'hh%y9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s8SrY;C K$}'ujjjjRPRP Ɖe[^]Ã=LuUhhXUS]=Lu1;Ls k<L[]Ã=LuUL]áLUWVSSÃ=Lut=;t6L5L19t$USF PZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h%R袾ZYuj juC,S0h%VzY_uj ju躎C4S8h%VR_Zu0j(uY^ƅj)P_ZFh%VZYuEh%VY_u j(uh%Vֽ_Zuj`u@S" Oh%V貽Y^u>hg#EPV XZt( T'>ttVPYZuG C<e[^_]USPQRhã%EPjr1~-h4N#uEjhXQ'Pht2u脆[1Eh#EPfV XY:tjME+[h4N#j蠀EZYuu=X]UWVS1jhPjEpsqÍPhd@Sl @SS,qEP,[1Dž Džƅ ƅ tpÃuMtGutЃ ) u DžuЃ A댋Ex@uP@4tPh%PVT ƅEpPh%jV1\E@@Ep0Et(pv0v,h%j"1V豄1ɉH0X,H{09L;C,P{89T;C4 PCP` ^_;s@\PVƺZY{% -EX,{@u ƅC@Ph%PQ EHs4{8C,S0t+QR PWVh%jv.$QRWVh%jU. E@s%S,K0E@S P  Pue[^_]UVS1҉PTRPRPe #TuPj(PXS& P&uKht SPh$jxuVs VSS$XuhQ&hQ'hh%輿e[^]USEP]SiXZ1}u#]UVSu EP]SugE tPwxt1e[^]UWVSÃ=LuCt<;t5=L5L19t#UuSv裶ZYe[^_]UWVSu] t>u1}ZEPEPEPEPEPEPEPEPEPEPEPh^$V4 uAEyƒt ƒu&UUSCEC EC fEfC1O1kpT'Ut4VPZYUu$`T'}EECEfCGue[^_]UWVS@utc`T'CPCPC PC PC PC PC PCPCPCP3hW^$j@}Wa 8ssWփ W'ue[^_]UWVSEUM܋}EEۋM );} GEE1EEƒ< ‹E䋀,uF;E9r+F9s,t }P;U u)9sE䋘0 }t%0tt13t]ƒt<tՋ,E39Et:ƒ}u9r&39s#P;U sxU9sډ)9sу@uEE}t(}tE8}tE܉1 )1[^_]USMU Zyu t tR9Qr[]UWVSHXH X$1ۉX p0uu]9]E}u1ɉMUtj}t}tуtat\@ uуt=t8v1]9]t UrH X$9} 1҉P P$ )H X$EE}u}0]Q[^_]ú=tUwB=tGwH w8RXs.'-v=uUWVSUM119}uP0uQjVRjGуtux`ڃuV]0]}tT1ɉ]Ut4u9}u*uu}7SjQWuPEЃuGAuFA1e[^_]UU 1tEMh]UEUUU ]USMEX؃< uʄt E0‰[]UE1҉UIU ]U EEEEEEEPU EjUWVSÉЉʋuˀ{u,C { K?H} K.C { K?H} K KI1ۋ}_ik?19Ή[^_]UWVS u]}1u܉]EPU Zu tX%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EMȍEPEPEPUE_E @/EЙ]u)։]u]uEEMԍEPEPEPUE @Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋEԉMϋUeƉωؙMʋEE)׋EU t2 t,EPWVuu%BEE}u u}tE}}4E؋EؙRPuuIEU LDH~1ERPWVIuuRPIEE]ÉUӉыUe9E1MȍEPEPEPEi @tKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9[YeY[^_]aUE]ÍL$qUWVSQ1A1҉U1҉EUF0E؉E1Ɋ t,}uÃt$<t ,}u9]t@u0Eu1M]ƒ< RWvWڋEy11AtE1ҍeY[^_]aUWVS,M$](u,}01EEEEEE1U9ЋU| E1E܋EE19M}M9Eyu1EEU ẺUЋEH9M}GE;E]UE0juQu@M]E@E1;EE }Vű}΃Mu uWVD);uE M}uu)9s ])] 1҉U111*1҉19]]܃}MM 1yAQ Eù19Ee[^_]UVSEP$9p |$1jjjjSQSQjURP),1҉Ѝe[^]UVS]U M1k N( u4؄tfEB 19EtJ @u,1u.R E@M,9du 1dd[^]UEUUUUUUEUUURCU UEUUE1҉UP0UURU }UEUUEUUP0UUR_U LUE1]UVS]MU2U k V(u؄t=&ukE U1uQЃ<![^]UEUUE1҉UUURU UWVSÉ΃8t2$41jVR# $Rh{dЀ3蠅jhPjRN@ue[^_]UEP0RPUWVS]E EC0E1xp@u LLu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@t 逌}WuSZ yуtu G{0Ea;hh|ZYohiS}ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]t}ttR<tNMt?1t61u,wtw A,<vxPW/=u7sE@,9uQVP3 &=t1skE P3 e[^_]UVSuE =LuhwLX>y LCFU,U9u L@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU P6b 1]UVSUEu Nt+t6uXE@VvpSaFD.4t(vtvPS軭 e[^]USR] =Lu0j EPuU+ ƒ =w uE8tt h X1kDMMu]U U1vEEUEPU E_ZÅt*UVS14VFZuSVXe[^]UWVSQu>xp19|hs%hW'hxhC%蝕]9|@89@|ue[^_]UWVS0uU= L]ډ@E =~Mȉ\1ɉ`}ډ1@8;FF| FP1RP|~ tlURjVPL tYEċUȉḾ1ۅuBu>dž9|Ӄ!!ut9ȉ׃}vjhvpe[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E }uthb%hW'hhC%誓hjRP^_ X'u5 CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP6@ǃEPu葋^_t!ẺEЉEԉEȉC1҉؍e[^_]US]=Lu]1Ҹ;Ls)=w9t kDMB1=w kDM[]Ã=*Mu ^,*MUWVSƉ $41󫋅 EU RPVhT%h4PE E jhPjVw@xShydPMw @u V>X1V>jSu蛨 e[^_]UWVSlu] E EE$EEPSV EP ډXE8t%E8h%hW'h hC%1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}u }t#1A}tPhH%%uPuM "}tPh5%Ph%uuD ؍e[^_]UWVSHÉ1jhPjS|>J1Dž11҉1ɉډ1ۉ؉!!ׁuO1 RPh?=fUGXqWVS]?9u)9u!V!ʍ4󥉅SqOX99;ƒ<<„t <uh0101ff=Uuf=u#(,D1ɉKu1󫋽{w%RXuX tHtt7tqiEt,EPFPVC,1RP諱P  Pc~ 돋t6t%C,dDž $t tx9,sbthjUH^Zt31ۉ Dž1ɉ1҉Jx 7Xu&1󫋅fǀUe[^_]US0E }uthb%hW'hhC%ЊhjxGXZE u\ CEUY~11ɉKKCSǃ?ǃjh>RP,.@ECǃ1҉oK0SUE Z@u S=KX1d3{ uUC$9K }DURjSPL t1Mt*M19t @D=u=u S뙉؋]UWVSUMtQ0t),0Ut,]))111҉XZ[^_]UWVS}UM] A<t <t11É1uvB? ڈ49'fDžU1 WVq&)Ӊ1!!ډuAWVhPq4x30 1<^uPX4ƙ9uK9uCH!؍S3ƃSdDY9k9_'/X؍e[^_]UWVS]Euh%hlW'h .1uEE}lj1Ʌuhy&hlW'hhC%躂s{u}Ɖ 9uE}QRuuK&K0S[Puu e[^_]UWVSÉЋ{M19tBDu3{u}s{ u}u}u}v}t LM1;})ωxMH PC u h"kE UP XZ܍e[^_]UWVSE }Ĺ HUMx}}t}1҉HM1ۅuh%hPW'hhC%M9tCDuu}E %}}1uuuuE1} u}w2t tu'}\JM1ɉMr1u}}}E}u}0}}u}t7}u }|ڀtu(}E}u }E}9}}u1UMUMUM}9}}u P @|UEUEUE9E}}}pEbE`Mt:EUu9֋}|}9֋}}ً0‰EU,Ɖt1xtx}9ЋU99uE|{}EE,EujSUr }4u9P?uL 4XZm1hj4;E_Z EfǀUƀEEl1ɉpplxt!}9}u|H1+EUẺUЋ,E,EEujuUs }t'4}9ttP>uY 4XZE0qEHEUȃƉplRPs)׉E9Ɖ}ME,uȋU)Ћu}ƃu}|U9E}}EU+EUẺUЋEEEUEĉUȍEujuUx }t'4u9ttP=u^ 4^_E9uh0u_E,9EE}Khj)9ZYuEbL}uu,fǀUƀ0Ë0}00UMыE`M]}v*}}u }t }iuM9ʹu}UUpx u}EEMEjR}wR‹E@vM1ҋu9Ћ}_EEE1}$tuVME]1uCu}ƃuuWV$)׉u}9]EM} EUEUE1ҋM]M]9ȉ} +EUẺUЋE\EUEĉUȋE}EuuW< }t2EED4u9ttP;u }D4ZYEu0hjjPt<1}?t;_u}E@Eu1EE1}EE1Vt_}9ti@уtuH}0t;1Ɋ_]ttt}t9}t#@AuՋ0U9u1e[^_]UWVSP]E EuEE}t:C,u)C0E1҉UĉUȉỦUЍMċUPX{,4}u1( 1}jjjj1RP1ҋ};}ERPjEPS,tEؤ>MEUEĉUȋEUẺUjuVSUEaUċMȋű}Ѓ uEYUċMȋű}Ѐ}u.hG'sWVQRUMsH'C,UMtX(C,u 9}8SjWVQRsH'C,tPC,e[^_]UWVS}Ĺ uE0xE0EEHM19t@D=u€t E1ɉM1Mtكtu‹]9] uEE@uȃwE9t}h=E]1ECƃuuWV)9މ}u}1E1҉EtqE9E E˃tuSE`tF1EM t}tȃ<ttE9E tw̋E0h܍#jP]Sr$ jPSSj SK ƍ@[=wʡ LEHDEU}~ E1ɉMRWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ L04}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ] L480h%h贼}WuVEPS$xuuuh%h豼WVEPS>tuuuSЃSIe[^_]Ujj iqj5 j P}USrPgc$]#PSh%hK.& j U=H2.u WH2.UMfPftPO$Z9H2.UWVEE왉U1E}ujEPjׅ e^_]U0E E1EԉE؉E܉EEEPEPu@rƒ xEÍL$qUWVSQ@@u5jhVM UMVMUMUMUMUMXZjPڥ UMUMUMUM+UMUM_XVM9}9UMUMs7UM󥋅UMUM1=UMuhjjE.t!jjjP =UMuihO#P UMY[tPh$hP* xUMUM19߭y0N&ݝ݅ N&߭ٽf f٭۝٭y1d~dVh4$)P=Px NjUM~-UMt P_Z)Å~:ùdh]#)ShZ'Ph;$)P=P ǃ119ʉst  @~4Z'SQhE$)P=P +VMVM+ VMy @B,N&ڽ߭ UMUM19ظw ȉ߭LN&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4Z'%Ƹd PSQhR$)PP áUMUM19‹UMUM)ލ 19‹݅99}ht$VQ: à +UMUM߭߭ٽf f٭۝٭?~~hg$rtPhM6#VQ Ãh֘%VQ à <ЙRPh$)PPH Ãuh4N#)PP à UMfPftSVP eY[^_]aUS/lj!lX]UWVSPu ]Ett v9sk71;uuߋuE9s$;ut:GFFPh-%jWo ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=R.DWtDOt uxuDk1!tjjEP  FCE덉뉉؍e[^_]UWVSujuZYt&Vu PW9uj7؍e[^_]UVSu huà @tuuS8S؍e[^]U|EPu ZYtM EUQ1UWVSEE 0Vj S8 DžuVjS8 ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U  sVFFtNMEUE UEPEPs  @u1jd8 t`d89th4['hU%_>^_S[VtPSV1ɉC F0s {u0Sh#js C2@uh4['h_%=XZu s]e[^_]g@ue[^_]US]j$Yt:XU P UP1҉PPP1ɉHPP 1҉P]UWVSpljӉ΋EftPh`['h9%`= EjEPEPS^ à jjP twPjS @tejjS tSPjS @tAVSW t/Ph#jp '1@u*h`['h_%<Y[h`['<ZtSXe[^_]UEM M]UEM M1]UVS]uhU YtShjPy0@uhp['h_%;XZhU Yt1ShjP10@uhp['h_%;XZe[^]UVS]t P?X틃1t:P0gǃ @؉Ƌu4P0ǃ uȍe[^]UVSlM uEPUZt%ÍEP P$VS @u SX؍e[^]UWVS} ~l`7N11;] },E4VOZHw̍CWPE e[^_]UWVSUu }u _VB1ۅttx 9{ s x 9}stKtHJ KUjj_XۋUuC u1ɉK;Es2Uus_ZUus&S [^뼉CEC {MECBK1ɉ JKZRh#Pr B-e[^_]Uhd\'9jEh2 UWVSREPx1YutE@$t5s% uuC tUBHEx uC t<v UD&0Ep VLYw{t)1 E@ȉC,ub Ex txj(Zu h]'@7XYǃ,f@S(P1.1;,s$k(рyus1(D@1u e[^_]UWVSSƉM׋ttZ9t<{ t6 1ɅuufujuP` t[뷃 S Vhs%l6 e[^_]UVSËHt2L~tHHHZR1ɉL^Pt2T~tPHPZR1ɉT^`t2d~tf`H`ZRP1dXpt/ttVK,tXp1҉pYt/tVfK,X1Xt/tV-K,X1XXt/\tVJ,\YXl1XZe[^]UVSNjjjVGtD@PjVp8@t@4%1҅ut 4%1҅ut 8t48SVqXZe[^]US]E ftPh\'h9%3 jPn t(@t Yh\'3YE u1҉U E],ShjP'@uE \'E_%]!3]US]E ftPh\'h9%3 j|P t@Xv|y X7`x\| xYZt>1҉ShJj&@u;E \'E_%]P2h\'F2XE E]+]UVSĀptQPhhxV蠥@u hh]'1XV Sh%1 e[^]USË4%1҅uau]hʪ%SɚXZ{PtSB5Ytk%1҅utSLt%Ju7#PSyXZ]UWVSÉ׸r#u2ڪ%+1uҪ%PSS~gjSKt PS/XZe[^_]USÍ@ Ph%0XZ1ɺ؋]hUWVSUMˋ4 848tt~΃1ut48B@01tT~ tBEU  1ۅut!VR21ZY[^_]USËltu;RSlZYt&hvRpPPh%m/]Ãx tpUSË%1҅u:u6S% Y u=uSvZ S2YuS1X]US]S询Yuj(XZRPh%.jl(]UVS]E ftPh|\'h9%. |)RxPn uh|\'.X;|t xD8t|xhJ.!H 1tf J.yhJ.j  Y^J.PJ. ShjW"@uDE |\'E_%e[^]-jXZu Ee[^]'e[^]UVSjhdx%ZYuhdx%h~#>-[^"VPIhZY@u Vh%!-ZYSQXe[^]US]S輠‹YBu jP&XZShjdjP%]UWVSMy t %1 EU}u%1҅ut6`u,QMY}Mtu1ۉ1@EU}u#%1҅uZ`LQ;6X}t u 8 ى%1҅u1` 1e[^_]UWVSM48%`uu %t%ti utSYt %@utS^5Zt %`ut[1҅u%u! u@uM1ɉȍe[^_]US]#,%P,jjejje4]UWVSQ]4Ɓ@1utg%@1҅u\uXt0t(VwZ%t4\' Vh %)NvSq_%t4\'h$%)[^8th>%)j# Shj#4Ɓ1uiue%@1҅utVS,1ɉMjjEP, @u h]')Z,ǃ,Xe[^_]UVSuh 2#m)48ӁYt:tt{ u hU%S>YX[j"XZe[^] @48ue[^]+UWVSEt~uuulx t$1ɉH hU%P虑^_8t2ttuu@j!XZe[^_]UWVSD]u Ctt,PCQPhj@EP觛@uh]''E_E{ VEPW3gƒuVWh]%Y' yt&Ej@VPU^ VWho%['UƃU3eUXYu"D@RWPcb׍e[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3McUM  Mut';xu;0tQh%&11҉=Y^{ tFEU   t3)Z@uhT]'L&Xe[^_]UWV։ϋH|tPxD@WVXZe^_]UWVSu%1҅ut V)ZuF Ph%%Y[Ӂ u% 1҅~GEj EPju=^ ]PShȫ%%M1҉1;,sYk(jQMu Mt5j EPjQPMAPuhԫ%$ MQC럋 Vv<Z@uF Ph%$[X ~ u#V@;%1YutVkX~ tV [ӁtK~ uEӁEuEuEuV^ZY@uF Ph%$Y[t ~ uVZtue[^_]e[^_]UWVS(]} uSn'EScẺ{Ls$ZYt8S('^{ }u }s uJSYt?Vh %"SSkSϬj3sE %%]e[^_]"Vh7%"h%S 11҉s$t jjS% S&Z@uH8t h|]'"X1}E A]e[^_]|%}{ tC uPhH%Phi% "Y^{PtRStCQEЍ}ԉƉщUSCtZU9uPEPu t{ t11҉{ t411ɉh7#SSMS>]e[^_]e[^_]US]C Pt (ZYts$sLP ]]Z#UWVS];1{Ly)tC$tjjSH$ 14%1҅ututEC$u?tS$Y@u h8]' ZjjAS# @u h8]' X]e[^_]US]][].UWVS ΈU;M E*} K 9}E4QM7ZYtGMu }{ }txEUh~%S>jjMtuuS tkSvYbS{`9t]C jjMks|X ~uV\C|_Zuh%|Y1҉S|1҉SxSX[e[^_]UWVSu 48@1ۅutjM1EU}tB,IjjURP @h\'h%_tmAhi%hج%h%K@t+XRD_twh%h%h% h%h%h% 1hƬ%hЬ%h% 1E1ۉ]h߬%h%h%t [h%h%h%T<@h%wYzjjj fQh%kD48ځuCȉڀ48%1҅utWXZUMAtߍe[^_]USS]E uPh\'h9% jEP, uh\'jYuZ8t$h\'hC%j,,Xǃ, _w$jPh\'h]%<j6M8tu h%YucSQXZ]US]E U{ u)C щ‰x{ t][]'[]UWVS]]} umSEt!XZuVA{ tC Ph%N^_CStP }tQSS[E84EUt1pEPjEPuU#Euh ]'YASuE!XZu@~ WEt!YXt3{ tC Ph%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Whŭ%11ɉ#Y[ۃ} ~EPuu { tSYZPHtJHPXEu}OuJEPuV ؍e[^_]UWVS]DžPPhhJ @uh ]'h٭%)1XZh%%Y^1hPF1׃ u Vh*%XZu>87t>8 tt Vh*%^_\XPS ǃuh ]'r[ttlHp VWZYu VjS ϋFVt=PVF PtZYt%Vhjj7u7W1FtPV2VP~ t11ɉVhxWftKPtStlPSH e[^_]US]E ftPh\'h9%a SZ@uD&=87u ]]=8 t=8Vt<8tE\']]UWVSD]} uMMtFMPVZYt3Mv/<7S UE \'ES#e[^_]EC(f9t { tQPC Ph?%+f{(K>:Mu#M}tyEPVC*P1 Mt_{ tEj<}WQC*PK PQMho%jt S*ȉe[^_]UWVS0}E EЋEE܋EE؋h%S,^ZuEE %+h%S,ZYu,EЋ@0S*^@E] EЉEe[^_]7hʮ%S,ZYEhڮ%S~,[^u EЃHj1E9}E4S*Y\FSQEZE1ҋE9}?E؋ UQM*Ɖ$MQujK K)Eƍ@E UB 뺋E@uh%Lu=1C.E 1E1EEEEPh`'h%uutrkt?(NtP4tS6uE뾃UuM@밃ptxtnE뛃M땁M댁M냾yEmC.E%@1҅u4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQM*ZYUBMu9]uuVjz EvjEPEp  uot0tR~ t3ڍN E4UQM?*ZYUBMtU9U9]tvuVu"z @u414E@t8EUu!9]u3}u-8UMuj \t0E1҉EȉU̅b~ ߍV }9}~E4RU>)ZYGUuEЉUԋEU E Uԃ}u}t}t }u  MEЋUԉv-tP9]u>t|[E4tY[tcEX]9]AKUȋtSu؋M6XZe[^_]UWVS] U1{>tNf}fC(ffGfJujQR ȋuFZK>s*S>+Ee[^_]UWVSu} lh϶%hPV蕍à t1=whlh϶%hh% <58th϶%h$XZh&h[u h$^'huP^Y1l>uZG Ph%otXZt{>u[C Ph %F_XhhG%)YhuPWhQhnRPhnR?$ =nwHƄn ƄoPRhh϶%V݋@u-h$^'hs%XZhtjWhà ppe[^_]UWVS|xЉ΋ZJσ|tfu<|1}Eft#|1҉UE1}}}EUtfu8BBft!BB1ɉJ JJB<|19t.jjj)iRQxpXte[^_]ÅUWVSÉu1҉P8PC(t 0P_1ɉK(C(C,C0t 0PZ1C0C0C4e[^_]UVSË@`4uC\<vDDDv {2Tkv f+ DFσ@SEPj; @؍e[^]US]t-1҉CXtP&Zs\X]]]USjljL[ZtÍ@PjK ZY@u SY1V1CCC 1҉SCC1ɉK(C(C,1C0C0C4Cdh@΂ CXZ@uSI믉@t؋]UEEEjjjEP Pv,fUЃttt tUWVS]Ch{h{{jtfCis(u {ul]Fu4~ uFVtPS,VvV1C4F0s4XyE1E1Eu E1}F {it:Ct/xu#HtJK H1ɉKHCCiVs`s\jjsXEts\Džt^ChuUFuCPt@sT65t Ht)NssNPqQ XZO<랋E9C`(8u(Cde[^_]USuuhK.S hK.j @ttC؋]UWVSD] u=6. 1EDžDžVShP- =v@1󫍅DžjP56. c6.1s3E~x~ @tVShK.h2.16.tVSuy e[^_]UEPu u UVS&uu hV% SPVhS#u$&e[^]UEPu u UE Puj UE Puj UE Puj] UE Puj UE Puj1 UE Puj UE Puj UE Puj á6.UE6.@t]]UWVSD1󫍕DžDžDž󫍅Džj@Pu@ vLv t$(.Ƅ6.Vh$16. ؍e[^_]á6.UU6.@uPX6.uUS hjh2.hK.]6.ۃ  s"jSP }t$V]|US]tKSeSUS藇S/jSSM3;$s|X]]}]US]S\Z@u:jhj詗  @tjhj菗  @؋]US]t$POǃ tP1ǃX]]׀UEE]5UWVSu] E`d$1jF PdWi3 Whit>t Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t&zLu1t]UWVS\u~>u !Vv!7EEEE1]Muk EMQUE UJHOuԊEEjPSdPF Ph%F>PSV(u V*N>׉e[^_]USEtSijS[ ]UE t E] ]USEtSS[XZ]UVSEu Ʋ9t t !ʉ11@u1[^]UWVS}] ?jWS=1 s jWV%1 wmj:Vu ZYDžt?EPjhjjj jGP C8 }t! UC8jVCP0 R. DJu <:tFu}Wjhjjj EPVh C0E t/it.u#Wjhjjj j@P5 C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPZYt[u{ 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUP=jURWPVsu ju (v$%XZ18#@ t xPp^_0tF WP ZYv}~(WE4 ZYtF9uu19u3}uPE0 ZYXE;1E9P~9jPET4 uE9P~ 1F1E9X~!jPE\4 uEXt39u/1%FjPEL4O t CE9HӋEH9u t1ɉSu#{_ZHu!}tSh%P!E@wC*WtE84%@1 u/t%SuZ@uh2%hSF qSnC@SxfCDCCHSw @t CPCHC pSpwCL1s@CX_Xƅ2e[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[؃4[^_] K(UWVSƋ tC1ۅu)u%O Ƅ  1ۅut1ۅutӃuӃ u %1ۅuu[^_]UWVSljQ7 Zuhd`'ÉEhg#EPe ZYtfP Xuhd`'SM[_LUj@PVaK Uuhd`'oS UR q7SXe[^_]UWVSljӅt΀9u113j/Q ZY…tH@EEPjj jjj ju }t uh>%-t SPIZYuUUWV ZYUuVhO%ZYtB/1t7VXe[^_]UWVSÉUQYE>"ux"MFGVj}XZt7t9}s7VSGZY1}u>t tCEM9tHM9MsuN\?~Vnt>0bt!# tt:xtBrt#   C  E R.MNMߋUDJt!U߈U~MDyu~~U}EjjEP3  tE1ҊM΃0wGMLBu}t?jjEPn3 t.S=~ttCEE}u$@t9E,1}XFe[^_]Åu À t t @ u1Ått u@ t1UVSQÉ֍EPjjjjjjR }uȉjDZ~~1CtCHuCЍe[^]UWVSE։M؋ER EYuhl`'Wj=uT _ZEu Vhl`'hf%Eu?E}uS[E܋EE1CEE8j=W ZY)9EuuuWV uʃ}t'V ^tOWaE[uSXuFW É4$ EBU$WZYUMuhl`'Wu[} DED1uVz _XjCPuE uhl`'VY[41҉TMe[^_]UWVS]s ~{X1;s s WF,Xs^1s s{$X1;s(s WF,Ys$61C(C$Ze[^_]UWVS0ƉU؋E1=$$@^'EB4@$} $t uh|%w$;`2.tPXjM 11rXu 1L$u1hx`'XE$S_tjM !Y@t;thdx%S _Z#S1ۉ^#@PY#} # U #} u#jM Zuhx`'h%t.u h%u%##  #} t% jM _u hظ%1 "} ""<" u y <P[^""} e"h#u 8 ZYuǃW"EPjjjjjju  },"u h%"} "EPjhjjjju  C }!u h%!} !8!jh!%u u/HLE܍@ð`ijh%%u y u/PTE܍ð$pt@DE܍CKPpMju PuVWRULUu=ju MQuVWUR.Uuju SuVWURU u h,% }  8 jh!%u u2HLE܍ E؍`ojh%%u D u2PTE܍E؍'pt@DE܍KC0E؍CpMju PuVWRUTju MQuVWURSju uuVW sM 1'1D} tjE 8tbj/P Y^ƅt@j/P _ZƅtM @t/N1!t1} vEPjjjjjju  }_u h?%F )jM EYu h\%  T } uhf%} j,u _ _ZE܅txu u h%E9E u=E H j^u h^#M rƁ1ut%ƃ EEPjhjjjju < E؋E, }t h%YuF )ǍEPVJ ZYHu-A78 U艔+ j^ ɊU؈  T [} GE :<4t E x4u  E 86tx6u @E @vE 묃} EPjjjjjju / }u h׹%&} LHM Lte} Gj,u ZYt u P $U_Uu h%RP5 1ɉV5}} u Ɔhh%u ZYu Ɔhh%u p [_u Ɔhh$u Q ZYu Ɔhsu j1[__PlAZYuhx`'X=lu Pp_X!} u ƃ 1h0#u Y^u ƃ h<)&u _Zu ƃ  h%u Y^th %u n _Zu ƃ u h%wwh} t% jM _^u h)%1   } 8jh!%u u/HLE܍ ð@ijh%%u p u/PTE܍ð$pt@DE܍CK0PMju PuVWRUCL0ju MQuVWUR!Lj} 8jh!%u u8E܋HLE؍ @ð`xjh%%u R u8E܋PTE؍ð*ptE܋@DE؍KC0{PpMju PuVuRUKju MQuVu܋URJju WuVu܋URJju SuVu܋U} Aj=u ZYu h2%@Ej hM%u / ud}u11҃uM'j hY%u u}u<1jhf%u u0}u 1ZM1Hjh%u @ tFjh%u * t0jh|%u  tjhy%u }u(jP&U [^E Džuh%7g@E؋M܍UE@u CM1ҍE@t Vt$YEPRU>3EPU܍BP.3EPU܍B8P3VURP6&$ 1ɋU jh%u }u(jP%U XZM1ҍE@eV#_T1ɉMEPRUn2EPU܍BP^2EPU܍B8PN2VURPf%$:1ɋU %%jh%u " tjhº%u uB}EPjjjjDjju+ }uhǺ%j hֺ%u }uEj/u _ZDžtGVuj HuNt>EPjhjjjjW }u G$uh% ƃ tGuh%11Ƀ}U UEM j/u 6 ZYuEjP1 <JM JM FUEM |j/u 貿 ^_uEj P`1  J M J M } TPM "T{߃X 5) % Ɓ QR󪍓 fCPfCSfCVfC^fǃƃƁE ƅtFEM 1+j@P /  JM E } u} 8jh!%u uHLHjh%%u uPTpt@Dju ÐSVQRPB[ 8u h%4} "$bu k $Y[hx`'c}  4%1҅utu ht%/CU Y@u u hB%     @r c T uhR%; EEE܉U4%1҅utEu} t hl%OE܋UE 1t @?} t:j/u G _ZE܅t@E܍EU /@uu h% 1u܋,EE19tIk(P} u*t,}f9xu#U8uU8PuU8Pu U8P. AjFV(z, (,P,kEfC} Ct)EECECECC}t }uC1C j/u% ZYƅtFWuj6 Htuh%1Y_\ f{Q EPjjxjjjjV菾C }+ Vh%CXZ  }   @EЍD1HEЍL PEЍTXEЍ\EԋE10E18} u\l Etx}Ѓ Eԃ} H h%} 4 Ex$}Ѝx(}ԅuhһ%}tlE qÅu u h% EPjjjjjju > }t u h% C>E tMh%1ۉ]ȋE ƅtFj:u  ZYt8URjhjjjj@PļẼ 1E؃}t)h"%j=u ׷ Y[E1}̅t@Ehv$u 豲_Zu*E mu h;%`p3hc%u tY[1ۅuQE .tphS%u A_Zu& E u h\%ph8^$u ZYu)E u hu%phk#u ̱Y_u E u@h%xhM%u 虱_Zu)@rE Ou h%Bph%u ]ZYuˀdhY%u BY_u@Ih!#u '_ZuHhL%u ZYu h/#u Y_t1h'%u ۰_Zu h%u 轰ZYuh%u 袰Y_uh%u 臰_Zuh%u lZYush %u QY_u Xh%u 6_Zu@=h#u ZYu h?%u Y_u h8%u ߯_Zu h%u ZYu @h1%u 裯Y_u @hD%u 腯_Zuρh%u jZYuqh̻%u OY_uVhQ%u 4_ZuXhZ%u ZYu@h#u Y_ t u h%W}tu h̼%XZ1E sǁt@uh%Xs}u h%|_urMu h%gEthMa$VbZYtVb Xu 1%@@=@u h@%EԋEċ}Ћ}t+M1ҋE9t}܋E9}sBE,j,E@PQ$ uhx`'Vt1}Љ}ԋJk,ЉE1xx x$x(E܋}ȉ8X}̉xp }t>u ^vuhd%HY[}܍W׋u؉)1E܍P׋E}t8E-}t }uE}܉8hE}܉8[} =h%`;", } u 蹃ZuTu h%@T} E E܅t@}Eh%u < ^_t&h%u  ZYth;v%u ZYu  %h%u ZYuL}u h%OEFƅt @Pƍ0Puj} Ht hս%u܅h@&Vo Y_th%V^ _Z@yj[B 3}  jM &^u h% @} EPjjjjjju  }u h%} tyEPjjjjjju ɳ }tfu h%P} tBEPjjjjjju 蒳 }t/u h4%P[uhL%ZY1uXe[^_]UWVSEu} EEEE1ۉE싀`'tM܉UVPl ZYUMtCnuFE샸`'uu u Ea#EEEEE} `'EEe[^_]XE8uu E,%e[^_]e[^_]UWVS }]u1C.} t[%`EUh% jjSM ƃ t8jVS; E tF9tF99uVS V> uče[^_]US]t'jjS t@Ttu SPD ]US] UHSuZY9tS X1ۉ؋]UE PTuh%hg'hh% 2PuUWVSSljӉMBTx t41҅utSW;YXu'SdZtCPV^1t<CT9FTuwFt ;CtulSV8 ZYu_FttCttC8PF8P ZYt>CPFP ZYu+֋CT@$uFx9Cxu%%}uv?&ٸt[Ftr0tCtt&Sj7XYBuc 8t h%蜰XVj]7ZY@uv 8t h%zXSj;7ZY@tP 8th%TX1tEVW8V Ee[^_]UWVSP}tDjjS}ƃ t)jVSkE 9~TuVSV} uӍe[^_]UVS E uhf&hg'hPTuh%hg'hh%; 2uh%hg'h߃}uFƈPVXZt1SVQuh%j uV ى?Se[^]UWVS8]48%u =h8h'uV^hXh'EPPhXh'}WBu WS'9$thg'h%諮_X14VSzZYujEPjEPIVSZYt1hjjVƃ jVEPEFT x t8jVYtF8PvT/=_Z@u h %YV;U t2F9t ;E !VEPQ_Z FTEVP3NjF|ZYtwG|tEuEGT9FTuG8PF8P3ZYuЀ~Yu Fx9GxuFXPGXPZYuWuW  /1z'1zuz uzu 1z1U幀U E]UWVSu] }uhI&hh'h{uhn%hh'h|hC%6 Fu#<u;FuFPh$WS | @u612WSPFDP bÃVWSPFP謢 Ã؍e[^_]UWVS}] uhv%hh'huh%hh'hhC% GS8t)R78s<t<t1&vvRS Qp: e[^_]UWVS(uuh8%hh'hFE<t<FVU1QF1 G!)JO9tx dB@t8tM9r1=8}1ɿ}tAut]@}9s8{ /`1ۀ=VMuU}ع1E׈EVMS}W<WV-th%hh'h'hC% VM1ۉ؍e[^_]UVS]C<t<t /g S'؉U Y=VMt15VMS>Z;E th%hh'hnhC%> VMǍe[^]UEU uh8%hth'huh&hth'hhC% fPUWVEu uh8%hhh'huh&hhh'hhC% fe^_]USi'tPh%y XZ]UWVSD1}]SeZ@j0Sf1uuuu}WSf1;5]'s/]'H>v S  DF1;5]'s/]'H>v   DFWSWf 1҉u uSjE0EPƃ SNeYEt 0e[^_]UVSuEPu VS uVj d ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh%h\i'hC؀xth%h\i'hh% u1W9s*jCPU tًUGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`P腭XZ+ `Sc X4%@1҅ut _t^Fh#>Yu%%PhC%S @; PhK%S @uWhW%S @dhlhR%W轸 YZu@ltDžplxDjVYZuGDžpha%Wl YZW\ Z|6hi%WE ZYuDžphʪ%W% ZYh7#W ZYh%W ZYh%%W ZYh#Wѷ ZYhv%W輷 ZYnhU%W觷 ZYpDžp Džp_t@F Ph%SU @ pli'tPh%S. @7@t pndTXI%u#Qh%S @VL-$&t $Juf%Ph%S @XvHh%S @@FPPh%Sr @&v$h%SZ @V'Ph%S>@~Pt?vtFQPhhtRw@ttRh%S @uF4%@1҅1)1h8h'tPtXY&Ph%S @uAz u RuARPXQTtPZYT9Pth%Sxv ZY@jjtPCƒ ttqTjjP$ T9u-BTT Ph$Sv @TyjR뛉Thؘ%h$Su @TuMjPSj] @3hU%W| ZYu>dTX1҅u!I%#hR%W- ZYhʪ%W ZYh7#W ZYh#W ZYh#Wٳ ZYh%Wij ZYsh%%W诳 Y_twpuhLhxOpu V蛲Z;pullxDpjVY_#I%#Ph %S @Wh%S @VnZ%u6o_%u*Ph%S @umt:u%u藜@t>(WQnY%uPh.%St @u'h<%S^_Z@pu^hh@hq PVh$%ShU@d$%0@ugpll@LlqPPVh$%S%@\puPhtfh@tYhqPVhe%ST@de%pu,Vhe%S @1d u{puDt׃8tVYtËlpHpDVhe%S$럃ptpuVS_ZPh$S @tXd 0uŠ SY^u hPi'.Z#_tFP`P u,hPi'X_Džp؍e[^_]UVSË2=tPS^ e[^]UWVSQ} utu@GL%t 7#Ht#}tE1@ۅt 1ۃu4t&xt HHt}tEP@uCWuZt!CE}ta%EE@t]jWt[^t W,Yuu"Ep}ti%Eƃuًt 8u1WZt^}t8EÃuˉ؍e[^_]UVS]u tPހ~t9 :jhN%S裭 uSLu SM \ZY9rhJ.r X1e[^]UWVSEE} u |U(ƃuh%%shC%sh # s hK%f XCt hP%wf XCt hY%ff ^Ct hu$Uf YCt hb%Df ZC@t hL%3f X ]EJ.e[^]髄 UVSM] X\19t 9t&B,X\19t 9tB,1[^]UWVSu} S<Z@uh%hд%hm%WV?d `PPSh%hд%hs%WVd u.P9r)ǍGPCP%ZYtۍP9r:)e[^_]UWVS EPm) EE[tF  >SP> ZY} -];уM I+ѻ}hg#EP7@ ZY;tjh%%S ujh!%S uu1;}1u1;} uJuo [EPjjjjjjS} }tG,9uSv - ZYEPjjjjjjS} }u9G,nFuLo} d!u)oX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9 1E؉EErE,@x k VuQ9uuT "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms 7뎉ߋM_.MIE)M܋E9,}v覲 M}}t ;]tC }uUUt;]tC } t}E[^_]UWVSu EEE}1ۋE9EeEEHes2i'i'Gesy4EuyR.DBtes R.DB@t蟱 E\t-x)R.DBte/t MM M\u/t#w1 7f\\t0v\0G0G0OttNGCt*tesUEu EZY[^_]UWVS(։U ÍP襞Y_@Vh$b @}uj=J _Z@u)|p hU#b @uX4@ s=Su hS Pwt sSu #?  sSu #>ҁ uL V t3Su PhS@Sh$Ssh|%;[^usp1۹)ًD<1u5E !Ph܍#Fa @Cut<0t} sPH ZY] ] 9;] uPt"Ph"&%j H ^_@ut!Ph܍#` @rCtffPh"&t+ffPh܍#d` @0P t Ph"&@tPh܍#'` $%t*3Ph$` @󫍅)ك~ljj.VPj蕁 trVh$_ @t[;tvCUE E]t UVShVuW= =tu11ƄVjuUWVC*P U[҃VSp_Zu VSp[^tRXZReYtPtrrVS_Zu VS\ZYtXg /1 X ؍e[^_]UWVS,E̋A tӉ΀ytu x1}ԍVx}W}ԉ}Z@$1FCt}ЉF tCUfCF t&EȀxu xtK|@Ft C8UF t CXUF0CxFftPEt@_ZF tU tUȋECTt14~t * h܀%Et諄CTZYuՃe[^_]UWVS8t覡 F1Dž@jB UPP)fDž ˉhPhiUpp UJ>r*hPhip0 ,؍e[^_]UVS1ƅ@ CtDžC8P6^CPƋƒYu9Zu)CT@fCXP_u tt uC| t Cxt(1ɉ,uCTƅƅfDž1󫋅@p׉މ;tHH t2fDž f󥃅 ZupV*XZtHHt'CstHHt0fDž f󥃅  t'CXsXtHH)fPR>? @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLPZ@OHuWUY1CPWRXZ$jjVSjLP?Z@uӚ 8 넋H؉@D@9DDx9@s芚 DD9@r׉F u]dEuGuXu ht'?tX?$RuhnPmpPC(PSU뼋F1,1t zuB01$t$uG4h1 jSVfDžx,|Vhi@(Hq @u6 8t 81tht'h%kY^<< 4R0R,RSjP(f$4󥍽hr󥃽$t$j4PSƃ u6( 8t 81tht'h%kXZ31 "4u5uSU ^_u1<vGD&BTtt_9t;t1zT9yTu)1uuU U밋@븀{>v P Sh{%_ e[^_]UWVSÉ։h,j;ZYt:PǀcScufǀ,1e[^_]UWVS@ÉR'gY@u Ph%^XZ.Gw*hH Ph%^ th, Pj:_Xt@dtVWv<u?(9x u1Wt cScuGhu @G @(GH>A<wOw*󤋅% 1҅ut&x utmtdf@ tStJSjjPSS9Ѻrf‹fP@TȋG,D8㉅ǀcScfǀ5NJH$1t_~DcScu\tuJVdt Fhu;Jt8fǀ2@$~$tMDcScu>tt1x<t%)؃f6@t4L7Pu"uJƃv9nC,m@1ɉ;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃qf9ffC tHGY u<)9(CM A 󤋽 \ tC)9C= A󤋽 \wr sb@WuM tB)9iC< A 󤋵 \ttWH4%1҅u/u+@t@Zu)؃fPhPfƃ tjt jVq_ZP)9}QC t  CfCtKSVY^>t/t+Vk Z@)9  CKttdt[%1҅ut)@^u)؃ftC t@)9rhC A 󤋽 \S)‰)=+wD@1,w,)Ѝ4? Ph%EU5 \Ae[^_]UVS~\jhPF\ uFz 8u!56.h%TY[ Sh v'hS#T 1ShpjpH@uh v'h_%YTXZ1e[^]UWVSMuh %hv'hh%s Ӌ}S OuO 0u싐1utXt Ctw qjSPC u3CC C^PP S@BSjuMEZY@u 3NCCXSjuME^_@u C CS j3uMEZYtC Sj:uME^_t1ɉKSj;uME_Zt1sSj6uMEuZYt1Ce[^_]UWVSu/h4j.ËXZ1C`CHʪ%1CPsijhV%1҃utV0g^_ 21 % 1Y t/@P* ^ A %1҅u1utfpFP) Y?V @ QP lpS@>p@PB) Z W(P O>w*󤋅Ɓ1uTuP%1҅ut3 t)hRR@P7 P PhE%>@>u1DhRP*P P Ph[%Ohu'OXe[^_]UWVS$Ɖ1iu1ho%QOfnJ.Xfth$SPkà 1GiPV Rh%Oh$SP6rÃuJu 8t8iW VhS#FO!w hu' Vh%9O 1d4@1u$u j5SKY^@uƅS0'Zu hu'NX랍lj󤋅e[^_]UWVSS]Sj8_Zt,]t#8tCP&Zulj1e[^_]UWVS$ϋEE Eh%R`e ZYu}WƅP7c $(&Xۋuhu'MYuQVhRSjP 4@uhu'h_%?XZe[^_]W|$wUWVS$?E苷EF$E1FH~ t)vFFFF F FFF1F FXNvU܉Eȃ1[utF0FH%1ۅut'v$謧PG Ph%G>F0FH%:~@tFH%F0u-F8F4v$bPG Ph%=nwjG Ph % >F0 V8u0E1Em PN&}fE fEm}mEЉF8D9r@E1Em PN&}fE fEm}mEЉF8PG Ph)%= V4F0u0E1Em N&}fE fEm}mEЉF4E9V8s@E1Em N&}fE fEm}mEЉF4PG Phh%= ^0>u-Vdt&F$;BuFhuP SPG Ph%x<v$SPG Ph%<E苐84EЉU%1҅ut*FHR%hR%W谥jE5~HuJFt.Fhu(VJ9Hu~<t>t FH %FH%>u FH%FH%~0uF8F4eWhv4jE4Wh~v8jE4(Whkv0jE}4v8v4G Ph%E;$~@u\EEЉU%1҅u%:jEo4 >vHW7&juW*tFdFhӉe[^_]g__e[^_]g_UVSuVcXt4s<s4s , !S1ۉtttt:uj@苃xt$P/xǃx |tPǃ|Y1Ze[^]UWVSSEE1%? t_H1w L1G Gw<GGGG 1GGXYt u3X 1ɉOdGhSubw1҉WW W$Ӂ tuOXEEe[^_]EEe[^_]UWVS]U Etu$Sjj1]e[^_]}WHƃ1u%1҅ E iP3芵S; tExtvx<tp1҉UE1ɉMp$PC Ph9%71ɺ_Sjj0 ShmEPj0$Sjj0]e[^_]e[^_]W|$wUWVStÉUMEEEu]S:_EHTS%u`v'rt E:tQVC PhY%61uEPLt @v@}GLih舧 ESI:ZYEE1}m5@N&EHTS%u`v'zt E:tVV$QWC Phv%5MEE@eEEE@ht 1ɉMExdtj$PS& tڋE@$Et͋E@4%1҅uu h&&SY^Sjj,1҉UuyX}tSuuj,e[^_]g_U幞E]UWVS ]ESjj[,Ghu/E$t#tShPj+E1u}}{ u}tEPWh%2!S%u%QWh%c2 ]e[^_]UVSuF Ph"%a2s &1C CCL ue[^]UE]UVS]tVwLShj!+v$PC PhB%1 ~1FL]e[^]낍e[^]UhE]=UWVS]{ Wh[%1F0+F8PWh%1Shj*1FB Fȋd9CTt}`he[^_]h@><wPh*PFP uT\\u ~P1ҋPT#\ًP9 tW9r7踍Ph Ph%p \T#\PˋP9 , 9r̍oj5`hZY@u ƅoA\TXth Ph %#Y[ oT< u8HvW`Vh6%W`VhM%duW`Vhi%$uW`Vhy%d1҉PLDžPPP\Dpt;jP`h莿Y[tW`Vh%PPuDžPT\@6@t:tj6`h5[Z@uW`Vh%W`Vh%`hƃ tPh Ph%"Vd8 h4%1҅u.u*h%hdiPh0.hhdpPjh_d@Pud@PpEȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉ誴fuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMЍE EUfҋE3ftuPE Ph%(fEfu)T3EPEXe[^_]UWVS$}E ^\ftPhv'h9% cCubh$RS5 u#>t=G Phv'hS#KWsPRWt^\ue[^_]UWVS ƉUMBEϋttb9tYtO8tJ9xTuEC><wPC*PEP諩 u%C PF Ph%8uMU[뚍e[^_]UWVSE 0xjPu$ uEu'e[^_]SËOwvRPw Sh;%B<uu؍e[^_]x\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhu'h9%_ t @`xjVP u hu'YVSzXZe[^_]UEM ‹]UM 1ҋE]W|$wUWVS }7tu PdYF><vu#%1҅uuF(fu  Ӂt1ۅu uuE0e[^_]g_>h蜄 ÉE1Em5@N&RR$F Ph^%5VhSjh (e[^_]g_UVS]Shjp t~ht j3dXZe[^]UWVS E} w]~tuE9{dfG PuF Ph%VE1҉Pdhڪ%VV8 *!GuE@ @;Gu}P{PF Ph%%1҃ut V;[AV%1YuمtӨtW1~E84%u!uG]9C$uSh{dChE胸,1ۅutEVvZ1҅uEp-E@]CO W؃袱]CX{F$E}uEUҊM]脄tI_E@Ѐ8t HD)у@v 6 M@X@E}uE@H%j6aEpHVye[^_]UU1t )]UWUBvP6 0E 1ɉJI} ډу¸)Ј1_]UE1҅t3Ⱥy(t%=t1҉]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVSdEtE}GEx /Eu1E@$h8h'EP:Xjju %[ÃE@htƃxduh%hv'h*h%+- h8h'uVWE@dZYx tWuYXu1_K|EPdB#B E}WSgE@d@ EWCPgC9SVZjjEEPeZ jjEPBZE }E8Pb_uqE0?X^D$NjuuPXC| SEPbZjuEPYEuEPZY@E@$tvtguuXX1uuVSfVCPvfE@dEPC8P`fE@dEPCXPJf SEPY_Xu![jj}WYà SWYsxC|ZY uC|E@htK|E@dEPCXPeSu 5W9tSWSUX뉀{tjSu Xà uhS`_tߍC8EP`^ujju jXƃ t9tEuVbZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E1u}}G$tN}u>}Ghu5j}Ghu5ju,Q*PQ+P Q,P f@ Q-P Q.PQ/P#uQ*PQ.P ' VPt ' P1[]UWU@EuuϬ Y_}UWVSQƉӅuuTw'ljUw'9r 9EsԸw'ljUw'|99] uZ[^_]UWVShPLufJ}xv& 'htAEH@‹EEhЍHdfhdZh%hPh}Ëh W& 8thw'h5%VXZh?w8j@h_uhw'#^Phǀ@h6o @uhSh袹S =wPƄ ƄPPhh%h|@u$hw'hL%wh1҉Y[hCj}dwZXETE``\ft\\@)ЉD$ 7RP*RuM UuU]UWS]U v! 119t@u1 w'[_]UWVSUyv >! u1΃y tËAdr@t$tt @$u@h%X؋UÅtF PSUFP}WWCPUFd@t Kth( u} WC8PiUY_C9@VCXPTUXZ؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV HXZ?