'V i>[0zNetBSD/earmv6hf ramdisk 08[>i<  [>i0t t[>i@@<@T 08[>i<  [>i0t t[>i@@<@TU [>it`A[>i[>i[>i$h [>i[>i[>iA[>i[>i[>iA.[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>imDxT"[>i[>i[>i (08@HPX`hpx8$[>i[>i[>iX`hpxO$[>i[>i[>iL$8[>i[>i[>i (08@M$5[>i[>i[>iHPX`hpxFA[>i[>i[>iC[>i[>i[>iA[>i[>i[>iA[>i[>i[>i![>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>ia[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i![>i[>i[>i4![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i B![>i[>i[>i B![>i[>i[>i![>i[>i[>i"![>i[>i[>i"![>i[>i[>i"a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>ia[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i?\![>i[>i[>i>\![>i[>i[>i=\![>i[>i[>i<\![>i[>i[>i;\![>i[>i[>i:\![>i[>i[>i9\![>i[>i[>i8\![>i[>i[>i?\![>i[>i[>i>\![>i[>i[>i=\![>i[>i[>i<\![>i[>i[>i;\![>i[>i[>i:\![>i[>i[>i9\![>i[>i[>i8\![>i[>i[>i:\![>i[>i[>i7\![>i[>i[>i6\![>i[>i[>i5\![>i[>i[>i4\![>i[>i[>i3\![>i[>i[>i2\![>i[>i[>i1\![>i[>i[>i0\![>i[>i[>i7\![>i[>i[>i6\![>i[>i[>i5\![>i[>i[>i4\![>i[>i[>i3\![>i[>i[>i2\![>i[>i[>i1\![>i[>i[>i0\![>i[>i[>i2\![>i[>i[>i/\![>i[>i[>i.\![>i[>i[>i-\![>i[>i[>i,\![>i[>i[>i+\![>i[>i[>i*\![>i[>i[>i)\![>i[>i[>i(\![>i[>i[>i/\![>i[>i[>i.\![>i[>i[>i-\![>i[>i[>i,\![>i[>i[>i+\![>i[>i[>i*\![>i[>i[>i)\![>i[>i[>i(\![>i[>i[>i*\![>i[>i[>i'\![>i[>i[>i&\![>i[>i[>i%\![>i[>i[>i$\![>i[>i[>i#\![>i[>i[>i"\![>i[>i[>i!\![>i[>i[>i \![>i[>i[>i'\![>i[>i[>i&\![>i[>i[>i%\![>i[>i[>i$\![>i[>i[>i#\![>i[>i[>i"\![>i[>i[>i!\![>i[>i[>i \![>i[>i[>i"\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i \![>i[>i[>i \![>i[>i[>i \![>i[>i[>i \![>i[>i[>i \![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i \![>i[>i[>i \![>i[>i[>i \![>i[>i[>i \![>i[>i[>i \![>i[>i[>i\![>i[>i[>i \![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i\![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i$![>i[>i[>i4![>i[>i[>i![>i[>i[>i![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i ![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>ia[>i[>i[>ia[>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>ia[>i[>i[>i a[>i[>i[>ia[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i?\a[>i[>i[>i>\a[>i[>i[>i=\a[>i[>i[>i<\a[>i[>i[>i;\a[>i[>i[>i:\a[>i[>i[>i9\a[>i[>i[>i8\a[>i[>i[>i?