ˍe[^_]UWVSQEp1҃t<t19sAM1ɻ BAt }ut1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}]Cfw EHfvw f9]u1Ʌtd@w 1 w w w ?w xIÉEU)ЉE9} "uu}u1EEftff@~jVC@P耉 ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjS&ƒ ujjSl ]UWVS} uEtCt=u{@uCAu=jjP8 u mߋuPHS@LC 1EEыU܉؍e[^_]Ge[^_]UWVS u~jF@PW Et @`uNd F$EF E苇tF$F 6~8u ~4u~<t$^4u Su誯F$u Sv 蛯F ^d1Nh]#s%_ QRSh%PV$F uuSh%Q[X/PSh% uRSh8%3 PRSh^%!VjDZYu"Ehhw'pEF$EF XEFft=F$t6~ t0@tVhG6PjEF$EF FdFd}u#h?_uhhw'Y1 P,1҉SPC܍e[^_]US]Cd@u;{ u9tS|XSjjCSd s9Sd1/u{@u{Du {Hu{Ltu SCdZY]UWVS 1}}}E01ۅt:>EPVTZYt$@u NtHUJNVl^C‰؍e[^_]UWVS} 1EEEE3CdEu u%StVMQS2uCE䋀%u=tuuStPMQSjC@PE0U tK9Ht ESXESut URP'ZYSXXu e[^_]UWVS} Et0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UVSEt0t.ttju CPP t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5jZuh(w'YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhjh_ZoECCdUSǃt_{ u Pu u(ƃ C S@t@sdKQPuR+@u s{ u @t{ u j.EPC K{@u RURbY^@s@{ 1UĊ  L @uj.EPC@Pje tOSRPhM%j.ChPn jC@Pu tP`S`Cdt  K`(Cdhw'S:XZ1ۉ؍e[^_]UWVS$EEE EEU}uM M؋M$M܋M(MԅuEtLRPEY[8E(uZEЋEt2jWC@P~ uE܉C`}tp}ʃ}jVWu{Py@u 1C$C {4s(E܉C`1E@CEX}CPt Nju (CdE܀t CdtS` ttSX{@t4E4uSu!uSu4u}uLSqYMCACu9~*Shw'Wz tShw'Wz u { V{IÅjU1Ejj@EPV#ǃ:@$@ 1E䋆%1҅ut(EPVGPG PG@P@tE䉇OW G@VwY@uWbO@jB@UPQMy MUuB`t7%1҅uuW0a 1ZcEOBhPB Ph%8W0 j.GhPQj 1CG8{jWle[^_]UWVS]} FtHtJN HPoZjj1PVt!t9E Ee[^_]N6V*1Sjjne[^_]US]XE]UWVSQEv E 81EjG@PE@Pw tGd(!E@`G`}u!GdtGhPuG Ph%yG` ttGd uFtWZOd }u/GdOdt OtHU JOWX}3t؍e[^_]UWVSQu E@EhE@PE Puǀ6@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F sM S Z11BCZ؍e[^_]UVSÉփhPC Ph%VSt VP_ZY hTw'Xe[^]US ]SjG`ڋEXZ]UWVS Et_uVj `XZ؅tt8;Cdt,z PjCPPCP@SF PtjR|$če[^_]UWVSEtt?u[0tFdЩu1҉6t Pu {-Y_6ҋEt^tTCƅtDGPEPP6WRV9EPFP9C PF8P9N| Vu ,XZ?랋sxt)~ tCztH|Pu ,Y_6Ӄ{dtSsVbZtEډ[ƅt6h(P\9h(FPN9C PF8PA9N|Vu _, EtE Et E e[^_]UWVSƉӈMB tN9u F9Au􀹉uyxtMjG PSp MuGdt}t1G$?1e[^_]UWVS]MEt6U }vf9uso 16}7҉19t99:uM C,tɃ[^_]UWS‹h$1󫉕pE0uEE@ht9PttȋPlS PnrZ@u 8t h\x'Xe[_]UWVSSÉUϋ@0Pjjsjj SjjyUtStP QSjjWCxPit"HtJHP軼YsL谼S誼XZe[^_]Uju8XZUWVSËxx1tOGdҀu? t4jG@Pw tOd Gd uڋC Ph%[^J?뭋Kthi%QjDZYtu{`?w C0yXe[^_]UWVS<]{Cdƒ U CdC`EshO VQMh%%1҃ ҋMu{@~QhM%XZVQh%MSjGg@ui 81t_ 8t hx'cXES@EPWCPC PRU5@Uuh{%,YECd׃Cdj.EPRj tSRPhM%j.V苭 ChhJ ShK=Pjb}u\0tNFE9u@Fx1҅tHd8t,19 ʋtE Ph%XZ6뮍e[^_]UWVS׉ΉÅt${ t8CujWC Pl t؉؍e[^_]UWVS] E1E;s31;Et k,9 t@v 6h% PVEG,1;uts 3h%蛭 PSEF,܍e[^_]UWVS(EEj:h0j ÍuԹ1Ej}Wj j)S/D@u SCXu}uj Vjj:S D@u_EjWj$j)SC@tEjWj%j)SC@tM@EjWh@hSC@u낃؍e[^_]UWVS|]|}1EfEESU|MNM}Թ1ɉMЍMMEMMEMԉME }UxjjST uC Ph%ShASE} Eȅ@)@. us Vh%6Y_xu_jxZuhw'pXxh_jPx@uhw'h_%6_XjEPM @u hw'Y|@P|WShAjj Vh %XZe[^_]UWVSPUB UPh'%hUXYu-jjËU_XuEx'e[^_]nU3CUB>^t @H KUQj葱ZYtUJ>t/@}wFH r*NjM;rC 1CUe[^_]&W|$wUWVS ue[^_]g_hcE ƉE1Em5@N&RR$C PhE%ShoCVj/(e[^_]g_UU t,t9PuƀRhIjjUUу1t.w 1#tRhlx'h}% UWVS 1ۉ]]] stqpCuCN@H9AHrrt t`t tN{du~duBu u0C`PEF`PZY9E~FC3^O6q1EC4UtHJUPe[^_]UWVS81ۉ]]]E1u1EEE9CEׄCdt\URSTRP t t0u5CPE Ph%1ɉKd EEt9sEsxF URV4RPp t tlVdtRNh%t %QPF Ph%Vje^@u 81t} 8t hLx'Z1F$F fdEt9sE6NEtXMPF$Pv t t1F0PC Ph%V tPVujSTRP>EċCPEЋCL }ffMM9Ms KMɉMMԃщu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u(}uƃEȃ}v1ɺ+]4tuhmFWjEf}t?E Ph%EEGjE0M hi%u8e[^_]UUt&t9PutƀU]a]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEPۮ1ZYtU9pu 1ɺJGEttu4@t$P,ǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj*JE _X1EE 9CEuh%j uV CPVh%u( @uosXsTVh%uy(@tuuVh"%u_(@tCtPVh.%uF(@tC`PC`^E]#tE.%"t ]#Au[$]# te%]#@tP$]#y8#uRWVQuVh=%u' @&sdVhQ%u'@ C1C;s WHF,Z拀H1C;Ls WGF,XCPECLE}EfE9Es SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQh};PB PEPu2pD UU)U0sx1t8Fd%u'~ t!GFhPWEPh`%u8&@6ċ?e[^_]UVSu Ft%tF9CuuVCxPu~ݍe[^]UVS]Sjj1҅t#09XuƀلtKj3%Y^u=t hi%S 2XZe[^]UWVS] 31Ã4x x44pT{(s4󥋅C C$$t ǃ >134@|C4X|ujC@P0 tjSZYC${ u1jC4Pƒ C )r߉= v 9r= v { 9sC$Cd%$ Cd{44pT1ҋCd{ t )C@{@t {$jS ^_C4PSZYh'%褿Xu@XDˁwS,h;%$_;0dXu h%g9s)VS,hN%$4pp4XpH@LI4ƀv ,h%<`1׋󤊅bff}fuEfǀ< 1҉1ЉЃEu.Ef}w Xz'Ph%j ]S薈 1:BUP7XۋUuhy'˴XߋMDغuf}f9<t >tuă PVh,%R~S0Ef]f<S 18f}uVhA%߳}ȃl(Y[Eċ4%1҅utj茭XZE΍e[^_]UWVSSƋ1;,k(Kfu{u#{u{ u {u{t]fuCUhPCPVcUt1ǀ Kf1ɉHG[e[^_]UWVShEw E@EEEE@|tXdÀuXdBEAE1ɉMM}Ef9UrZ9]s# E Ph^%諲XZu<}])Ӊ]ff}ftftfu f9s#0 E Phr%B_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPD UtLF΅uE4%@1҅u/u+j EPjEPxkPE Ph%$f}tHuΉuȋ]ˉ]̅t<9s8j EPjEP.kuSVPE Ph%-(b1ủuEEPM1ҋEPE[tE-Eƀ>f}uEȅEEEPjuWƃiUЍ M))Ufw# E Ph%虰ZY%EܹEȉEUʉU9s*D uuE Ph%:EX|ۍEtjPS u`jhPuǀEfEĉ{(u 1ECECdu%Cd{4u EC$U9S tKdS t};sC t u9FhsFhE}{}uuE Ph% Tf}t21u~`}W9rF`E̅t}OdMQ9rGdE}uE؉EEe[^_]UWVSljUMu w@ Ph<% 1҉u1ɋUYti E1ɉKhKdK`ǃu uVj+XZƃ>VuMUZYuC;u}tG PhW%0[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[] 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύG=DQK wWF(1RPQhx%~(WQh%S EPjSuuAtBf}u;8ύG=DQK wWF,1RPQh%艬~,WQh% e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@%}tQuЋE؃ Ph%uK18ujjE؋?EPj)$x'8u ǃ8%EPj s@s<Qtf}uʁXsXS`1CdChǃF8u ǃ8 %8u ǃ8%8u ǃ8%8u ǃ8%{`tps|t8Fdu.S`F !AtH9sFhPE؃ Ph'% 16ċC`tPE؃ PhI%ڪ1CdC` u9t.E1Em N&}fEހ fEm}mދEȉC`{duEt:E1Em N&}fEހ fEm}mދEȉCd ǃ8r%}Eǃ;uCTt>}t8sLCDCLCHCPCFd rFV t#tFhPF Ph% 1F$upFhPF Ph{% Vd s"1F$F VjjF0-NtHN rVXVYHC`;}؍w u PVh%MuVh%,KdSh tRQPVh%u蠦)uVh%u艦 RVh%uujE0,u1siS0,G$u u iSS0S ti;S0sS0udR Yd{u1ɋS0)@N& ڽ 1$߭ ٽ2f2 f0٭0߽ ٭2 Љ ,'Z{ 1߭5@N&u +t ]#u¹ؘ%ݝC4HH H¸J%݅u?%+t2%WW$VQ RP, Phy%=,{t 1s,1Y6Pjs8s4f6t= ,TVjXZGu 1a8RPV[ljփ 9иr781kddȃ9ƾsff+tST1󫋅,@EUUE E)E.E d}TjEP^k @u, Ph z'h% C@Cto ?9sS0S9su,S$t%,R j艙P, Ph%~ e[^_]g_U庯xE]UxE]UxE]UxE]UxE]UyE]UyE]UE&yyu]zUHyE]i twUWVS 1tx 4 u1ۋM9s3ru2u\tffW׋uUuƅtfC [^_]1UWVS@D@H@4tPH1҉P4YH8 w$x'ƅ< dƅ<;  ƅ< Bƅ<ƅ<0ƅ<ƅ<D 4u:ƅ<D8%1҅ut,Dž41DhP  14H,X@(fDž11,,9(DPDT19tk,<>98tB9rIpr@uDtDu f,,ht1(4tj(\ZYDu" t\1(fDžD,0% 1҅ut#j@wP$t @pt1$Dx@1ƋH8G 5bu`(uHX<@D&v P Ph{% HP4BZYuNjt w1rh묋0t_1[tt1thDjR_Y_@(@,1҉P|P|0fǀ<fǀ?SjhP%jjS،u"C Ph%Sh,S薓SaXЍe[^_]UEtQw]UM E] UEth%PXZUWVS} G@4j.DVCPjI| 4wVh9%́~}tE@<"jWu͏< u hz'G8@Pj48nƋ<% 1҃utjjDP48<‹Y^BuH<Pw>tHuƅ0DP< Ph%|Ph%G YX؃t w t u F19tAE9uuUM7Ph"&F XZUM΃^Ѝe[^_]UhK.h%诙j< ZMZMt9W|$wUWVSZM1BZM156.% [Of {O s fZM/sfZM s/fZMfPZMfZMZMZO erIZMZMffZMfZM=ZMtijEP EȣZMEȣZMZYFZMZMZM ZMZM ZMZMfZM1ۉ6.6.p4ZMZO8ZMU1EZMuEF h%LFfVRVRPWSPh%+C j.]SFPjh uj.h#S迤 Sh%B j.SFPjsh uj.h#S菤 SLF^(ZU)ڃ<,wJ<w1tR<CSPSPh%<+h%"<:tI< =whRuޡ =sC뉋9WJCEe[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.PD XZW|$wUW 5ZMh%> 5ZMh%> 5ZMh%w> ZMt Ph,%`> XZZMt?ZM9} h$A> _(EEUe N&QQ$h$> ZM=ZMZMpZM~4؉EE]-hZMPP$͖XZERR$5|ZM5xZMQQ$56.56.h>%= $hJ.\ _hJ.[ X}ɍg_W|$wUWVST ZM0u ZMhZMjXZM_Xv,-ZM<tG<T@8PhW%P $ {'<rT@<w*$T{'h%Bh%;h %4hU$-h$&Ph0%,T@t <uh$hp%_6^ Ph%, Y[THFh%, T@Z<t%w uh%<uh%h%, _h%Ph%, [^T@8Ph%%s, THjh7%hD%hO%h^%hn%h%h|%}h%sh%ih%K5j.STPjhQ uj.h#S脍 Sh%+ j.STPj2Q uj.h#SN Sh%h%z+ hg#p+ T@f8fZYfw2$h{'h%h%h%h%hI%h7%zuhA%nhN%hX%* S1ɋHQ t Shn$he%&uj.VSj3P ho%* [hy%* hg#x* T@fHfZYfw-$|{'h %!h%h%h% h%hI%%* X!{Ot-T@<m4T|'h#Ph$) ^_ {O !{OuhJ.YH [g v狝t݃{)!C2t!#t1 h%3th%n) C Yh%V) C HC SRRPC Ph%,) HtǃxPh% ) XZ h%( XCPh%( Y^19~gVHtYZuVh %( XZCj.RPjAN uj.h#RW PVh%( F땋L 9؋ZMZMt9~~"{O qmZM0t 90P/ UWVS]u#P{OtP3^1ۉP{OT{OS%h T{O@$#+P{OYux U1҉L{O5R.t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSU}tIB<:u1ɍ4 E  8uAu t<@t:u <:tu9uF~@u1[^_]UE6.]USE] u|À:u%u@C8t9EsH:tt @|u1[]UWVS4}!}u[=P{OtQu Wn[^u<5T{OP)YtHWP D3XZhY)^1u?v Dž)Etw}xjjjuU !jh@P}E xDž1ɉ1ދ9rqhQuƒ ?tuZu 0S0u 0HЀ u%V1Iu8:ut+<Dž\t-Dž t t11:uΉ1҉V9r)ډ)ށVSv,ZYu"S/^u[Ɖ‰.1<#kcu SZYPFS7/XDž6.M1j=ho%&S ƊtV:t֍HX)ىMAQPuVË tF}t uXWi.^KtF:^Dž@DžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QW_*ZYu:W-Xt uXr-r _<ljljƉlj )PVQ SR ,Ymt u ^)؍P9s&PSD)ZYuS,q XË Dže[^_]UPUjujM EUH{OtP> 1҉H{OY1@{OL{OD{O1UWVS1=@{OuE @{O=H{OuYh7o%@{O0# H{O^_u=`P5H{OY[t?Duz1=D{OP{Ot=L{OuL{OH{Ou@ @uP= 1H{O@{OP@{O@Zu 1Sh7o%PAًR.TZ:u#t =D{Ot|0\ND{OG|0\u D{OP1ɍt:uf:Y\tAߍP5H{O}Y^u'H{OtB @R< 1H{OZD돁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u wu ][^]UWVS j=u uy ljd![Edu!n l8]EdUru<:<^uFG<:wMu})ߍGdPS%ZYuS([w<\ůG<:HЀw+1ɉMF0MȉE9t HЀvE농w1e[^_]UPEPhhOhOuƒ1uEUWVS} uLu7uuW1ɋU à =Ou u1Ɖ>1e[^_]UPEPhhOhOuƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס|OEСuDC[^]áOuÀ=O4UWVS \ DžDžDžjjPhOjP-@u Ot |OPxO1 @HtO1t3tShPhr%3 t!Ƅ9h%uXu ƅ t5Ou OFtB<97$|'OOOOO볡6. tOQ9}H 6.@6.OOw6.iH6. tOQ9P@6.E6.7H6. tOQ9@6.OOOOOOOOƅ^X hW#Rh%P6.GY =Ot hT Y=6.6.9}6.׸É\O |O pOr5lOhOtO)I dOXOPTOtP`O 6.POBLO HOЉDO4@O#5xOt@@O)‰D=OtMjRPj M95@Osxu@)lj|| >;DOFs"J| u| | DT>| T 9Ss$EExSW}ED CSW{;sss{uISC P}XZ=OuE@,t POEX,PO؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC tO‰ى[^_]UWVS¡LO!9t> tO)su܋tu 9t)D @!u܋D UEPh,OVy@ZYe[^_]UWVSQӋLO!‹ tO)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS EܡLOЋu!9`x }؋ tO)‰WtO]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w _~'w_~'"1w}'1;SsS |C@C;Fu ;u1ɉHt SFP({XZNZH9t9sxt PFPxY_SVxXZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPh,OFwPh,Oz=Ot KZ{ SC OOe[^_]UWVS9POtPO9kjjhOyǃ t؋_ jWhOyEWhOzO=O;(Or; Orw1ɉÅuj}먋 HO1ÅuP=$O@u1jNjLO!‰)[9tPx$OY9uō3 Ot]EPhOZvXZt>G 9r7 39s0jWhOxEWhO)yO=O}뾉؍e[^_]UWVSÉU tOEC1t}9xts@ƋuzơDOEF}}1U9s1k`;d't @u-$`'`' sjttC> 0@p00uHP@$u1S$0t9(s> *\p0믋H@9(s(0띍e[^_]UU%;(sR.]UU%;(sTD.]øUS] uShK.&h h"StZ= 0Phm$hK. hK.j XZEK.] UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt ; )wu PEPà Et ; 1]UWVS ‹@E조R.E11 =E}9s%9]D{t}tk Y DFɅt}uzuB OBO [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEP'ÃxuUSˋ@ ى[]ÃxuPO@O9Ps=UVSÉjRpwo u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD P C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$@'sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj=4P.t9s?MjC,@Ps(k Mu e[^_]C(S,z{,f P{<tgFR.0=4P.u9sR.0=4P.u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E@7.HuVQM}% t uMQ"$ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCCOOO'8[u"x.u.K9r !f3r9s:.u z]u{uCOCO[^]èu'B R.fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uCOCO{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4'# ZYuCC u1]UUE ft҉Uż']1]UWVSSɾ=4P.t9rC,E5R.=R.113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh$%V*! u 1ɺjh+%V ! u1ɺ,S j@B@Pr 0f u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uCOCOO<-t<]u{uCOCOOCE؋ R.Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ=4P.u˸jE@$E@PEp d u fMA Q$JuN$f8-P9x]x-t A -f9k=4P.vNf9~;{uC OCOff9UPF΃=4P.uމEa~{uC OCO1E7* UFup>-uF3-U;Cr{uC P8]u OCO{Ex8tC @tEHfE14P.u9}~Ju9sE8}3G8GEx<t4t fEfu-GR.8EuޡR.8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF R.f tNt R. t< R.ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCCOOGƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC OCO{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JR.DJt%9~{uC OCOPU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uCOCO<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $'^[m\p{|;{r{uCOCOS B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)uOCO 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCCOOGu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM R.Dyu},t{uC COO@}t{uC OCO?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJR.DJt%9~{uC OCOPaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPR.DPt 1e[^_]UWVS} UҀcE tEp9J) W ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEu:Džh 11DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXR.DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qERGPx u )MuMA}dM)ыU9uG PVƀ @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ R.Qu?f_t9f}fMQҋ R.Qu f}_zftQ R.WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgR.OJf_ f}_Zf_ 8u_CfCU R.DQuf}_f}u2ы R.DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVp @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRUj UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f R.DAu;f_t5f}E R.DAu f}_fEzftOR.DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡR.DHf_ uR.Dpf}_Ɖ 8uaCf7E R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRU)h U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRUc UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG R.AuE R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRUa U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PV-Y @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=4P.lt1ۉ]tMEAEW YE}M9MP F,EF4EtpF8EtfFu}D$c&uƅt%lhp%dwtD$PD$<$pKD$hD$<$D$GD$<$tht4D$hD$<$PD$`D$<$6lzdD$hD$<$D$pD$<$ <$G Ġ[^_]ËphOldunu E $3G Ġ[^_]Ëhld<D$hD$<$D$a}D$<$ D$hD$<$D$gD$<$D$hD$<$D$wD$<$zd9M`D$WD$t<$A`u!phD$hD$<$'UWVS #} uttEEhEEEED$E$\…PEt /ĸ [^_]ÉUD$ED$$EDžDžDžDžjDžUDžDžDž W}׉ƍWOt%%VF9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$UMDžDžDžDžDžUE@fE@fMIL$D$ xD$D$$x t$ D$D$ 4$x EDžDžDžUE@MIMI Ɖȉ } Dž UE$lD$D$4$D$:4$o U H9EDžDžDžDžDžDžDžDžE@fEEDžDžW19ĸ [^_]øzR%Kwҋ>V9s%u9sF?V?r95+ hNv.&.&N9sVu鋽 Ex[%hML$ D$D$$wt.&.&V9sNu[Ex @?⋅D$ [|D$D$$nu &.&.&V9sNuE@D$ D$D$$t Pf.&.&V9sNu;&N9sVu hN&.&.&N9sVuR ZhN&.&.&N9sVu;rEhNf.&V9sFuEx66hUT$ D$D$$]Zf.&.&.&V9sNu;t94hN.&N9sVuhN&.&.&N9sVu{ExÙ @X@ውVhN.t&.&V9sFu鋽Džȉ&.&.&N9sVu#1?h.hD$D$D$D$ D$L$M $.&.&N9sVuD$D$ L$D$ D$D$E$;ҋȉ.&.&N9sVu鋽BD$BD$BD$D$ dD$D$ $>o Ȅ.t&N9sVuAD$D$hAD$D$ <mAD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ D$D$ $m AD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ PD$D$ $,m B D$(B D$$BD$ BD$BD$BD$BD$D$ D$D$ $l sit&.&.&.&N9sVul.t&.&N9sVuha.t&.&N9sVu{i.t&.&N9sVu;1Qu.t&.&N9sVuv.&N9sVuv.&N9sVu{EDžDžDž+hoU DEED$ED$$~]U}ĉ|$T$E$\ ƃtdE$踷 ƃt'D$ED$$(]1҃ډ MD$|$E$ M 8D$ED$$\˸ 8t[^_]躸 UWVSP J o Dž/devDž/XtyDžyXXD$kh$]t-ƍD$D$FtH4$萗 4$O^D$D$ D$D$$N@Dž[hp0ƅpD$D$<$\ƅt&L$D$<$`uD$<$`tg$B]nC P [^_] 8u)΃wΉ<$^uD$D$<$[`\EE ut|$E$IMUt#ED$D$ $EtED$D$gt $K 1P [^_]DžUVSv ÛED$ED$ E D$ED$E$tKJ ƃt?uE$[E$;[^]ËEUE$s[[^]þUWVS8 D$ D$D$$} !ЃD$}|$4$YtiDED$D$D$D$ D$D$ E܉D$<$X Ut VuU܀: u8[^_]胴 U Ep 4 ! #ƀlUVS pt54$ #E+UE$]fffffffUWVS$ æE@ E։υU };EE EU D$T$ $""""D$"""F9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""E]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""_EUM]9ȋEE9EE },EU D$T$ $D$E9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""D9BMϋEE}19}E UM T$L$ $D$GD]u9M΋E eƉi`T$L$ $D$C9MϋEEƉ]u덁݉a)u}T$L$ $D$kCUM]9ȋEM""""9""")Ɖm݉]u UWVSH< aD$T$|$|$D$$E D$$H*)R)L$L$ |$M $wE tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8X u}܉EԉŰR.ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}¬R.UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$] E܍ }h D$EЉ$]ۗ u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍ }h t#D$D$EЉ$]k uKE܍,h t+D$EЉ$] u}g]܍"D$EЉ$Ö t2,h t%D$EЉ$]薖 u uE܍L]̉ލh tD$EЉ$]R uruЉ4$]; T:sE܍LD$EЉ$] 2u݀}u<E]DCt.E܍D$EЉ$]ϕ u1ۋEЉ tC.uu#ỦD$EЉ$] Uus5uD$EЉ$]H tu#GW ]ԉSG UWVS\ ÁƋ'<'wwEVN)щȉMEED$$Zt_FMȉFD$F$Zt:F]؉F>FDF 1[^_]ÿ'E {UWVS D$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$`MD$@|$X\$LD$\D$` O|$Txq|$X\$LtL$T=qwT$`9A-D$@tT$T=qw L$`9AtL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$XGD$\D$`t$\QT$Lk)ЋT$P ‹QD$dT$hD$t ] 1uUT$$]e6tFuɿ [^_]UWVSͻ 0t:,>t M1uU T$$5tFu̿[^_]UWVSf Ët:>t M1uU T$$5tFu̿[^_]UWVS $E $ ƋE%EEhUuUT$$#+…U>t M1uUT$$4t1FűuUEEu54$`0E [^_]ËUt }1]uЋu9t!$Ud D$UT$4$ E0E렃}tE1҉UWVSǹ u Ex}u 4t+D$4$4uE)E@ [^_]Ë$!t 1[^_]Ét$SD$$tUVS@ euF$H.F $=.4$5.[^]UWVS$ )}E 1t u$%E[<$ E܋MAnD$4$c)EMA  EU P8E܍hMUT$$'ƅ>nED$=4$6 HE } M D$4$t1uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE j$!t(E܉$,E$,EE$[^_]Ét$SD$$7r $Z,ffffffUWVS8 Cubq D$^sD$4$uD$:4$K5 DžD$\D$4$訄hF$H` $I#D$$޾D$D$|$ D$D$S4$/$"6D$D$|$ D$D$4$/|$$(%ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $N  $D$$` |$$_$ƅOD$E D$ ED$D$$q$OD$E$vtPT$$}$)$|)n 8[^_]À>/uEt$D$<$t'D$<$SWn 8E D$t$E$~}뎋E D$`D$E$~E D$D$D$ ED$D$S$2-BE D$t$E$Nrm E D$dsD$E$@~Dž1D$ sD$E D$E$ Dž1k4m E D$dsD$E$}1;$ l t$ %D$E D$E$ <$1sD$E$8D$/4$Ӳl E D$4D$E$}DžDžv?l E D$V l E D$VUS(訰 ͼEEED$D$ED$ ED$D$E$+x E([]øUS(< aEE>ED$D$ED$ ED$D$E$*x E([]øUS(Я D$ D$$?D$D$D$D$D$ D$D$D$D$ $1*x D$([]øUSZ ED$D$ ED$ED$s$|]x E[]øfffffffUS E$g U֮ U|t |]ÍD|]UWVS蠮 ź}|$E D$E$z9s [^_]i ?|$ t$TD$$|[^_]UWVS/ T}|$E D$E${9s [^_]Mi ?|$ t$D$$|[^_]US E$k t []ÉEsT$$|EUS z ßE D$E$c t []ÉEsT$$|EUVS, Qu4$t[^]ÅtEt$sT$$|EUWVS۬ u} |$4$t[^_]ÅttE|$ t$T$$|EUVS{ àu t$E$6t[^]ÅtEt$sT$$|EUWVS# H}|$E D$E$衷 u[^_]ÉCg 0|$ E D$D$$|[^_]UVS踫 ݷuE D$4$ t[^]ÉEt$sT$$|E[^]USa ÆED$E D$E$TuEtT$$|E[]US 3ED$E D$E$uEtT$$|E[]UWVS$蹪 ޶D$ D$EUD$T$EUD$ T$E D$D$E${@ Ɖ׋D$ u $[^_]e L$ EUD$T$EUD$T$E D$ ED$ D$$|$[^_]UWVS$ D$ D$EUD$T$EUD$ T$E D$D$E$-Ɖ׋D$ u $[^_]d L$ EUD$T$EUD$T$E D$ ED$\ D$$|$[^_]U7 `U!SፀJ]Íν]Í]Í]ÍB]Íl#]Í]ÍQ]Íq]Í]Í]Íi]Í]Í]Í]ÍQ]Í]ÍR]Í]Í`]Í]Í[]ÍD]Í<]Í]Í]Í]Í~]Í]Í]Í]Í]Í]Ím]Íi]ffffffffffffffffffffffffffffUWVS ƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$k UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS`} E}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s UO?VLwűEЋU t1҃1 EUȋ]9s UruGt$|$ D$ED$E$ 뺉}UE$[^_]eT UWVS^ ÃD$ED$$Pt{NjE88/tbD$/4$譚…tL)JBU=wsG|wdD$}|$M$ Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSS x}UtlƍxD$4$ſ tD%=`u'u$U ytĄ[^_]3S O1Ą[^_]S 1UWVS謗 ѣ}U)tlƍxD$4$ tD%= u'i$U tĄ[^_]R O1Ą[^_]rR 1US( /EEED$D$ED$ ED$D$E$qx E([]øUEM tP8t P81]Ã߉P81]UWVS m Ò}tc$UT$U T$$5| ƅt/tV$ uDt$D$<$ Ɖ [^_]ÍD$$6u [^_]U 试 ءU T$UT$O$]U EtUT$U T$$]ø]US P uE D$E$Du$ED$ED$O$ []øUVS !uED$E D$4$DuED$ED$4$H [^]øUWVSL觔 ̠E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$ EPU@E)99}W~A}ủu1MEUȋEĉD$ |$EȉD$E$"sE9uu֋UȋED$T$E$CE$1L[^_] OEԋ U6fL[^_]UVS4` ÅuЉt$E $ED$t$E$}4[^]U  EU T$UT$O$H]UWVS uEE}ED$E D$4$Bt}EE u[^_][^_]UWVS4苒 ðO8ủt$E$?E D$t$<$4[^_]UWVSB gEE}O0E D$ED$4$Bt}EE u[^_]C[^_]UWVS4ݑ uED$E D$4$At%}̉|$E${ED$|$4$4[^_]UWVS4~ ãO0E D$ED$4$TAt%}̉|$E$ED$|$4${4[^_]UWVSH ?MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$oE9u܋EUȉT$D$ $MM@M $诋1H[^_] O}ԋ Uy'H[^_]UVS4 %uЉt$E $輤ED$t$E$4[^]U 輏 U T$UT$O$u]UWVS苏 ðuEE}ED$E D$4$]?t}EE u[^_][^_]UWVS4+ PO8ủt$E$ߣE D$t$<$4[^_]UWVS EE}O0E D$ED$4$>t}EE u[^_]p[^_]UWVS4} âuED$E D$4$X>t%}̉|$E$ED$|$4$ 4[^_]UWVS4 CO0E D$ED$4$=t%}̉|$E$跢ED$|$4$4[^_]UVS 軍 EM thP8t P8ƐO@:t1 [^]ÁP8 2D$D$@O@<$9PH8붸 [^]UEt @:]ø]UVS  5dOt^B.`J.T$XT$$@4ƄOtE$1O$$wO [^]Í$Cbu뎍Ft$e$fUWVS(a Æ}tG{E{EOEEME EM<$bƃ t tu#E([^_]ËE1([^_]ËUGD$ D$GD$<$SE9E9G?@UR. DqEEmUT$D$<$;;E;E :E+m}EE;E tu}MMD$ GD$GD$<$FhD$ GD$GD$<$%hMAE9O~D$GD$<$:iGU9ut$GD$<$e:u7D$ D$GD$<$gD$ ut$D$<$gt$GD$<$:E;E v}D$ ED$GD$<$MgEHU9_E9G5MzUG;U D$ u4UT$D$<$fED$GD$<$W9E E&OL$D$<$f}D$ FD$FD$4$fFD$FD$4$8}tE9} uD$ FD$FD$4$9<ffNv tv$uMI,4vD> qxf~g$>O HG 9u͋9 <>f|>y_u$F,HfD99f|9y.NDfHD$F|$uĴ[^_]Éщ$E@,R|)ƍTxDlx9qf+fG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YMQ, rfVAtωp$0V PF 9u͋tp9l9h\T$xy DžxEP$ty DžtEL$y DžEԉH$yy Dž4$Qy Džx|Ƌ)΋)ȉpl9^p9dE@,H1҉tvf~94>ff~~ t‰ljv$Bu}O, I4F uf~0r$n4W PG 9u͋9 Ƌ9l9|)ȉ9~ht|Ƌ)΋)ȉpNj9p9 E@,H1҉lht}f~94>ff~~ t‰ljv$Ju}O, 9I4F uf~k$o W PG 9u͋9lhwDž?lxE@,@xMT6MA,@ƋQHVfF94QDfHD$A|M$`uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8B~1ҋEH~mE@,<1E@~MU.&.&E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$b\@[^_]ËEUĉP|DE9M $M @UĉEtAO M $v…h@EP|M U\ hUT$O$ ]UWVSd\ Éh}O0t=Gt6G$&|$4$D$4$E[1[^_]ø[^_]UWVS[ hu} t=Gt6G$0&|$4$XD$4$Z1[^_]ø[^_]UVS[ øgEM tnPHց1O6u9PDQAP|ttA\Ru1[^]ÉցO;3u뫸[^]UZ &gUT$O$H]fZ fǀ(!UWVS8Z fuOEȋ8B.…2OE2OE2OE2|OEԋG xOEЋG$tOEċGTpOEGXlOEG\hOE̋G`bOGlaOEGm`OEGnEȉ0Ћ2E䋖2E2E苖2EԋV EЋV$EċVTEVXEV\E̋V`FlNmE܈VnE؈4$`#FO1ҋ2‰T$$YV OVO4$k4$w 8[^_]OEOEOE|OExOEtOEpOElOEhOEbOaOE`OEUWVSX ôd}D$4$)ƅEdž3E Fdž2dž2dž2dž2dž2(!3ǃ(!džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $E3dž34$7t$<$‹2oPJpdž2D$D$D$D$ D$D$4$7FD$D$D$D$ D$D$4$F4$oc4$肓D$D$D$D$ D$D$4$菦F tjD$$Q4$n%4$4$\4$IIO34$B[^_]Ë2t$ s2$k29tDžu拆3$4$1먋RhL뮍$ +Dž1{4$fUWVSCU ha}2t$r2$wj29tƅu拇2$#<$b3$3$O98t<$[^_]<$[^_]ffffffffffUWVST æ`u, ".&.&.&+@+9uǃ ">ǃ "<ǃ "^ǃ "vǃ "#ǃ":ǃ"'ǃ"#ǃ"#ǃ"#ǃ"-ǃ"-ǃ"_ǃ "|ǃ$"oǃ"-ǃ"-ǃ"<ǃ">ǃ"*ǃ"!ǃ "f2E@tgt.Ex tAu[^_]ËE싀t(VT$o2T$ D$D$E$1.t&.&.&, "Tp=u[^_]USR ^M1&.&Tp, "=u[]UWVS,iR Î^,!EƍME$+$FF(9u݋uD$$C8CuxuiD$$"$3;gT$$>ǃ!!ǃ "+ǃ"!ǃ ",ǃ<"!ǃ "-ǃd"!ǃ ".ǃ"%ǃ "0ǃ4"%ǃ"`ǃ\"%ǃ"aǃ$ "ǃ"fǃL "ǃ"gǃt "%ǃ"hǃ "&ǃ"iǃ "%ǃ"jǃ "%ǃ"kǃ " %ǃ"lǃ< "%ǃ"mǃd "<%ǃ"nǃ "%ǃ"qǃ "#ǃ"oǃ, "#ǃ"sǃT "%ǃ"tǃ| "$%ǃ"uǃ "4%ǃ"vǃ ",%ǃ"wǃ "%ǃ "xǃ "ǃ$"~ǃ "#ǃ"pǃ "#ǃ"rǃ "d"ǃ"yǃD "e"ǃ"zǃl "ǃ"{ǃ "`"ǃ"|ǃ "ǃ "}E2xU,!U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$o2L$ D$T$$eEp, "}Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> !$<"$^<"$vd"$#"$:\"$'$ "$#L "$#yt "$#g "$-U "$-C "$_1, "$| "$o "$p "$r "$y "$zD "${l "$| "$} "UUSL X,!]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0!L FXEU܉MDŽO72EE4E,"fEE$Hƒ=4M4%y 4 44fǃ,"EDPfvM䋑f8;@E,"fWf^fqf$MdU܅tOQ)ʉ$J2E$N‹E@ @M M4 'UfB 49}} 4% 44;4tf,"@Of1҉Ѓ0[^_]ËE44%y 4f,"y4D$ D$D$$U 4449)‹4L$ T$U؋MȉD$E$!4;4U}dž4…f,"4xp4fǃ,"3E$~0t3E$=E1U,)4fǃ,"E܅U0tE@ U؋4 E44B%y 44D$ D$E‰T$E$貿~v4%y 4 494114M%y 4;4)fǃ,"Mԋ4D$ T$U؋ED$E$U؋M~4y 4 49411x4Wy 4 494@Off,"@}AEE܅U$-E$‹E@ N@FM MtU.jE@ U؋4  UfB 9 4,fǃ,"!E܅{tOQ)NUm~ 4}} 4Hx6 44m4%x4뿃ߋ 4}} 4%y  449}fG Ef` `J.D$ D$!D$ $X $DUD PEfǂ,"ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSXcD ÈPuDŽOMV8у$33B.EEtO EU)V8N<t=%*tE11zE}uAX[^_]Ãt $*tًE$E@EFF$Z Ut p@뮃$<UVS> JƍSD$4$S NtD$4$9 4$) 11t)0tGB<1;NVt~΅u׀>u|F[usVmt2t00uVFtJeNVu1UWVS0D= iIUu :uF2tU$qZUF@fu2ML$ MD$T$<$%2M EPJ(N$JN 3St$QD$D$$FT\t$ zD$D$$FXV  ~$xO9|ONTtO pO2P3PB0zp12džp2E싂E苂TEtU܉Udžp2ELɉMEEEUtwD$Eԉ$UtE܋U؉$-Mԉ $"E܅IH 1$ΰt2džx2EE-EED$E$ u džx2EPED$E$ u x2t|$E$ u x2dž|2UtE)dž|2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(EU܋ED$<$ UEU܋ED$<$ Uu p2MU܋ED$<$ Up22@@,EF@fL$ D$D$<$ 2XE1ydžt2džx2Edžx2;Et ED$E$ u dž|2EtD$E$ u |2|$E$ |2LMFEidžt2džx2dž|2Mdžp2EEdžt2džx2dž|2E@tg|$E$ uTx2dž|2EJt|$E$_ u x2dž|2dž|2E8ENdžt2džx2dž|2ExOAOU6 DBOD$E$]US5 BExOH$ |OH tOHT pOHX bOHl ˜O2 p2<"t28"x24"|20"2$tQ[]UT5 }AM„OtJXpO1]ø]fffffffffffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS p4 Ǎ@}ƉDHfx 4 [^_]Ëf=tyfDN4f>tX$]ȡTP.t&ffB9uǀFF [^_]ËEFf\Nu]ED$$]eMME$ ])UMtZf@f@@ f@@f@@]\]X ]]9Eu] $ެ$p]`J.D$ D$D$ $H $4] $腬$UWVS 2 é>Ɖ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS1  >Eu^.&9t)fxf8u@$9u׋~1$]蕧9> $]}4$u[^_]UWVS Xt&.&9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS0 <}fǃL"$KP.