\a[>i[>i[>i>\a[>i[>i[>i=\a[>i[>i[>i<\a[>i[>i[>i;\a[>i[>i[>i:\a[>i[>i[>i9\a[>i[>i[>i8\a[>i[>i[>i:\a[>i[>i[>i7\a[>i[>i[>i6\a[>i[>i[>i5\a[>i[>i[>i4\a[>i[>i[>i3\a[>i[>i[>i2\a[>i[>i[>i1\a[>i[>i[>i0\a[>i[>i[>i7\a[>i[>i[>i6\a[>i[>i[>i5\a[>i[>i[>i4\a[>i[>i[>i3\a[>i[>i[>i2\a[>i[>i[>i1\a[>i[>i[>i0\a[>i[>i[>i2\a[>i[>i[>i/\a[>i[>i[>i.\a[>i[>i[>i-\a[>i[>i[>i,\a[>i[>i[>i+\a[>i[>i[>i*\a[>i[>i[>i)\a[>i[>i[>i(\a[>i[>i[>i/\a[>i[>i[>i.\a[>i[>i[>i-\a[>i[>i[>i,\a[>i[>i[>i+\a[>i[>i[>i*\a[>i[>i[>i)\a[>i[>i[>i(\a[>i[>i[>i*\a[>i[>i[>i'\a[>i[>i[>i&\a[>i[>i[>i%\a[>i[>i[>i$\a[>i[>i[>i#\a[>i[>i[>i"\a[>i[>i[>i!\a[>i[>i[>i \a[>i[>i[>i'\a[>i[>i[>i&\a[>i[>i[>i%\a[>i[>i[>i$\a[>i[>i[>i#\a[>i[>i[>i"\a[>i[>i[>i!\a[>i[>i[>i \a[>i[>i[>i"\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i \a[>i[>i[>i\a[>i[>i[>i \a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\a[>i[>i[>i\ ![>i[>i[>ii![>i[>i[>i![>i[>i[>i![>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>i a[>i[>i[>ia[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i![>i[>i[>i![>i[>i[>ia[>i[>i[>ia[>i[>i[>i![>i[>i[>i![>i[>i[>i![>i[>i[>i B![>i[>i[>i B![>i[>i[>i![>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>ia[>i[>i[>i![>i[>i[>i![>i[>i[>ia[>i[>i[>i a[>i[>i[>ia[>i[>i[>i a[>i[>i[>ia[>i[>i[>ia[>i[>i[>i[>i[>i[>ibpf![>i[>i[>i $ [>i[>i[>iE$[>i[>i[>i$>[>i[>i[>i$[>i[>i[>i$s[>i[>i[>i$[>i[>i[>iA[>i[>i[>im [>i[>i[>i$[>i[>i[>i $[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iA[>i[>i[>iVmQޟJ1B #p048b%C0h$ڮgqRhu Pc0qkU_ٝ +U'tS}vH1*2h8G9|*io/3ε*g<}UnSe^7[av6@UC(,8?d-tY(mxGpAT!&9=O'8W..c=X*~,7O] 0^JxsI`~ ~ۋeJUX|0@rcCr4053ZlL+oFu_ E=Mm GVu%'hpLTg}Uop1Zo% [֙Sp KIo"Td-$[槱cH~8O1qs`> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4Q"4 (@{!@{!x}!x%x%@> LLx}!x%x%NetBSDLwGPaX NetBSDearmv6hf4p@-D0D 0@`Qp(@P`F`F&a03/T@p$l$A-`0`` 0PpU(pGpG@Pq`P03/T@0US m$XH-x`Q MN h!h1 @`p0 0R0D1<  0S  /S 0S1Y PY9 T IPE0PUH2H0@3(1*03/T@ 們0地0 [* PC PE%Q03/Zd 0 P0 0$xԺ$`$%p @-l P`@P H厮z>[`POU 儮P  j@\&ءP@-@)O-`882@4RMt00t@0pWo \P@tt@( R @Pmp0: S 婭`0SЍ@P0`0x; 0xS0S CP0S S0p WUP { 0S;00 0 pP 0s s0T T@L   hPpWH&ϣ&ף&H0`  BR` pRp R4X Xp/H&&@-`0 w& 000/&pC-؀-`P p0M@ { A ( A{{z`P$0  {ЍpY@&l%&@-@ M00@  jP # ЍA-` l1V0zP 0 c@P@TV ]PC  W@@7<B`0S@ @0;0/P W 0Xp*`V 4p!