&ffB9uǀ2ǃP"ǃT"ǃX"LT2@tL$ =w4D$T$$N2!9u[^_]Í $t$US y/ š;E E„Ot+2UT$$U(E []ø []U/ @;UM ~*Ot2t _1]É1]UWVS . :DŽOte3339}}<31 [^_]à D$$K‹3t333뱸빋3L$PT$$ 33]\33u-U - ":EOt%2UT$$1ɋUE]ø]U- 9M„OtJTtO1]ø]UWVSw- Ü9}<$ƃuOG @tI 8u?DŽO3t-|OD$xO$uǀ3[^_]UWVS , 9EUO2El"EE$3=X" %y P"T"fǃL"LNfu f9qL"fmffjMUU$i E$mE@ @ME@ M P" %y P"T"LNfL"X"T"yt鋓P"X"9fL"y [^_]ËE$t3E$8=DE,MR [^_]ÃUfB X"T"9|l"<X"P"9fL" [^_]ËP" %y P";T"fǃL"Eu-E$E@ @aσufF tOQ)=X"T"Ef` [^_]ÿ`J.D$ D$ D$@ $ $ UWVSv) Û5uDŽOMqV8у$2c33B.M MEtOEeF8V<t|‹FHP,UD$UT$PT$ PT$UT$$C[]ø[]UVS1! V-O0E D$ED$4$tCEt?VF,ED$ED$FD$ FD$ED$4$VC[^]øUVS ,uED$E D$4$tCEt?VF,ED$ED$FD$ FD$ED$4$B[^]øUS) N,EEt>HP,UD$U T$PT$ PT$UT$$nB[]ø[]ffffffUS +O3t`3$蒎[]1[]UWVS s Ø+udž243@fu|$$莲 t%F@f|$$m 43`3<3h3@3l3D3p3H3t3L3x3P3|3T33X33\3383d3Fl83Fm4322<32D32H32L32P32T3222@3%2fdž2432<32D32H32L32P32222324832@3%g2`33@fuT$D$$ [^_]dž3bOaO1 [^_]ø|$$K UVS )ƄO$LtHlbO PmaO1[^]UVS  ý(ƄO3ugœO Oǀ2233t9@fuT$D$$ [^]V1 [^]UVS  (ƄO3ugœO Oǀ23tE`33@fuT$D$$b [^]1 [^]UVS \ Á'ƄO3ucœO3tW2u<23@fuT$D$$ [^]Í21 [^]UVS &]C=w"DtOX c } MƄO3322l3UujU22l3 O3@fuT$D$$j[^_]ÁU 3P1[^_]ø[^_]U1 ZD$O$]U .D$O$]UWVS u$豛 33|$ D$D$F$2VT$o2|$ D$PT$$-2VT$|$ D$PT$$F@:udž3[^_]Ë2VT$|$ D$P<T$$xO8|O8 w+3<$31҉31 US ú[]~ O3US] ÂO$ 1[]US1 VO3t-3@fuT$$H []1[]US  O3t53@fuT$D$$s []1 []| O3ts31V O3tu310 YO3tUs3E1]ø %O3tUu3E1]1U OU31]UVS ƄO@@fuUT$D$ht@$ t Efu5"PwtU$Ѓ[^]Ëǀ3[^]UftxO|OUWVS, '""f}ƄO@@fu|$D$ht@$P |O t }fxOǐO;Pu9HtL$MԉT$U؉$QMԋUO;Pu9HtL$T$$Q43@fuT$$i 3@fuT$D$$$$ܖ,[^_]EfEfxO;8t8>LJ3}9t:ǂ3)EEEEEE"D$}܉|$$ ǃ"EOD$$ "ǃ" US "t[]ÍOD$$H "ǃ"[]US "u[]Ë"D$$ ǃ"[]US$U z"t$[]Í)EEEEEE"D$ED$$G ǃ"$[]US$ "$[]ÍED$D$$ "9Et"$[]D$"D$$ 1UWVS4] ÂƄO3;3@fT$$h ""yǐOB$oD$D$ HQT$PT$@$^@O@|U 2E؉D$D$ $cUԋ@t A:zUԋ}؉|$D$$+|$D$Uԋ@X$ @$ D$ D$D$@$nǀ343@fuT$D$$4[^_]@O@| 2M"E܉D$D$$ "9E"ǐOR뒸"D$$ ǃ""|14[^_] 2MvUԋM؉L$D$8$Uԋ@YD$"D$$ CUWVS,~ ãEEEE uԉt$}|$$gEEEED$|$$ZgD$$hO3tD$t$$g,[^_] O3tUS õO3u-3@fuT$$覚 []øUS 8 ]O3@fuT$D$$ []US O43@fuT$$ []>US  E U@ORtI|t7 2T$D$$AOǀ3@$# 1 []Ëxt 2T$D$$Oǀ3@$ڎ 뵸 []UWVS  EƄO2tQun@O@@tt\ǂ2 2T$D$$`@$R [^_]@O@t ǂ2뮿 [^_]@O@tǂ2{U $O2$]ffffffffUS]E  }t J;}R ;~[]ÃUWVS ð}tG8 u^@u[^_]ÍtG~W,EO(G\p;}@ ;~9Uu׋u멉<$"G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U091[^_]É봸USEt=H~6X,1".&.&.&9t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًU-9u1[^_]øUWVS}] UG9)9i4utU}t]G,E] Eu pW(9|_9}W(p 9 _9} E E;E 1[^_]É듋uW,G(D$OL$$D9UED$ PT$D$$]UWVS}G~EW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]ta{tZO~[w,1 t&9tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]ffffffffUWVS> c ЍR4ր33V,U39VG8 L4U;W81҅ZE1EEEEẺEUMD>EED$D$ E3@@D$UT$M $mV,UD>Mȉ$wUV,E3EEE;4ML$ T$D$E$7ED>$IwEENjE94~-D>D$E$unEE94ӋUЁĄ[^_]Ã4$D D$t$ ED$D$<$‰ЁĄ[^_]ËED$ T$D$E$ED2Mt$ D$BD$$D$M2$P‰ЁĄ[^_]úsUWVS8 ƉEЉU̍R4Eԋ4}8<$P ƀ?EEE4E؍EE'E$uM9Er;UU)ր?Et)E؉D$ t$|$E܉$sEy8[^_]Ë}ԋGu܍WMtFȉ׋uԋ6tftE‹u)uƋ@tQuEt}|$D$ $U' UEЀ4SŨ8[^_] EԍPMtыujuE)ƋEԍPCt$D$ $U U)u}E)9s뷋E9r7EԍP9UtU?$9Uu~X24H90t…#ȋH90utJ$_2UWVSS xlj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$vUtB8tt<$6u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVSj ÏƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u;u?uGt@O@@8tf@1[^_]Ãf@t4$,t4$미[^_]US% NMU Ot%t X@t @@f%f1[]ø[]U UOM u]_]U UOM u]]UVS ¨E ŒO2Uu0ÁE% úډ1[^]ø[^]US% NMOt;U u4PX2P@P@[[8u1[] щH@[]U OU]SU OU]UVS îO0tFFX2@Ttf@4$-4$@O@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]i]UEU Mu]5]USEUu2U Á ӺEڋE 1[]ø[]USEM t;Uu4PX2P@P@[[8u1[] щH@[]UEt@@]ø]UU E]UU E]aUVS utFFX2@Ttf@4$u4$a@O@@8tf@U 1[^]] @OPT1 t t t@t̀t(t t8t ttLt 1 @OPT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS çu4$" D$t$O$ [^]UVS E ju 4$ D$t$E$Z [^]UWVS 1uE ŒO:x<ut&.&9t<uЉD$t$<$ [^_]É4$a UWVS }O0E D$ED$4$st<$ D$|$4$ [^_]UWVS F ku}ED$E D$4$t<$ȉ D$|$4$@ [^_]UWVS }uOE D$ED$$U辎t/Ux0u 9t<uƉt$|$$ [^_]ÉU<$. ƋUt$|$$ UWVS X }}uED$E D$E$-tAxEut&.&9t<uƉt$|$E$& [^_]É<$莈 UVS u Ex8u9t<uЉD$t$E$ [^]É4$/ ffffffUWVSHa Æ}EUċEG,4@4E@U {[f ZE EG@E̋GXpXș)։uȋE;GTEȅ1ẺEĉ}u 9}_EĉD$E$[uظH[^_]É$U5EEFEȅE@$UEyEGM+M9E  G(UQ9~I 9}F t$iF E@ffO@EE %WHUUȁ ‰ЋM ȉFEfFE@EȃvA}$9IMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$hG UMȋE@A%GGfGfwu}G9+uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$ EEGT9tBuW,u P GG(<$1H[^_]FEP1Ʌt=Uȉ}$GxMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$/\E;GTG8 <$@<$z EE A!E 4MUčJ‰Uĉy19uĉ)UBHFBLfFMEy19nE0B,4v4BDfFt$B|U$eu. uEc$Q]E u E;GTuO,u u6uč @4EOT9E M MO(ʋH98OU9U+GHFGLfFfFUO9UGDt$G|$du- ȅM KUuUȋu6O, 4I49~X}uEFDfG|$F|$dFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$oM MG8 ;aO8u E<$GG8  <$E uĉ׉EċE MO(P9 ~ @ 9E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO, qE EG8  E DW9)ʍBE<$jE'G8  <$RkUWVSm 8uE;E0E,EP@,Dt@ 1H4[^_]UD$ED$ ED$E D$E$]UVSt ÙO0E D$ED$4$Jt&D$D$ ED$ED$4$[^] >Ot<@OR8tt H@Ëuø Ot"@ORt`@øU £Et9@OR8ttH@]Ëu]U- NEt#@ORt`@]ø] Ot=PX2R(tt H@Ëuø Ot @@øUEt:PX2R(ttH@]Ëu]UEt@@]ø]fffUWVS uF8 4$ lj4$ED$FPD$4$}D$4$cUT$|$4$}O;0t 1[^_]$ {aO8uFָ[^_]U: cUM Otx;H}9~ PPHT1]ø] )OtUHPU PTE 1]øUWVS u} F8 u 1[^_]É4$E4$ED$FPD$4$i|߉|$4$*ML$UT$4$E|O90u$ pzaO8uFx[^_]U +UT$O$]UEU Mtx9H~9~ PPHT1]ø]UEtHPU PTE1]ø] @O@t 1\ @O@t 1UWVS(% NEUE uO9}tO9zH}z}JP9krT9`N)9c\]u܍D;9u׋WE1MfFM9yA,U[4ADEFFfFt$A|M$]Vu([^_]؉9BT9H)9)Ɖu9EMAIB[ωރtftEEE}9B,}4!}#zuŋJ)9q)؉E9E]u=[BI߉΃sEtftzmEm9FB,M4!]؋#zu띉ϋMG9 u9|-׋GD$ D$t$<$]9w~׉BtU$]U$]1)J)9A:0UM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]?TucE9EuM܉r9M׋GD$ D$t$<$]9uuE:fS 4fU UT$O$m]ffffffffUWVSE89tp@EOE)w~TEP,G(UW,΋M4}.&.&y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS$3 X}GDEO98 GH%EWUG,E40UutWUыpG9UfFE9svffEF%M ȉFt$G|$CQu¸$[^_]ËOU9~VUEEGGED01E_GD$ ED$ED$<$<$s1$[^_]EU O$]fUS E] "*t&t "A""1[]øUVSu^(~^F,11҃} <.&.&D,~9u[^]Ð.&9tD,y)9u[^]1ɉ[^]UWVS0 EH,xOE" "E1|OEMED$D$D$D$ D$L$ME$t#UB UUB(ҋM~CMM L$$Vt=9"~#tyمjE)c)Mǃ"10[^_]UWVS }W$G(E1Uv.&9w(~hD,tO L$y؉D$D0$uED,yD$UЉD$D0$p tD,E9w(E[^_]EyUWVS* O}G(~"1D0$vD0$$9w([^_]UWVS u"1~M1$v.&.&.&9t% 9"uDŽ "9uۉ[^_]ffffffffffffffffffffffUWVS A f]ƉE׉UM$N ]EPt MA +B A(EEuFF]^]^FT4$] 1ۋN]uF,MzF@1ɉU܉fGU9VUGfGFD$]97G |$F|$Ku [^_]ËEED$E@,$]1tыuF,U)D$F0$]1tF0V]K +J K( <K,[+ZR,UʉUf.&.&rprpP 9MuԋEqU܋zUED$<$]LUBEE9F~EP1 [^_]ËVE}ǍD$uF4$]0ÅF4F0V, M܉ً]Ӊ]ut&.&.&.&HXXXX @x9UuҋEo];90G EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS蝼 E]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$EO91[^_]C:}xOO9ˆO9ŒO9S9M 9u M S E|O89E9EE)Dž#EÈOtS} x }x$}u UM su 9+E|O8;}~}낸[^_]É1)ƅ.$1NC E1'CM 1UV wE~M ~„O9B$t ]1]ËE 9B ]UWVS 2UE OEx$9}iOP H4 9uogH$p <19} KCJpOP H4 9u91H$p <19}  &D$E$u)OP H< 9H$p <19} E}x$} x xO}:|O} :2u $vt@:u$vuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )8)UWVS 0EDŽOǂ3~aM ~Z;B$t_M L$$D$O$t [^_]ËE D$$$&1[^_]ËJ 9M uUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS }M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$F|$4$D$<$L1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8t @P81]Ã⿉P81]ffffffffffffffffffUWVS } E} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]CFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HMJ$x9MtH}9űMQ ztQuut duH8 uX8J$UWVS(8 ]EUMia$!ƅIǀǀǀE܉$!EF,D$E$o%ljF0EF4EFXFF]^EF^ F$EFE F F8FbH@ U@t5@t&U 2L$D$$bH@@Ut5@t&U 2L$D$$aH@UuLt<@t-Lt# 2D$D$$aH@[^_]Ë@@tU 2L$D$$DaH@UzUVS > c@ORt @u [^]$BL 2D$D$@$` [^]UWVS͝ Eօ}„O@U}GFGfFt$G $8*OfNfUFv>8~xfHf@fuEfx~OE@uFE@#h2u O:tx}$K t$KutE1[^_]f~E@tfx~݋E@uO{uGm뱅t}$vK u%D$O$IH}$GK QiUEPT$ PT$P T$P$11>]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]Z뭉U델[^_]UWVS *ƐO@@Mt@OJ y  2ED$D$@O@$]A@$O#A@t2ED$D$@$U]B@(O#B@~ED$D$@T$]A@,O#A@Ot $E[^_]uX~t@O 2ETt 2D$D$BL$\`@@O 2EfED$D$@L$A\`@O7[^_]@O 2EUWVS # 8uӉ΋}9u;M tQEU$E@,U" D$E D$ |$t$$][6 [^_]ËH, uUWVS脘 EOE܋3x}ǐO}JXHJHUE@8@u B8@ B@i] 2|$D$@OEċ@@D$ZE܋@@@ D$}<$]g8EEċ@@h} 1EH~k}*.t&.&.&.&;G}EfED$D$E$].0E܋CEEQA,EE1u}7v,4~9z I~r~1҉M׉E؉]9}UL$M4$]MuՋE؋}QxA,EЃE}ЉMԉE}7v,4~9z}ԋ}~r}1҉Mԉ׉]9}vL$M4$]MuՋEԉE}ЋEA,EQBu9~Eu@@%9}E)EU&At]GU9 NjEPB%9uŋUԋ}؋ENjE)Ey9UEEˋ})lj}9<}}ЉuEuEE̋}ىE9q,Ex,ڋEM؉]]Љ]!t&.&.&]9t [9Yt]M؋E9YEE9~˃EEE}9dEuSy9$E@}܋{SE@9EPSPA x)Mȍ}G}WX@#h2L$E$]K6E܋@EE@OEċEċ@@hExE܋peE$]P])E܋vE`8@@$]$ߨup uXE]9EЋEċP zt6@tP#]ЅĄ[^_]ËU؋EUE}t܋E;x|LE܋}GECGC_ES*$E@86E܋P}GD$GE$눅u1LK}GD$G$_EWPWP$ ]6BUJ[]̅wHM])؉ED$D$ EԉD$t$$]%U؋E MD$)ȉD$ EԉD$]ىL$$]]%EEċ@ ẺD$$]{o 2U؉T$D$$NJ1ҋE~EEċ@E] 2L$MD$$IU؋E-EMԉL$D$Eċ@$I$U]؉]ȉȉыXU؋zrth1҉]Mԉ9}tDL$M4$]Muًuԋ]ȋE}9}8EEu]Ћ}MԋEE}9tn}z,p,dMԋ]̋EEԋ@,EM}ЋME؋]ԋ}q,"XQ9$΋]ȉPEE]Ћ}EEAyu9E9E}EEPDu9l"tVl" ]PDt$@|$]VEPHVfFPLfV9uuEqE;`"1ɍl"}މUL$D$ 4$](U€w։}荆V)ƉL$D$$]ƉE̋E@`"d"EЉE9~}E})Eԋu})EEH,E9}}}E})uu׉}1uu؉1u9| u9}9}9}Eԅ9E؋}9xEl"E@=vm EȉEE؋Hىωָ /tftEȀEȁ =wEဃ)ȋ}؋OωփtftE؋}̉xEBD$ D$ED$$]a}9}uE}E@,E}EE9EEH,EElE.d ] 2E؉D$D$$6EU\E؉u}؃]d]؉\$D$$]DEdmMFED$D$ EԉD$t$$]:U؋EM+D$)ȉD$ EԉD$]ˉ\$$]EEċ@}R, ?Mԅ+Ex}@E؋uЋE)ƋEċHY0QpuAM.}EPE;PHED$}|$$]bh 2|$1҉T$$:CD$1ɉL$ L$U؉T$U$|$1D$Uċ@@p$BD$1D$ ED$1D$$Uċ@t$$g|$1t$$BE@D$1D$uċ@@0$]g|$1҉T$$eBD$1ɉL$ L$L$E$|$D$@@p$(BD$E؉D$ ED$D$$/ Eԋ}9E2E؋HE@1Et$qt$ $]9 9}u܋]l"T$UȋE؋@$ Ur }G,u40GD$F$] FE܋Ed"Ef}6BE1)t E7D$1ۉ\$ ED$E؉D$E$]e1 2Mԉ|$D$Eċ@$]s@Mԃ9uHxHY1ɋEl"|$D$Eċ@H$] @EE9uYfD$1D$ ED$E؉D$E$]pt$Eċ@$d 2|$D$$z?E)ED$D$ D$D$E$]Eċ@t$ $3d|$1҉T$$?D$E؉D$ ED$D$Eԉ$]H } D$1ɉL$ ED$E؉D$E$]f1 2Mԉ|$D$Eċ@H$]t>Mԃ9uo |$D$Eċ@$]3>EE9uwAplu9t#t}EPE;P7L*ED$ED$$]b 2|$1҉T$$=D$1ɉL$ L$U؉T$U$;|$1D$Uċ@@p$\=D$1D$ ED$1D$$Uċ@uԉt$$]!b|$1t$$<E@D$1ۉ\$uċ@@0$]a|$1҉T$$<D$1ɉL$ L$L$EX}D7ED$1ɉL$ D$E؉D$E$]5Eċ@t];zMEԉD$$]Ca 2|$1҉T$$<D$1ɉL$ ED$1ۉ\$EЉ$]Eċ@EԉD$$` 2T$1҉T$$;D$E؉D$ ED$1D$E$]|$D$Eċ@L$]^;uUEԉD$ $ O {E 2|$D$Eċ@$];uCE 2M̉|$D$Eċ@$]:M̃uD$1|$ ED$E؉D$E$];t$Eċ@fjILE E};x4 E 2M̉|$1D$Eċ@L$]9M̃uUWVSv uDŽO19p‰PtZF:u11ɉUM4$vFD$ FD$F D$F$MUtB[^_]F9uO Q+Vx"VQ+V xVċNxVtz1҉V1҉VQ+V y[^_]Uu O$]UWVSu u] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$ou>F9u+O Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSu Aut$$vu[^]UWVSt }GDEO98GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$ sD$D$<$#1EUs O$]ffffUEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVS0s UU} w ty1 f.&t6~RutF$u1[^_]ÉU$t8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJU @ E]UVSBr g~utv$Du[^]UWVS r 4~Mq~X1Q,zQ~>1҉EM׋q tMv$uME9xԋEM9A [^_]US] t2UӋE tȉt %1ȃ9u[]ËE[]UWVSuU 111t؉Át %1؃u1\t؉Át %1؃u֋^ t8}1 ;tȉt %1ȃu׋[u΋}9\[^_]1[^_]USp ä|E"t$D$"$x)"1[]É${1[]øUWVS4#p H|U܉"""E苃"E@OE@E@pE؅bOEE싳"tRyF%y }93}Ѕy}Ћ})щ})9uM)9IBljы"U)y<93}}Ѕ}}AxOL9+~ EЅPD$D$E$1ǃ""EE1ҋ"u}uaOE8";"|~)EЋEHAE̅q}؃E9|9;PT$D$Ẻ$1E@p"ǃ";"QuJ"ƠOlPT$D$$0"E8uuE@@l8 }";"MJ"Alu" D$ <$…y")Љ"m"t}艻"u䉳"4[^_]ËE1bOEEU苳"u}4y yFȉEaOE8O)}ЋEHAE̅";"}tM؃99R"D$ "$)"ǃ"";"y"E"9U"ǍP"t$D$$.";"~a"x"E@@xu"XD$<$y)"";""P?"t$D$E@$-"";""uԀ>"u)ʃ|OE"EԍPEișǍry )ƋE9E@M؉L$D$$D-""EE89~1$ h"_$QU";""ƐOuR,r@PE؍"E0"""}"[9"EP,"4v4~}}܅uE@}؉|$D$$ ,""y}9PD$D$E؉$+ǃ"ǃ"UN;H@uRFuLf~-$"D$"D$F $[V"fI"E@$ """tD$ Eԉ$…y")Љ"늋@lPT$D$$*""E9"ȉljM$ gf"t'D$ Eԉ$y)"$ ǃ""D$ "$y)"!"E)ȃ9E@PD$D$$)"9""ǍP"t$D$$W)";"~b"E@@xuƋ"t2D$<$y)"$ J4$9됉Ƌ""t*D$ "${y)"$ "E1UWVS e ïqE苃"|OM19|""""9"xOE@O9"9OE 2E)$ .Eu ǃ"E98.@@ltˋM t‹UT$D$$'뵉""PBh9}d"T$t$$kLƅtDE;"t4$ U 2D$D$4$'uU1"""" [^_]Ë"OEu@@h9ME4M䉋"E;0 GE""@Op >u~x OU 2t$D$$B&mtGUt @@tut$D$$&@@lu$ Kmu"ǃ"xOE"9P))Ή""$ 둋"xǃ"Ub nU"U"U "U"11]UGb pnU"U"U "U"E1]fffUWVS b &n%O2OEO]19u9uVF,E1҉MEF~`CH1U.&.&9F~59uuS9~S 9}͉9FˋU9VMIS[^_]Ë]S~Cs, 9tɅ~UMڋXCӉu.t&.&.&.&΁9u9uu9u_v` l@OBH8~NHD~GBlthtËuu拐tt 1 ` 2l@O@ xUWVS$_  lƉEY@OEBH8ˁ=ulO}@D-=}hOLJ"DŽOY\A`fAdBt%] 2D$D$ $"EBt8] 2D$D$ $!Op2!P@EBlhzǁl2ǁh2BxT2@@Tth2t h2t h2t h2 t h2 @t h2@t h2t h2E[A\sfǁrǁt5Wfǁ~ǁ;fǁǁfǁǁfǁǁfǁǁ|fǁǁt[tfǁǁ~>Rr&.&ff@f@@ 9uǁp"ǁt"~@p"p".&.&.&ff@@9u}싇"%ȋp"t"LJ "LJ"2OEOE ItiE9tE9tE싘" ZHB~&zr,EEz9uuMD$$]ZMIu1$[^_]øhOˋtiǁl2w}UM܋HQf.&% ؉9u9ut͋UMDlO놋tǁl2]tOǁl2[UWVS?Z `fEM ]fMf]f_hO;7NftvlO969+Ol2tot"уt>]f9p"t"]fp"]fr"1[^_]Ét"ufp"ufr"ft|WfffufEftoEft\fYfEN}f9r"at"yfufEffEfEfEfEfEu%UVSX dEM ]f„O;B`N4f1Dfl2t1[^]ft_/ftMfufft2#ftEfuffuffufffff끸yUWVSW cEM MMUUfƄO6;F\<@<UfrftMfv@O? tV2vtCL$҉T$ UT$D$4$*? 2T$D$$1[^_]øUW !cEfx?„O;B\}1@rU f tUf vEf1]ø]V b„OǀǀhO t%"ǂp"ǂt" "u1U勀"%1]UWVSV Db}M „Ol2t^ffǀhO t)"fp"fr"ǂt" "uI1[^_]fPfftifuft_Bfthfj`"%=1[^_]fuf/%뛻늻T "aOh2UVS T aƄOl2t^t f@d [^]@ORt 2D$D$$m0OM!A@f@d [^]@ORt 2D$D$$!0OE!P@O!P@f@d [^]UWVST %`"tǐO} 3x@tOu f„Of9pdt6l2t3ǐOfpdQ@E % ЉA@[^_]΍N} f_f|SǐOUL$2@l$5; 2L$D$$ UUULf`L$2@h΍N} ff|ǐOUL$2@$: 2L$D$$wUUULfL$2@t$S: 2L$D$$)UUǐO$8UM fxGUǐO$UM fQ ]Of@dUWVSQ ]UOpFFy ;F|# tH4$d [^_]Ét$$UWVSRQ w]Uu FFy ;F|# tH4$ [^_]Ét$$HUWVSP ]Ox|$E$VƉ<$ [^_]UWVSP \} |$E$Ɖ<${ [^_]UWVSxP \UOtX } xQH9M IX9}Bxp,9!39M t' u pP1[^_]Ë#39M uك׸[^_]UWVSEM UtY xSpu9|Ip9~BXx,9!4>9Ut'PH1[^_]Ë4&4>9Uuك׸[^_]UWVS UztzB EBE wGGtXNjEB_ ])؉ƋEBWU)Љ xыOM9NjO9}_W,9~ ! U9u뗃 [^_]fffffffffffffffUWVS@N ZE}E E EE E @$]ÅGE؋E @ uWUXts EpOE_E))9~ىL$ED$<$]؃@[^_]à u:G1@[^_]ûkEGy1Gڸ@[^_]ËG,M؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9rTU).&.&.&.&.&AFAFA F AF9sڋUB E H %BfZE @E܃vKMȉ]ĉ}}$]XM \_ XG 9uuϋMȋ]ċ}EԃUt3uމr}ߐ)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]{K<$OG<$]藆E9GTG8 <$]}E D$<$]k+ MԋUЉE E9-]ȉMĉ:BD|$B|U$] |UBHGfG9}s*w tUv$]-uUG 뜋]ȉMĉUJ  WUT$O$]UWVS J Vu}ED$E D$4$t} u [^_] [^_]UWVS eJ ÊVuO8E D$ED$<$8tu } [^_]X [^_]fffffUWVS|I &VEMu ME $]+EMqM$]aEEÉEMAEȋQUċE @U zދ]pO]t_ @ U$ ]ÅyEEę)EEĉEċuMqQ)փE9yUċAEȋE uEEpOEEkEĉEE U rUUEσ tu[ $ ]yEEę)E]É]EE E  uFE EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9wU@t)G$fE9rFUv.&.&.&GFGFG F GF9sڋEȋUUċuV}ỦUUĉUUȉUUUu΋^,EEEF@ED$ED$ED$ ED$ED$4$]v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(? KEUM؋ufUވM݋U 1ɋU EEԋ}R.Et$$UEx}P$u܀G$蒾 Ut}EMU E‹E Et~MލAf qCYЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wCYDž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS= IUE t\J;A t];tUZ {$u_Z[pۋtC R(D$ Et$D$$b1[^]ûu11U= /I""D$ ED$E D$E$1]U< H""D$ ED$D$E$1]fffffffUWVSm< HÉU:GEG<\<^ЍtR.z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PR. Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVSp4 Õ@@Ot"t~9t $Q"EED$D$E $!uI"tG@t  O "@x"[^]É댋E[^]É"@uUWVS(3 ?UEtBEE@Ou4$ UT$ D$D$4$bM踵N)‰)`EีNe)‹E)`Egҍ)nUD$4$ ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$< UuG([^_]1([^_]ËH n([^_]UWVS(J2 o>UEtBEE@OEu4$ UT$ D$D$4$}kLЍB)`E܉eЍBE)`E>)<;mD$4$- ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$ MuՋGy([^_]Ë;m@x([^_]UWVS(0 =UEtBEE@OE܋{u4$^ UT$ D$D$4$製}-?L) RЍ)ЍLZGEeE)  IȍE) GE*SRЍ)<;LaD$4$ E܋;PaAQ tUy$E܉uv.&9t(~suED$$B uދF E܃9u؋E܅tЉ)43mD$E$< jEOMEuu4$ UĉT$ D$D$u4$TuĹ-?L) @)ЍLZFUeȋE) @E)4FU։*SRЍ)43LaD$E$U }tux}cur}ulUGEEt}fOMrBEER3n$AE'u땋3m$B3Pa$pCk}t EE$UWVS( 4E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىU Uƍp@Hπwx9}몋E D뛉Ui UUWVS ( 4084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0\t,8C,{0K44y0 1[^_]Ë0 "8a$0ݓ8 "t@0@4$0譓8G,tG0ƅ`%0R. 1Dž$Dž(Dža`,4:~Jwɋ0oʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0`pV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0Xqው,4O&4PD]Em PUT$,0 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$0蹋F8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0Å8X,4H0@44,-0T 1s0< ,40 ,1!4e0 1,40 14c,0 14,,0y ,&Gwҋr1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]U $U]UWVS #}u >}0D$$B+D$t$$`‹U$4UtUuE2$ƅ_EE[^_]Ë}ut$ D$$M$E2@ x tbMut$tD$$yEQ D$$X$> Ex tUE9ED$D$ht@E$诰 tEftUft IA(QuEt E1$ot!D$D$$RB($<tD$D$$RB끍 D$$?} D$$t$tD$$tD$$UVS !EtD$ E D$ED$E$ƋEt$0[^]ffffUWVS ö ƉEωD$$) tB4$ ƀ?u1)9tXzzt"D$|<$譓 …uۉ<$߾ 9t 1[^_]Ét$ED$<$^< [^_]ÉUt$ED$<$8< Uu[^_]UWVS$ uEUt E<t] $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%]]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]ljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$mkUu$nEE܃@[^_]ËMAOMփ_EtfEtǤ$_nE܉$TnEP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$hmEp@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMx讱 11EMIuE4$LlE܃@[^_]px11Eu؉4$lѨu2u>Mwu$EUw r}fm밍ku$E0UUWVS{ àUJEtB9swt$U$hUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$ebU[EfUWVSn ÓuVzF9sHtT|$$gt8~VM f FHNMLF [^_]Ëu1[^_]É<$aUWVST  ED$,E$6 D$|$]A: xD$|4$]s HM4$]$ =M t<$ = E$] =n D$$P]dÉE@ t$$Ut E t E D$,E$*E, EEER.EȋEE u<.tk)ύ)ȍD$4$J t [^_]U £E=w  ]1]UWVS P uu4$ UT$ D$D$4$5r}-?L) RЍ)Ѝ GEeE)  IȍE) GE*S)ύɍ D$4$: t [^_]fffUWVS4a ÆufF(}ȉ|$$w t4[^_]É<$0S1".&.&.&t9̫ufV(4[^_]UWVS uL "L "OfV EO 4$&V(EfD$FD$L"$U|=UwDE |)ʉM싆t7T$UD$E$;U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$O[^_]ËUыU|UVS ÿutgF$XF$XF$XF $}XF$$rXF,$gX4$_X9L "t 1[^]ǃL " ?L "@ +L "@tÍiffffffffffffffUWVS lj$U_ D$$ ! Et$UT$U$c@9UuED$$ 1[^_]ÉUED$$ ̲$BUD$BUDS UWVSd @&QEEEEƍ̲EE> tqE9D$t$U$@Utˋ$A$AUDŽ衛 8Euu>vt1< tHv0FFU$@$@UDŽC UWVS<B g@&QU1ҍ ̲t"uW Džguԉ@!&.&O@6ƒ:uƅ/nFu$>̲$|. .Ɖ$h?D$V?t$t$ DD$D$o4$FE+<[^_]rD$@|$/$R:tW.&P:uVpƅ끋1$A>Ɖ$PAƉ$>D$ >$>D$A$=D$=s$Kv$>]v$ƅD$/4$/tY1ɉL$;T$/T$?T$ |$D$4$t$fvD$$ٗ 1҉T$;T$ |$D$4$빉oPvIUWVS p Õu}D$:4$Z t!D$`T$$$ t|$E D$4$; [^_]ËU t考 [^_]UVS uD$:4$EZ t!D$`T$$褆 tE D$4$1 [^]U ¶Ew°t ]1]Ã̲]UWVShM rEu @&QM9}xUED$ uvD$D$@U$UBUƒE9~Љ̲EΉ )t$|$ʉUM$9MUӉϋʉU$:uD$:UD荔 !̲}|$t$$>9uU+u h[^_]ËEUWVS` EM @&Q7upUMED$ {vD$D$@U$UAUD$$ EED$ML$ED$)7;EUT$$ u>詐 %!̲`ut$L$$6U+uW`[^_]k ̲U$?9ED$09UED UWVS` êEU@&Q7t$\pwbtNT$E UD$ T$vD$D$@T$$T$.@T$Mt>$̲uT$ U MT$L$$q L$\+u`[^_]øUWVS Exw|Mt_LƃtAƍ̲U$7ED$7UED [^_]Ã̲u$7Ɖ [^_]UWVSp 3}EU @&Qu]]p3MmLm8@EEߺ81tEI}E̲ )|$t$ʉUM$]>5MUЉ΋ʉU$]a6}D$R6UD !̲\$T$$]=o ]U+p[^_]ê0f%CD$D$ ]aD$D$@}<$L=mo8뎉f>~%E~LSC9u1Yf7k]*  ]US EPw*Ӱt -[]Ã̲u$8[]USd ÉEPw*Ӱt薎 -[]Ã̲uU T$$Kf []UVS  ,uD$:4$_R t!D$`T$$~ tE D$4$[ [^] - [^]UVS ôuD$:4$Q t!D$`T$$F~ tE D$D$4$2 [^]ËE D$D$4$ [^]US .EMPw*Ӱt8 - []Ã̲uL$U T$$2 []US UBwðt1[]Ã̲u$Td []UVS ^ ÃuD$:4$P t!D$`T$$} tE D$4$2 [^]W - [^]ffffffffffffffffffUWVS uE1ҋE "xtGEljу1Uvt 2uU@u [^_]UWVSĀD a}E|@&QxƋE "pM"E="E|1E]EU"Eƒx  EB A ǁE9uʋE%u " "- "EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËU "1ۍLU "@tBEtʍЉʍI$ wu1묋}M"E@1ۍE="EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }C\uE^@]̯1҃DD  u̓E9uE9":*.&@t$EDu۸@u܋}!"Ƈ "̬}8T 8 "0u},)"]l "]E "M "}~Et M  ЋU 1ҋMDŽl "DŽp " r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹Elt a1v`,tEUEEt @Eǀ "-] UWVS` 3uE EM@&QENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE9"EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEE "E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ)"]3*"]3+"]3,"3-"3."3/"]30"1EEԋ1"]32"]33"]34"35"36"37"]38"1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u)"u3*"u1E䋼1"u32"E1ljE3+"33"3,"34"3-"35"3."36"3/"37"30"E38"}m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1!"E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEEd!"?UWVSP= fEЋ}] ]@&QEƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍv]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝl!"}}̍,?tLD$ D$\$$.t&Ҁ09u$?uE]Јl!"E؃p!"l!"}E,ủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝq!"]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍvN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍ!"${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]oUWVSm E@&QEEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]UWVS, E؋U@&QE]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSD 2U uU@&Q‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$8 @D$$   @D $9sӉ t׉D$@BD$ <$L$C $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$D$$(D$$dP4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$VtD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*UWVSú Eu @&QE1D$D$U"$DžDž4$8$u vt$4$Ɖ$d DžD$$8vu[x=uUT$$l D$$z DžDžDž DžDžh|$4$-pt5tmuIT$$x'멍T$$ye뇋$.1U+Ĭ[^_]ÍT$$.x+t$v$d uDž't$v$d DžOD$$ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$Rt*D$ 6D$D$p$$,[4$` |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$]D$D$4$?D$D$|4$!D$D$p$)$&D$vD$`J.$w"hUVSk Ðuv$舺‰)Ѓ[^]øh`UWVS4% NÉED$vut$u 4$_ u3D$ ED$$EE8$E $]h`)‰UE E h`9t$u+E E܋E$]^ NjED$ut$u t$u܉t$ vD$D$bW"E$1W"t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃vD$D$b}<$U^D$O O ȉD$$EPU9uD$]W"W" W" ȉD$$dEPU@D$D$4$2E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVS3 H9ЍPH USD f`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂLX"$2?ƂNX"aDLX"ƄLX"$,T$ vT$D$$%7H4$O `D$HD$T$14U+[^_]Íxƅ?n)nOPEȉHTDUWVS >u(} @&QE14$N $?$u 1H t $t9u틽)x  @4$ $D$(|$4$ D$vD$4$ T$|$4$ }<$T $D$(L$<$ T$T$<$ $D$(L$<$v |$0, $}$lj~T$,D$4$& Dž0Dž4Dž8Dž<$D$#,D$<$ u։fǃX"$1ƃX"$ D$D$X"$ mD$xvD$ B$nt$,$m 1<$ ʉ)Ѹ%I$))Љ)‰ ;$D$(D$<$  ɋoD$,D$<$ |$,$ :X" X"D$06 < ȉD$$X"X"D$17 = ȉD$$X"X"D$28 > ȉD$$TX"X"D$39 ? ȉD$$X"X"D$4: 5 ȉD$$X"X"D$;T$$X"PX"@D$D$,$hE+[^_]D$,D$<$ ɋ$D$(D$<$l|$,$y $D$(D$<$6p D$D$<$ ;$D$(D$<$[ D$D$<$ &(D$<$$Dž0Dž4Dž8Dž<Dž Dž DžkffffffUWVSZ MMUu@&QƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$荵D$@|$<$E D$D$<$׵|$$<$@D$@t$<$詵D$t$<$菵|$4$誷E+[^_]Éu4$ʹUT$L$4$1t$4$FDž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\T6fffffffffffUWVS! FutJD$ED$4$NjE9t58u0EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$<<$ UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$5UtE(D$}<$ E0D$E,$ <$) jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVS& Ku4$u1҉[^][^]UVS u4$u[^][^]UVS賑 ؝u4$Zu[^]}[^]UWVSw Ü}u <$…uL}wPU>…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSX M $; ƉEE$ljE4$rƉEE EEEED$ML$}<$/t.1EM $M $x4$pEX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSy Þ}u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVS '}u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVS肎 ç}u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úU -E##+ፂv]Í$]Í ]Í ]Íw]Í~x]Íx]Íx]Íx]Í ]Í ]Í ]Ífx]Í$ ]ÍH ]Íp ]Í ]Í(w]Í;w]ÍQw]Ífw]Íxw]Íw]Íw]Íw]Íw]Íw]Íx]Íx]Í0x]ÍIx]ÍWx]ÍP ]Íx]Íx]Íx]Íx]UWVS 貌 טEwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu$6 tffUS (U T$D$U$# []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVSŊ u Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG XU\ UM tt M U],]UWVS4$ MMU @&QËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&DɋtxD$$ҋtFD$4$2Z tt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$I؍UWVS  ,E}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$] [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0 }wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;HutD$$]E+u <[^_]Ë9UEU Mt t]%]UWVSX DuU @&QE1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS \a Ámu} FEFED$E$?