`0-S XdH7p 4@0SV  W l%0&O-5MpY xp `P` Ѝ  p` 0`$5XP0S 5%0 0 5X0S40S* D$尠D00CS0 ~@ Pp  @YT |`0 @00CS0Xf0 X0 pN\00p :p@300 8F80: Sx h+"p@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `Ep2  p 0Z 1(#00 H  0P \\;P 4 `+X"J 0R 0p0ZZ3r0S /P Y' p00 R0S ``0S  0 >(d P <`V k`0 ?oR20S 0  0 0R0P r`P hhj`0S H,` P0Rt00!P @&l%  &(&,&$&<&&H&8&&4&(Y&L&P&0@-MM@P  #p  ;0U$C dzP TT#ۍЍ08 AP ,(0P XNl%[f4&Q@-@ TWP DD,2P $ 0P@l%[r4&Q@-@ X8P HH0"P $ 0P@l%[}4&@-]0 뇨&0$/ '0$/p'@-@-&@-=@-S Y@-1   0 0 Ѝh'@-1   0 0 Ѝxp'@-1   0 0 Ѝ䄩 '@-1   0 0 Ѝ䐩h'@-0   0 0 Ѝ䜩`'@-0   000 Ѝ䳩p' '<00/@-0   0n0 Ѝ䰢'p'<00/@-0   0Z0 Ѝ䰢'Щ ' 0@- 00 J$0P@IKЍp%,0A-`M!A!qX0 p! R0B=0B  P嫩0H 8 R8B 4!010,!0ЍPP =cM0P   0S  0 pPI0P      0 3/R ! 7000<040LD0p' '',#=Txp',HX0p@-|@PtP00 R 0p800 p0  B0Sqs t' 'p'0 0 0 / 'p' @-G@- @-G@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qph\0S 00dm8@@-@@PЍ@ PЍp@-(`Vp80@  03/PPA8003/(Ppg@-@P`P 80 (0(3/@'\ P !\PЍp`'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A/B 000+ xpt| @  ЍOc0 P % pHp 81/qp4  ?P p 4 [0S4 tp0 0 0 0 "d@0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0ק004 8pX  FЍ`'pp'dʬR/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  P0 0  0  $0 !(0Ÿ}?LB?@PN3c` D0S%H0}??@3c`_`RP0!!!! d 4 !`P4T4 R" BXX P!d44sT4 ?" B   !d44`T4 ,# B  d4|4MT4 /0T8p<@0! C?` d @4_40T4 Ѝ'Mb'׭U@-@RC- A `00P4 2#&P8P (01/qp$ D㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@0  Y $  'T'p%W@-PAM P04!2#!8 P0(5/qp$ P9 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080l0( p 3/p #U0* ,0P/`RP `p'TmSP @-<M4@  @:  Ѝx'O-XM0PS M. 8S+ #=,(,0|s0S( 000| " ! !x00# #|0 & %ݍ Ѝ'|D 0 Y0 S 0F0dGS07  S  S $0S1 87000000S70 070 00 0@RR R0r0C0C00Q0 0S, ,B< 6W t[a@0 V  $ ( ,@T 00,0$0 000 0S $Z% 0 V(0Se0'  - 00   0 0+,0S 0H 2 8!EsYʀ0 @@X; ? X07* fS 0 GR`( \S0 >Rp SS0 4R@,00 0 00,0 0@"<P0( P@ p|# .SX6g&(0 p ? X : 0吣$0s'D(00S/ ,0S#$`V $;#40S \ /\ * R0 Q 0 R$;# Ls |0P0$(00Z`40I #(9#v0 "$#l0$K#d,00 0 00,0@0 <"'U,0S 0p804< $`W @Pc  0>000#80]@bV, ?V0(*R 0 4fQ4{R0 ]QprR0 SQ@(0004 0(@ pT\R40V3*40 ?V :NR 0V㐓$0s' ?V :@RD!0 0 0@0 0< x'® ʮ3kx%ϯگ' JOϰK %0@-pPP`@@Y RP Ѝ`3MU@7p@-XP8@T`@D p cRP<opQ<Ppx'A-AP 0P$ 0 0 SQ ( $0\P Wh d`P, R2DaDqU`0``000PV 00CS000 O   0,`0CS0000 (00?/U R V8 4D 0$00 0$ У'8&<Х'R@'`T0 S 0SP/P/S/@- У'vp@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 pХ'У'%P'@'p@-@10`! S:`Fp00  1S pCa0S `10 BRpE` S`l   儼P 0a0CS00   @'޶& '( Q 0@30/@-K@'`01S @-0@!S @DP /9P /@'޶7@-A0 R!RUUʐ0\00,P@kI- |Yxj00CS00+ 0 @ R,V R P Ѝ00!S KP c0 Sڰ 0R0CS0000 0 Q  vP   @'&&!2?A-O 0 P0,p W !GpY\ϟYP PP0  nQ pQ lQ 0 S , PP1S P PPP0 nR pR lR 00 S1S P P0PP_PP0 nR pR lR 00 S1S jP!S00P0PP1S 2S 0Sڜ 000@ `PP 0 nR* pR# lR$ 00 S5Pm PPPೃ0S!S , ~30S 1Sm cP0PPPeH 010,0,0]0S000@ PQ 0!SP@ =P00 nR pR lR 00 S-0S  :3 kb3PP1S PP%G@o%G`GooPbVWP 101@PP00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PP"PP0 nR pR lR 00 S{1SjP pP0PP PP` 0 nR pR lR 00 SX_aP0PP PV0nQ pQ lQ 00 S 9PPD B 0  P6p PP10S `Vp0VmVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  l P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l Br R0" 0 S1S 2SqW P0000@ 0S0 0`PP 0 nR- pR& lR' 00 Sc1SR1S0!S h10S1S d  PXX 0S0T 1RP0PPP` gRF  R 0 B RF `8ݯ@p>E0"S:b-pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 /P00PP2P02 aP P 9G0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& HPP0 nR' pR lR! 00 S1S"P20 2 2020P0PPP pPPP0SR `V0V pʈ0 nR pR lR 00 S]1SLcP0PP RPӰ nQ pQ lQ 0 S?:P0 PP&@'ĵF]p %%D'&xϷ- ''ζȥ'%(-/QP000P0P@w _`P 00 00 P 0 nR+ pR$ lR% 00 S1S0!S /0S1S| aWWv FP0S0P0PP1S 2SqXP R$ l Br R0"0 S0@PP0010CSvD PNb@p kD0"S0mPP00 nR pR lR 00 Sx2 00S =PPPP0  nQ pQ lQ 0 Sa0S |jPP0S6PP^0 nR pR lR 00 SBP ^E2SGP0PP P6 #-@- 00 ЍЍ/'D'-0^S0]S0]S S]S[S .0Ls0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0cP,Cd( $ 00CS010 [S \S @@P`0 S @ #0(a0CS,0p00,a hB L0 0@S G 0(ȥ'D'Х'&@'޸X'p@-!0 P= P@01SE0p0 SS t`P@0P 00S P0P00 P0 h0T S0岶0Q^P0CѸ0 ,(ȥ' D':,'0''&O-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00vP? 0A0CS0l10G 0P \QH 0 SP 010S vP/ 000S S)00 S [ U 0007P uB7 ct00CS0L00 0`00Pp8 Pȥ'x'NХ'@'Ԧ'ئ'H&g&k0A-P0 0p@ W 0 `@P 0 R00R00 1BQ+B@ @P@p B0"S,"@gR000ȥ'x'yO-@SMpcȳ00 0GS TcsT`0``00寴PA尷` \X00C0+0&SK BR D R: Y J@p R僴PA僷 00C0S @Ѝh20  S  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p *P gA)D @U<f00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq 0 bx'Х'@'g&kO-M 0@P0P0s 840S 0 0 000 (0ypP ߍ0P0`#2C 00 S pSN(0Y01 Y  $ 勳P$@勶P LH  B R+030  # _  BR 200S 0 0m ? 0 0(PP.00Y0 Y H $ =P$  BR 200S 0 7 f? P0 (0 P'0 p1pG Y;ttZ P<1@@, (.