$ug$E D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=uztUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$t? [^_]øUWVSX_ ðk}EE@&QUE1D$E$ƋẺ$E]} Kf$OME Eĉ4$ U9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$YUĉT$ D$D$u҉uȉ4$X4$0 ‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$X4$ 9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$vW4$ ‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$V4$ ‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉfUMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVS{Y àeЍ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSLzK ßWuE @&QU1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFTcxUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVSH 8Tlj(UE u@&Q, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(sUWVSdE QML$U T$@&QD$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$~!D$0 "D$0 !D$06 "D$0v!D$0f X!D$0H:!D$0* !D$0 6!D$06@ !D$0I!D$0 "D$0q!D$0v, h!D$0XaJ"D$0:b,!D$0!D$0|!D$0g!D$0N"D$0!D$0x!D$0h6Z!D$0J<!D$0,!D$0!D$0!D$0,!D$0m!D$0"D$0x j!D$0ZL!D$0?EEEpsD$D$$]UBu܉F0B??E #EXEmEE@N?EP RM}]؋ut&Fǃu}M]؉uOE}E؅E؋Eԍp}E}]؃UBk}<$])0GG?} mmuԋE@H?u؃ U E܋}ȉx P}ԉ8p}uwߋuԃUtftE@t E@ x )UUԋExD})щHDrcgfiM9}U؋u..t&.&.&Fǃ9u}MU؉ucf-0Uȋ]HEuFD]FH?%:  f fBN9}U؉MuԋEs9Iu}EE)W,UUMЉ‰EE!MUЍ D89UZ uuUԉ}}H.&BEME!MMȍ MDM9Fuu}؉U11]؋uvFǃuu)ƋE@DE@` E@ l t$EԉD$]C$]k]C)uuԅRSKuU؉]ԋE@$t}xE@t @ E@7?11U؋]MU؉]ԋUvm)E]艃{DE@M?UluU؉]E E59^EЍ2|u܉FE@Q?EtuMU؉]ԋ]EC<EЍ#W뼉uMU؉]ԋu}WdGh _`umw EЍ@ WE@ E@  t$EԉD$UB$]iUB)uuԅRkE@G?} pEsEuFHUVLFK?M9}]؋u&.t&.&Fǃ9u\-m)Eu艆~D Eǀ@??}MU؉uԸЋU!ЋuFDFDU)]}}M]؋u)&.&Fǃtu}wr}M]؋u}M]؉uԋ]̉؋})uFuF E@O?ExEE11]؋u}]؉uԋ]}{DC$txSt ]C l]C9?EE}M]؉uԸЋ]!؋}GH])UEЍ{EPD@B?} EE@EЍ|]܉CE@Q?E}M]؉ut }*]C$t @0S EB))9EEЍ#WU܉BE@Q?DtBN)߉]ڋ^ۉD$T$ $]^f]CU܉B0S ) EH];XEЍ|]܉CE@Q?EEEEN90}U؉MuԋEt&s9u}ȉU؋uԋ}Q U})EMU9MMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋U}zl!EЍ|]܉CE@Q?mmuEuu}؉UԋU}]Zf]m)u]=T$UEԉD$uF$]dFU^UQfUEȋ];C>EE1ۉ]]{EED$ED$uF$]1dFEЍ{ Ӌu!މ Mt M9M]]}}؉EE`&.&.&.&puMu!MM΍ MtM9^u]}؉E E@l@E?1EXL@I?N9j}U؉MuԋE6v.&.&.&s9uv}ȉU؋uԋ}QU})Euԃw1EЍQ&]t&fDSt9uE@l}荇4GpGTGPGXD$GXD$GpD$ D$GtD$$]O|]܉CGQ?uE]MU؋uԋU=u*EP$t EE@t @ FE@6?11ɋU؋]EfED$ED$uF$]ZaFFaE@ yfvPMM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)};ut~ruԉуquUiE@l@F?XdPhUuyEE@ $E܋UȉP UPUԉ]؉XEUP<]X@EEP(u@(D$D$$]_uFfED$UT$$_FF5?11U؋]]]EEUUEE@O?]QfURmE]C(K(mEЍ{D}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$]$ UMh|U܉BGQ?)]5"E]ԋEЍ}EfED$ED$uF$]-^F%9uF1FD$D$$]fFU܉B0eF??1ET}GpGTG\L$G\D$T$ GhD$GdƉt$$] |]܉CGQ? UR\mm1ɉMĉufG (E@O?E@=?11ɋU؋]UVS](u9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0tuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS K p}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$cML$M L$$c9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$F oEԋMM@&QE܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$ ExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffUWVSF cuMx11D rt"E pt&.&fDU9ux.t&fPE$Uy`EHUZ9s˅t1]x rs8Eu(EuX ZX)X)ZuBB [^_]äfEtuu#MEtKMfmUWVS8O xE}wtuƀy(uz(É}Dw`GpE_lG8DOXWH1#GTGHWD BMO4!ًW@fJMfwxUWdG`t;s)W,9v ;w`TGhG8DZZZf9GlGtEGtp18[^_]Gh_lmEGt}GtE=E t]Zw`GpEwxGdG`_lG\Wl)…G8D$ T$D$<$]_GlG\,$EDEFf+]Kr r,JSuff;ҋEz(f EE܋_xGt)؉EGtSWxwl]؉UuԉGl9Er2_8\ OXwH1#OTOH_D Kw4!Ƌ_@fsfmuwxu]؋uGhG`D3GlU9UW\)ЅW8D$ D$T$<$]"^GlG\@GtE‰G`wt?t/_lfu11r+_pvG`뽋_hteW8GlDZZZfGhGlƒwg} tlW\)ЅW8D$ D$T$<$]\GlG\l@8[^_]ú} uW\)Ѕx\W8D$ D$T$<$]\GlG\Hu8[^_]ø1M1UWVSP E}y(EċGtEEz(E},_lG8DOXWH1#GTGHWDBw4!ދO@fqft)ыG,-95G`JHf+_pr<rMffۋEz(f E؋Eԋw`Gt)EGtOl_8]_X]_T]9r mΉwlG`]3GHT3M1‹E!‰WHM9MGlW\)ЅW8D$ D$T$<$]yZGlG\X=1P[^_]ËG8ZZfGtEGtGlGl9@}vGt=u XG`_lffۋEV|G`_l^_`GDEЋG@E̋G4EȋGHQu]MWlMuL1ȋu!GHuЍFu!֋M̉]fq]fmuw`uuMGl<1TGlƒwg} tlW\)ЅW8D$ D$T$<$]XGlG\%@P[^_]ú} uW\)ЅxNW8D$ D$T$<$]?XGlG\Hu%P[^_]øP[^_]11PP[^_]UWVS, EEP @,z}9sEEsu1} E܉u} E9EED$ D$D$E$]WTEP@]\EP@|EP@߉шLEP@шlEEtD9sK }_\_8‰ωރtft}C )CCG\)Euu|CEMEEP*K9Epl+p\E<v)щE9sMEU9} ES uEs )ssCEMgE؋})EE/@l}9sUu6^}E w9G\P}O,u9s}W*u~ })ցv}W\)Љlj9V99v} xD$ D$EEP8T$$]R}EG\1,[^_]ËE E9 E܉Eh<})9}O\,9|m)uN\)Flv8u4>tftߤEw }EH,@l}7^;s9sӅw}G8‰ىuFl؉FlO,)9u:EE؋})EE@,u~89Edž3)ƃE@,}Gl‹uF\|E QEXA99} D$ |$EP8T$$]PEx\9늾}W\)Љlj9ًuVlvM9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^tgFDVLfDPTT$D$$(-dždž @9E"EUWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS$r EuE EME}}}}U ]$A:188/fF~ ^$}uE}W~Mx}} }Epg^} T}J.EES,}W } }؉EED$D$F($V ÅǺ1tft^3C*E܉CCEC0{,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u$[^_]'}¦V$E}V F("EE $[^_]fH1CE`{-@F4$U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅU+Ǿ1ZߋuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8U&s@KDuv8{@C,Muv@tftCL{DUrD8tftMy+y{{Aqtft{usutft $ | 0 E[^_]äQfG1ffg"ui*Ql+9@:E쪾1f{ffffff$EEffffffffffff膙 UWVSWøU} žEHw)l]Íi]USD iEE $[]US BE $([]fffffffffffffffffffffffffffUVS~XHPrpHPrpfǀǀ[^]Å~UWVSljU䍱\ ]܍ PM9fUU苔\ ] fM9E~H` }ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+  øU)9fGHOWGHOW)ULuuJE0uTUU ھ])9 fOY_wWJOw)ًUML fu苜 ]u'ME;uMU]u+Ɖ кu)f9OWrwWGpw )щfEDE\uΉ.EuE]؉E$]ˉ]ERD$U_NjFD$U$tE 8" [^_]1 [^_]UWVS &g Ks}GtUD$UN_ƋGD$U$豎t+4$艦=yarauE 0%" [^_]É4$諣1 [^_]UWVS f r}GtUD$U^ƋGD$U$4t+4$ =tciduE 0! [^_]É4$.1 [^_]UWVS,f QrED$E D$E$tSEt4}D<$;^ƋED$<$衍tE01[^_]![^_]![^_]UWVSe ýqED$E D$E$tJEtZ}D<$]ƋED$<$ t54$=yarauE01[^_]w [^_]É4$` [^_]UWVSd qED$E D$E$otJEtZ}D<$\ƋED$<$bt54$:=tciduE01[^_][^_]É4$R[^_]UEU E MMM]GUEU E tcidMMM](UVSd *pE D$E$gwƉ$舣=tciduE0[^]1[^]UVSc oE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS \c ÁoE$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]USc 'oE D$E$dvUT$$c@[]USb nE D$E$+vUT$$@[]USb õnE D$E$uUT$$A[]USWb |nE D$E$uUT$$;A[]USb CnE D$E$uUT$$oA[]USa nE D$E$GuUT$$xA[]USa mE D$E$uUT$$A[]USsa ØmE D$E$tUT$$A[]US:a _mE D$E$tUT$$PB[]USa &mE D$E$ctUT$$B[]US` lE D$E$*tUT$$B[]US` ôlE D$E$sUT$$B[]USV` {lE D$E$sUT$$B[]US` BlE D$E$sUT$$B[]US_ lE D$E$FsUT$$B[]US_ kE D$E$ sUT$$B[]USr_ ×kE D$E$rUT$$B[]US9_ ^kE D$E$rUT$$B[]US_ %kE D$E$brUT$$B[]US^ jE D$E$)rUT$$B[]UWVS ^ ñjE$D$9t,ƉD$E D$E$rlj4$7 [^_]1 [^_]UWVS )^ NjE$D$09t,ƉD$E D$E$rlj4$Ԛ [^_]1 [^_]UWVS ] iE$D$8t,ƉD$E D$E$qlj4$r [^_]1 [^_]UWVS d] ÉiE$D$l8t,ƉD$E D$E$Yqlj4$ [^_]1 [^_]UWVS ] 'iEU$T$ 8t,ƉD$E D$E$plj4$讙 [^_]1 [^_]UWVS \ hE$D$7t,ƉD$E D$E$plj4$L [^_]1 [^_]UWVS >\ chE$D$E7t,ƉD$E D$E$2plj4$ [^_]1 [^_]UWVS [ hE$D$6t,ƉD$E D$E$olj4$膘 [^_]1 [^_]UWVS x[ ÝgE$D$6t,ƉD$E D$E$molj4$$ [^_]1 [^_]UWVS [ ;gEU$T$6t,ƉD$E D$E$ olj4$— [^_]1 [^_]UWVS Z fE$D$6t,ƉD$E D$E$nlj4$^ [^_]1 [^_]UWVS PZ ufE$D$5t,ƉD$E D$E$Cnlj4$ [^_]1 [^_]UWVS Y fE$D$=5t,ƉD$E D$E$mlj4$藖 [^_]1 [^_]UWVS Y îeE$D$4t,ƉD$E D$E$}mlj4$4 [^_]1 [^_]UWVS &Y KeEU$T$x4t,ƉD$E D$E$mlj4$ҕ [^_]1 [^_]UWVS X dE$D$4t,ƉD$E D$E$llj4$o [^_]1 [^_]UWVS aX ÆdE$D$3t,ƉD$E D$E$Tllj4$ [^_]1 [^_]UWVS W "dE$D$M3t,ƉD$E D$E$klj4$觔 [^_]1 [^_]UWVS W þcE$D$2t,ƉD$E D$E$klj4$D [^_]1 [^_]UWVS 6W [cEU$T$2t,ƉD$E D$E$+klj4$ [^_]1 [^_]UVSV bE D$E$7jƉ$X=gntst 1[^]É4$'tU[^]UWVS xV ÝbE$%%t,ƉD$E D$E$tjlj4$+ [^_]1 [^_]UWVS V BbE$$t,ƉD$E D$E$jlj4$В [^_]1 [^_]UVSU aE D$E$%iƉ$F=atadt 1[^]É4$kwtUEt 4$+wM[^]UWVS RU waED$E$iut,ƉD$E D$E$Gilj4$ [^_]1 [^_]UWVS T aED$E$ut,ƉD$E D$E$hlj4$蜑 [^_]1 [^_]UWVST ó`E D$E$gƉ$=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$/1UVST '`E D$E$dgƉ$腓=gntst 1[^]É4$=$tU[^]UWVS S _E$R"t,ƉD$E D$E$glj4$X [^_]1 [^_]UWVS JS o_E$ "t,ƉD$E D$E$Fglj4$ [^_]1 [^_]UWVS R _ut*t$E D$E$flj4$謏 [^_]1 [^_]UVSR ^E D$E${Ɖ$"=loobt 1[^]É4$WzU[^]UWVS FR k^E$lyt,ƉD$E D$E$蝊lj4$ [^_]1 [^_]UWVSQ ^E $yt%ƉD$E$Plj4$裎[^_]1[^_]USQ ü]E D$E$sUT$$.[]US^Q Ã]E D$E$:UT$$I/[]US%Q J]E D$E$UT$$/[]USP ]E D$E$ȈUT$$/[]USP \E D$E$菈UT$$0[]USzP ß\E D$E$VUT$$ 0[]USAP f\E D$E$UT$$A0[]USP -\E D$E$UT$$0[]USO [E D$E$談UT$$0[]USO û[E D$E$rUT$$1[]US]O Â[E D$E$9UT$$"1[]US$O I[E D$E$UT$$.1[]USN [E D$E$džUT$$;1[]USN ZE D$E$莆UT$$;1[]USyN ÞZE D$E$UUT$$;1[]US@N eZE D$E$UT$$T1[]USN ,ZE D$E$UT$$T1[]USM YE D$E$誅UT$$`1[]USM úYE D$E$qUT$$m1[]US\M ÁYE D$E$8UT$$m1[]UWVS !M FYE$D$((t,ƉD$E D$E$qlj4$̉ [^_]1 [^_]UWVSL XE $D$'t%ƉD$E$lj4$p[^_]1[^_]UWVS bL ÇXE$D$i't,ƉD$E D$E$貄lj4$ [^_]1 [^_]UWVSK $XE $D$'t%ƉD$E$^lj4$豈[^_]1[^_]UWVS K WE$D$&t,ƉD$E D$E$lj4$O [^_]1 [^_]UWVSAK fWE $D$I&t%ƉD$E$衄lj4$[^_]1[^_]UWVS J WE$D$%t,ƉD$E D$E$7lj4$蒇 [^_]1 [^_]UWVSJ éVE $D$%t%ƉD$E$lj4$7[^_]1[^_]UWVS )J NVEU$T$1%t,ƉD$E D$E$zlj4$Ն [^_]1 [^_]UWVSI UE U$T$$t%ƉD$E$'lj4$z[^_]1[^_]UWVS lI ÑUE$D$t$t,ƉD$E D$E$轁lj4$ [^_]1 [^_]UWVS I /UE $D$$t%ƉD$E$jlj4$轅[^_]1[^_]UWVS H TE$D$#t,ƉD$E D$E$lj4$Z [^_]1 [^_]UWVSLH qTE $D$S#t%ƉD$E$諁lj4$[^_]1[^_]UWVS G TE$D$"t,ƉD$E D$E$@lj4$蛄 [^_]1 [^_]UWVSG òSE $D$"t%ƉD$E$lj4$?[^_]1[^_]UWVS 1G VSE$D$9"t,ƉD$E D$E$lj4$݃ [^_]1 [^_]UWVSF RE $D$!t%ƉD$E$/lj4$肃[^_]1[^_]UWVS tF ÙREU$T$|!t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSF 7RE U$T$!t%ƉD$E$rlj4$ł[^_]1[^_]UWVS E QE$D$!t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSSE xQE $D$ t%ƉD$E$~lj4$[^_]1[^_]UWVS D QE$D$F t,ƉD$E D$E$E}lj4$蠁 [^_]1 [^_]UWVSD ÷PE $D$t%ƉD$E$}lj4$C[^_]1[^_]UWVS 5D ZPE$D$t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVSC OE $D$#t%ƉD$E$1}lj4$脀[^_]1[^_]UWVS vC ÛOE$D$t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSC 8OE $D$dt%ƉD$E$r|lj4$[^_]1[^_]UWVS B NEU$T$ t,ƉD$E D$E${lj4$c [^_]1 [^_]UWVSUB zNE U$T$t%ƉD$E${lj4$[^_]1[^_]UWVS A NE$D$Kt,ƉD$E D$E$Jzlj4$~ [^_]1 [^_]UWVSA üME $D$t%ƉD$E$zlj4$I~[^_]1[^_]UWVS ;A `ME$D$t,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS@ LE $D$'t%ƉD$E$5zlj4$}[^_]1[^_]UWVS z@ ßLE$D$t,ƉD$E D$E$xlj4$$} [^_]1 [^_]UWVS@ ;LE $D$ft%ƉD$E$tylj4$|[^_]1[^_]UWVS ? KE$D$ t,ƉD$E D$E$ xlj4$d| [^_]1 [^_]UWVSV? {KE $D$t%ƉD$E$xlj4$|[^_]1[^_]UWVS > KEU$T$Lt,ƉD$E D$E$Kwlj4${ [^_]1 [^_]UWVS> ýJE U$T$t%ƉD$E$wlj4$K{[^_]1[^_]UVS>> cJE D$E$vƉ$}=gntst 1[^]É4$ytU[^]UWVS = JE$ t,ƉD$E D$E$9vlj4$z [^_]1 [^_]UWVS= ëIE $3 t%ƉD$E$vlj4$@z[^_]1[^_]UWVS 2= WIE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS< HE $ t%ƉD$E$>vlj4$y[^_]1[^_]UVS< éHE D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS < 8HED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS ; GED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVSO; tGED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS: GED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS: þFE D$E$urƉ$z=gntst 1[^_]É4$ P$U DžtڋUT$D$4$ t U:[^_]É<$:1UVS : 2FE D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS 9 EE$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVSU9 zEE $t%ƉD$E$rlj4$v[^_]1[^_]UWVS 9 &EE$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVS8 DE $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVSR8 wDu t#t$E$qlj4$u[^_]1[^_]UWVS 8 -Dut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVS7 CE 0Ft%uFt$設4$蠭1[^_]ÍdY"<$膞Ft<$w1[^_]Ét$Y"$<$SFUS(7 MCD$dY"$D$Y"$1[]US6 CEU 9t8J 9H u(Rt<@t-T$$_[]1[]ø[]ÍiˍiUSq6 ÖBE @tUT$$[]Í D$ XD$D$t $-US6 ;BE @tURt3 c?u$ ޠ… D$$UoUBB BU4$EE$苠Ut]NjMs"EtfEtBEB Ѓ[^_]׍}D$ D$D$/ $u$Lo1UVSQ2 v>ut4$[^]%}D$ D$D$} $ UWVS1 >Etw} |$ ED$D$$芚ƅxEH $Mj…t1|$ ED$ML$$USU1{[^_]1[^_]Í}D$ tD$D$U $MU31 \=UT$6$]UVS 1 1=ut4$[^]}D$ D$D$} $UWVS 0 <utb 9uXFt@~ G$=…t>FtAD$$U赂U [^_]K4$l [^_]1 [^_]ÍiUWVS 0 A<utJ 9u@~ G$贝…t,Ft/D$$U,U [^_]1 [^_]ÍiU/ ;Et 9t1]Ë@ ]U/ ;Et 9uP@tt ]1҉]Íi]US?/ d;Et 9t1[]ËU tH Q9Ur@tD$E $I[]ÍiU. ;Et 9t1]@]UWVS. :}t; 9u1G $AƅtGt"D$4$輀[^_]1[^_]ÍiUI. j:Et 9u @t ]1]vÍi]UWVS. -:ut 9t 1[^_]ËU tM 9uFtA F EP$UyDžtŋE HɋUtOFt@L$D$ D$T$<$苖F~}~ t$舣si븍iUWVSD- i9ut 9t 1[^_]ËE FtE $F EH $M谚…tFMtI} |$D$ D$L$$UƕFUV}~ t$oi믍}D$ D$D$; $sUS\, Á8Et 9t1[]ËM tM 9uL$$mUS, :8Et 9t1[]Ë@tU T$$[]ÍiUS+ 7Et 9t1[]Ë@tU T$$=[]ÍiUSm+ Ò7EU tG 9u=t99 u5Rt@tT$$[]Íi@uፃiٸfUS+ (7Et. 9u$@tU T$$[]ÍifUWVS * 6u~(Ft  [^_]D$ED$ D$D$4$tȋUBU$ DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ 褗ƅt' D$4$PfFF FE 0 [^_]É<$輟D$-dD$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]US) =5gD$,$6Y"$[]US( 4Y"$[]UWVS4( 4M EpAQAtp}D$ T$L$D$ uԉ4$gD$|$E$Bqt2t$E$"nt|$E$7r4[^_]Í\14[^_]ÉD$ T$D$D$ uԉ4$y0D$ D$D$|$UVS' 3E 0t$Y"$ 4$虝1[^]USh' Í3D$Y"$,LD$Y"$1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS& 2ƍgD$,$ƐY"<$薍t$Y"E$et $Eb<$jUЃ[^_]ÉE<$R$ Ut֍lD$ $MbMAFAFA<$ t$E$Mt+$Egb<$M $ڛUЃ[^_]ÉL$ME$M9uE<$觌UЃ[^_]Í}D$ D$D$M|$aUVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS7$ \0utl9u4$`[^]1[^]UE@]UWVS# 0Et l9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YU(# I/Et l9t11]ËP@]U" /Et l9t11]ËP@]U" .Et l9t11]ËP@]U" .Et l9t11]ËP@]UVSo" .Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS! .Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS]! ~-Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE US -Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U ¥,Et l9t1]ËHP@txE P]USA b,Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UVS +Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVSF g+Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS *Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UR s*Et l9t1]ËHP@txE P]U 1*Et l9t1]ËPH9иrE ]U )Et l9t1]ËPH9иrE f]U ¦)Et l9t1]ËP@uE ]UL m)Et l9t1]ËP@uE ]U 4)Et l9t1]@uP@xM A]ËP@M QU (Et l9t1]ËP@uE ]U ©(Et l9t1]ËPH9иrE ]UC d(Et l9t1]ËPH9иrE f]U (Et l9t1]ËP@uE ]U 'Et l9t1]@uP@xM A]ËP@M QUSj Ï'Et l9t1[]ËM tM 9uL$$\US& K'EU Mt l9t1[]@t Xxx3P3H []US 'EU Mt l9t1[]@t Xxx3P3H []UVS ¶&Eu ]t l9t1[^]ËPH@uxx11 [^]UVSE f&Eu ]t l9t1[^]ËPH@uxx11 [^]UWVS$ &uEEEEVt $[^_]À~(u~-+0u xZE܉D$}|$F$jEUщ¸9иeEF>t"D$mD$4$VJE@U $[^_]E 'E܉D$ED$F$SjEUE܉U}9EX8"J&8"0fE܉D$|$F$EU!Ѓt4MEFcfD$ED$J8"ut&4fffffffffffffUWVSP #<$WfwtH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$>_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS<G l!4$cB BBB$BBB(B8OwuBfn'"H[v*B|DžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{BJHJx"t_Yxaucxlu]xsuWxeuQHBzB(J1xru+xuu%xeuH̃BB(YP)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{i<$O1USEt&.&.& w u[]US  E ;Et1 []ÉD$ED$E$: []UWVS ]u}E E $0VEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]8?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]}D$ `D$D$$)щN$x>qUWVS, EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$prvvxEpD$~t$$t}(u GtLt51E$~[^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVS í$Hhp$utD$D$E$gǃxD$<$LaEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$^Ƌt0<$gd3D$L$d4$llp ȋdE D$4$aNjtPD$T$l4$?llT$4$-t${Ĭ[^_]1)<$gt${1Ĭ[^_]D$D$D$D$ D$hD$l$]lthȋtGL$4$,t$*{1nUD$E$U]fffffUE 9E]UWVS ƅtBD$$\vEt E$@DrDžMu% $z1\$@#rDžtED$<$@D$G$lEG,w0G4G8G<[^_]US %Y"$k[]US 3D$L$mY"$j[]US D$Y"$`jD$Y"$D1[]UST yED$E $[]US' LED$E $躯[]US E$kE $k[]UWVS( UM܋p4@,EEGEt@E<E tDMUD$E$UMtLօuE܅tE܉1([^_]Í~D$ D$D$ $ϋE܅t([^_]1UVS Pt@9 u6p 9r@~D$ D$D$ $˱UWVS uFt09u&x<$weƉ<$fe[^_]ÍPD$ LD$D$ $SUWVS: _Ƅt1XƅtptC[^_]ÉUx<$d1ɋU'ƅtpt<$d[^_]ÍPD$ D$D$ $踰US E xt"D$ D$E$r[]ÍN~D$ D$D$  $QUS: _UB4tB4R,…t8$7[]Íf~D$ LD$D$ $-~D$ LD$D$ $ïUWVS4 UM@8t 14[^_]ÉƉ׍PU$dcMDžt6pE$6EG4$67E$&c4[^_]Í3D$L$VdY"<$&aED$Y"E؉$E܅$w6<$`V09V4E$X6N4~,UEE؋UЉMԃD$E$1MԋUvA)D$E؉D$D$REF,}܉8}xF4F<<$<`E$ȣE܃,n}<}ܜ$fEMD$ $F5UT$MA$KEM܉H<$_UT$U؉$E܅$5<$_E@,vu1<$O^0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$ D$4$~D$4$=4$<U܋T$4$P tEO49H1hEq<$\D$4$ ?Ɖ0[^_]Ë}4$Z<E$5mD$4$9n}э0D$ tD$D$ $螨}E$5n 4$;EԉD$4$|=~D$ tD$D$ $<UVS$ IE 0t$Y"$aF,v ut 9t 1[^_]Í~<$Vv4<$V[^_]UWVS ut 9t 1[^_]Í~<$VE 9F0r<$oV[^_]ɉUWVS` Åu~<$6VƉ<$%V[^_]UWVS# Huth9u^F4$I"EFE$UF4tM1;~4sAF,D$E$U&uߋE$UE$)EE[^_]ËE${UE[^_]UWVSx ÝutB9Uu5~<$=UU9u/U Ɖ<$U[^_]1[^_]1US 5EU t$9ut9 u 1[]1[]UVS Eu Mt 9t 1[^]ËP49P0r [^]D$ D$D$  $pUVSX }EU ut 9t 1[^]Åt9 uH49H0r [^]TD$ D$D$  $UWVS, ut 9t,[^_]Í~<$SF8t<$S,[^_]ÍMU tߋUUN4Mt{M9MV,UMM9M܋PU؋UM)L$MUTT$$Bn4F<M܉ $&U؉$&Tf~D$ D$D$u $ٞ~D$ D$D$v $诞~D$ D$D$w $腞USu –EM t 9t[]Åt9uM E[]TUS* OEt 9t1[]ËM tM 9uL$$*U Et9u]1]U Et9u]1]US øEt 9t1[]ËM tM 9uL$$ *USL qD$E$4[]UWVS  D}U uFt  [^_]ÉU1$t~(Ut [^_]ÉUE$UMUt E [^_] $$US ôD$E$[]US b ÇD$E D$E$65 []US0 UD$E$|[]UWVS  &ExU(E P $D$L|$E$/E p@ E4,E}pM9D$E$_+E}D$E$=+ED$E$+trmEV0MM<NʈUV?UMD$E$*.1 [^_]ÍLD$E$0 [^_]Í0D$ D$D$s$z}EE}FUu0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃PD$ D$D$$蠑xD$ D$D$$vUg ˆEt,9u@]1]US7 \Et ,9t1[]ËM tM 9uL$$US Et ,9t1 []ËM9H uU tL$M L$@$ []UWVS øu>t=~(u7Ft=D$ ;T$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MHEtFVT$U$MUs9}D$D$4$ $`Hƅ,D$4$FEF~ E 0%躕D$ED$F $($ljEt\UF$F 9:" ~D$ D$D$$E$ P [^_]/8"uE$O$yGƅtEE$O1!1U ²Et l9t1]ËM tM 9u9]UVSM rlt$Y"$ƃY"t$Y"$ƃY"1[^]US E xtD$E$#[]ÍUVS uD$l$BtY"4$[^]ÍY"UVSh Íutl9u4$[^]1[^]U3 TEt l9t1]@]U +Et l9t1]@]US Et l9t1[]ËM tM 9uL$$fUVS öuFt [^]À~(tD$ D$FD$F$Vu_D$ D$FD$F$.tWD$l$CAY"4$E 0[^]ÍD$l$ AY"ǍD$ pD$D$$詋fffffffUWVS æƅtBD$$HEt E$@DDžMu% $SL1d$@CDžtED$E<$ED$G$>EG,w0G4G8G<[^_]US E$>E $>[]UVS éPt@9 u6p 9rt 9t%$c$Y [^_]ÉUMGE$24UNjE$4Ut$ M9t;E [^_]HD$ D$D$t$A$衸MA8,uA1)UE]UWVS }9GE$[3G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$2UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS ut 9t 1[^_]Í~<$|2v0<$q2[^_]UWVSo Ôut 9t 1[^_]Í~<$+2v4<$ 2[^_]UWVS Cut 9t 1[^_]Í~<$1E 9F0r<$1[^_]ɉUWVS u~<$1Ɖ<${1[^_]UWVSy Þu~<$O1F8uF8<$:1[^_]UWVS: _u~<$1v8փ<$1[^_]UWVS #ut<9u2~<$0F49E s+F,U 4t"<$0[^_]1[^_]1ލpD$ $D$D$at$|UWVSm Òut 9t 1[^_]Í~<$)0F8u`F4;E t\9E seE V,tUEE$N,UEF<U$<$/[^_]1UA܍\D$ D$D$t${oD$ D$D$t$~{UWVSe Êut 9t 1[^_]Í~<$!/U Ɖ<$ /[^_]UWVS 0ut 9t[^_]ÍFE$.~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$&.E$[^_]ËE$.%\D$ D$D$t$ypD$ D$D$t$yUS Et 9t1[]ËM tM 9uL$$FUSr ×D$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]US *D$E$A[]US D$E D$E$ []US D$E$[]fffUEU @]US^ ÃE$;t[]ÍD$ D$D$pP$!xUWVS0 *$}`HtыpG$萍`tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$ Ku}DžPtҋ@w4$躌)T$$PtЉ4$~taNjPu냍D$ D$D$P$avD$ D$D$P$7vD$ xD$D$P$ vD$ xD$D$P$uD$ xD$D$P$utыt$PD$ xD$D$P$fuUEt]1]UWVSD6 [$UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]Í|D$ XD$D$#P$[sEEU D$E D$E$]UE]UE@]UVS ]C$$3[^]fffffffffffffffUWVS螽 ƀ8$hD9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$DgP /.pl@istX@XXXXf@ X $軫ƃtb|$D$4$(9|w84$$S1]w8[^_]Iw?1[^_]PƄ$fى4$^$lj$ׁ|$4$+D$$ v84$UWVS /uM ^t^F9tX^ [^_]ÉMD$$-…FFM빍D$ D$D$9$xoD$ D$D$:$LoD$ D$D$;$ o1<&M䍙D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$Vuύ0T$ @T$D$#$Gkt][^_]UVSյ ]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍0T$ $T$D$D$jE >][^]UWVS ]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]Í0T$ T$D$c$hD$/$9E >][^_]UWVS 蝳 ¿UyEx i} _$#!ƅI$ !+FFF E Ft.ED$4$ׄuG$))14$) [^_]Íl< t~D$4$uD$ 4$tFu.D$4$tD$ 4$wpD$4$_DŽ^OD$D$4$G)D$ 4$Ex 4$/(1 UWVS #ED$E$;t>Ɖ$\E mU4$'mU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVS$ IutFwyM MJ]ZMJ [^]${t|] X]XMH ]X뼍D$ D$D$A$seD$ D$D$B$Ie1fUWVS) NUu }t`t`tAtA}tA uutA} $%[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍PD$ D$D$Z$7dUWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ Ɖt1t[^]øf$̀ffff'̀ffffỳrS[D? [̀rS[$? [̀rS[? [&̀rS[? [%̀rS[Ĭ? [ḅ̀rS[ä? [̀rS[Ä? [ḡ̀rS[d? [̀rS[D? [̀rS[$? [:̀rS[? [̀rS[? [̀rS[ī? [̀rS[ä? [Ḯ̀rS[Ä? [%̀rS[d? [̀rS[D? [_̀rS[$? [\̀rS[? [;̀rS[? [b̀rS[Ī? [̀rS[ä? [̀rS[Ä? [ḛ̀rS[d? [c̀rS[D? [2̀rS[$? [̀rS[? [̀rS[? [9̀rS[ĩ? [Ḇ̀rS[ä? [ḵ̀rS[Ä? [8̀rS[d? [Ḁ̀rS[D? [̀rS[$? [Ḅ̀rS[? [̀rS[? [ ̀rS[Ĩ? [̀rS[ä? [̀rS[Ä? [0̀rS[d? [Q̀rS[D? [̀rS[$? [)̀rS[? [{̀rS[? [|̀rS[ħ? [#̀rS[ä? [)̀rS[Ä? [=̀rS[d? [̀rS[D? [̀rS[$? ["̀rS[? [USÚ E UD$T$ D$E$=f[]US芚 ïEUD$T$D$ ED$E D$E$f[]USC hEUD$T$D$ ED$E D$E$e[]ffffYXZQ̀QQrS[? [USҙ ED$ ED$E D$E$-U[]US 蚙 ÿED$E D$E$\i []fffUSf Ë9Et[]ø []US= b9Et[]1[]US 9Ou1[]$R1[]USژ Ou1[]$sR1[]US蠘 ŤOu1[]$9R1[]USf ËOu1[]$Q1[]US, QOu1[]$Q1[]US Ou1[]$Q1[]US踗 ݣOu1[]$QQ1[]US~ ãOu1[]$Q1[]USD iOu1[]$P1[]US /Ou1[]$P1[]USӖ  ]"?oIZ".t& @tM:u DŽZ"с?x" ]"] Z"\U1[]ÃӅ~%Z"1f.& 9~:u돸#[]U" CE@M Z"1]U !E@ Z"]U E@DŽZ"1]US]Cu U C1[]US 蛕 Ou#ED$E D$E$u []$OP []øUS< aba[]US" GOu -[]$N-[]US $UUSĔ Ou1[]$]N1[]UE 9E]1UVSu Úut$E EED$D$vt4$.[^]ÍD$ D$D$;$IUVS /ut/ED$D$wt@4$.x@Eu[^]ÍD$ D$D$;$zI른fffffUWVS聓 æ}u tKt$ttfN[^_]ÉuED$D$t<$-[^_]ÍD$ D$D$:,$HUVS utD$D$^t 4$g-[^]ÍD$ D$D$8P$lHUWVS腒 êu} t~(~$1[^_]Í]D$ D$D$7t$H~(~$1[^_]UVS CutE F(1[^]Í]D$ D$D$7$GE F(1[^]UVS輑 utE F$1[^]Í]D$ D$D$7$MGE F$1[^]UVSZ ut$&ff gFF[^]Í]D$ ,D$D$;$FUVS ut F([^]Í]D$ 8D$D$7$FF([^]UVS蘐 ýut F$[^]Í]D$ HD$D$7<$.FF$[^]fffffffSL$D$ t9tEAf.&€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US 膏 ë]"D$E D$E$腑 []fffffffUWVSA fu} %=PwM=@/=O= ctGrGƀtGwE===lu-Gƀu-G@GAEGx --PP@x-uX-tXrx BZf [^_]øpwwurT뺹ryw2r@s?@Gs@-!GS@SG--Drt7=`ubCs9d/?%uQtSa PD$ XD$D$9d$VBMGA-fffffffUWVS A fE(D$E$dE=iAD$ED$E$1fǃ|4QuE$dOEtMEMED$UT$4$x7Mu E<=tX4E8E4uϋM9|>) ‰L$D$$ i1 [^_]ÉM4$dM랹čD$ `D$D$>$@넍FUWVS謊 іEhdl ~ptDžxAEEEEEE|(D$ut$$kD]E$D$t$$EDDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$XD$4$|$4$D$04$f|4QD$hD$t$ D$D$0$T,f4$,4D8D$t$0$tD$(D$$BD$$D$$BD$|$$4[^_]D$$X[^_]Dž4c;C,Dž4GD$(D$$ByD$(D$$AD$$D$$AUWVS@k ƀt$(D$T$L$,D$,t "|$GD$8UT$$\$(3/uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(U@"D$8D$D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(WD$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(;"D$8D$D$8HL$L@L$8t$@|$D<*tXD$=E$EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $u֋U$ZU9t5EuEEEuU܅/EEUUыr/Eԅ0C.t*E8:t"UED$ED$$=MAO0E<-<+<::[B9FB 9F  E;u~#9EiC.0tE8:tD$W,$肼OWE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$Et 1pu-/ED$ Lt$D$`<$UEu[^_]Ír ]":u>ut2E8:t*d|$ D$D$`J.$C?[^_]ÀxFi_>uTx:tL9MiE8:t|$ D$T1]"i[^_]ÍD$ PD$D$R$EuD$ PD$D$S$E 4l:bUVSc 7outD$ D$4$(?[^]ÍD$ XD$D$/$UVSb nutD$4$襚e[^]Í6D$ `D$D$/0$3fffffUSCb hnE$N1[]UWVSb AnEtVu;U E} Uz BD$E@t$9s0E@ 1҃[^_]ËE@D$Mxe);u EE UD$9sNj]C 넋E EuGE@D$Ex gE Uy{bE E%MD$ hD$D$P$DD$ hD$D$P$TUWVS` ülUB Eu1ƃu}9}EE}B269r|])9ErGË}u sJu(u J J ZR9r [^_]ÉfftEË}u rucuk띉UGD$4$ƅt[UB)ǍD|$D$$)U0MJB E2Xf넃@UWVSG_ lku} D$$$…0x@@ D$D$D$ 6D$D$$UDžt1D$$[^_]1[^_]8U$x$n818US ,^ QjE D$ED$`J.X$D []US] jED$ E D$ED$`J.X$3D[]UWVS] iu} t(ED$ 1D$|$4$R[^_]Í1D$ D$D$4|$*UVSD] iiut'D$ D$D$4$Q[^]Í1D$ xD$D$A|$UWVS\ hu} t)D$ 1D$|$4$'Q[^_]Í1D$ D$D$6$JUVSd\ Éhut>D$D$ D$D$4$ Lt [^]1[^]ÍVD$ D$D$0$US[ hED$ D$ E D$E$:[]UWVS[ guttE D$4$~7F0u D$4$[^_]tcF0uҿJF0뻍1D$ D$D$/$]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSNZ sfE0x$Ttu[^_]1[^_]UWVSZ 6fu tLEt>Bt+fx f@UPp$MH,UP(UPDUP [^_]ÿUu1UWVS Y ôe}u$4‹EE Bzr EBtntpE tZE EUAUtnMfH f@PM H$x,p(@DP [^_]ÍE뭋M tE E딉U U$1UWVSX ùdUE trB0~4r,txM q J$tE D$ E 0xt$|$$I[^_]ÉUcD$ D$D$<$ UY1D$ D$D$;$ U US W ücED$E D$E$> []USfW ËcED$ ED$E D$E$覹[]UVS-W Rcuf~ D$4$F0tN@9t $F0F0ǀǀ FFF t1FD$4$1[^]ËFߍ1D$ D$D$<,$A I UWVSEV jbEU tgP0~4p,tu ~r H$t} Lj ${M׉‹M y!1[^_]ÉEcT$ T$D$9P$p Ed1T$ T$D$8P$> E+UWVSQU vautFD$4$Nnx$P8D$4$W[^_]É4$Sڍ1D$ D$D$7t$ US T `ED$E D$E$H []UST ú`ED$ ED$E D$E$4F[]UWVS,[T À`Et8uj}ԉ;$F@FF )t$|$$踲,[^_]ÉEԉ$E؍EEu}wo끋uUS µ_Ex9]Ë]Ío]fUWVSTQS v_UE }}@&Q}7uցE0 tS9utOD$2@D$u4$4$|PEt8UED$t$E$Uu-p4$DPEuȋ}E+TЃT[^_]Ét$ D$D$2u4$W4$P볅U@E 7t"ED$G$ut$ 닺WR}UD$ D$D$$UET$ T$D$$LuE7M,ET$ T$D$$EfUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSP C\ut;F)F3E uF F[^]1[^]ÍD$ D$D$Y$UWVSO [u} Uts~F<FF DWPWPW P F F 1[^_]ÍD$ D$D$v$U`UD$ D$D$w$U+UVSN ýZut~u@~w:E [^]ÍD$ D$D$$뺸UVS1N VZut~uAF u9<.w5[^]ÍD$ D$D$$빸UWVSM Y}u t5u%G u<.w~9|D7[^_]1[^_]ÍD$ D$D$$0UWVSIM nYu} t*~uPF uH<.wDx>9؃[^_]ÍD$ D$D$$몸UEu E D]1]UWVSL X}utQEu@D69E r4E D$D$<$ 6GfGG[^_]1[^_]ÍD$ pD$D$.$UWVSL >Xu} t;~uaVL\WQWQW Q F1[^_]ÍD$ `D$D$M${뙸UWVS4K WƉEԋE} @&QuЋU1҅x%PލT$D$<$]Gt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍT$ LT$D$h$HE܅ E܋]ԍ*T$ LT$D$i$ Em] xUVSJ 4Vut~uEFu=:Fr6[^]ÍD$ 8D$D$$뵸UWVSI Uu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ $D$D$$fffffffUWVSI 6UƉׅtat1>t F9rF9s1[^_]ú䍃OD$ 0D$D$${뾍6D$ 0D$D$$OpUWVSeH ÊTt4ljփt3Rw0FGT$D$<$[^_][^_]ÉUBD$ dD$D$$UUSG SE x[]ÉE_T$ T$D$T$fE[]UWVSxG ÝSu} Et,tYPσF)F 71[^_]ÍT$ T$D$b$EuEsT$ T$D$c$ErUWVSF REu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃D$ xD$D$$5MÍD$ xD$D$$M}]썃D$ xD$D$$ {P7f/UWVSD PEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍD$ PD$D$$vME]荓T$ PT$D$$>EjUWVSQC vOu} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃D$ <D$D$$`LD$ <D$D$$.VUWVS9B ^NU} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]ÍD$ D$D$W$UUD$ D$D$X$UUUE ttuB]ø]UWVS$@ LEEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]KUMi1ɉM]썃D$ D$D$$RMXMUEE썘\$ \$D$$MUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUS]< ÂHD$D$ED$ ED$E D$E$[]fUWVSP< 3HƉЉ@&QU1҅[ƅD$D$D$D$ T$D$4$Ft1U+<P[^_]Í1ɉ D rFDžDžD$ T$WD$<$xutjƅD$D$D$D$ t$GD$G$%Fut$$stu<$w$wT$ T$D$$3jthuGtLD$ D$<D$$聶$0u1U+uXT[^_]Ë묋$uʍD$ D$D$$eUWVS7 CϋEE uE@&QE1,VD$D$ D$D$<$hB4D$ D$D$$7t6D$ D$D$$z $D$$D$${$街D$I$cG$m$_L~f$$*t$D$D$$ U+Ą[^_]ÍȄ @$0/uXp<+%<-q<@nL'PHD$ D$PD$r$q؉DžL<+<-w҉ht$`$hyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$tpDžL<+F<@[hU\l K4$茣 u9F<@t$`$bqU\l<+<-t$`$>qU\؉<+N<- t$`$_Z<+<-DžLDžP.hHD$ `D$D$4$nhQ7F<@uhHD$ `D$D$4$%n؋h]PFF'<@hHD$ `D$D$4$mhU\1PU\PF]<@UHD$ `D$D$4$5m)F<@ DžLDžP1D$ D$D$$D$ D$D$$^XD$ D$D$$&a5GUWVS4 Y%M(E<}@&Q8ƋE1f<!ǃ,]"U@D$D$ D$DD$<$n@D$@ D$4$D$ D$4$GP4G 0@@ $@@P T$$w@@$CD$4$M,t$D$4$?,|%=>,]"$S4$u0$8E+[^_]þ뿍CD$$葅…tE|[^_]1䍃.D$ D$D$N$c r0UWVStt ÙEUU@&QM1ɅtBE}<$kM L$ED$<$kED$<$RU+u:t[^_]ÉEXxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVS5J]} @&QEEGWEU?@)ƒw)ƒT$D$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼnUE]UU ft1]ÁE ]fffL$$Yai qyD$A(tQS[Rjj [1Ít&.&T$D$ Zbj rz $z(t RPS[ØjRj [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj [1Í&T$D$ Zbj rz $RPS[þjRj [Xt@US pÕED$E D$E$蘟 []US?dD$ D$ED$$'[]US)D$ E D$ED$$-[]USʾD$ E D$ED$$[]ffffffUWVS,聾æuEEED$D$}|$ t$D$EE$8EE ED$D$|$ D$D$E$8EEED$D$|$ D$D$E$?86EEED$D$|$ T$UD$E$7UEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$[7؃,[^_]w8 u>ƆUND$ D$D$<$)rfffUWVS.S} @&QE1}D$D$HtHE$Vt=ED$D$<$;Es1U+[^_]ø"㍅D$E$Ntt@D$E$Nu[ED$`D$<$t;EsED$|$ H%D$`d$T$GUnvID$ D$D$BD$pUWVS ۺD$c"\$E$qƉ؅u [^_]Éu01UWVSp腺êUg"ut$$g"@B1NjEEE1UЋUME1EHt$$>xxg"@B1Ƌ}E1NjExME1EH D$E$u(g"]ٸ@B1E1؃p[^_]øp[^_]$' g"9D$ D$D$H$ offfffffffffffffUWVS&D$pD$E$ЇuEPD.".&.&.&@t&tD$E$@u܉[^_]D$ƇD$E$Vt 1[^_]ËEpD$QD$4$&E@<-u?EPR.DPtEPD$ ED$$UMU9p9g^My+th)ƍF߃1BD$u+D$4$xE@t<+ !M?!fffffU;\E?wPD.t u]Ë u@u1]UEP>w PD.]1]UWVS(Ķu}܉|$D$4$pxINE uG>wl1QEظE! EED$|$4$p([^_]Ã>w21QEظE ErqeqUWVS!uoD$ tot}D$D$,h"<$y) h"S.t@ h"[^_]ÍU T$ t$)‰T$$B뵍6D$D$,h"<$^fffUWVSAfƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUʇT$ |T$D$td$iEF!FUWVS۳u] "<-EEEE}|$EԉD$$$~$E~D$|$$TEImD$D$Ẻ$w%mMẺE0EUR.DPщMEE1E$TU$U~9E~T$$lƋUfffffffffUWVST蝞ƪEu}]E E bEEE;E܅~ 0MU tEEGz;EGEEUEUEUEUEEEE EE؋E$]:H 8MЍD9E  0^EUM]L$\$ $T$]9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]&D$E D$E$09} T[^_]ÍEEEE2EEiE7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]Mȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;EiEbEdEE Eg]U]EdEEUM]$DUЍD9E ỦUM܍$KMM[D$ $D$D$>$KMMgD$ $D$D$>$oKMq~}~f}uf]/f?kUWVSGlu} ttFD$$=[^_]ÍD$ lD$D$D>$JuvD$ lD$D$E>$JUWVS,賔ؠ]lj։MhVЍEF t =F]\$$]'FNfzuM)U܋E$U]UM|.tgƒ_ZuNV>_׉F u ,[^_]Ë]Uv]NՃmu$] ,[^_]ÉUE$]&UtÅT$D$ $M]MVD$ D$D$>$Hn]D$ D$D$>$H$nHU؋EMVVUWVS$fËlj@&QE1tz|1Gu@F @t&T$ $V$U+$[^_]ÉT$ $փ=uʼnD$ PD$D$C> $dGҋD$ HD$D$p $G D$ PD$D$D> $FD$ D$D$E $FP>뷉D$ D$D$D $JFD$ D$D$E $F UWVS-Tdhl}X} uUpUP@&Q@E1dVhXphfTJ9rf.&9f>*uf~*u1f~*$j?_lTDlmTT.lJD$ 8D$D$>$>hTD$ 8D$D$>$>XPTĈD$ 8D$D$>$>p TD$ 8D$D$>$E>13=qdTCh/p@ @t`<$PG$`$T,؋`$T,lT踵UWVS跇ܓ`hl΋}p} M\@&QdE1h!lKp{pfXlp1 9sYfPftf/u܅t0t&.&.&.&f@/f/u%9rdU+İ[^_]flpP`D$ XD$D$o>$"<D$ XD$D$l>$;l`D$ XD$D$m>$;p`ĈD$ XD$D$n>$w;PXllftp‹hG t\SJKt*lfx/t|%=@=t`G\h;FX\D$|$ pD$L$$lh 1h1h C ukG @tKpD$$W([|%=@E9ll/(pD$$`ī뫃=u`D$ @D$D$S>$X9T$ HT$D$pX$9`蒱`>1҉l/UWVSDvǓÉ@&QE1vHf~uQ@ ~ύff/P9uݸx0f"f*ffʃft>f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 ^T$ D$)L$pP$ gf[!~ʉW-0$T…ZJD$D$ D$D$$T@7pf@!fH9"Ĉ|$ tt$D$> $^3|$ `D$D$ $&3T$ tD$D$> $2`T$ D$D$ $2T$ t$D$ $2|$ `D$D$ $`2rMUWVS4L|qgU9U‹)߃r)ڍHPftDΉ1ff}tYFftf[tWf{uFfuM E14[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1Gf,f[uSf]efً99S{f{vf}uͅt8Ĥf}Xׅu9f1TffuM M1B:qQf]tىC)ȉD΃tft FĈT$ ||$D$>4$.ɋtFUԈT$ |$D$4$.|>T$ |$D$4$d.^|>눋yuI󥉽SًfvfUWVSwƅtyB tA xy f>{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃ĈD$ D$D$>$ -MUQMU썃D$ D$D$>$,MU82NUWVS(vu} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍ĈD$ D$D$>$(+U} UhUWVS.uSEtXEPtF@$v*yUU1Ʉt<\t?<\<[ft*<*t:tƀ8u^iMT$D$ vD$D$`p"<$FME tE 0[^_]D$ ED$4$H@x]MultQyuJ&wɋ⍻`p"뚉t$)$D$?$еt$Y$辵u=@=~Ӊƍi=[D;= ?tD$?$I@D$?$D;@sD$?$i@@HD$?$ȴ?@UWVS8~bãn@&QU1ǃt"t"DŽt"r捃p" t"D$ D$D$$˳t"T$$|D$\|$4$NA8t߉t"8#mD$\|$4$Nt8t㉃t"D$\|$4$_Nt8t㉃t"D$\|$4$8t$ t"D$\|$4$Mt8t$t"D$t"D$4$,hD$\D$$aMƅ8tщ4$ uċt >t|$$ uቻt"?x{U+8[^_]ÍD$\|$4$LK8t߉t"8#wD$\|$4$Lt8t㉃t"D$\|$4$iL%8t߉t"8xuxxu xt"8sxwxJt"D$\|$4$KtQ8t$ t"D$\|$4$Kt&8t$t"t"~t"D$D$$蚰Yx{Elǃt"171Pǃt"ǃt" FT$$ hUVS]jt"tJtKt"[^]ǃt"CD$4$t"ut$s$41UWVSx]Ýiuǃt"t"t3$虳t$t"$ tIu1[^_]ÍCD$<$`t"uˉ|$s$3t"[^_]ÍD$ pD$D$$FUWVS\huǃt"t"t7$t$t"$ tMt&u1[^_]ÍCD$<$t"ulj|$s$3t"[^_]ÍD$ dD$D$$BUVS[gǃt"t"t$[^]ÍCD$4$t"u҉t$s$`21USQ[vgt"t$ǃt"[]fffffffffffffUWVSP [&g}ƉUԉMEԅ}@ER.EEEÃ]}ԃEȍFE]|ЍL]DStER.XD$Ẻ$ut Eԉu"ED$Kit$Ẻ$\plEft"EЉ$衶EȉD$D$Ẻ$xuXEԉu"EȉD$jD$Ẻ$JuEԉu"EȉD$'D$Ẻ$uTEfu"EȉD$7bD$Ẻ$tEfu"EȉD$-D$Ẻ$tEfu"EȉD$aD$Ẻ$tEfu"EȉD$TCD$Ẻ$\tsEԉu"EȉD$D$Ẻ$.t>Eԉ u"EȉD$7pD$Ẻ$tEԉXu"EȉD$ND$Ẻ$sEԉ\u"fEpxEfEbxEfEfxEfEoxEfEtxEE`a`u"E؉EEEčEEE$u"1D$ D$D$h|$.ifffffffUWVS!;FGu>4$T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)vlv"9u(Ƅlv"[^_]Éր>/tJ(lv"ǃs$utǤƄlv"[^_]ftt鍳#fffffffUWVS:&FE$}Lt°R.DBt;R.0fkfbfgfE@ E1ɉMD$ ED$E$Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZEN"E0US8DD$ E$裙[]ffffffUWVSq8ÖD}?t<$D9uzf.&9ti8/t9t`sc~/t9u)=vlz"׃rtftƄlz"Ѓ[^_]ø(€8/t Ƹ봸#US<7CEEEEEEEED$ẺD$$tEMt<[]ø<[]ffffffUWVS !7FCyt4ƅu"t$Ut,E t: [^_]$ [^_]Í#$1E uD$D$p$ ǃtD$$D$<$D$<$h<$ė[USB6gBEt=tU T$؉$͖[]cUVS5ButE D$D$4$D[^]ÍVD$ D$D$1$y붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[t@? [Ḯ̀rS[T@? [ḭ̀rS[4@? [̀ffff̀ffff/̀ffff^̀rS[?? [̀rS[?? [Ḥ̀rS[ä?? [<̀rS[Ä?? [̀rS[d?? [ḇ̀rS[D?? [̀rS[$?? [ḓ̀rS[?? [̀rS[>? [`̀rS[>? [R̀rS[ä>? [2̀rS[Ä>? [ḩ̀rS[d>? [P̀rS[D>? [ḷ̀rS[$>? [Ḷ̀rS[>? [ḉ̀rS[=? [̀rS[=? [Ḛ̀rS[ä=? [̀rS[Ä=? [Ḩ̀rS[d=? [1̀rS[D=? [Ḍ̀rS[$=? [òrS[=? [ìrS[<? [l̀rS[<? [t̀rS[ä<? [s̀rS[Ä<? [r̀rS[d<? [p̀rS[D<? [j̀rS[$<? [m̀rS[<? [̀rS[;? [Z̀rS[;? [ ̀rS[ä;? [!̀rS[Ä;? [S[n;? [f.&*̀r׋L$Q1fffffỲrJ!QS[;? [UWVS.;l~"p~" D$$kp~"x~"+t~"|~"s$uu[^_]ä[^_]ft뻋t~"Pp~"D$D$D$D$ D$ D$$-l~"11l~"D$$D$$覌$Cf;USv-Û9p~"E)9l~"t$q[]à T$$U[]US.-S9D$I$L~"u $n[]fffUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVSZ,8EU1UE $MƉD$ED$M $t9} uˋUtE붋E8E[^_]1[^_]UWVS$+7Ɖ@&QE16°R.ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $EDžtҋ0F D$<$6zF$F(<$h떋XUWVSX*6E؋}E }EEEE]ðR.]wu8EX]E]܋DJ@u.<%uEUMYC\}IED$ED$4$S NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$UwE UπUE댉E䍋iL$ M܍lT$UD$E؉$貿EFEF#QjD$4$E,[^_]ËF$\}Ef~ FFCFFD$4$莛E,[^_]ÃUML$ T$D$E؉$EFHUE$vE UtRπM1D$ lD$D$?$蕾ZE(E9Ut'$QvE UtπUEEUVSY~uD$4$ZV(4$WF u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$D$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$豙D$D$D$4$脙UVS2WuD$4$3V(4$0F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$՘EUw0E[^]ËVPNTUMutt+FEUTD$4$pzD$4$SfffffffUVSEuUMx#L$ T$t$$nx9s[^]ÉL$T$$J[^]u3UWVSô}?ew t>Et[^_]Ft$\{V tQFtB1ɉωMT:0$8{V T:($){V D: ${MV ;Nr${F,t$zF4t -$zF8t$z4$z[^_]ÍD$ tD$D$M $S?e[^_]ÍD$ tD$D$K $UVS,Q$4$2k~"D$E${4$k[^]UVS $4$j~"${4$j[^]UWVS$<$j~"D$$sƉ<$j[^_]UWVS]ÂuED$@$iED$E $|j…t?t$U$¯Ut'zu Ńtt$$蛯uUEHutU$艋EUЃ[^_]ÍD$ D$D$<, $_7UVSvÛ@4$|i,"D$E$h4$_i[^]UVS1V@4$7i,"$h4$!i[^]UWVS@<$h,"D$$iƉ<$h[^_]fffUWVS0 UR.E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍD$ D$D$FX $軵ULuԍE9s11UWVS  虹D$t}D$`J.<${mE tED$E D$<$vD$$ .UE$_USBg 艺UT$ U T$D$E$offffUWVS & }u9cEt' [^_]M M@E E} ; c ‹M EEEME}u},v.&.&.&d09uM}u}  [^_]à t [^_]ÍD$ D$D$$aΊD$ D$D$$/nE TR.n} X} NU R.DP] Sɨ E nO} ;M R.DH9Ѝۺ/)9 ] DCЈ} ?VU  ЈxE m} -}} ^dU R.DPE P ЈE PЀ ZˆE 0<kЈE TR.hE 0 } #EEE } d= RE +E TR.E PEu } \Et } %Et } &Et } =_E R.M DHQE 0yU\GOD       ME}u΋}9|dtH9tud^EcdME P2 ZE P*(R.WER.W E' UWVS(gE܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]诲([^_]ÉxÍw7D$ D$D$$U U ]܍<7D$ D$D$$賬U ]j  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]fUWVS!Ful"n/>3)Ѝ)Ѝ:~ 9w$t"ugp U$Ѓt"dU4$Ѕt9w$D$ D$w4$[^_]É4$duljw$t$ YD$D$ w4$:^E t1붋t"t9U$(bNjU4$dY[^_]Ëpǃt"뭋U tuGEǃt"d\"hD$$=9fl"`ǃ\"11UWVS<auh"o))Љ):~ 9w$p"ug U$Ѓp"tU4$Ѕt9w$D$ D$w4$蟿[^_]É4$tuljw$t$ YD$D$ w4$T\E t1붋p"t9U$(`NjU4$tY[^_]Ëǃp"뭋U tuGEǃp"tX"hD$$Sdh"_ǃX"11UWVSV{u4$Džd"ED1.t&.&P9u/>3)Ѝ)E:WɉM~4T$U4$nUuMG$U 1[^_]Ët"u$pU$Ѓt"UD$ t$$g4$h@G$됋t"u$pU$Ѓt"UU$(^NjUthP뀃t"tT"u/D$$=bEd"ǃT"ǃt"4$htՋ@UWVSdÉu4$Dž`"EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$}UuMG$U 1[^_]Ëp"u$U$Ѓp"UD$ t$$v4$x@G$됋p"u$U$Ѓp"UU$(\NjUthP뀃p"tP"u/D$$`E`"ǃP"ǃp"4$xtՋ@UWVSsØUEltЋl"t'Ǎt$Gd9uǃl"ǃ\"d"t'Ǎt$ d9uǃd"ǃT"ǃt"EpE lEhEd1[^_]øUWVSíUE|tЋh"t'Ǎt$\c9uǃh"ǃX"`"t'Ǎt$!c9uǃ`"ǃP"ǃp"EE |ExEt1[^_]øffffffffffffffUWVSzpUE  DžXEK/tBD$E $p-E $Ŗuv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $p:!%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pJDž`D$`p脔D=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p_?t9E DtX$p^1Ĩ[^_]tN~uPf/tpڢ?pĢx貢zUWVSGl}E ttrD$<$(xX[^_]Et$<$}YDžMtAt$$h(ymt *8"tƉ<$\1[^_]1fffffffffffffffUWVSæ}<$"$T"ǃ"7ty°R.E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]Ë"t$[ǃ"ǃ"΍yU͠ UWVSbÇu} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]Í6D$ D$D$ $o[UD$ D$D$ $@UXU]UWVS>cu} to.&.&8u$ u|:9s :t|tu[^_]ÍD$ D$D$ $dbUD$ D$D$ $3-1UWVSpJgƉE @&QE1=m}! Mu0"t |$$U$>P UD$ D$D$E$|DžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$ T lj99D$D$E$A^Ѐ txE<#=D$ $,#Dž{D$=D$$yS<:uA)ljED$L$E$:=w!C:SDžD_D$ |$D$$HD$D$ D$D$@$kD$D$@$*?qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$k6L$t$<$U6 $SOދDžމ:DžD))))T$<$Oo<ljljÉtE$=)ȍP9rH8E+p[^_]ÉEDžD$$N됋"$WI!"D$<$-|70ƋYq0$+Q\0DžƋ|$PDž>BD$ D$D$ $ZND$ D$D$  $cD$ D$D$  $ޏ.6D$ D$D$ $譏tp@a$ODžmE$:;E$:n땉Ƌ$XO>$ŃD$ \$|$4$V Pu Dž$@H $5FDž L$T$$14$V18Dž4$VDž鋝D$ D$D$ $藍0<$M0$MtE$8貒 M4$V薒 1ϋ$?Mu%$M됋E$U8UVSEM ut.t^UD$t$$F[^]ÍUT$ T$D$ $?M EuM ENT$ T$D$ $M ElM ET$ T$D$ $NjM E1US"t$^ǃ"ǃx"ǃ"ǃ|"1[]UWVS0åME @&QƋE1Dž]x""ǰR.C"t"uD$"$ ;D0Dq@:#|"ux|\u ǃ|"׍:\tWut$"$I:lDҀ|\tǃ|"ǃ|""$ECƋ"u$n\ǃ"x"Px"@&L$$A"dǃx"ǃ"ǃ|"f:wu<:tAt<|uD$t$$}ƍ@E+0[^_]Ë"$ Buh"$:[ǃ"+x""0CD$x"$@"5"t$Zǃ"ǃx"ǃ"ǃ|"ND$ D$D$ $胇tD$ D$D$ $T7ǃ"ǃx"ǃ"ǃ|"$Yǃ" UWVS3u} tPtz"t$Yǃ"ǃx"ǃ"ǃ|"} u[^_]UD$ D$D$ $[uND$ D$D$ $-WUWVS$?hEu} (TED$=|$4$ƅl$d]=Dž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]/BljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]BAEEM$[^_]Ë]뽸 y]䍃D$ D$D$ $ÍUD$ D$D$ $调]䍃6D$ D$D$ ${z1*E$]C<$]C]諈 UWVS?hEu} uE0D$=|$4$Dž$d]:ƅ<:d <:tCZtsu)Cd]D$4$]q?Un‰ƹd<:uЉƍX)Ӎst4\$$U].?U@Љ)ӍsűE[^_]Ë]썃6D$ D$D$# $́E]썃D$ D$D$$ $蔁ÍUD$ D$D$" $cZ]썃eD$ D$D$` $1)D$4$]>t-M14$]6A։4$]A]K UWVS}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/ DžDž)S$N9>:hf  81Ƀ4uA )čD$pxr󥋵t$D$$u'D$D$$ %|$t$$$D$D$$$D$ D$D$E ${udurP(1(rBvBDžqfzU .|4QD$E D$E$]UWVS}U @&QE1EtqMyu )čD$UPtMP}y:u}|4QT$D$<$~%U+ue[^_]ø"fUS#HD$$M"D$ $L"[]UWVSH}}ԋE E؋uu@&QEЉƋE/D$$-"}M؉MufuUT$U܉T$ D$ UT$$Nuu vU܋9El} u "tUԉ%9"t1MЋE+H[^_]Á} u "uD$D$ $4[ƅtEĉ4$"`AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UAnDžuED$UȃT$Ẻ$?;Es4$O^f % ЉD$D$ 6D$ED$Ẻ$*x ;Es1"B9EBf9EzJ Uȍ~|$D$ $MnKNMMčD19C9}rỦ׉΃s$tft1V4$r]DUuuB r EfUSD$"\$ ED$EU $T$u؃[]1[]UVS<M uEEEQEUAEt:EȉD$ED$E$zuEȋỦVE܃F1<[^]D$ED$E$^z<[^]ÅtEȉD$D$D$D$E$'zUS,ȿEEEEE܍ED$E܉D$$uE,[]US,tÙEEEEE܍ED$E܉D$$uE,[]US EEEEEEE$%[]fffffff=̀rS[? [ḽ̀rS[? [̀rS[ô? [(̀rS[Ô? [UWVSQv}t,}M MUT$D$C$XƉ[^_]ËE D$<$eƃuHy8uD$D$@$DuyffffffL$S[¤D.[t'L$̀rS[á¤D.[ S[È? [US GlD$E D$E$d []US :D$E D$E$u []USD$ ED$E D$E$d[]UWVS襼uE 4ME0@&QE1%,hEED$E$#D$h8$#hǀPǀTǀX8HDž@DžDDžL0D$ ,L$4D$8$E8U+[^_]É,D$ D$D$F $*q,,ɐD$ D$D$G $p,UUT$ U T$Q.D$E$]UED$ ED$E D$E$]U蕺UT$ U T$Q.D$E$]1UWVSY~}E 4ME0@&QE1E(,hEED$E$ D$h8$!hdžPdžTdžXfDžD8H<$:d9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -UWVS茝ñ}D$<$/ED$ ED$E D$<$D$<$/[^_]UWVS,Q}D$<$-/ED$ E D$Q.D$<$D$<$$/[^_]ffffUWVS U J} PD$$U .U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$U  0Muωƃ}EEu2J0B0upH MHBD$$-E [^_]ÉU 虃U fb ߋrEt9spE9-JUT$ U T$UT$V$Љƅu E[^]P0E[^]Í!D$ D$D$8!$J@U 'Q.D$E D$E$2]UVSДE$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]O0E[^]Í!D$ D$D$p!$J@$U%NQ.D$ ED$E D$E$$]UVSE$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]N0E[^]Í0"D$ D$D$y!$2I@(UEnQ.D$ ED$E D$E$$]UVS5E$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]N0E[^]Íh"D$ tD$D$!$RH@4UeQ.D$ ED$E D$E$$]UWVS(/TuEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}L0E([^_]Ë$ 1ҍ}uU썃"D$ $D$D$!$F@HU]EU썋"L$ PL$D$J! $FEIUT$ hT$D$}"$LFEXD$ @D$D$["$FUU*SQ.D$ED$ED$ ED$E D$E$]UVS E$ tKtE@8t>UT$ U T$UT$V$Љƅu E[^]J0E[^]Í0#D$ D$D$!$0E@8U ClQ.D$E D$E$2]UWVS9HD$t}D$`J.<$Et8ED$ED$<$t|$ D$D$$5E $' D$vD$$pE$USjÏD$ ED$E D$E$T[]fffffffUWVS0!F}u t$E$'6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw"Nwq\E@VR.PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$&tU@}ظ^DE@uS4$'uV tQFvIE %Fv7 ,-}ԉ}؉xE7R.DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$nrF<gE\}؉xE^E?xgU ML$ iD$ED$E$ME9]US x&EEEEED$E$fE []UWVS$wDžE = t27ƍXD$D$ |$t$$%tm1 9BD$E$#uċR} u9rcJ28 uK9t4$$Xƅ(19t4$tЁ$[^_]UE D$E$a]ffffffffffffUWVSv&ƉЅtK Љ Љ Љ Љ Ѝx|$F$tBF~1[^_]ÉUT$ T$D$y$R+E냸UWVSauÆƅ9N rd~PRuF$D$ D$L$M<$[VMf.&2Z^uC[^_]ÉUy(M$0ED$|$F$UM0ҋMUu~ VЃ[^_]ÉMUD$ D$D$$7*MU MD$ D$D$$)M9N r~y(M\/ED$|$F$U8/Mu~ 1UWVSsƉυF(JJrPfJtt$ $ uL蕛t4F%=@=(=Ĕ[^_]ɚttk.8t$tB$#t5z |1tft Ĕ[^_]fxt~B8z<~ ^z0Z4FB@zT.BpDpf@PDP01H41 u䋕t3P8H<1 uҋpx9t<|1tftF - rĔ[^_]ÉtD$ D$D$$A'tzUtBT%=.,8t, f({f'{UWVSp}E։ʅE@(u+U$lUxTLYHP#BXU$DU@PxTZrtftP,}WP@ @J@ @@[^_]ÉM썃D$ D$D$$%U!1UWVSo{ljօxlxD$$tE3G0U3W4 ux3G8|3W< *xGЁČ[^_]D$@ $ttRxD$ $]ƒ{ph*0t$wS*0pЁČ[^_]úЁČ[^_]Ët$YUWVSXnz}ljU ]1G(D$C$]E܅}-G(҃EEE܋1ɋENE̅n]؅EfHJ]`)EEEċX(]S@|/EEG(EGU)ЉEԋEċ@DEEEEEE?U؅F fFHEċ@FFEEpEuE܉$]#5Å(G( u { .PK S M2ƅMpE9EȉFDEN(F{ ufNJE̅GE؅tEC G(YFFfFH FE5u3ҋMċI@M)щM7EEċX(]S@|/EELGEԋETMM/GU9tG(UЉEEGU)ЉE{~f{.n 8G(tkFFF,D$FTD$E$]a1ɉfFHU؅&؃)‰UFTE[FTF벋EEUEEEGX]/IE܉$]EG(E9GEUЅE}G(UċRD#]%EMtuv$]uE܉$]_%UEf@HO(EEX[^_]EEEE@]uaMЅW$tEЃtUX[^_]t]-%E4$5EEUE}MЅuW(EċpDuG$]y}Ef@H }0]$UĉB }EEEOGt8f.&.&.&PXT9t+PʉPH@uUЋrDyЋXDPXT9t+PʉPHPu׋@ԋ]D$ pD$D$$>} }fGH]#G @E}G(UċrDuG$]EЅEċ@hUZG(UċZDuu떅uEċ@뽅?~t&UWVS$ogÔs} EdD$,$ƅEF$~(EEt=}1҉Eu׉ $9sǃuEuw1ɍiE‰EM@DEwE1}EBUE$UUQ…U@DEBBTBN(U?fUufBHEuBMEPUEo}}Ut E1ɋUt9xf@H F(EuNE$A}  $vuE$gF$\4$T1$[^_]Ã}uω$9sǃuu0UU~8 릋}|\1ɋUYxf@H F(hD$D$@($FN(D$ D$D$$D$ D$D$$1ɋU@f@H F(ZE4UWVSco}tH@JHDy$VDxpup$VDy4$wtv$muGt$ZG$OG(t&<$A1[^_]Ë@$$dG$ ƃtCG$[뻍D$ D$D$ $EvEG$ <$EbUUUWVSjbÏn}57KW(?FLfFL;NHtlfv$NDFLf;7tȍD$ |D$D$$Affu@F83G N<3O FJ"Gt uƉv$uuGfFHPp$c~DWF(VD{G(G$ O(1[^_]ËGt+tEW(uƉv$uuGGIG)t룃8N?wGGENQ(BI|/u‹E/N,QT$VTT$$7[^_]ÃD$ |D$D$U$1ɉfFHG(uG$F,F(NTD$ML$G$wD$/M $$at;9EP$U) @MD$UT$E$+MN,GFFF8V}F)uGHf fű~t$u} EHDu@8/tF(tF[^_]ÉUD$D$@($ǃUttF<$<$ugF)E@[^_]ÁN(fD$ TD$D$1$FUWVSZ gutpOu4E4$u(4$E$'[^_]ËF$$뿋F$$F$$F$$뵍‘D$ D$D$B#$+aUS @ZefQ.D$ D$D$E D$E$l$]]US Y!fED$ D$D$E D$E$l$]]UWVS8YeƉ׉t,M=U= =T$E؉D$E܉D$ L$|$4$=ƒu܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1"كl8[^_]1UXdQ.U E]UMU E]fffff̀rS[td? [̀rS[Td? [̀rS[4d? [ ̀rS[d? [UWVSWcu} u !t9u[^_]1[^_]ÍD$ D$D$*#$K UWVSdWÉcu} ttB|$4$[^_]Í'D$ D$D$B#$ u2D$ D$D$C#$ UWVSVbu} ttB|$4$e[^_]Í'D$ D$D$B#$Y u2D$ D$D$C#$+ UWVS@QVfbt$(D$T$L$,D$,t "|$GD$8UT$$\$(uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$葦D$L$8D$9\$(;"D$8D$E܍ 0MU‰T$UE$]/U})ljEuUD$ D$D$E $]MAQt$|$E $t~")Ɓwf]/8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$]…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]D$ D$D$E $m$뫉EX@$]TMA }E@@eBE $]ҬD$@E$迫E |EMH ]ωu]:D$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]buDG uNjUtG~uU܉$]}닋]썃eD$ LD$D$<$$$]‹EE1]VUWVSIV}G $wt6$uG[^_]UWVSIUu} t"tL D$ $.[^_]ÍϑD$ XD$D$:\$$"uڑD$ XD$D$;\$$UVS8I3Uut&'== =ED$E܉D$E؉D$ T$E D$E$==t3w dEf>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[S? [ffffffffUE]UWVS$GýSE։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]Í>D$ D$D$r$$EP,D$ D$D$s$$t!UWVSXFREu Ud E' } E EE̋EƉE$]Eȅ E? Ef UȍBEԋEЉE؃)֋]ދuމuED$E$M!EȍDU؉UT$}}|$}<$U1Ʌ9uWuuEȉEMEEĉ}NjE4u܋E9MuЉEËE9s#ED$;D$$UU9tΉMuЃ\97]ˉ}}܉+uED$|$4$UM9t#+EU‹ErUENjE9r}܉ً}}M܋E9ED$u܉t$)$UbE‹E+EuEuE9EԋM9KEEEUčB}9EU}؉EC‹u)}U92؋u)uEԋ}9}EЉEM]}9}ED$}|$]$U}]UEE܅U؉!ED$|$$UU9~S}E9rՉ߉ËE9M̅fU؋E.& 9r}G9T)E؍LEDEEUv9uM؉E}9}M]U9UU̅U؋E}f.&029r}Gu9!F)u؍DE؋EԉEUEE9'EUċ} :9t?Eȋ}ĉ}ȉEED$E$ME>Eԋu؉0EȉEċEEȋE9E^Eĉ$]ҷ1X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$]}~],D$ D$D$y$$Íƃt 1$[^_]8 u81ፃD$ D$D$<$$`ffUWVS05FAE̋]} @&QE1u9 &t8u)؋U+0[^_]ÍM1D rE̍.&TЃutS؉].t&.&.&t\="t]W$]I1B]afffffffffffffUWVS3@}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU w7D$ D$D$=$$#U 끍<7D$ D$D$<$$U KfffUWVS3&?M} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$.Ɖ[^_]ÉUMw7D$ D$D$A(%$UMP<7D$ D$D$@(%$UMUS1>Ey œ(9~)ML$¤R.D$E $1[]ÉD$ D$ED$E $)1[]UVS1å=Ey œ(;}.D$@¤R.D$̃"4$U[^]ÉD$ D$D$@̃"4$[^]UWVS1%=u} taEtHR.EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]Í'D$ D$D$?d%$<u2D$ D$D$@d%$ FfffffffK̀rS[4<? [UVS/<ԴuimNA90%[^]Ë9r[^]9r싋UWVSu/Ú;]д^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓̴4819u[^_]Ë]싃̴u޸UVS[.À:l4$aԴuU4$D[^]ËE4$-[^]UWVS -#:} E[lE$Դtt)ЉȉB}H}wQǃԴǃдǃ̴GEG1E$qE [^_]1뜍Gƃ}?v8}}E?EG EEԴд̴E艃E=)ЋM@G@EE띍D$ D$D$X%$3vE$fEEE3UWVS ,38EEẺEыE)ȉE䍃lE$ْԴU)ȉAԴ<д(̴Ept)̋E򉓐1E$>E [^_]1끍D$ D$D$%$UWVS*6l<$ޑƉ<$ϑ[^_]US *6ED$E D$E$t []USn*Ó6E$[]ffffUWVSA*f6}tHD$<$ƅt&tt$<$[^_]1[^_]ÍD$ \D$D$A%$UWVS)5uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]"x썃D$ PD$D$V%$N<fffUE U9r 9]ø]UU E9r 9]ø]UWVS(ï4 " "u "|4QE1ɍеt-ωD$4$>t  "PEu׉MD$D$4$ MtMljMuD$|$E$  "8Ftt$E$ 4$՝uME"9t$$距ǃ"ǃ"[^_]É"TD$D$$[^_]UWVSD'i3u} t%wD$4$tt=t1[^_]À=t[^_]UWVS&3ut4t$е<$ƅtD$<$ 4$͜[^_]ÍD$ |D$D$&$VUWVSo&Ô2}G$ƅtx @D$е$~[^_]UVS"&G2ut/t$е$tU 9P [^]1[^]ÍD$ dD$D$&$UWVS %1U|4QE8s7i1}ƉUE D$ED$<$Uu E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVS&ƍEFyL$$L$t9~L$ T$D$<$U+u h[^_];f+̀ffffj̀rS[? [ÒrS[? [UWVS }u t$<$vu 1[^_]D$FD$<$tۍFD$<$蹰tȍF D$<$覰tG'D$D$D$ FD$t$<${z2D$ HD$D$GD&$6D$ HD$D$HD&$hffffffUWVSq Ö]}E 0|$E$裰tp?9}raeto1Ɖ\$E$U]9suM9u+EE $]E E E8t 1[^_]ÅuUuCtD$$]f}ƋE 0i]\D$j$|랃t.t&:똸vLE8qw .UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVS u @&QE1V F\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …x^D$dD$ TD$XL$E$6 …x'hD$t$E$‹\f8tVE+oЁĸ[^_].֍F\DžTDžX\P\p9{\hD$t$E$x\NSP\6DžhhD$pt$E$fx'q\D$ hD$D$4$\D$`D$ TD$XD$E$ \8)6Jffh̀rS[D? [UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS u}F9r+)F|$E D$F $Q_~  [^_]1 [^_]UWVS X}u}F9r+)F|$F D$E $^~  [^_]1 [^_]US,EU ]t,HPP UP[]ÍlfUWVS}u tgt$<$˳t6tu*t$<$謳[^_]ÍFD$<$u 1[^_]Ãt$<$[^_]Í|D$ D$D$l&$j2D$ D$D$l&$7UWVS}u tnt>t$<$u[^_]D$ FD$t$<$[^_]Í7D$ D$D$Xl&$1떍2D$ D$D$Wl&$cUWVS@}u t$<$u 1[^_]ÍF D$<$tF t6u$FD$<$_tăt$<$L뵸[^_]ËFE }F[^_]2D$ D$D$wl&$-OD$ D$D$xl&$ UWVS6u} t tJD$|$4$[^_]Í2D$ D$D$gl&$莸uD$ D$D$hl&$`UWVSyÞ}u tet$<$u 1[^_]ÍFD$<$ft~uD$D$ F D$t$<$赴뵍2D$ D$D$l&$豷qD$ D$D$l&$BUWVSú }u FFt 1[^_]Ét$<$tFD$<$jtӍFD$<$ѨtF D$<$辨tt$<$諨랍2D$ D$D$l&$讶VD$ D$D$l&$|'UWVS÷ }u -t8GunG toFF[^_]ÍL$ M썃D$D$%l&$UGUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ L$D$$WEh GFG F[^_]ÍD$ D$D$$l&$G EL$ L$D$ $մE   FFfffìrS[ ? [v̀rS[ä ? [VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS uM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1эMD$ D$D$:&$вM E9M D$ D$D$;&$蕲M fffUWVS(ƉЉ@&QU1҅OD$ |$D$$$<$@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ ӒD$D$ $d4t9um΃tft%D012 (ӄT$ T$D$&$轰vD3T$ T$D$&$肰-D$ ӒD$D$ $wcuoN }L$$ te$螤ff^N mF.t&z'UWVSyÞƉE @&QE1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$04$9E{ED$t$$+1F5EDž*FfEMfD$ ӒD$D$<$`<$89EED$|$$sF<<p EED$D$D$D$ T$D$$w~0wDžFȉсI<<9fE<|$ L$D$$U8<$轠9Er8ED$|$$$mj$m~MLED$E$NDF <Džytt Eut2ED$ D$D$$ӄt1ED$E$1"UWVS<uU EEMEE܋EE؋E E@&QE8}1w~wF,}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ ӒD$L$M܋E$^\M܅x9lEE܅t E؅aFfVT$D$ xD$L$M܋E$[DžMn9fFfF fV ffuu҉T$D$ ǒD$ȉM)D$4$[Mx 9EtEc҉Uԋ}^UT1iE܍ޒE؍vE̋E܉M܉u ET8ẺT$D$ E؉D$t$ $MZ9M)ƃ9}u1hȃiviD$t$E$製1?FD$ ֒ EEEDEԋ}1iE܍ޒE؍vEЋE܉M܉u E8EЉT$D$ E؉D$t$ $MYM9)ƃu1yMFD$ ӒD$D$}<$Y<$FM9L$|$E܉$腼MFUU܉D$ D$ȉM)D$$JYM9\D$T$ xD$L$M܋E$ YMUWVS@ lj΋E@&QEG uY$fto|$$gt9wuҋtD$G $ u1ffh$ݙ@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$ft$ |$D$$hu8u Dž11fB|UVS äut$F $&eE $MUYF t [^]ÉE4$dE [^]ø̀rS[D? [UWVS&}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$^qΧ8[^_]1[^_]ff̀rS[t? [UWVS1Vut7D$4$.~FftID$4$:~[^_]Í1D$ D$D$@&$蚡띿fffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUS5PtStI/[]PtfHuX uHuxuπt[]Pt#u[]@ tOE虢D$ ED$4$ 1uuEt8u x[^]ø[^]ÍD$ D$D$&$襜qUWVS(tƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJء"ء"f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.<븍MUWVSƉׅt5tet&u 1[^_]É $7GuMT$ T$D$&$MuMT$ T$D$&$MkMT$ T$D$&$諚M6UWVST։@&QE1|DžDž 'F F`FD$$D$ D$D$D$F D$FD$ D$D$<$u G @u}D$D$ L$D$<$蟺O @,1ƒ $VD$D$ D$L$<$T~QG KD$D$D$D$D$ T$L$<$!E+ȁT[^_]ËQu7Iffft#fFPЃ6tRrD$ 4D$D$ &$軗U+t't܃t&u؟UWVS(uÚƉЉ}@&QU1҅t\D$t$ D$D$4$"J=1U+([^_]É4$萋PwstP|.ut$T$ D$D$4$I댉T$ @T$D$ &$C覞O7UWVS4A^}ĉÉ@&QEЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ] UWVSöƉ׉MEOD$A M$P…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftugD$ D$D$&$}0D$ D$D$&$Nf mUWVS&=b@DϋE$E,@&QƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} u?