$?00C0SuX   R    P> 00CS000^`W 004 00S xxL00S 0  >8 0%X  X'x'Х'g&k@'NO-pᬡA0M0CQ` 01 00C S00`NlЍ2  0P5 P!` 00000`P00CS000  N[  0S00CS0x00` P  PH'T'Х'L'x'@'O-RB0M00bsp 0siЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S [0p0000000CS0C01;  \" \   " L\ B  @      0C LN P'%T''Х'ܦ'Ԧ'@'A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT X@ 0ꌩ'T'%P'G-@p0 PR` 0 P (S%0  d P T0 ,("茩'ù&ǹ@-\>0 lm&O-eGM0PS@pM$Q403/P 0: SW>00W +) P8:J>?0^P0: S 0SFP0: S 0S 0S 0/S&4P790p0oO9P- 劊P 0#v PvO+;)M0P ]D#P]P 墦/?P/?P 90P+I [(H Z% U8.0. 0PT9.0. 0P @DP ^ PT1RP o R00S$ 0SS 0: SOPN 6  0<G=00 04K <G=00J0SP. Tqi/XG DXe00CS0 *p Pp  pYW hX0 X p00CS00 U0S !P0SGݍЍ0c ?o2500#0 8v꘩'HϺú&&H&\\O80\\K8X X0p@-@P@@DDT ` U H H0Rp@\\58ppX 0Xp@-@P@@DDT ` U HH Qp@\\8ppX X0p@-0P0@44T ` U 8 80Rp@\\8ppX 0Xp@-0P0@44T ` U 88 Qp@\\7ppX X0p@-PPP@TTT ` U X X0Rp@\\7ppX 0Xp@-PPP@TTT ` U XX Qp@\\7ppX0X @-ppt t0\@ ^0@\\7X 0X@-pptt \@ ^ @\\75S %R R S R SSh -^L^S R 0/0/0000'O-QMTg @ `u @ 0 @0L0@@@ @@D@H@,@0@<@@@4@8@5 SS$影\ l0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?]5$pp5,0S d4 @?C000@$0D0p0H0D0pm50$ppe5$0S00<00@0#0ppU5,0S 3 @?CZ㸰张 0x#pnp?5 0\#pfp750 \ 0C0CQ0B003/040 0S YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " &p P 4 04080080 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$4[(4 0R  P 4P07@40S00P00P00/PP\0.S0S 0!{0P$0 ]0P(0 $嶮 (屮 R P0娮PP000Ѝ'~VUUUG-@a!80S M%PP 'spW G#&<0SB|n&@P :@&~:@|:0Sy5!0CS0 \$ +  چ00L0S \0.S0S '@0S40S t'$<0Y?o20S X (040'/~G-`1b.P0DL0 GP0S$00D0H0=P0pP〔0t$pZh4T H0 `F0P 0 H1P Z$4X0 s0X00 00dt |  P PRPS W( ?R004(0'R S S S3 L0St3 T0Sh3 0S\3PT#QP30V < 00Ѝ10@GS  0$ 00H00P0L0 0T0X0s0X0 00P0L0T0H00 00P0L0T0H00X0v0P00L00T00P0L0 0fb0d0_PP\0<0Y080 PT0 D0h l0N0D0h0000000Bp=0p$0,p80$00,03000@0-0 0*0p0'0t0$0D00h00x00|000000000D0@P 8 00D`0S0\0S00S S S0 30`0St0\0Sh0h0Ȼ'ht@%6&*'|dP%ɻ&\Ȗp`480p@-@PT @@\p0'280p@-@PT @@\p0'2-L0MSM\0 + Bp8Z0 ލЍ 00 p>04@pl0l 0 0  ~L00S   4=&7J(',''$0\ 0S 0'740L0S/0 0 0/@-00 SM 4@@$;p3xЍX0T0P@ CH0@ B ? 0Ѝ@b̩'Щ''h'\'P `00CS`0p S00 P0S X0X /XnH&: S@-  S  S/ I* S  S%|@=A-x1`@TXPM !X@P10S D10S- 0qp'Up *@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?1 0H00S ȩ'Щ''h(','$'4''''s@- P@@P `TU00S @KT GЍp0t  Q \0 \@1U ,P@(Uꗼ