(Dpf@fPff[PD 8Hx LD$ |$ T$L$$ږ…P @@ u+!<$ϖf$GΏt,$ډL<$ LwdmPu .8tX<9 u拽4t t҉tH9Y PP1] UWVSpTyƉ@&QNjE1>$=$=`11D r틅FFtGGFUCF֊Í1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$߉8=.t&ČG au$1ҋybKC;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$>C$0CU+cp[^_]Ã){$B$B1녃1(@<tcE D$ D$D$$u|d@=1$1ҋ_/"@ P$1ҋ載覉8D$ TD$D$ &$$1ҋRE@uu*$HDPDE$@̈1gUWVS`hEdpPt%=~hDž1E1 Dr]`1 DrV]pdMEE`]MEE$E]1 DrFdd<$h.dU[^_]É<$h<h+.[^_]ÉЉ`6`fXhN\G]1}`X D r틅h`HOT`@pPDXLHHX9HHD$ PD$D$L$h)dL$P T$ D$DD$l$:xq]1EDr틅lEEE!$\Xl$h=9TX\d\$hЂEE؉E؉d<$h艂dS|dMEEdMEE‹`MH@A‹@u@<$hUWVS`ljUMMME EEE@&QE‹E1EE$Uu\WtUL&t89uML$MML$$OMt u܋E01}U+`[^_]ËG;t?OƅE$1ɋU "D@u듍ML$ME$1rD$E$T4M<MMG;tƅE$1ɋUv.t&@uD$ D$D$&4$yEED$ D$D$4$y%uܸEvWt$9<$9uEaME뺋M#*U6WEw ]Í3]UWVS*ut(vGt$9<$8u[^_]ÍD$ D$D$r&$}xUWVSøEdE tEpMh@&QlNjE1x1󫍵1҉D r퍍T11D r틽dpPu x x$9Dž hlE+[^_]Í}D$ D$D$&$2w t]DžDžDžDž|wHt;u Džx$tT+ l`XtGt`u\W9tCu+w9 t  | t1҃1҉ TL9G9}Gw9 uuttdx$tTLf.&9u`q@D$%d$=gd$…^ d)xD$L$4$tPTP `pLH@D.t&.&vZ~u~ x G<_$)8J_D$ tD$D$x&$}i>x$z+Džx$]+DžX`A{$0"DžDžt?G t,Gt&H?wB11  ?uNj<$7AD$ D$D$f&$WhG H닋Dž(D$L(Dž{vGt$(<$(u DžDžvXx.fǃء"4$1ɋt.GtuŋG@fuXHS$D$D$D$ L$D$ $+ȉQH9rs$P xrHH9s $&GDžP.tp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$蘢x$1ɋD$D$ $0y|$L$$~D$|$$FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $ctpD$ D$t$<$$)ʍ0&J9uB<$L#Xt;1AtF0 $ #Ft4$#X@FXVDž|1dH1׉D$ D$D$$ԟT$D$Ii $FwjNxa 7 $"x$#5x$#DžFB0$!t2Buቅ߉UWVSpTmMEׅ M11D rEME EED$ E$]R*HMt$E$]oX@t\}}< < ߉ډt$$]Ht!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍxD$ hD$D$k &$^]D$ hD$D$l &$^UWVSpʨuE$z>FEu11D rE@tmEEEE<$SML$ML$D$ |$D$E$vtwEЅUp[^_]øp[^_]É<$RMML$UUT$D$ |$D$E$t2E$RUEetFE$gMEԋAE܋A EAEAEAEAEEUԋEtEЉƋ@u{e!UWVS\ +P@&QNjE1a D$ D$ D$ $sƅ?8#D$4$DD$4$'x1҉< tv< tr׉ʋD$$ƅtbHT$$GFt < t< uσxzT$$2uЋAAA AAAADžD$ D$D$4$fU׉&.&t틍tڋ$CD$$k1ҋE+Ё\ [^_]ËډD$ D$D$ &$YD$ D$D$ &$YUWVS4蚣ïEȋE8Hu11D rM̋]ȍCD$$EЉuЋM̉t(Ct&.&Ë@uM̉u؋EЅt $]+EUt 4[^_]ø4[^_]UVSѢuD$F $ttP PH p[^]UWVSD腢êljE@&QEG ut$gt$$ctӋD$$NtD$F $Nue$qL@=wI$IL‰@=wЋЉ=@1U+D[^_]Ë~D$<$Mtu狵1DžЍtftȍtftD$D$ GD$D$@$+9qt89FD$D$A$Dz<FL19\9PB 9=0t9$9uۉD$D$ $uD$ D$D$$I(u9u Xu3fvfvBUWVS蝞ª}utHt$F $=E $UF t[^_]ÉE4$E[^_]ÍD$ dD$D$($SfffffUVSÉ13v.&.&.&.&.&.&   lLLLL9r[^]UWVSTNjEGEGEG EM],t&.&.&.&.&.&Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVS贖٢ut0FF#EgFFܺF vT2[^]ÍoD$ D$D$($$LUWVS=bEBU oP?ωMM1ÉPHUʉP@)|89]riڋu uwuoxEE);UEމ}E} ]7E@9r})uu Eu sItft[^_]äftX] E]DEvoT$ T$D$($JEU EZT$ T$D$($\JE\f7u S,f$UWVS$CEE} @&QE1WEEG?78)‰T$D$<$cD$ED$<$LEyX1tftE+$[^_]úx)r|D$ D$D$($HoD$ D$D$($HWZfPUWVS$讒˞}ЋME E@&QEƋE1R.ljEDGtXEE؉ƀ0xC1E 1҉uËutFt9}t`}׍Ty1ME+$[^_]Ã}u1ft* ta) 봻A8w믋u܀.u{E9twVË}DGt03Y؃01$[^_]ÉT$<$][DžqEx(UP,ӃuCu*E $[^_]ËEP fZUVS$u F tcu.tR4$tEED$4$tE[^]èu?V$ED$ ED$T$F$q t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$a[^]fUWVSp-VEċUOD$D$}Љ|$ D$D$]č44$EЉ$rD$D$|$ D$ED$4$SU1}9U1EEމU]̀{u9S4u'ft"Uf9rŰR UMщM9rƋUE]؃{UEU$]EUuUE0U]Ӊ]t$D$Ɖ$]= űUfEU{u4C<<u$Eftf9CC %E9rU$]du̍F}9FE81p[^_]ËUBtnr uv ]ȍUȋU]TUMщM9bCu=fE9T1MщM9*vC fEȍM114D rCEEMύEtfEt}DE}}E<vtft}d}Ds!E󥍀EEEEE9MEE$]\E$]C]̃ ]1ɉE]txà uыE]E1ɉEfuuà tu؃ыűEFEFFCFC E1ɋ}ƉtRƃ uE1ɋEt\Etwupű}~utftEEEu u}̍G E9Yt#tfE뽸ű}~ utftűN yu }̋uwEEű}~utftEEuȋEuMщM9Eƃ E̋up1MrEtfEt}}EXÍD$ LD$D$])$z1]EErEu<u"M%$]u&fmHMUVS{;ut4$[^]Í1D$ $D$D$/)$04$[^]fUSz؆ED$E $\[]UWVS,zì}} 'v?NBCDt51,[^_]ÁB u$<ƋEEFOM؉NGE܉F G EF$G$xF(F,}EE=V-~U V O(N1utE)NE܃UȉF99U9} 9U܅TEE = =w=wUUE=?B 11 +EUEUEUD$T$ $ED$}F4OF:ON;J34$0}vPEF(V,}{EF-~E F O(NEEE뮋EAE܃= =w=wU܉UE=? @11 +EUE܉UEUD$T$ $E܉D$4F0F8GF9UF0F81F4F:1tx11 +EUE܉UEUD$T$ $E܉D$F0dx11 +EUEUEUD$T$ $ED$BF4[F81F:1UWVSQvvD$E$ƍxD$4$L }и9ED$D$t$D$ D$|$$t4$)ttKD$yD$ E D$|$$ƅt/Ĝ[^_]É4$01Ĝ[^_]É|$t$뽉4$1UE@ ]UWVSu?EEU ;P snH,X<3t;t-?39r09Pr+HE)E1[^_]?SӋ?̋]/Ӌ]/UWVS${tàuF$ED$ F(D$ED$E $X}f4N:^;)ЉMMЉ]MF$)lj}]f4)MMF$)É]Ef4E)MMF$U)‰UF-NσthtT?<߉f0ED$ ED$)N8N9^ )߉|$4$D$[^_]Yf.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴1EE<2w]X EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVSi vlj΋E @&QE`M!t&|$GD$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,_i}DžD$ D$t$$juctYatJBu(f.& B;2uD$ϔD$$@u f})|D$|$D$ D$D$$g4|$$_%|$$ 袽#8Xt&"$*D$D$$st$E+ Č[^_]U#.t& x;uUލ=hlt&.& H;u|$L$ D$D$$"8/<$|=!|$HD$ D$D$$^vT$ L$D$ $#0vT$ ߔD$D$D"<$uT$ L$D$ $uT$ D$D$X" $|(wuut$ T$D$ $@Mu }艽EЉT$UT$ D$`)D$$-R.9D$#D$$)U frffXftD$D$$.1D7D$D$$9|҉ƋD$ D$D$<$O1D8 DAu.L$$d9|ȋD$ D$D$$aD$$ D$ D$D$ $jfuLD$ D$D$$1l~D$ D$D$ $1D7D$D$$9|҉ƋD$ D$D$<$h1R.D8DBu.L$$k9|$D$8D$$H?UWVS>acmuEĉED$ED$E $Mb#D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`ED$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`UEfEEEfEEEfEEEfEEE`t Lf H;8uT$L$ K.UD$)D$4$E`t Vt$$;FE`5t$ D$D$i$D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,B_ED$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,r^'D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$, ^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,] D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,:]zD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,j\\E`} AuUT$ D$D$4$GO A=9uUT$ D$ED$4$kG.& A9uUT$ D$ED$4$!GuL& G7?uUT$ D$ED$4$E`t tt$$ t$$1ɋ}Et$$ Et$$@Et$$ErEf Ef Ef EĈ[^_]P}f*Al%U)j|$ L$D$ $j UiD$ T$D$ $i iD$ L$D$ $zi xiD$ L$D$ $?Li =iD$ L$D$ $i ;$iD$TD$4$Ĉ[^_]Ét$ D$D$$)}t$ D$D$$t$ D$D$$_t$ D$D$$t$ D$D$~$At$ D$D$z$ft$ D$D$v$?#t$ D$D$r$t$$ /UWVS$`WÅcuE }@&QU1D$L$ t$U‰T$$xVD$t# $hU+u#$[^_]$.x1螄UED$ D$E D$E$]UWVSuVÚb}ED$|$ ED$ED$E $x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$UbE@&QE1D$|$ D$E D$E$&…tD$<$ E+u Ё$[^_]\UWVS^UÃa}u Gu 4 Gt*D$4$uUt E[^_]ËEtE[^_]UWVSTaU} uBu& Bt9:utJ[^_]d|$ T$D$ $莽td [^_]UWVS]TÂ`E} uHu) Pt98ut@[^_]0d|$ T$D$$tc[^_]UVSS_u=hl.t& Bt ;2u[^]ct$ T$D$ $ycv [^]Ét$ D$D$X"4$;[^]UVSSC_u} t^ f Bt ;2u[^]bt$ T$D$ $ɻb [^]ÍAlUVSRû^u# Bt ;2u[^]~bt$ T$D$ $IVbv [^]Ét$ ߔD$D$D"4$ [^]UVSQ^uuwU w $!@Ew- wiue@w, u8=6bu(Ru9Bu 2at$ DT$D$(1$̹`1[^]Í鍃ፃڕٍʕэĕɍƮ빍뱍%멍롍,뙍둍UVS7P\\uB`D$(YD$4$`x `Y[^]`t$ ӒT$D$(Y$ڸUVSO[uL.& Bt ;2u[^]_t$ T$D$ $iv_ [^]UWVSHCOh[@&QE1E <teU‰D$ LD$D$.$UUt#HL$MT$<$M0E+u?H[^_]D$ .U‰T$UE D$$yUuE is|UWVS4uNÚZEEEE$E܍U}}؉EUEEU t 14[^_]ÃuuU<-.E<+u JMBR.DK(r1ɍ.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF UJEuuEVt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVSaJ~VEU UHMHMHMXˁHɁ@ =.-E썇iE0ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)ME$wEE$wEE$lwEÅU܋MJEP}V\$HD$DED$@]\$*t<.tȅx%[^_]Åt<.1[^_]ÉMST$ !T$D$ *$E[^_]UWVS0EQUE荰EEEE$藜PlPHH8|$ x|$x|$@ D$L$T$ jD$D$4$G~ Eƀ0[^_]UWVSE>Qu# Gt-D$4$蝤u?E tE [^_]Ë?D$D$4$ukVR.DPtMD$ ED$4$NҋMyE8m1Ɂ]1VUWVS)DNPul=h Gt-D$4$譣u?E tE [^_]Ë?D$D$4$ukVR.DPtMD$ ED$4$^ҋMyE8m1Ɂ]1VUWVS9C^Ou D$4$:FFy ;F|/} t)P}D$4$.[^_]Ét$E$USBNEM QQy ;Q|< tZ[]ÉL$$Ų[]UWVSpBÕNEu E$ EEEEED$4$PF0u ǀED$4$D$4$A[^_]UWVSA NQP1QuV@ttuF*V@uuOFuuFuFf~@t8D$4$5Rlj4$KQ[^_]ÉFu뺋F몉4$FOfF@UVS'ALM1QFu t$`J.XD$ D$ED$4$[^]UVS@L1QFu tE D$ D$ED$4$J[^]UVS@êL1QFu ztED$ E D$ED$4$[^]UVS,8@]L1QFu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$A,[^]ÉED$4$EUVS?K1QFu t2ED$ED$ED$ E D$ED$4$4[^]ÉED$4$EU7?`K1QU]U?BK1QU]US> KED$1Q$[]UVS>J1QFu t$ED$ED$ E D$ED$4$[^]USz>ßJ1Q$ M[]UVSS>xJ1QFu Ht2ED$ED$ED$ E D$ED$4$:[^]ÉED$4$REUVS =J1QFu t9ED$ED$ED$ED$ E D$ED$4$6 [^]ÉED$4$EUSg=ÌIED$ED$ E D$ED$1Q$B[]UVS$=II1QFu t4$ K[^]D$$DUS<HD$ l"D$ED$1Q$p7[]fffffffUWVS <æHE8tj׉ƅt|$4$Pt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS;H}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$EĜT$ D$D$<+$@L.EE룤u9sftuu_SfӋ]QKUWVS0:GE׉΋UU܋U؋U$EM9L9MyӜE荃EEuuE9D$E$讹t4$ME*t4$MuuE$E4E؉Eu܉00[^_]ËuE$Etu)y9uΉEd+T$ &T$D$<+$BE0[^_]1UWVS$N9sE]Uϋu M MUL$T$ L$U‰T$$EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂ĜD$ D$D$<+$@L.Eډ)؋ux$[^_]ÿ뛉댋]썃לD$ %D$D$<+$~뷋]EE}8UWVS(u7ÚC]}u ӍR9M)ÃM@L.E썁ĜEЉU u2D$ED$ D$D$E<+$EJBs1([^_]É4$Et+([^_]ËUU]UE([^_]UWVS+Y6~BE|uE(M,M }0@&QU1҉M$tt$$J:ƀ?0E4$b1DžU4T$|$E$%Fƅ9s9D$ĜD$ D$D$<+$@L.)U4E$NjE$D|$D$ r5D$D$d<$Ɲ‹$T$ $}wyUt}wvM "򋽜1st#t<.z<7|0.m}u$U$iD$T$t$ D$D$d<$蛜‹$9f @)|~ DžȉD$ D$d)D$$ӛ9u$򋅠|O4$cqt$<$1ɺ0f; @R.|yxʋ|DNu.9uϋ$90Ƌ)9D$ &D$D$Y<+$}+(}$ 4$ND$ ֝t$D$d<$‹$D$ t$D$d<$蟙‹ $@D$ t$D$d<$\‹4$A9Q9D$ D$D$d<$ؘ$uE+:/Ę+[^_]ÍE4$(^tD$$1ɺl09=$$‰<$uC$Ɖ~$}u ;u$P$d"u$)ƍd}$$HxH$4$T$t$xL$D$ D$D$d<$藏‹ $| $9M$qq9$EƉ9$uD$D$$U |*9G։F?.f.&.&.&9Gt1GtY$D$ D$D$d$譍‹ $u_$_u$FF$B= $D$D$$U |$)ȅ?1A0.&.&.&.&.&.&9t؉4$D$ D$D$d$‹‹ $ut$D$$U |4$A։$v$AD$ :L$D$d<$‹$4$Sr$D$ L$D$d<$蒊‹$w4$fB $B $D$t$D$ pD$D$d<$ ‹$/t$D$$U |S4$F$t 4$4$D$ D$D$d<$:‹4$(}$}4|$ t$D$$ӯ94$9s?D$ĜD$ D$D$<+$@L.x}$KE4D$ t$L$$?4$9s?D$ĜD$ D$D$<+$@L.։)ЉE4FD$ zD$D$d<$ч‹$F9Dž1xǀu2$`Dž t$ D$D$d$‹ $ WP9D$T$ $U | $2tT$L$$U |?$6)ƃd4$0N $۝eD$ YD$D$d<$;$‰\|$ $1ɺe.<$ :$<Nj${U4T$D$<$,Dž9s9D$ĜD$ D$D$<+$@L.)U4D$ $1ɺE$ D$Nj $[U4T$D$<$*Džn9s9D$ĜD$ D$D$<+$@L.)U4D$ $1ɺ%$O<$Nj$;}U4T$D$<$)DžN9s9D$ĜD$ D$D$<+$@L.)U4D$ $1ɺ<$ Xd$<$#e}4|$L$$(ƅ69s3D$ĜD$ D$D$<+$@L.)}4<$b|$$1ɺ<$ e< y@t$D$E$$%4$‹$,}$}4|$ t$D$$荦D$@t$$oE$ VUUU)ʍB=+ $; xED$ D$D$d<$}$4$oF$[$GQD$t$|$ pD$D$2@4$~‹<$q|$D$}$($$D$t$ sD$D$2@4$}‹$ $uƉ$c$G}$A$<$|$D$$U | < $A$QQT$D$t$ D$D$(4${‹$U$r VUUU)ʍB=O $]}$X@<<  }$.D$ ֝t$D$d<$'{‹ $ NBBD$ t$D$d<$z‹ $@D$ t$D$d<$z‹4$}p@<BnE4D$ L$t$$a $赻9s3D$ĜD$ D$D$<+$@L.)E49n)= $R"E$D$ D$D$d<$y‹$<6S9@Dž@DžDDžHDžL@)‰t(19rE4D$ L$T$$M $衹9s?D$ĜD$ D$D$<+$@L.ȉ)ʉU4Q9sG<$C|$t$}$)ƍ5򋵠R BBR BR BBƅ=t9V FFV FV FFV F$V򋵠R BBR Bƅ=fDž==fDž==Dž====sD$ ԝD$D$d<$s‹$DQ9D$ D$D$d<$Ws$9uzD$ @D$E$D$$1@)0~0<$09g$*‰<$guD$ @D$t$$1@)0~0<$09$W‰<$u}$v9֝)ƍ$g2o$b5$ڝ L$ @L$L$$c $‹dЉ3|$t$$U |E9<$u$Hq $D$ :D$D$d<$o‹$f4$r$nD$ D$D$d<$#o‹$J4$wD$ ֝D$D$d<$n‹4$t$D$$U |)D$ *@L$t$$ |1@)0~0<$09$a‰<$u}$?&a<tu$<$<0r$<?~($bD$ D$D$d<$l$ uE<$<+m<fD$D$$U |x"t9quD$ @D$L$4$ 01F)0~0 $a09<$謬‹$u($($<kE4D$ L$t$$- $9s3D$ĜD$ D$D$<+$@L.)E4-$c$<HL.UWVS8Vs E  U8u(E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$V8[^_]U M8E#̻л]UWVSè u}'|EtG9E r'Gf|t+E D$<$蛺y耺([^_]9} r+Ey;}uE T$ p&T$D$l+$贴E뵋E9E r1UWVS EE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]D(UWVS Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,b>M]&](UWVS Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cN]]ߴ(fffffffffffUWVS ]E}]} 1E䍘&;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃0u F+$;zMUWVSIn}u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉET$ &T$D$g+$EF"UWV0u"o^_]ø1L"fffUWVSXϋMM@&QuM1t$D$ CED$D$2M $MXƃM9r,ML$$A7M)11}U+uX[^_]ø$UWVS "KEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EE,Ku}: w) ]u$M EÉ$SyKE}~=Ut3}ưR.ǬR.w\DAtu܋E Ƌ})x [^_]9u]䍃D$ 'D$D$_+$舣 [^_]ÍM U$WEM E$DtiEEM E$HEit?EM EÉ$MM>tEMfffffUWVSu4$qH9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} 1(yUWVSE @&QE1D$|$E$tGD$T$${tT$<$JU+u [^_] fffffffUWVS &utcEt\E $F)ljD$4$*u?|$4$&u%džt$|$E$D# [^_]É4$&fܥUWVS oÔutcEt\E $(ljD$4$Y*u?|$4$%u%džt$|$E$" [^_]É4$%LUWVS u t\E$+(ljD$4$)u?|$4$f%u%džt$|$E$ " [^_]É4$$äUVS W|uD$4$!tD$E D$4$5 [^]D$E D$4$ [^]UWVSu} tAv-u3D$4$'tD$4$c(F1[^_]USèEU tttu P1[]覣UWVS9^}u t' td@t/tZv{Nw u6O(D$<$'tD$<$'71[^_]D$<$&tD$<$R'΅uʍ&UWVSäu} tPD$4$&tb== D=D$Xݜ$D$ht$pÉ$-wʋ|$|,'\$`t$pD$P0D$@/M\$`D$xD$p1/t$pDPЉD$pK$C‰ƃ/˃9y~ǃыt$xDPЉD$x?D$X!D$XD$8D$HD$@ \$pD$dt|$h8D$pe[^_]ËL$T8pet Et$D$h|$8D$HD$TD$0t$hF$F<+<-D$,NЃ S$0` P.&.&.&Љ$2R0tVσ D$49D$@ D$T \$H' ݄$\$pD$T:@q t$8t$T0.t&.&.&.&18tt$8|$8D$HD$TD$0߃E<b$D$h|$`GD$pߍO͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈(\$8؉ȃD$xtD$xj݄$D$| (tru|$T݄$L$PtT$0D$4)‹D$|(Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|8ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|TE$$It$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـx\$8ـ(RD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|(S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|SJD$`U|$p|$$K1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$|'D$4$+$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|9ID$`Z|$p|$$rJ$%|$x==p$$\$|AD$h$AD$p$AD$H$AD$`$A$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaUQ.U E]XUMU E]Fffff̀ffff̀rS[ô? [̀rS[Ô? [̀rS[t? [̀rS[T? [UWVS6u Et"4$qEExu4EE[^_]ËED$t$<$rtGt8Eu׍GEE[^_]ffffUWVSæu} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]Í,D$ (D$D$e8,$z`,D$ (D$D$f8,$zUWVSu} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í,D$ (D$D$C8,$y,D$ (D$D$D8,$y,D$ (D$D$E8,$y1sUSvÛEL-T$ D$PT$$;[]US7\E$uE []1[]UWVS$EpEEEEEE1ҹEEuxw88 w384(E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`USEU} ~\wEBu - t wJt Bx1[]ùr u-JuB-}} UU1Ʉtt'4$kD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USUt/9E t*ўD$ (D$D$p,$duE []US>cM E%t.9t*ўD$ (D$D$p,$u[]UEtt]1} ]ËE ]US衿E ~>uTEtKўD$ (D$D$p,$`t~Ewǀ[]ËEǀ[]US=EU tt 1[]DzUWVS׾$ ,Etc@@yD$D$4$&yu E[^_]y84$~4y81EUWVSFkuthF~O9tHNM 1[^_]ÉU^yED$|$E$U7yu=FUF맍D$ )D$D$Z-$~si|UWVS芽ï}t;t-M tWt1$x3;wr$f3<$^3[^_]UWVS,Q}tJWt7E1U9}t#E4E D$4$iu߉[^_]1[^_]ÍD$ (D$D$-$rUWVS蛼E@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$( D$D$0T$4D$T$ $D$E D$ T$t$8L$$}t$80 E Uwx9rUT$D$E$ []USЭE D$E$[]fSL$D$ &t@AuD.t&.&€tAt9AtAt9Au΋D$[fUWVS 1VuMD$E$?E@0u ǀE EEEbDUT$UD$ $M6MU)֋Ep}Ћ}΃s-tftU)UttEp~)EE9u6u뺉$7u)EpfB뺋E;EED$E$+>E [^_]ÍP))Ƌ}w‹}΃s_u$u}D$E$=벤fvtfEfH @D$$=1|뀍1D$ `)D$D$C-$`UD$ `)D$D$B-$`D$E$=1fkPLUWVS 蓪øsdD$t}D$`J.<$UEtE D$ED$<$PD$$  [^_]UWVSBu D$4$<FFy ;F|/} t)P}D$4$<[^_]Ét$E$UVS襩ʵutDD$4$;D$D$4$Hff D$4$;[^]Í1D$ h)D$D$6-$_USAED$ E D$D$E$$>[]ffffffffffffffffUWS¨Džt)tYBfBfB B [_]ÉUw7D$ )D$D$M-$7^UuU<7D$ )D$D$N-$^UrUWVS;lj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]ÍD$ *D$D$`-$-]UD$ *D$D$a-$\E+D$ *D$D$b-$\UWVS\ÉEEE @&QE1fjDž9E]qA D$.$%zR.8tGt3\_u<.uuy.u}fD$:$%tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $3O@)9x‰ ȉ@ M<_/1U+\[^_]À:>E4$'NL$D$t$LD$D$ D$LD$$襍A,Dž9E0^D$ $*D$D$B-$~XD$ D$D$$DTIf ugx.fcD$:$u!?fnUWVSl衡ƭZ‹BcB $(DžmDžDž D$$ DžtUpЉD$D$$<+Gt< tu򋽜$H@)49O)9y )ЉA V1ҍ;tftH<@ lj)9t?9rr ΃rj놉D004$I@9U$#@ EZDžl[^_]à f.&< t< t򉍼3D$4$j P8 t$$ K19<)׃ D$$T848#Iu‹tft‰)‰DžNtftR :)9&44$G@9‹f&B0tP< t[< tW< <9s>z2D$4$tpu׋)ʉ׃ (D$ $8f cFt$$]H'9Dž1Ct$$Hz90CxD$ )D$D$^-$PwP$f0x0k$UGtxf\>0N7L1UWVS`蠙ťE‰Eu@&QE1FE"D$ .u‰t$L$E$')},EE4$CML$ML$D$ t$ED$"$&v‹Et]$E@ U+`[^_]ÉM"$ouM<ʍE`MUƋE$u눍ԈD$ )D$D$-$N$UWVS(&KuE>FE苳"}tgUE<$BML$ML$D$ |$UT$4$t‹Et)$ E@ ([^_]Í뗋MUƋE$ t([^_]Í"$tt:"EԈD$ )D$D$ -$LqUWVSh։} }}U@&QE1} o?$(% 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$<))9yrtft1'$X1U+ h[^_]9Az 7t$$l*D$t$ D$D$$BK@ 9N04$:=3׉T9E>f t$$c9P }u,04$:tp9J90Љtftפ9P'$:NjE$:$;|$t$D$ D$D'D$$%h 6<$8=9D$ )D$D$-$C.D$ )D$D$-$qCD$D$ D$D$$&Hg@ 399x04$7=1Ɖ$}7P)9| At$ D$L*D$$% r<$ 7p)9L$L$<$1X8f&($ЅwDž$F1Ht$ D$D$ D$D$$EDž8@ ?9$5x9D$D$4$V>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $Ulj$ FfDž 1DžD$D$4$eT0։9^f 19s<04$CJ})σ (D$ $<ljUWVS$Chu}6EGBEB $E+BDžD$ED$ED$ D$ED$<$R…F D$FD$FD$ D$|$E$MElEE$<$lBEt $[^_]ËF t:$[^_]øEE$*<$B$[^_]ÍԈD$ )D$D$-$;E$F 뮸xUWVS@蕅Mu@&Q‹E1kFB FBPƋT}ۉ\$D$ D$)D$<$~HNj9s@ xtfof>4$*@ ԈD$ )D$D$-$7`4$$=@ -$=@ t҃$S=2fJz UWVS$<ƋEtvF u>ED$ ED$ED$E $Elj4$<[^_]ËED$ ED$ED$E $EDžt뼍D$ <*D$D$-$6[E1UWVS+H;t@ËED$ ED$ED$E$ًU EƉ$;[^_]ËE1[^_]UWVS0ԋE}u  t:/10[^_]Ã} uyMMUUUUu|$M L$D$LD$dD$ D$ D$E$iuE0[^_]Ã} t=:a8t{bPWPtD@ 7 E #T$ )T$D$-$94Ex{UWVSX7~\}E EЋEEEE@&QE‹E1$(1 E؍EEȉMԉ}܉<$D$D$ D$D$E܉$qDž E؉D$<$XƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$zPu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$&@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$%@9Er7‹}ԃrsSt}MԉM܋E$E܉$D6E1uU+X[^_]ÃỦϋU)׃E (D$$yt 8E܋UEȉD$|$$76P@ EĉỦ $R6ŰEMEЋPEEE$)E܉$Eaf{E̋EM8Mԉ $EE4ufiK1E܉EUSy9S7D$D$@l"D$l"D$ ED$E D$E$[]USx6D$D$ @l"D$l"D$E${[]UWVS|xǙ6'4tDÉt$ D$@l"D$l"$ًU EDƉ$04[^_]1[^_]UVSwL"tpǃl"ǃp"ǃt"ǃx"ǃ|"5D$D$ @l"D$l"D$L"$?Ɖ[^]ÍL"$覠L"t5ΐUWVS0AwfƅAqR.8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]NȃE@ fu+-dt ufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$E@0E@}Gfg D$<$1İ[^_]6Q}Wf9xD$$3‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09FE E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$.E 1[^_]ÃuEt$E ԅtEuT$U$|EM U_D$ +D$D$`.$M2D$ +D$D$^.$U D$ +D$D$_.$+D$j$$UWVSMZ}u t'tQD$ t$t$<$ [^_]Í2D$ +D$D$.$XuD$ +D$D$.$*UWVSCMhY}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃DD$ +D$D$.$XUpU썃*D$ +D$D$.$#UE1U썃8D$ +D$D$.$UU썃2D$ +D$D$.$UUWVSKWuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$VE 1[^_]Åt<$E냉<$*E ωЃttkE녍D$ |+D$D$.$2D$ |+D$D$.$dUD$$4NjE 8Ut Eo|+D$j$B! UWVS0JUVu} t tJD$(#|$4$4[^_]Í2D$ l+D$D$?.$uD$ l+D$D$@.$UWVSIýUu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍUD$ \+D$D$X.$B2D$ \+D$D$W.$k UWVSHæTu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍTD$ L+D$D$|.$B2D$ L+D$D${.$T UWVSjGÏSu} tt@} u[^_]2D$ @+D$D$.$uUD$ @+D$D$.$UWVSFSu} tt@} u[^_]'2D$ 0+D$D$.$cuTD$ 0+D$D$.$5UWVSNFsRu} tt@} u[^_]2D$ +D$D$.$uUD$ +D$D$.$UWVSEQu} tt@} u[^_] 2D$ +D$D$.$GuTD$ +D$D$.$ffffffffUVS"EGQuED$t$ ED$E D$E$~>.t[^][^]USDPED$ED$ ED$E D$E$[]UWVSDóP}E D$E$t u)x[^_]9u/D$ x,D$D$ /$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]USEBjNE D$E$[]USB@NE D$E$[]USANE$r[]USAME$@[]AM1QUA½ME MO]UEf]UE]UEfU f]UEȋU ]UWVS,-AVMEE EEE8EXU E荀-E܉]}} 9U E9r.ƒ@]9@[}AE)EGE؅uE]荃aD$ED$4$b…xvE9soE؃<E荀{Eu։ƋE9sAUUD$ ED$E)D$]3$]y])(,[^_]uuG뒍V>[U|$M $U:M)ȍ<FtOD$ $t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\]( [^_]ø!!"UWVS(;6dBEEEE܋E9ErME 9EsEEH0}}]EEƒ@ht(]#(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]nD$ ,D$D$D/$EKuV]ڋ]9 }9;] }|>}uE~΃s3uu Ut&8U/ft+MAEuPu\tED$D$<$tE+uЁ$[^_]ú[UWVS$-9E MU@&QE1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]ÉZUS]E M9r 9s9su[][]UWVS,8EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS,8uE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É()[^_]UWVSx+7EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]#[^_]Ë](1[^_]UWVS *ö6u}E9E |2&6D$D$$UumtF;Gt1 [^_]ø [^_]UWVS.*K6U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]É(?UWVS)ǜ5EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]Éj(F[^_]øUS(5E D$E$[]UVS(4uD$D$$tD$T$ tV[^]øffffffffffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS( (&4}EU܉΅lt F"}uFEUT$$]uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVS !0-}D$<$ |$ ED$E D$E$ND$<$[^_]US ,D$"$賉[]UVS| á,Ou"[^]Í"D$l$"$1ƅu$ƅtD$"$FFF US ,)U T$UT$$ []UWVS+D$t}D$`J.<$mE t8ED$E D$<$h|$ D$D$$̟E$辜D$vD$$[^_]ÐUS(+E D$E$~[]US*E D$E$j~[]UWVS*E։ϋUt%T$ML$$Hw[^_]ÉD$4$+ƅtU1UWVS9^*u} GD$F$uD$$}[^_]UWVS*,l$xD$4$]EE9""Elh$qCD$4$͋L4Qd""Džt`t\Os1Wp΋ t $(pP9uዽp$ Gt$tt ;"r`t4$˒ǃ"ǃ"""t\1tt:$菒Ft)NtF D$F$ыF9t$W;"rtt$?ǃ"ǃ"Id$軤"uAEU""h$躄l$܂Ĥ[^_]ËWT$ D$ D$"$ҒUWVS,xÝ'@&QU1DžDžDžDžDž$It3D$D$ D$D$<$=~h$"""T$ D$"T$$ב1U+;,[^_]D$<$yzT$$bT$T$$Љt6t,$L$ D$T$$-;t$Dž$Dž$譏t5tD$$ҋ;t$f3GUWVS(5Z%u} tmNV$VFED$D$ "D$"D$E$oz1ti([^_]ÍŠD$ -D$D$~/$eiw7D$ -D$D$/$3:델UWVS 8]$}SG<kL$ D$D$Ѡ$NGEE썃_eE荃hE+E$EE;GE4G0D$E$ՁGD0t‹E$軁GD0tQt$螁GD0x$聁GD0c$dP$QGD0$ ] [^_]ÍiŠD$ -D$D$/$~UWVSü"U1"u;"v"<D$E$uu΋Ot5GEt1 t $=O9uu $*GD$ ED$<$n1[^_]$ ""Et7"ύŠD$ -D$D$/$l UWVSl{à!U EIEjOEV"P"lE$~EEčD$D$ "D$"D$Eĉ$v"HM@EEEEEU<ЋM E u D$<$tuNVZED$L$E$ҋUBuM}#TuEMU9sE$|E "ul[^_]~EH4$z"U .9PuMEA""E4$za}ED$D$ "D$"D$E$utMPtFMMЋMMԋUT$D$ P T$@D$EЉ$ttH P1EUM9EdFE)ED$ ED$ED$<$yƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F1Xe]؉E܋؉"}<$}؍@#1ƅP#F(EUjUWVS\$pƉ׉L$x<fPHЅu1e[^_].&t>u)Ӄst$tց|$twō$2D$ltCD$hL$xA!TT$dDD$`L$xdP1҉\$\t$Xpt$x RpdPhPt$xlP 9ɋ\$\t$XDI`PHL$X@D$TfGD$l<IPHЅu.&>u)щL$\T$l6u*t -~0 w)KL$tD$dD$`GG$؉dFLJhFLJlFLJpFD$hG dNډD$xat |$xf|$xt|$xD$XD$TD$dD$`D$XD$TD$l*t -~0 wT$l)щL$\L$\L$0Z$-$D$p$L$(d8, $L$>8G$D$؉dFLJhF$D$؉lFCpFƇqFfLJrFD$xD$|D$p/\$PӃ؃D$HukQ9(D$xT$|{D$@T$DT$@D$D9T$dT$`[T$@T$xD$|؃D$HtD$xT$|D$HT$LT$HD$L9T$dT$`T$HT$xD$|4*D$x|$x|$xx,t@;t;$`,;C.t&$$i)\= ף)D$HD$xT$|D$@T$DT$@D$D9T$dT$`\$\$PL$@L$xD$|1҉T$HD$p/D$PL$\$8t$4|$,ri)\P(\wf= ףt$P)D$xT$|p:σ|$@p/|$d9֋|$`}D$x\$|L$@t3빉L$\$8t$4|$,`D$,L$,9L$hD$D$PL$p/L$\$4$Ɖ|$pi)\P(\= ף\$)D$4\$@9)؋L$49ȉ؋\$PT$HЙD$xT$|D$8T$<D$ T$8T$ T$CD$PD$HșD$xT$|D$ D$8T$CD$Pș\$X9ىЋ\$T}D$,D$H\$4ؙD$xT$|D$xT$|D$HD$,9L$T$( D$@L$T$D$43IL$@dD$41H|$xf|$xdNeN|$xT$t\$4$|$pD$PGlFpFdFhFGD$\L$hDG dN\$xƒs`D$xtfD$xtפ T\$\؉׋t$lstftD$\uluSҨu|udL$x눋\$4$|$pD$PGȋL$)=AfG6fAyD$0f l$xdNeN|$t|$xe\$\$PL$HL$xD$|D$H.\$\$PD$H\$\$P \$\$PL$@L$xD$|\$\$PD$H{D$,D$,L1G-UWVS '|$8ljD$T$\L$XE \$\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}7)à u\$hT$P׋T$h)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 L$@\$<;ؙ\$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9T$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 2D$pT$t9D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`PD$D$e|Xu$hF1dN-00tDX|$p|$X40>D$HD$h$t$|$tȃ|$dw|$T:f.&.&.&.&.&.&.&%1 ڃ9t$tuމ|$Ty\$pC\$h!sK\$l\\$T\$l\\$P9D$T1t$hL$h\$lDT\$d߃D$pD$p\$t9D$Ht$D$l>71t$t&:t|$lt$t7>~|$t9yt$@9|ɸOD$0L$@LD$,\$`v84$1D$PD$t$t)ЉT$PD$ $L$t\$`T$P<|$PL$tD$D$|$d9X\$TD$p9nD$lp Ƌ@~#>Ft>8t$|$lG$D$\t$lD$dk XPD$T1$D$P\$hD$X$(D$TT$dT$t ;H Pl$ty1pYD$tT$pFP~L\$t9\\$p}3=H\$t\\$p\\$P ;N>VD$\9W\$hD$lP~7|$ldF$ tft|$lGD$l@11D$h ؃ux\$T9؉ӋL$P>\$pt$t|$lw|$ldFT$|$@/Rd$dD$|D$#D$$D$(|$pD$lt$t0P`t$0D$(t$lƄjF9ut$lkFkF\$,u59uv.&.&9vt$@$0L$(t$ljF9G<v)|$h׉É|$t΃sstft|$tt$PD$x D$p‹|$d9\$8t$D$t\$`dN$8u0uqT$f X1D$t*T$tRlPu6uc\$hD$l@%f$ $ 1i1҉T$pfE|$ldNeND$8UWVSlÑ]ƉMӀ:M‰9Džt;:tgEua1ɉ2tRN 1MU |9}D$>dN$]I=uҿT[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]M1eDžuAM荆dNdNt_9t:*~+uـZ @ҍt&Ƀav뿅f1uUVS@#d0u[^]1ɉ򍃓[^]諱ԽOUS萱õOt$Z[]øUSW|}u[]Í$![]UWVSHEuM V~FhFhF1.&.&P9u dN9ut [^_]Ë]l1[^_]UWVS諰ȼUM Z~>dFdF&.&P9u09ut[^_]Ék[^_]UVS,Q}u 1[^]Í4$4$[^]UWVS(EEM E?#mEE1u,h0ǃ"1}tME"}tl0ǃ"Gp7>Cu"U1)Љ?#([^_]Í{E؍?#E܉΋E؉$ZNjE#D$<$ EE?#~|$E܉$[tm}tM썳4$ 4$MN([^_]ËWrHy}D$L0D$<$HOGYUWVS(Me=t:F$V FtD$$]4$uƃ[^_]UWVS}ƃ#$b tCƉxtD$<$\E FEF e1[^_]ÃUWVSKpuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍ݀D$ |0D$D$H/$rS멍D$ |0D$D$F/$FS3݀D$ |0D$D$H/$SD$ |0L$MD$G/$ERUҋEM݀T$ L$D$H$RffffUWVSƉUM̓#<$EtC$G pupMH ##<$w1[^_]Í #1#.&.&#txu8u돍D$ 0D$D$0$Q7<$uUVSÛEU Mt [^]MUE͡t$ 0t$D$04$IQMUE[^]UWVS`u̓#E$Q##1 #E0E}M#D#{ uZMUCЋMU#9u`#tgߋt}Ct9K ttFߋteC9K ut2#MUCS$ЋUM#9tV#uE9rRE9sKu}샮#E$C#ut?$)u[^_]ËE]1#tߋtCU11ҋE]ffffffUWVS讙ӥUE0}E,@&QE1M zhEED$E$#D$h8$hǀPǀTǀX71DžD8H@L,D$ |$0D$8$"8U+d[^_]ÅE ((hEED$E$&D$h8$hǀPǀTǀXE (ɐD$ 0D$D$Q40$MW(١D$ 0D$D$P40$nM((ɐD$ 0D$D$Q40$3M(RT'U(QUT$UT$ Q.D$E D$E$>]UUT$UT$ Q.D$E D$E$]UED$ED$ ED$E D$E$]UWVS|áD$`J.FX$w(F`F`y ;Fp|4} t.FXPVX}D$FX$f([^_]ÍFXD$E$HUSE`J.Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US 蟕ġE D$ED$`J.X${ []UShÍED$ E D$ED$`J.X${[]UWVS(MM} }E EEEeD$E$&E@ E@U~5M19E}EtfEtME)‰UE$UE@몋U tE eMOTEfH @1[^_]ËUulj7wWU<$\UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $%E[^_]ÍUD$ 0D$D$QX0$(Il1D$ 0D$D$=X0$HE)1u E MOuo Ux0D$ 0D$D$X0$pHE@UUD$E$$EU)1u .fBefm7MyHMUS *ED$E D$E$w []USԑED$ ED$E D$E$x[]UWVS蚑ÿEED$E $ƅ0zDžt}D$ED$E$xY=?fGfw  G$ G, G( G Eu/[^_]É$gCLfG 1[^_]D$ D$D$<$)[^_]ÍD$ 0D$D$>0$\FUWVSr×}t6D$<$o"G ƃD$<$|"[^_]Í1D$ 0D$D$;0$EUS E9ErD$E D$E$ []蠽ffffUWVS豏֛u F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9u0D$ 0D$D$W0$D+V9Vs4$u^4$qg1D$ 0D$D$<0$ODI fffffffffffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS 臌ìUM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$F0`UWVSLInljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw 0t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$80X21ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$L$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$!L$D$$9$L$D$$9$tL$D$$9$WL$D$$9$:UUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$HL$D$$98$+L$D$$9$L$D$$9$~L$D$$9$aL$D$$9$DL$D$$9$'UWVSHu$M$} |$8}|$<]\$@@&QD$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$D$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$2⋼$<$$ "SG f A$fx/D$<M$$DŽ$DŽ$D$$$$D$$8$$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$,4 󥋔$\$l{$ [L$8L$ D$T$$4$$FD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$@$4$$RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pd$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$1$$|$D$$4$$H2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$:$$D$l@$3$"$T$p$$$nÉD$d4T$p$$D,4 t$8t$$DD$ $D$$D$$<t$d$$h$$$ $$$4$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$4/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$,$5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$,$4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$#y$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$4DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$,4 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$PvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $ɐD$ 4D$D$$1$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$a$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVS;$}ED$E D$EE$$S4E܋\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$ܠD$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$+$B@Ɖe[^_]ËED$E D$"$@Ɖe[^_]ËED$E D$W$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS,>c!}m|$D$%U <$Y!5m܋|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$+$d=Ɖe[^_]ËED$E$D$"$2=Ɖe[^_]ËED$E$D$W$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`cÈE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$X¿5፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$,5$U:ue[^_]ø랸뗸1fffffUWVSp^Ã9v==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$Pأ܋$܃,݃4T$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$`(\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$`(D$D$PD$ D$`|$Nj} t$@ ;؋\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$+$6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0ك(ڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$`(D$X (.&t u)D$@L$$~YD$`D$؋TT$HL$H؃\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$tNjUruu[^_]ä[^_]ftD$ 6D$D$:(2$臆fffffff̀ffff̀rS[ä? [UScÈD$D$ED$ ED$E D$E$/[]UVS?MtLCUE)Љ)ƍ)ED$E$R01[^]UVS$utTEE E ED$D$ED$ t$D$E$J؃$[^]ÍD$ 6D$D$;L2$fffffffUWVS&UBJt+v.&.&.&@9stЃ[^_]ËJ;J}ABDЃ[^_]ËBU$DtËUJ<}x r s$EtfEtE$EEHuuMJ H x r mfmUWVS0 ։T$$L$ T$(T$ T$,T$$aQNjD$()ЉD$(D$,~^5t6}}K u tO΃rT$E 1<$De[^_]ËM tL$,D$D$D$$@9~J)Ήt$D$,9}QGuP1L$ |$T$E$?E 0vD$$@9t$L$$IuL$at$aE .T$$#DƋD$D$<$AET$$RD$,t$JT$D$<$m?D$D$(D$<$@T$T$<$NjT$уL$T$GD$EL$9ȋT$t$u GD$T$D$<$`@D$,HL$,D$ T$oD$$p )9ƋT$ D$(/T$D$<$>D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVSFku} G9F}uuFV|9s]B9EE)ׄtdD$D$$UhREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVSSx$}<$>D$t$rD$dDŽ$ݜ$DŽ$E$E}É$-wʋ$6牜$}D$p0E@D$0D$h/$D$xDŽ$15$DPЉ$K$C‰ǃ/ ˃9?~ыL$xDPЉD$xU tE u0e[^_]ÃL$t8et ED$PD$TL$hA$Et$LD$t1|$F$ߍN L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$D$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$(1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$*=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈(T$@$L݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـ(D$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈LD$@ؠ(TD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$ب\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$$yD$$4$$$bD$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$(݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$(݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`7D$h$$$ $$D$x$$G)‹$(݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$(fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(}E܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<}E`&QEx0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVSAfuEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS09^}u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS0YEM]E TsCD9sf9r)؃L9s&)D$D$ $]][^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVSIj0)ˉf.&.&.&l#u썊/a)ˉ.&.&l#u썊A)ˉ.&.&l#u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVS0UUBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS O} w.#U4tfMt@@P.$0E $ ƅEFEFuFF [^_]øMEPDUу#‰)U= wD|@P.$t@P.$xUWVS裈Ȕut"F w"Ou&# 4[^_]É4$[^_]@P.$UeN?#4tU$C[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8fË} EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $MnMUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVS臃ìu l#@P.Eut?t|$E$EE$`EtsEuOEu?|$<$r‰EtUE$Uu@P.$u먋E[^_]D$7D$E$ E1[^_]OEuO$rDžt@q@l#E@P.$@P.$l#u딋En@P.$1Xǃl#Eu1>UWVS$蔁ùu EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVS {1utD$E $zDžD$D$4$ptt ʃ9t*xD$4$ t|E%=ct`fx ttpu ffx fp@“ P$— P, P( P Ĕ[^_]K51Ĕ[^_]ÍD$ 49D$D$Ep2$/514O1USyòE UD$T$ D$E$[]UWVSRywutFD$4$O nx$P8D$4$X [^_]É4$Tڍ1D$ L9D$D$=2$.UVSxut&nxP[^]É4$[^]Í1D$ <9D$D$I2$@.ffffUWVSQxvu2$'- ffffffUWVS1wVuf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $F0F0$F0ǀǀD$4$FFF [^_]ÿF yF$Ki4$Lǐ81D$ `9D$D$82$+81 fffff̀rS[? [UVSuǁut8F0u ǀ4$uAnP[^]Í1D$ h9D$D$;2$ +뜸fffffUVSu7ut#1V ҃ t[^]É4$[^]Í1D$ p9D$D$;3$*UWVSt̀u! PFF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $F0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$UW8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$EW8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS kwEU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVS9k^wƋ4D$D$4$-EtE$Gu͋$tMtf~ 18t$9⋎t $4$uu&E[^_]%U9%8}%]EUWVS j=v]tCƉ$[^_]þUWVSiuljUD$@$y:ƋUu 1[^_]ËOD$M$:…1]~˃Mt|tatOt=t+tt9EGX<^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ C$ ;F@tNO$W4$%81[^_]ËxP.NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$pXPx H XPp[^_]Ë8f8F8FF F FFFF4xP. ~D1 󫍾$F~ 818t181D$4${dž0M8?8UWVS$UauF(x~(V0!UN9F9MUD$N $@MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$EEtlE܋UT$ML$E$袭ME)UЉL$D$$AM $EUVU(_US]ED$U $ #C,9C(}#C0[]fUVS BTg`EpFtD$D$$F u  [^]IUWVSS_EPwhHtwSuNP L~8xpXpTPtYtQ1[^_]1DžLDžPX2DžTHDD$$$ƅtǀHXdž$$[ljFHDt dž w:?GhGG C8G VG MG >GE UtAtCf\ Ft$t$S4$ XxD$ ED$E D$E$XE EUuM, Pdždž QXTtt!ЋTDTT9QX1XA1L=f+fdžXD$ L$D$$T PD$D$$fxuu fxD$D$$E t @E@t E DžLxpX]2pTPO AfXmxD$O$s XD$`D$$@` =b1уX`abcddefghhijkllmnoppqrsttuvw `b1d}h=f]t_LX Љ lp&D$$ 88D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$O,t$ ;T$€9T$$X +ǎXFTST$ 9T$D$*`3${TfUWVS$~KãWEpFtD$D$$FUED$E D$4$kDžEtuD$D$ED$D$ D$|$4$踜‹!@u FЃ$[^_]ÉUD$D$$LUЃ$[^_]D$D$$'Ѓ$[^_]fffffffffffffffUWVSAJfVuE U VfFFVVfFFVV f F F V V fFFfFFfFF=6F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\Nt&.&"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍlD$ 9D$D$b3$F lUWVSGTuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\Nf.&ɉHɉH@tH ɉH H ɉH "B9uȋF mlD$ 9D$D$b3$F ƒl'UWVS(EQEpFtD$D$$%FE  D$D$$kEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$f$u ([^_]1([^_]UWVSDìP}wFtD$D$$FD$<$tr$tcFt$@t$.t$E4$ <$E$M[^_]øUS COE9ErD$E D$E$* []fqUEtu]11ɍT9r]1]fffUVSaCzOUE X91rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4qBÖNEE@Et } 9x 1}EEEEE*EP}GA у@3=0fuftpfuE@E܃!‹EH}<}0}}Gu kUzu@G GGBPWxG8GBW}O ME9kOft DAfEtD$D$ E܉D$L$4$TV1ۉ]E@Ex#} EHU ꋀEEƒUƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$蓱E0E@ D$$rMAt MM} y AUtiUJAUQ}Q D$ML$D$ M L$D$<$@E4[^_]Ë}GMWW:D$UT$D$ M L$D$E$ڢ!E ]}؉0fuft tpfuu^/Ex }OE@D$ 9D$D$3$D$щT$ |$D$E$lE@E܉dU܍D$ 9D$D$3$U/B $轳fUSEP M TH}[]UWVSQ=vIuE9G Ut OuhM Gt"V T$D$$vG$GB<$9}thG tkMtOtD$L$ D$GD$4$7n"?9}tG tUE?9}u1[^_]1G!,USUE @@ @HKYXBP[]fffUWVS ;H}ED$E @D$E$+t7ƅt|$$t [^_]84$8UWVSDf;ËGuE @&Q‹E1k*mt$D$ D$D$<$ =5DžDžDžDžD$D$$<$*ƃtI<$)D$D$4$脛tntD$4$tSD$D$$膙E+uqD[^_]Í$L8D$D$$+4$C8?gUWVS,9E]ƉUM܋ED$T$4$YNjE  &ЉUUD$L$$]̷EGfEf}UBM (9tD$T$$]肷UBD$D$$]cXMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉MEl\$ :\$D$b3$E؋M7UE:98uDE܉ufp뛋PUD$D$$];UuT,[^_]ÉUD$D$$] UE܉ufp5UE:98to!D$T$$ZtfGUE]lL$ :L$D$b3 $UED$T$$]bsUWVS<6B}EpFtD$D$$#F w8t<Jut(F( 9GvЃ<[^_]F(ǀF,}Qf3G !DGDE䋆fHD$|$$DD$ED$$軱DžUPulED$ :E܉D$D$b3E؉$GG 9=7EED$ M܉L$D$bU؉$WUMԋEDGDE䋆}MԋED$ M܉L$D$bU؉$uMtUMVE$Mƒ7MɋMEVUfVD$D$$ϲD$FD$$F[FV(VfxD$D$$ZD$|$$̯hP OfMEMfMMF,PfG fGTU䋆f@D$|$$覱UD$T$$Dž@=zlD$ :D$D$b3$TEfEEM8FtM$蠨F FMF(~UfVF(D$D$ED$D$ E D$L$4$‹E!@uxFЃ<[^_]ËE @ME$MU *‹MEfEE'D$|$$ApUD$D$$UOV(UVfeEfEN,MKOD$D$$ίD$GD$$EWfPM9uD$D$$}7}fEfEM/}fMfMMV(NfMHUUf9UǀxD$D$$D$|$$WfEV(ENfMfMMgJfMuljȉEMED$ E܉D$D$bE؉$EME܍lL$ :L$D$b3 $WEEMfMN,MaOD$D$$D$GD$$WHwf9M9uE܉UlL$ :L$D$b3 $E܋U뫃fU@ ) G OfPDWTUD$|$$D$UT$$iDž@=vU䍃lD$ :D$D$b3$UMT9fQTP|D$D$$OD$|$$ɩ1҅c8@ tfUEfUME䍓lT$ :T$D$b3$&EfUUVS/-T9uFt$3F FF(U VUfVF([^]ffffUWVSh,8E EċEE@&QEEEpFtD$D$$$F &}Et&}U+uh[^_]ËEċ@}O9E}9|$EĉD$4$tEEEEȉEEċ@EME@Eă9EЉE0} D$D$$諧DžnFfN @EW)‰UEċ@UB 9EGfVT$UEĉD$4$~fdžF fEE̋UF(h`Eċ@}O9ED$FD$$谦Dž$FfEEED$ |$EĉD$4$1D$|$$ӨGdžD$|$$裨ẺD$EĉD$4$KJ…Ezf}:}% EEEċPMQ GO)MJ9MsBED$T$UT$ML$ EĉD$|$4$> 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MUlD$ :D$D$b3$ZMU.fEEfF fE~EUčlD$ :D$D$b3$U'UMlD$ :D$D$b3$UMSfffffffffffffffUWVS8%1EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋lL$ :L$D$b3 $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸l:3E܉U|$ L$D$bE܉$]UE@(EuU]䍻l|$ :L$MD$b3E܉$rE9EM؋UB=VVU]䍻l|$ :L$D$b3$UUfEED$E D$E$rUEH(EH(]䍻l|$ :L$D$b3$U;U1҉T$t$E$]8UUWVS ï*}u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0*ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃lD$ :D$D$b3$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃lD$ :D$D$b3$UMUWVS@'}EpFtD$D$$JF Tt:t@[^_]F(tڨ1EElE؍:EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b3 $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃lD$ :D$D$b3$7MTD$|$$ו럍lD$ :D$D$b3$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfEl}Ѝ:}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$b3$MMԋUBHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍lD$ :D$D$b3$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[? [UVS÷ut5D$D$ D$ED$4$Ot6E[^]ÍVD$ (:D$D$53$럸fffffffUWVS#UE pu@&QlE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdrl:d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?hVD$ L:D$D$X3$hMX\pD$E  D$\$n8 X9hƋ`l:d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS| ǙEu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS 4$rD$$D$F $3 [^]UWVS ~ ã}$ L$K#1$KD$$D$<$h3t$<$2 [^_]US ,D$$q[]US $q[]US, EEVEEED$D$ED$ ED$D$E$ t}u E,[]ø,[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9t9t,EȋU+u0<[^_]D$$D$$.#ԃ $a(UWVS`EE@&QE1} w6}̉M UEZE9t~9ue $aXM̉MO} EME9tX9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $`'UWVSD@&QEE1uUč}̉yMȉM}ǹU?UȋE9r}9t"9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $/`U&UWVS8"@&Q>}}̉11҉EE9t9t)E+u18[^_]D$$D$$ ׃ $_fx&UWVS1D$ED$$`iFUWVSp EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN .y EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]ЍlL$ ;L$D$b3 $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]ЍlD$ ;D$D$b3$ϗM"M]ЍlD$ ;D$D$b3$藗MTME̋]ЍlT$ ;T$D$b3$\MEMUEEЍl\$ ;\$D$b3$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]ЍlD$ ;D$D$b3$nEMċU6MU]ЍlD$ ;D$D$b3$'MUrM]ЍlD$ ;D$D$b3$MUԋ]ЍD$ ;D$D$q`4$贕UűEԉE}EEZqUqPqUWVS4 }G,EЉlE؍;ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$b3$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oMlD$ ;D$D$b3$M:  GEV@Uȉ]ԉuu}}ЉMً}}̉uƋE ʋE؉E  1É1؋}Љ׉}!]!1Ћ]؉ 1Ӊ 1Ӊ]U}1!]!1ڋ]ڋ]ЃEEU}܋}Љ}9UWuE܉]؉MEEԉEE؉EԉM؋EEE܉EU܋uu]41J 1 ]ȉ׃]< 1u1ȋu؉ 1ʉ1ʉы]!ىu!1ʋMċuH>‰EЉ‹}܉ 1 1MЋ]؋M1!!1؋]؋M‰}̋]]Ѓ@E}x}x}x H}x}xX0[^_]UWVSӉʋp x$?utm@)M|0(9MރEE} H P$MTUp(t$$EEU]?vIzt @}߉ÉU|$$C S$@9u}؋UM\9@?t*Ux(ރBEtfEtP P$[^_]Ã?vōJ΃|3@p(M}UމËFGFGF G FGFGFGFGF G F$G$F(G(F,G,F0G0F4G4F8G8Fu\uBMEt H(x)Z]fmfm sMM Z]IUWVSzß E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀ |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVS } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVS . } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVSOt MDžDž<<L?z DM E5@@x  D$D$D$D$ D$t$$(uVD$D$D$ 0D$T$4$8t0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$.8L0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$$'3DžDžEDžDžDDžDžCDžDžBDžDž>#DžDž DžD$D$D$ 0D$D$$z6t0#DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$?$$2D$D$D$D$ D$t$0$#4D$D$D$D$ D$t$$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$!$"3oiD$D$D$D$ D$t$o$!D$D$D$D$ D$t$W$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$40RPLDžDžDž D$D$D$ 0D$D$$/D$D$ 04$T$1t&=S,vD$`$ `DžDžyD$D$D$D$ D$t$$D$D$D$D$ D$t$$7SfffffffffffffUS観˿ \ []UWVSP芳ï EEEE}|$EԉD$$Ẻ$W1u} }Ƌ0#u%1P#uBfEʍ M MM9MMfJM^MHHu u p Puup$0$@  1Ẻ$RD$|$$yP[^_]j,#D$D$D$D$ D$D$$ ‰0#f@,#fN9fE($@  EU tdM HUPMH  Uup $($녋uMHx$0<$@  \L#uM M P#M310  $$t $(ED$D$EЉD$ ,#D$D$A$*u}u,#tE E E~ vMiMP#DUWVS 華ô <$$t V6u%j$Et+%t V6u<$IE [^_]%t V6uD$<$E [^_]US$ ̡#t$[]EEED$D$ED$ ̡#D$D$E$9)t̡#uãD$ AD$D$A4$$d̡#mfffffffffUWVS!F E }0@DFƅtGFU M U9BFD$F D$ $GEUtRFE VJE}9OT$T T$$EFMAE1[^_]ËM!@]GF MtFuV]SF }WT$|$ MQT$D$E$ u>E]놋ED$ED$ GD$F D$E$LE!@F aD$ $]t̋EUBL$$9t}VWVUVS?d uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS Ȫ E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$]Et͋]E0U=UWVS(Щ E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVS讨Ӵ }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[ ? [̀rS[ ? [US 賧س EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[~ ? [f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVSpÕ tMƋuA~8t:F4@9s3`V8F4@9r$<F8[^_]ÉUWVS! E}}u@&QENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]=F86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$]NjUN8#UV4V0]LMD$ D$`T$ $F4~81.& @rPu B8~8BX;F4rELyF8$]NF8UȉȍB=]I_8 4U]0_UF8$_UF8$]jF8tgD$`||$t|$ D$xD$E$$DžuUN8]^N]^{]UWVS@A EE M@&QNjE1lI%;E" = L9#ƅDƅdFD$$"8BƅC8 D$BD$d<$nv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $lt[U+ @[^_]Á}L@ Džh1Dždd ׉<$ D$`D$D$ t$D$$\f 9?LMD$ D$`|$4$9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$[Ju"dhD$T$<$[jFPp @?.T$GxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E E4D$ 0AD$D$l4$>,D$ 0AD$D$m4$>U誈Ӕ UT$`D$ ED$E D$E$9]ffffffUVS bÇ EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS(& ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$]iӋE111 ufEUD$ T$ED$FD$$];u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVS% Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$IÅt@C؃[^_]ÉډSu1V룋KT UWVS2W u xD$4$HE%=D$($Džtz@@&@9uE ED$D$ EЋUԉ$T$dEČ[^_]@1Č[^_]UEU U U$]UVS9N ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D `J.D$ D$%D$4$;U D$E D$E$]UWVS>c E HMPpt)rP@t6B E$"1[^_]ËxMt P@uʋMAUWVS4ʃ }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$U11MM1 MMEԋU؉D$ T$E܉D$AMD$$=9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVS=b ut PtH J H $0u4$"1[^]UWVS uu2&.&[tCtډu[^_]Ë$[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS  U EtUM"t&.&.&.&t.ZYutD$D$ $ E [^]UWVS eÊ } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS(}~ E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]/E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍ1D$ 8AD$D$G5$.u ]܍ɣD$ 8AD$D$H5$.bf%BBff+E XffE]F3G]33 4UWVSw utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]1D$ DAD$D$Z<5$,[UWVSw- utWD$4$ F u#f~t(1D$4$ [^_]É4$2 E.4$|$Flj4$h[^_]ffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSquÖ u PtfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉F\1맋V0 t~@9t $V0F FV덍1D$ PAD$D$<`5$T*=fffffffUWVSNts u}E FftRxT$$<xU+u 8[^]f̀rS[x ? [UVSlx u tt$D$t,@E$[^]Í]D$ 4BD$D$95$$"UWVS4=lbx D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"'D$ 'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]9&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍2D$ @BD$D$K$ L$(=%D$ @BD$D$M$E"UWVSiv EU uM] $\$M] ǠQ.}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVS.iSu u} 9vtGFfuUT$|$$xFP^T[^_]ff [^_]ÍUD$ pBD$D$C5$s덍D$ pBD$D$A5$G9vVD$ pBD$D$B5$'UWVS*hOt u} 9vF t5Fft\D$ D$D$$!Ѓt<F fF FfuUT$|$$[^_]ø"8F 뱍UD$ dBD$D$V5$%DD$ dBD$D$T5$9v D$ dBD$D$U5$?UVSfr u9vufFftEȋED$ E UD$T$ $QF !ӃtNPVTfF ȃ[^]ù뷀fF ȃ[^]ÍD$ \BD$D$j5$kD$ \BD$D$i5$7UVSer utO9vuFfu$1[^]ÍD$ PBD$D$|5$f붍D$ PBD$D${5$:f6̀rS[tq ? [US3eXq ED$E UD$T$ D$E$[]UWVS@dq t$(D$T$L$,D$,t "|$GD$8UT$$\$( uL$8ǀ-[+nD$,L$8D$0T$4D$T$ $D$\$(ID$D$0T$4D$T$ $D$ܼD$ T$L$8D$$11҉D$8T$<0D$,9tmD$ \$$9D$8|$e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(ϹD$D$0T$4D$T$ $D$bD$ T$t$8L$$}t$80 }1th|$ D$t$E D$L$T$ |8D$D$4$6D$t$$R'iljUED$ D$E D$E$4UWVS8J=V Eu}@&QE1x>'T$ t$D$E D$D$|$ |8D$D$$xu(u~6E+8[^_]:|$D$ D$D$4$D$t$$xtLKH󥋅D$ 6D$D$$x:iǃx$<…x1A<+wlLuىDx9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVSwN#ԡ#t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]US5FZR ;UT$$L[] F5R -f̀ffff7̀rS[R ? [>̀rS[Q ? [USEQ D$> D$ ED$E D$E$[]US`EÅQ ED$ ED$E D$E$[]ff&.&$D$4̀D$̀fffffffT̀rS[Q ? [PS[P [USDP Ou 3Q[]&[]f̀rS[ÔP ? [USSDxP $1[]UVS,DQP ##t [^]É4$buF1f1ø11CP |1øUWVSdU+u8[^_]ø1}XUWVS<|*á6 EM uU@&QU1ҍx Pf9 9px(ҋqf9t1m4~94$:fV$(L$L$ D$t$$t}tmD$D$ |$D$ $]E+u0Ё<[^_]Ëqx(ljVL$qUWVSQ(4 d1y `yA@&QLNjE1D$4$GGN 3% )Gu atZ`J.pXt$ D$D$b$蜨t$ d@D$D$<$GO dx\f9w1~t atbDžL$L$$xr~ut Љt:9x Kf&Dž\4$C5fdžH ~TF1fDŽVDŽxt!89xyxyx y N 9f@%@=@v G.Dž@<DžlDžH`J.XXw GhDžthDx}tЉ@<x< DžP$t ЉoGd@p|h@\Rt4F<<8 Džt GbD$ pt$|D$$S9w0G 0<$2tth9G eHH9G1$2\ul&<Dž*dL$L$`L$ L$L$4$Ѓv <$1fhF<SDžVh@<DžP7H担tt ƍx$bD$ t$t$$NT$T$T$T$T$T$ $`J.XT`D$D$D$D$D$D$ $C)ʍ‹fDž@D$D$$蛁DžD$L$D$ D$D$$Ԁƅ <P|f9Aua tXX|$ D$D$K$|$ 9D$D$$Džlx$"ua t`J.PXT$ D$D$[$eT$ 9e^8v0GJ$D$ )u&L$$J HmD$ |$|pD$<$aWуua T|$ D$D$o'D$ D$D$$L@5j<$,DžlD$t$D$ pD$|T$$b}p9*D$$.<$U,}LU+~eY[^_]aD$ D$D$D$ t$PD$$( t$ tD$d9D$`J.X$O+. 3.8'0@0$U+ tߋp ~Ƌf6 ׉󥋵NNNN1҉Ћƃt<1ι t 4 t t t t t t BfB9ȅtȹ lj󥋅PPP fG D$D$$hJtG`J.XD$ D$D$$*tDžDžPG`J.BXD$ D$ D$+$蹚Dž\DžlD$t$$H{Gt80Gm$$D$ 1OG<$(Dž@(Džl+$ӖD$ CD$|D$`J.$ WWWWq(0G 04H u6`@t*+ <$!'Dž\Džl#Džl7`Ҁ!$ t5`J.BXD$ 9~D$`D$<$謶G\B:<$&,Dž*t$t$`t$ dNL$L$ $Ѓ f<$%`W`@f`J.BXD$ D$D$$mG`D$7D$`J.BX$蕄)wHuttЉDD@<P<sDžDžpxy<$$D$D$PD@$bE0D$DD$$wD$4$.D$D$4$0pD$|L$4$D$D$$s‹p9DžfDž`)ff҉T$t$$t@0G0<$"@6<$"Dž`$9 Gf\`fx‰)fftg҉T$|$$s̉@0G$$D$ ܬ x|`6f90cGu a &`J.pXt$ D$D$$ht$ 9~ȉD$`D$<$^`J.PXT$ D$D$$T$ 9~D$`D$<$$貏D$ D$|D$`J.$:ff &$` \8=$D$ D$|D$`J.$Q`Hf+f)fffv҉T$t$$*q7D$$ ;<$bWQDžT$t$$xDlu<$7z`J.XD$ D$D$$脐Dž`J.XT$ D$"D$9$9T$ 9~ȉD$`D$<$),Dž@<@8`J.XD$ D$D$$蹏tiDžU@H;0G$YD$ G<$UDž@(s@t$D4$<$ 2+t .0Ge$褋D$ q;<$舋D$ D$|D$`J.${ D$ɬD$`J.BX${80@<$D$ qvfffff̀rS[t ? [UEU UP]UEU MHUP]UWVMu}u }E E=ɚ;~ -ʚ;1yA^_]UVSUEu M ]+M]9|) ZB[^])ʚ; ZB[^]UEU +EU uE9Ex]ø]Åx]UVS B g uED$$uEEFEF [^]D$E$Tx(E EUVN [^]FF [^]UVS  uED$$PuEEFEF [^]D$E$x(E EUVN [^]FF [^]USMEE UQY[]UVSMuMb)E UQY[^]ffffffffffUWVSH~ ã }E E@&Q‹E­ 'Gbt&ED$ ED$D$$>tD$$D$ D$D$D$ED$ED$ D$D$<$x ƅ u G$@ED$D$ t$L$<$jƅ,Gƒ @1u`$|ED$D$ D$t$<$ƋG~U=2D$D$D$D$D$ T$t$<$ƅGD$<$E+NH[^_]ÅD$<$|ȋPu@fffuGtwp fHfHff$t$ɉL$ T$D$9$qPtIthtRD$<$ܭ$z$zD$<$yD$<$gD$<$U4UWVS, }U ME@&QE1GED$ED$ L$T$9$pL$T$ D$D$$Co=E D$D$ED$ ED$T$<$qU+,[^_]Åx$腰=wttH|.uT$L$ D$D$$nUD$T$9$oqD$<$9$3UWVS(#H E E@&Q‹EE@ pc$MCT$$s-ER.D$ D$D$4$KV ,t&.&.&.&DA@tD$4$6j.t&DJ@utSFNu tDJ@tEpt$|$<$调7$N$<1U+u ([^_]L1UWVSPWp u} E@&QËE1fD$4$^1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#^8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$HED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$AFDFD`DžDžD$4$虼,fffffUWVSl6 u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$TxƉt$E$踻EEFD$ $蠻U(fBMЉU(E,) X}|$}|$ D$t$E$з,Ɖt$$ 0FD$E$FD$$FD$$ U(fB )Ѕ9E$T$ NT$D$,:$El[^_]ËE$EE$EML$D$ ED$K.D$:$fU(E H E, 9(B B U(D$E$$U(BD$E$U(BD$$ U(BD$E $E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS  U }E@4E)Ѓ FD$$)FD$E=s$VfFE@ uG1T$$ǸF D$$贸 G fffG )~ [^_]èu2밸9u1 [^_]Í>$kmU *UL$RmU븸UWVSó M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$GD$u4$请W׋u$ssuXuQ}׉+u9~ED$4$V+E~[^_]äft9}u1[^_]urpUi$lUM 9}tT:D$ ND$D$=,:$SgMAyEtflffffffffffffUWVS( ljUM܋EGkE8u䍃}EE썃E.t&< t< tD$ED$4$;D$ED$4$D$ ED$4$)D$ƮD$4$ۢG~î$tj< t< vtu([^_]À>6F$†~d ʈdGtD$$`띍F$y~GtD$$}`iD$ ̮D$4$tD$ ,D$4$ܡuEO!F $~GGD$$_D$D$4$ytjD$ٮD$4$[uXO@E܉D$ED$:$_O]L$T$t:$t_zO TD$D$4$t*D$ D$4$Ǡug OD$D$4$葠u O@D$=6D$4$gu OD$D$4$=uZU D$4$ƒ?v?T$U؉t$E$tEUƄ4D$D$4$şuZE  D$4$聾ƒ?v?T$U؉t$E($sEUƄ(D$ D$4$M D$ D$4$(u OmD$*D$4$Kg?UVST $@yt."|xEEE%EEEEND$D$D$ D$ED$t$.StT[^]UVSCh Et4D$E$~EEFEFh!fF [^]Í#UWVSx @&QEEtbUD$E$Ef3EfF}<$ZD$t$<$=[|$4$P]FUM+ ux[^_]Í#IUWVSKp }x$RLJft/1t$pRDŽ9Ӄ[^_]UWVS u4$`t&tuOxu:<$fdžt$fdžf[^_]É$Q뼋|E9Eut$QU6W Et]Í[]U - Et(]Í]UWVSu] }4$sfdž1҅~!1u.&{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVS$I uD@&Q E1D$4$PF u uD@@$v\D4$U4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$_6 WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$$) w`D$D$4$jmƇ_WHwDG` \Dž01< t/t 201Ƀt&9c< [< uuDž(CD$$[8 Dž4DžHT,8D$ D$D$H$8>s<;t<#tH8domaH8searH8name%H8sortH8optigxionsZ< t< GcD+<< ~< uvfxinJ< t< I(  t t Dw`D$D$4$"kƇ_3D$4$VtDž0]t DF 4DdLʃ Јd8$XD$D$ $Kx8$&s,D$x$x}t<hlp###DDx`0DpHH`HD@H@`tg.&<.ǃu~DD$. $hDFH7D$.$hDqPALD@R$߾t0‹DHDH U+X[^_]Áxservfxer< t< 9 < t< t1D$4$P< X1DžX DrDž\DžTD$ 5ӒD$D$ <$ QPD$ ,D$|$4$>%UPB=ADt/RωփtftPBb@D<ЉT$L@$dLt׋$ˆL,D$ $XRL <4,LTDD|$@$5d<mFV9xDw@ut;u㈕$<,t$$Q<$TDLD 44 KD$&D$4$1D$.4$BcD$D`$6DǀtǀxDž0Dž(:$WDxD@DtKD$4$Mu덃@$V< tt< uDž0mL$,D$ $ PLtċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž09@DDumuTFuvuYLxD$D$ 1ɉffL LsUD$E$]UWVSX!F }u h3#l3# t;D$<$t##F#FX[^_]Ë#9puttl|E9EttIND$D$ED$ D$D$t$ABt##F#F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]UWVSd{à .CD$$M@$LDžDžDžDžDžx@ N L$T$ VT$D$$K`T$$>F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$A=ut G74$ @9 W ‹Atft‰)@0Dž'Ztftlj)@#tP4$1@9r5‹zV$d@ $/R`Džd[^_]‹)ʋ;Wf)f f{\D$ OD$D$:$ڐ$c0P@~~ 9V)ȋ 9cVʉ)ȉA1҉=tftH<@ lj)99h΃r낋$b@ $O@ 4$,@9:ƒ{tft‰)‰DžJtftR<lj)944$R@9`‹wShf`f% PD$NuKu2ifM/f릋$5`@ XUVSSx @ЉD>]T>ӉT>WMHL>@CD>#C#dU։‹#xzt#=w ;OEt#=w ;O#tH~k#LJ##yU& !ȉ#UeUt$ ##ULJ#(#$#M싗4#1ɍO]MEUtwM<9ErMtu艷4#(#Ѓ([^_]LJ#5 #LJ#D>ED>ЉD>]]Ӊ\>W,UlV;D> rU=UsD>HL>PD>HL>#HV=Ë(#;,#elRH(#P4#H4##HLJ##V#MULJ<#D>UMD>ЉD>]T>W,U]ف9OlRLJ#롋#@#LJD#LJH#D>ЉD>]T>WoMUS.E@4QE@#$UMD$1ۀ} ËE)؉D$ D$P;D$$KUMLJ#D>ELJ#D>ELJ#D>ELJ#D>EqMUD>@E싟<#]X] É<#%LJ<#lR(#l$#mUUxz# Mt 4#(#;,#r tXlR(#H(#P4#H4##HVЋ]!LJ#$7ffffffffffffffffffffUWVS0} EЋh#L#u䋸p#}9E \u؍lZlXu썰,Yuԍ [u̍ZEE]]Ef[^]FtF$>UVSbƒ Et=@HHAXX@@,|#t #;t[^]ËHt#p#L#X#x#UWVS ƉU84$XUF(|#t #;4tF F$Fׂ8[^_]UWVSmÒ } $05t2Ɖx <$5FtFUD[^_]Í;UVS / |#tT#tGU#|#Bt#Bp#L#X#x#[^]#|#4D$X#$|#t#uUWVSLPy E苰l#gp#Ux#U荺 [}؍ \}lZ}lX,Yu܍ZUuE苈h#uȉE}uuf U]U& UX#]U UT#]и P#U輸 UP#]UWVS誸 |#u"$#uމ4$.LJ|#LJLJ#LJ#LJp#LJl#LJh#LJX#LJT#1[^_]US E$%[]USѷ E D$E$*[]US觷 E$-[]øUS~ã L#D$ED$D$ D$=D$$m5[]UVS*O ut,D$4$'Iff D$4$;I[^]Í1D$ \D$D$5@=$lUVS 踶 EpFtD$D$$'5F!u  [^]qUWVSOt uM5D$ ED$E D$E$+zTl>LDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$aDžH V€ʀ UTLpD$ D$D$T$OM P!ЃLPpp0<$pT$o01[^_]À Voo0<$o  PxD$T$`GP^E E DžTED$D$ D$D$$_Džt HƁ Snn0En01  G G=G G !G G GD$D$L$A/PLPP LЃHtfD$PD$L$\1H  D$ $PP D$m8LlPu  PuD$T$6PD ƒ@ uv h0 ffffUWVS }EpFtD$D$$-0F \  D$4$uc  t$un  T$U4$DžU9B(E lb1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$w.[^_]fffUWVSɯ EpFtD$D$$..FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$X-UЃ[^_]ÉiUWVS$葮ö }9EUEEEE;E MmG$4u݋M…tEL$D$<$7UUD$ ED$}|$4$8uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$$G t㉇UWVS(Kp uE䋆EMM܉;E E苷EHMU$3ƃUtY9Euȋ})lj}苊U|$${U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$87u@EE9E 1([^_]D$ ED$ED$$6l([^_]UWVS$ M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $MG6}9} MUu1$[^_]Åt#UD$MD$<$v4MU눁 $[^_]ÉT$$Mt$[^_]UWVS({ EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVS蝩Ƶ EU EpLB< D ?ZU )ىL$D$$]%f}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]MU ̉EU ]썋L$ \L$D$d= $]EU QEU ]썋L$ \L$D$d= $]EU U E]썋lL$ \L$D$b= $}]U EUWVS荧ò D$T$$tV@D$T$U4$NjUuD$T$$%[^_]D$T$$%UWVS ' }EpFtD$D$$n%Ft:tb [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSD=b }wFtD$D$$$F}  8GuD$4$D$ D$D$$e@ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$;EtD[^_]ËMN$tD$ D$D$$?Љ!ƒtL$D$$+u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$‹E؃9tD$<$ ^D[^_]UWVSΣ u~GtD$D$$="GD$4$C uUEu@t*$,u*4$^tME[^_]Ë$tE͋D$$E EUWVS uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $,U]C1[^_]Ë]C鍆D$D$ ED$T$4$*ul}D$$M UtEdžU|$ $tU#DfffffffffffffUWVS ] EE,E}1EED$ED$$]Gƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃lD$ \D$D$b=$UU].[E}E9}twu})D$D$$]/9utAFD$FD$$]tVTP‹}u뙋u]Z}8 [^_]ËEpE )}fG w [^_]fUWVS$& uƉЉfMy} ~ϋX9U)ω\$D$M$]EfD$$]M1ۉ؃0[^_]Ë}؋C #C$yPE9t׋}؅ }11ffw$C4EU1҉S4UEE܍^\$ \\$D$=$zGE XUEFEt+w@Euus DDoD\ED$ D$} D$$HxDOHDVt9E눃E}P}{ HHhD1 UWVS4跐 E} wf~ˉM Ef8LM fMMEHE@D9EmD$ |$EDFD$E$]MDžpft6f~wuftLÉEffEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]39E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]D$ (]D$D$=$`<Mt !EEfEE:M]D$ ]D$D$T=$;MdUWVS$% Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$SEu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$vB…t EME$EPEwD$ |$UDBD$4$$B tʋ@f8 $dž ?UWVS,[À uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$zUU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍D$ `]D$D$y8>$$8M UaM D$ `]D$D$8>$7M VuM DOƃ=Fu u䍳`]uDG)fET$UUT$7$eU)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$8>$56UED$ E܉D$D$8>$6D$ `]D$D$8>$5̰D$ `]D$D$e8>$5E@ED$ `]D$D$k8>$p5D$ `]D$D$b8>$<5FE!UWVSHq EE @u E1OftsDPND$ t$D$E$]<ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃D$ P]D$D$8>$h3E@ M]f\Q=맃1fM1UWVSM}r U EzMq uf+4GMM9U t$ED$DM$Bu)uD$ U T$MDD$E$>:…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$謤Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS|< Eu} 'D$ D$DJD$4$]c9tDPfzuft,ˍ< f$h+fEH$++D$ D]D$D$f8>$*U܍D$ D]D$D$8>$*UUWVSPt uU@&QẺNjE1;B.EE 9?E0UD$E D$4$U8@fE֋9E <E։EЋBE؉EOGE)E؃9YE=f9Ms(UɋU)ɉL$DWD$DW$UfGGf+EfGMfDOJMȈHJL$T$$d D$|$$1űU+bP[^_]ÉUD$E D$4$tf8@fEփ}Ut]}9E UE։EЉD$|$4$DU1D$|$$k\fEvEЉD$EĉD$EȉD$T$ D$|$4$χE܉D$T$U؉4$tEEEE܉EU؋BEEUUM؍lD$ ]D$D$b=$'UMUWVS(q~ }EpFtD$D$$VFG!9t~rd96D$D$ $HG)‰T$T$$E䋆E} v&,([^_]ËUE} wڋMp]E 8t9  u|$4$tH9s`!EEUU,D$ UT$D$4$OH9r!>ED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$UNEZUUT$L$$H#T$ $GE$4]]]ȉD$ D$D$|$$ USnz |wrm]e$YTOJE@fff]2].t&%].&fffUVS(nMz EEEEjuVjJ С#uǃС##Qtj'jjN&jVj js'j'UWVSEE] }3t>u~j/VoZYtp A&t0MPVZYMu}] EEAe[^_]Vh"hU"hK.,~UWVS]u 6_h"VSH tfu ODT.ۋ=C.)u~DT.u%h"uBZtDT.DT.""hjP @T. @u5DT.hǔ"j(hXu4'hД"jy(MUW6ZYMtUBk D&u6h"j(VKSWD&PUWVS] 3h]#j(h]#Su0@t h"C.DP證dU.ZudU.$1hU.tU.F&5tU.F&jjPhU. y 5dU.@U.萌@U.辋=0-v`U.u h"j5'$U.u#(U.$U."4U.F&4U.F&T.HthRP](U. yQ4U.PT.HthP5$U.ң(U. U. y5$U.h$j&U.詋U.׊T.u/U.uXU.HDã@U.ujU.D5T.XU.9\U.T.sã@U.táU.U.tDU.U.=pU.u =lU.tD=0U.u =,U.t'T.%h=`u; 0U. U.U.,U.,U.%U.RP5(U.4U.P T.t h̘"jhT.Whj!h$j!1=dT.=hT.=lT.`T.h\80-P0-5T.t'T.T.T.T.;T.T.ss XU.DU. u15XU.5DU.5hU.tU.P$lj uu15PU.5TU.RdU. rPPh$=?ƍY[`U.u9j5\U.5XU.5hU.tU.P ut5dU.h$>XZT.XU.\U.PU.TU.HU.LU.^XU.E\U.E܉}EHU.LU.EUE9Eu:E9u3 PU.TU.EUEUHU.LU.T.T.LT.tM]܋EU EUEU PU.TU.HU.LU.T.T.T.t1HU.LU.U. U.j蝈1=HU.=LU.XsGPU.TU.EU1҅utT.T.EUDU.uRRQ PU.DU.T.yT.=&ua=u膆=u薆T.t=U. U.9ȋ U.U.s")1=U.U.U.U. U.= U.u =U.t j蜇[`U.5U.utL U.1=U.U.U.U. U. U. U.)։U.5U.uu=(U.uj4U.PY@u 8th"5(U.4U.PZ@u hJ#jV!jUWVSX ] 3h]#jDjChܜ"SuB G-$,F&U.1U.U.U.U.1U.U.@U.zU.U.1=U.YU.J15U.U.3U.$U.1ɉ U.U.U.U.U.U.U.=U.th@"= Otu he"j1nuouU.j,PYZFt@jVU.^Zu hu"X8pj,WZYt x>1>Ph"hK.j~U.U.=U.t t7h"Bt U.t+h",t=U.thH"U.C.jWU.ZYu ho"|;R=U.u6=U.u-=U.t$=U.jWW[^11ɉ=U.u >=U.t =Ci ȉ=U.tj@u^Y[t}u U9sUPUxtă}uEE1ۋtP]Z\tSUXzEt'U)RPSSÃ~t C}u"hA"h8%EEZYu h{"K}uEEuhT[.WuuEpEP,u yj=T[.y h"}tLjuVjhS Ty h")XjVjh5T[.Sy h")XhA"oEjuVjpSSjVjw5T[.S,u91ɉM̉MЉMԉM_18M&H>v u  DGu΍EPEPjG =X[.t}t.D1}tE܍jEP48M& GuEy hO#j Vh~f5T[..Vh~fS"USME}u j uXZj۱UE 0>j±UVSEU A5J pFuc1E1ۋ4HO&Vh:#NuU_AJ.HJ.Y^yhJ.j XZJ.PJ. Cu A1e[^]ÍL$qUWVSQpq1FFFF FFFFFFDžDžDž1h4"VW @I&/0$`O&S'$O&1=---r-cFjP5 OD :uy5 Oh"/-F ܕFFFFFF14݄P&4݀P&h" C uD FvFkF= Oj/WY[ÅtC?t t]D@tj/S_ZDžtG;ttD@tqtj/WeZYtA?t(tC@t.t9h"OFPhFhFhFh"5 OAu O<t h"j3 =FFPh FPh$Fh"5 OA~! O<u F$F9sh"뉅 F= Oj/W#Y[t4PW@t_Zu!%=@u O-Y OR uFF6-- OF5 O^-[=~ PPh"j C.)ˋF=Ft F F  F Ft0B=Ft t$hT"4t= Ft=Fuh"=Ft=-uh"覝AKu -n=ܕFDžtDžxjjVjjtS@t,޸YtjjVPjS@t=-=ܕFu4P5-r_Zu%=u ܕFF F F1  Ft1=F-=ܕFuRjhhqFPR)-y'8uhqFh"r>hqFh"--qF-jPR蜪- u5-h# ![^ =ܕFtRPZY@u5-h"E̋UЉ1ۅuthRP5-h"͛M̋]Љȉډ%1 F1<8FF4FFF0FFnh`FhrdAP @uX5-h7"& h`FhedA5-@u-5-hI"^_5-`-[ F1ۉ @FDF=F=PFFHFF-FLF?w=8F4F0F!ȉډ; (F,FFtJthVP譨- @u=5Fh$ 5-臩- --j-~S蝵uFYu ShX"j`F118?t NF1SQ@FDF F8QFt#F8FF4FF0FDžDžjjVjjSdǴuFZu h?"jjjVPjSy5uF1uFX-j/SJH^_ޅtpt#.G` ϋH~v Dž~tYhH#N#~A` 9~ hP#X1;D}%~rY_,~<0~@4~Dh;#Vh(r ~`< @tXShZ#<_Zt Ph%Y^hw#׃@ZtRPh#踃 j ς_DPSh#N~h#aZz$tFjjj< =Fu6=ZuhO#貃jIjtPhO# tj3jj jh"_ ,;FF|=Fu虎5F F9Ȼ@r&} VG9ƉS}M)Mt1jjs saM9ȃM} (uXSu,;C|=Fus譐^{u;t븻N#=Fu!"=FtO#=FtN#hF5FShO#j蒆jNhO#{=FthO#{jB=Ft3hhh#P#hƃ xjh-P#PfVliShEP#jQhFpFheP#{jhF}j谏 hP#Z{[=Fu=FO#O# N#N#EE=Ft EP#E=Ft P#=Ft P#=Ft "=Ft -1$=Ft 1$3$ tFPtPH1ɉ hN#*jEPSh*0ShP#j0ShP#$ jjZgXZj讋UWVS@u} E@h Q#WV  tTHth wT$s&ЁȀπÀ5 Oe-X뫡 O|-1ɉM똋C.)Ht4jVh" tVh"h%j hFnFjV>fXZy Vh$j ]1uȉuԉufE5-]SrSjWeyhQ#^jhyt W y8thQ#95|-hCt W yh'Q#}tjjY[t h2Q#j21҉UUUUčEP0dXUWVS8]u 1E6NXhZ#VS x`At$MFăa$s&FFFЛ-kx#덡 OF!FvFkF`FUFJC.)Ӄ=Ft=Ft背F =Ft =Fuu F F.#=Fu FU1FFh\qXUu hZ#j西=FtEčURWjj111FtjhiO#Pq[Xu5Fh$jO1ɉ FjjhFjVÃt;tMnSyZV貋X"4~MF=K1=F؛-J.e[^_]UWVSE pDFEX1=NG8NGhxMGRhpMGHhhMG>hDtj#=4MGtu#Ph$fLXMG^_L?f=\-t j}[ ÈE8-utrÈE͋4MGu t{8,-u1f=--< t< u=jEP5dMG f=-y]#} uO#Po]tu8-u ÈE5-PgZYf=-tCۡR.t R.fEjEP5dMG" f=-EP`dX6h#jUWVS E 0DPGW1PG4QGhE#@^_t D# QGM#hc#[tTQGMBug O8tpjRPD :uS1ҋ PGbuVQGQG PGh#u u?à uC$ &5 Oh{#QGQG먃 PG륃 PG뜃 PG듺# O낃 PGv Ou)h#hĻ&h0W PGh#SiZYÀ;+h#S^_ƿ&t&VRSZ! u <2t&h %SZYSPh#J PG GPGO3u<=fRhǛ# <=tRh#J_X\3h %SIY^Ɖtt t.iSZS&^h-#HjPSA‹ 3 9r(<,tuxG PGQRh#SV7h7#Ix5 OuhV#h&hKh̚#詬1k$RGt!VP9ZYuRGPGkGhe#Vhh#IjW Oh#h&hq둃 PG'=C.u)PG u'~=PGu,PW8Y@u h#j##PGPGZ!Ãt~&t%Ft!áPG0RhƜ#H  sPG0h#HXZ sPG0h#sH_Xt Sh(#^H[^jҀ uhU#tthy#2HjVE uCQG3hR?ǃ u R3hS#kPhPR] uPGPGt %#1 Y%QGhRPUPG uW5PGh#jrhPGP|ZY@u5PGhН#PGt&hPGP_uaPG05PGh#jRG=QGt:PG8thPGP¡PGYu$݃8u5PGh#j谰=PGuh5#hԻ&h0hjsT4QG u shM#h8QGP薇_Z@u shl#@QG%=tEPGBt,=@t sh#\54QGU4QGY sh#7C0QGPG5PGhԞ#-^PG_Ztpp 0h#^ PGuB@QG%]#=@u#)#u0QGu"#RPh"#] QGt Ph=#]Y[PGPGthPGP Z9#8thPGP_>##Nu@u hV#jhPGP^5#u Rh#(PG%=u5PGS[@u5PGh#@mQ5PG"TY@u 5PGh#4QGtPTZ@u50QGh֟#j薮jRUWVS}u 1ۃ~^;-tC.114<Dž8h+#VWm 1҃i!8-t+:t!;B tBu OBPr5σitot8DuFDž4뉅u  OzSh$h #C bDž<Su#dx1jSVkqCtjjj ǃuh&VhiPNj @u hC#j0WRY-7tvFtjNt^HuT:'ItBQ#Z.0QXɋ0u hR#j莬'돃넃<t$8t]+4t'jPUWVS$u] 34:h]#jfj h̯#SVm Btb$&jj5 O,LVG\VGlVGPVGhVGdVG`VGs\VGdXVGUPVGTVGvBeR0G.f"$l&H $&aVGVGVGGVG1VGVGaVG1VG VG?VG1VG1VG"VGVG1VGVG1=VGVGVGVGVGC.)ӃY1VG=VGt*th#VG VG VGtih#j迢t:Dž|=VGu Dž|=VGt=||)Dž|=VGtDž| Dž|4pVGjVGPٲCx<hSh-;=v ShY#h-輐Y--X/u!-= -vx/uP-@ߣ-1hjKXZ=VGt Ph- Ph-: ZY@u8t%E%=@tkxtHZxM=VGP6 Y_@%=@t&/h-hk#jDžx0Džx=VGu1=VGx/lt$PoZPvЀ8/uj|V}t 1pluv6h$j腠lQh-+ ^Zh-ċCHfuFs aPshS#>6lDžplt~Zu)wfush#5Y[ftf tx)-C,--=~TSh-h#5 o{DsC(huTxtClj/VYZlt)xlhQ#>PYZlhl>h)8/t z/t/Bс-vPh-h#4 VPRlUl- -= -vx/uP-@ߋl=VGxt Ph- Ph- ^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-h#C4CP@% =@B%=@t,M1@ush-h#1Jl΁@w `||t {DPS*ZY+=VG(h-sh)"rK sH VG VGu&fNush;#3Y^jSt迃fuV5VGVVGVGMh[#h&h6kE%=@VߛBfuk=VGu%VGHVGVGy/h#hܾ&h?jR "ZY+hn#;CPph- E^Xsh#(2Y[=VGt'PR)=VGtPR:)PS"{8t hʰ#jǛt{p@1x=VGtVG VG(P6#x:DžxxUWVS|]u >j/WYZtxh6&Wȋ_Zu^h]#VSNy @uiC.)Ãu]p07BZY@u jjje;LtEPtIFu'fHh.#VSx w~)fw$&1fHfHgH1fHfHfHfH1gHfHtfHefHVC.4)Ã=fHtfH-=fHt,fH=1=fH=fHugH1ɉ fHttָ%V1ɋ(P|=fHxt)SWYZuE%=u 褘SWXZt Wh$jJE%=@9t' ÃS=B8UWVSu 6&h]#jWj_ЉÁt1hhs%Vuv tVmtDžhptc5 O)Xu5 Oh#jhWo(tWhR 딡C.E%=@t 蟖"st/$tS@^Z@uStSZYy7h$[^DžlOt?t7?ZY@)lC;UWVSu] 3$h]#jT h#SVt tUit)ft5huTgHσvuCgH1gHgH1=gHgH뗡C.)ƉlNH4jlgHh|j膒 =gHtluˋVIP+l|tP7apY[uË|%=@uh7R蠥à =v7h#j`htx/tlhƄ/C[9t H@>8/tj/WZYtPRd̓Y dv1Wh##+XZDžplt5>W葃ZD@PRh1H p p-9UWVS@] 3"IK.Su]Sj0uEUEUSj荥^_Sjs0ZYuEUEUSji^_SjO0ZYuEUEUSjE_XSj+0Y^uEUEUSj!XZhO#蕭II1=I=I=IIP]1E؍}ȹEĭs uVSjxVSjؑ x"}ujVj近 y}tVSj褑 xjVj葑 y}tVSjv xjVjc y{}tVSjK xjVj8 yP}tEVSj  y1jVj yVSj x]y yۑhW#0j ^=-tUjhָ%6-[^y 蠑hw#0jI #=-u=x-t cj@h#輫Yt8ua"V襀ZÅt @|/tCPCI_uh#jIZYtlj؍PI/hgH迬h j- t! ttBGuBvs@cl9=gHt h#jcsq=-u-rjt IIe[^_]UWVS]u 6h]#jO 1h$VSo tLtPt9C.thf#I_8/u|h#P^ Y^ukh#SM _ZuZPSY^@tHxPhָ%_Z@t2|9u;xuM9 u;EtjjY^uj SGhJ.\XZJ.@t h"jjN4UWVS}] 3h]#jM 1hR#SWm ft]/WPtwR)dI벃vtbit6rtxu{II1Ip1IIZIKI<I-C.9=Izu8Quth\#.$XtI؋Ht ʉA?)jdIYI Iu t1=It =It@jPWjǃ uh|#LC =It.u)WnXCHHf $P&PDs NPshS#j=ItC ƒ?ut6s pNPshS#"Ik=I^KPSCh#ZBjSWpsC 1C %{uR{ uL=It!CHSftbfKPSChO#\Yu=It sH#KPSChO#,ZuR#2Y=Iush$ҦI[Xg8X=IusZuKC1!t2=Itъ8Ê8? 赊8zI I1IsBX|8t hʰ#j5WAk[bxVS!¡IYYu3t>jrLPShS#!I_uEE%=@u"=IuSh# I[^뱃=Iu=uE%=u"S08hO#ډsYup=@uSc=Iu SbZtXt9=IuSh$a<8.8? 8u=IS[AX5I%.1e[^_]UVS@jj^X1EĉEȉEEjEPj, mvE9u B9EEIj j;.Y[IH Ij I$]#j/GZYh#衢V-1ۉ]$hI ^ZItt3Hu:I. <I8I1\IE IIIt.U=-v=8Ii`%=ItEPX1IItA:-HyP.X-H J h-Xo EHmII$<I8IG$EPşXu u[XZu uY[}um=-t,Eh#ۜ^E=Iu PEuE=-u}rEj茛^=-'7=Iuhf#[u&jh #Pj|ÃPJ$连Y|=V-uL=IuCEPО$#Zu EPRX8tEPW$XED#I1ۀ=n-t$=\IuEP衞X\In-u'j4&#^XC̈́RPZY=n-=\I4-D#I5Ih4N#!$-XUWVSpE 0h]#jC1ۉ]C. 1C.] ;E9h$WD9ZYEWt_9Euph$Suc tZftatDeuI렃gu=j5 O)EZYz5 Oh$j^C.E ]Su,\ZYy h$yEPhBt @u[c y h$訟X}Whht@u8c y h$腟XEPht@uc y h$bXt$FvE 8uVEPuWS=SL5^1ɉMME 8URu V:YZURV3YZuURV;^ZuoE 0R.DPt"VWPS5VS5E9jh$Vs uVS5EZYVh#FE E}tSju: y hQ#jg}t Whgtua y h$%Xj'UWVSu 6h]#j/A$I xo$I11ɉhdtlp11ۉ`jh-h$VuGW`Rtf(LtntMH1һ뮃PthtPdtXfuuDžl뇃vudDžds= OhDžpYMDžt@Džh1C.M)tIu uDpt$t*tt h$j蟁 t)ˍ4$I$I>=$Itzj:WDYZt@0j.WYZ`t!h$IW_Z@`u BhD>t0<#u@%C$Ih$IWZY@u ۉ0D8xPW}ZY@u Wh#j=$ItE$IE$IjSV+]ǃ tl`1h#>pu jSWLg WaX CHHf wg$&s APshS#VDžl=s APshS#,ttDžl@ Džl$Iht)KPt9Qu$It;Au A<5$IRslЃ t"`tsh$yY[ds7Z~8t hʰ#jYV#UWVSu GfII(II II ʈII$IIII ʈII IIII%$IfIIIIhE#Q[tCh$=Y&t7GtPS#oYZu CShI $WhZ $j:~1h $Vu\ A6$`&LII3$IZ9ujVjTH hiO#V*LY_uVh$:XZ`IIe׋H󫋅LJLDXtPWDžu V-[ghG$1&hJ.DdJ.HdJ.ZYyh`J.FX`J.P`J.0t- t( dJ.y h`J.E_`J.P`J.΃߃NP薪^ JPTU=IIu II =IIu II Ph`IIbY[JLII,IIPT=,IIX=@IIt `II?@,hEIh`IIhJ.cf5$Ih`IIhJ.jh`IIBZxd-hiO#v([_uvh$jL I1JPhmdPS h $jv^~WwYu Wh ${`IIeȺxIIt jSR9 h`IIAZIPTWUWVSjj]Sjjh& 4@u h$jduu&YtjjSPjh&3@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ>MQh$#U1G맅u) J.yhJ.j (XZJ.PJ. 1e[^_]UWVS ƅ]-ƅ_1ۉKI KIKI15KIKIKI1=KIKIKI1h4$u uiR ycPtJTtgxPl$& KI뫃 KIq KI e KIY KIM5 OGKIYe5 O>Vj:V6[Zuh$SHKIt)XV3dZYXu C[ӉKI=KIt h@"js Otuhe"1Ҁnuxou-h %P^_t]#KIIj֋= Ou KIi]# OKIjOeph@&Ph$hK.T$j^]KI(jKIt KIt KIC.M Tu)tP1ۉXh8 h6 5KIPUrXRrRh#RLlbZYTLSfojjLRPVi9X}XTPT0VhPà uj/S˶ZYuSh"h%hSVbXXu"V|WXu9SgW^ty2LhVà LVh$juh"LRPaZYh$LR5aZYShE$jjhVjSǃu Vhf$jRph KIhzd@PN uWXKI`PhedAWN @uVhw$WYV^H__9~Vh$(f1҉jjSX\ \UXH8ubf8u2Sf8$ShT$$8C.`9!ЃPu#@C.TP`9PC.T`&@HtPSWZY@u֋Hxu Sh"U$S Yuh,'hAf$j^VzZuh,'hap$j^@ uhup$h,'h*WSй%1󫍅Php$S@uhbn$S_Xuzkh %SѵZYuh!&h'hqPƍH_v󤍅PhiSC @uhp$xYS joVZ thp$h'hih=i$VVƹ󥍅Phui SVC@uhp$UjmZt h@'j]h hbIhbI6 Uh-hbIhbIh ! hbIh hbIhbI hbIXUh`-hcIBhcIph* hcIEh) hcIDhcI~ hcIXUh`-h@cIh-hHcIh@cI hHcIh0 h`cI h+ hPcIh}0 hXcIh`cIhPcIhXcIUVS8)my h~$ wYh}%9Zy h $vXjh}$tp[^]4u[jj ph$"p u=jh~$/pXY~$u~$jh$h#$Ph"h4%j 7jSP @t-Et Ph'$Gv^Xjh}$oZYtj .Yh>$"vj Y -D jj hC ,^jjjj j jjjhmC ^0jjjjhB ]jjhB ]EEEE jjjjjjjj j j jjjuVa8jVj1EEEEEEjSjXjSjX$jjjEE EjjEPEPjEPƒ$BuHY8lcI -te[^]UWVS]} DžhDžT1ɉL11PXDžD-H h$WS7 ubfFt/RODžPg7$t'5 OeDZu5 Oha$Xu O8#t5 OYu[ j dR@P y d:uh$W9?ZYu%FN[\u vh$WhPƒ NFjjLWv XP9\ j\P*)^_1u?h7$jMi T\PkeZYu \bF9|1hSW]j/WtPRT!u h" PGh %W8YZujIXhv'&W8_Zu 1ɉ jI:h$h$hg% = Oh@%W8YZu iIh53#We8YZu iIWhލ$Djj5 Og 5 Oh$Phjhj O$苈(jI,jI= OWZuR.DPuWh$@=W _+= O=iIj:WD ZYuj/W6 ZYth$ ?u hB$jX iIC.=L-~q=0jIt{p1󫍅ljIAulE)Ћ@jI2DžbDžS=iIthn$N=@jIt10jIkr@jIjxlRPph$(X@uph$jI@th$ j+ H<1󫍵`4󫋅 =$jIu $jItQ=,jIu9=(jIu0P蘰[^@u=$jI(jI,jIDž-=8jIu;(jI,jI}hR @uh$PZY@uhӎ$|=8jIj/jhheIjPyheIh$!S^_@t%=`uheIh$u=8jIjjheI yheIh $jPY[uheIh3$jheIh"H3 eIt#eIVRW3^ZtN xRjVh"2 u ƃrVW3YZuSheIhB$jBiIu@iI`RRPheI6@uheIh -'01=iIiI=$jIu$jI hV$ uuheIhm$h2$S2ZYu&iIuQh2$S2^_t@u5=iIth "hɍ%Sr2Y[th"heIh ,'DžeIt'$jIRP5,jI5(jIJ(jI,jI5(jI=,jI19|[<@ut $jISQRP  5(jI=,jI19| h$Pt5 (jI,jI9sSQRPh$j@ÃtYtU$jI(jIȋ5,jIRP @u5,jI5(jIh$jp@*"0P _Z@uh $[[^ _Xtۍth$j 7Phf$jdWMjjjh۳%PiI(jI$jI jxlPjI@PVh$N@;0Shf$jdW!j0PV y VhƂ$jX (  >h"EEPURj5K5K5KXy3"8 h%$_>hK.@Y[ h̆JjzKD`_Z~9XU8KL {uoePXh.$:! X`)dDhh@;J hfXJHff9u `-J̆J󥸄J=Ju=JuJJ\@JK1PT s)hPU@ EʉU1ɉMiE'%Uthp UJݕPJJ݅PJJh-ܝPv ݅Ph-݅PJvJ؉ff K!@tK\JDž@ff KhJ@1҉\9XDpfu/cTPV@dhJPЋX)t6(uRKuKt@KhS$XDž\7K uK t Kh~$RXh$e 뽃@uhhf@fXffX-)Jf~8Kt1KQ@PRhΨ$ Kt 1ufX-KuY\uFDphfXfuaTPV@dDž\5KFd9{KnK)PćJPhDP; A9~hćJ8DuC烽\uODxhf@f\fu aTPW@dhDPćJP+KSh$K;K}+u h$~_hDPh#0$gCY^Dž\`<$2'jdh{Zh@<$ 3'h9$chU$Yhr$Oh$Ehf@fPh$7hթ$h$h$ h$h4$hJ$ha$hq$h$h$h$PhǪ$jdh_h$&dh^1ɉPTDž\1ۉ@jdh,Zh@<t%w uh$<uh>$h $Xh$Ph`$^_hvPhw$.jdh[FhfPfh@fRPh$* jdh_Yh$jdh9Zh$jdh_h@t <uh$hث$^ Ph $Y[dh]jdhZDh@Ph($@dh賿^_jdhe[hL$jdh?YhV$jdhZhf$gjdh_h~%Djdh^ihz$!jdh[Fh$M3jdhYhPh$XZKdh葽Dp`<wg<`x^FXsI\s)`h$mXXȼ)k`D`X) 뺍FX`xFv<9~<葑tjPh$j}tVS hN#j+}jDžu%P%_z$t8=$Ktj jhO#Wh5$= Kt j jhN#qWhB$j8j jhN#Q tVWhT$jWhg$j h]#h"hv$jjh]#h"hv$k }uڶjjjjjjjj jjjj yjj蘸@u hx$jjj}ZY@u8th$=jX}uTj_j j>ZY@u8t+h$s.Y2 u h$膩Z WLXVS=hح$A. 0jjٷƒ ]#Bu$SPh%jUWVSDu]  '4Kh8'SV% v~jm cStITtbLu\K뼃dw$\4'hKXKTKLKz0KkHK\PKMDK>C.)ƍx|K=PKtjjhdx%ltK >Ejjj"PtKjURh@hPW @u h{%,Y=tKy h&j;u=hK! . WZ) '    ms / =hKt1ɉڸL1ɉMhjE؉EhjE܉EhjEȉEhjEĉE hjEEhjtljEhjcEMU ʃ} ʃ} у} хuu h_#E1҉dK8gtj5tK謶_X1ɉME]#E]#FEȅCEċS:-%BRU&ZH3U$4'dK"0-dK0-dK0-dK0- o`KdY\K XK HK DKPSV 11ɉډe[^_]遾We[^_]UWVS }$hI$PZYƅh"u W[ t.at"t=ԗK OԗKþ뼡C.)Džt>upԗKt&h!B$Si^_thk$SXZYt2=ԗKu)U KbujOuShP$hK.ЗK/=KFK5K)C.EU)tHt:t#u =ؗK=̗Kt =ȗK=ԗKtEt h!B$W\YZt&hk$WKYZth܃%W:_ZE U @7@tCƀ5ܗKjj5ؗK5K5Ke5ܗKjj5ؗK5K5K>5KSjP ISh$jKi4=ЗKjEPj @u h$/EUuuh$辸[h`RPhƹ$Kt S蓸YE  1SQ%1RPhֹ$ f1=ЗKtTph%V=_Zt)h$V,ZYtuuSh$趮j Sh$觮jФjɤUWVS u] 1h$SVm tRtfu2KֿϡC.9td1ۉ`XVS7WZYVxPVPkZY%=`h=@uvu^Ph$腕[^Dž`ddPhS FSh$j00hٺuٺ Åjhh.$hVǫl=Ku Džp$lPV}ZY8t Vh8$|^X5KS耤ZY@Sh$Z`e[^_]UWVSdh]#j^XZE 01ɉ LK4VLn%0VLo%1ۉ,VL$N$^uF$,VLhhLxhLdhL0hL,hLà LKuS jj _XjHXE j:0[^t*E 0蝬YuU ERPtt16j5`vLhJ. t h"j\5$L躒UWVSP}1ɉMM1h_$u WZ t3gt!utGu. OE O;u OE85C.9t3SiZt@E%UMM@uShf$j1}1ɉM}t EE1}t6h %EPpwYZt"8tu hx$j4GDʋE 46Z@u6h$j4hָ%迕Y@ttEPW_Z@uh$}tusY@u h$jtuZ@uh$FtVRPkvh$jh#BXu4%jh$SSSh$jUWVSu 0L1ɉ L L Lr%1ۉLh£`La1_ @'E؅t2Gt&W =LuRhL臄XZ RwP LL|LLLh%L_1u"hK.hkr%jGDuGLhs%Vu tsmtW~ԃptXrthK.hr%j躏ft$CuhLhLhr%5 O*#뚡 O8뎋= O4Lw%*`jh|%h"$DLE t$5OSi5O0ijjVPSLuhK.hs%0tn5L5LY[5L/h `hjhjhj 5Os+hhLUEj@褛j@蛛ƃ j0Px\1XZt"]u1EU,8]u}u=]u1EUָ%8}t]uU t%7]u}j[/XjWEZYts؋M܍Q M؋JDM9ujjjjjjjjj jWuj&E؃4@tj0Vu,up'E܉E1uТY9}}E4迢E4财EXZS觢V衢jB/à tPj蠦jSha#10Lj /Lj".LjX gnj9| h>[u=4Lt j Y jjBXZ^L1e[^_]UWVS(}E 0u1ۉUMUMUM^Dž111h%u W @p&ab$Y'zFjhjj5 Oh$ڴBu Ojhjjj5 Oh%蛴UMUM6 OUM'C.9qt&jjSǃ y Sh$jt \1ue_P6.tf9} h%U^jPShh5ZOyh%$jShh5ZOyIh%js= ~ h%jU[DždjdPhh5ZOnDžjSj$j)5ZOIy h%YjSj%j)5ZO%y h%Z {O  r)r  rr6.PR(Ph%%lZO+Ph@%lZO+Pu4t&Kh5j蹺h5j譺1(ZM$ZM@,.ffffUS c"u=ƃc"S.t~tA)}v[]ËP PDc"UWVS  EuFN 910u$Xx}xWx U 9s?uɉtE艘|~"ux~"u쉰t~"Eƀ~" [^_]ÉtE艘|~"ux~"u쉰t~"1 [^_]UVS u4$7hD$4$gt$̓#$gg[^]UStÙ L#t[]E D$D$ED$ L#D$D$6$kt} tǃL# []Ë$Ë$Ë$Ë<$Ë $Ë4$Ups_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6fusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ... %s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleanersegment %d: bad seguse count %d%s: fcntl returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segments%s: fcntl returned %d (errno %d, %m)%s: errno %d, returning%s: filesystem unmounted%s: reclaim failed with errno=%d%s: wrote %d direct and %d total frags to clean %d segs (%d%% recovery)%s: cleaner not making forward progress%s: inval seg %d%s: rewriteseg returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: failed to read cleaner infoRead cleanerinfo: %d clean %d dirty %ld bfree %ld avail flags 0x%x%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: must clean%s: enough clean%s: dire straits%s: busy clean%s: failed to stat ifile%s: idle clean with fs idle %d%s: failed to get load avg%s: idle clean with load %f%s: default no clean%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALL%s: coalesce: LFCNREWRITEFILE: %m%s: coalesce: LFCNFILESTATS: %mcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYpwriteSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystemillegal inode block size: %d cannot specify inode block size when version == 1 %d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:more than twoexactly twoUNKNOWNdisremainstat failure on: %sinvalid device: %smirrorFor RAID level %d the number of columns must be %s. RAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%ubusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in ~30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGutf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... %s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedexamine files in%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260804073608Z SMALL REJECT_NULSLINENOincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%jx %*jx %*juBKMGTPE%s: %lluen_GB.UTF-8 (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: Long_Type: %s Attributes: %s Could not find index %dDetails for index %d: StartType: %s (%s) None %*s index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]gi:b:luaxAhHpW:wGPT not found, displaying data from MBR. %ju %ju %u %5dshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addresspltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSPriorityCapacityBadDevice%-*s %*s %*s %*s %*s %8s %s %-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260718NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverUnsupported redirection Location `%s'Too many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expectedread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%s%lu: %s: %sfirst RE may not be empty\%c\%03o\%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.7 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.7 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.7 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.7 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.7 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog11.99.7xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:863: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= ntestsmanhtmlrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuexbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%H%-30s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1181: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresvvmresered/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRE%s: removing interfaceDUID %spid %lld failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshotSTOPPED%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREalloc_args%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departed%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.3.1 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: ND options: DHCPv6 options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %snd_dhcp6_unknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentstrslen >= len + 1/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sRELEASE%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: %s: short frame header %zu%s: checksum failure from %s%s: redirecting DHCP message to %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completemulticastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s%s%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: %s acknowledged RELEASE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)STOP6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646tolowertoupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist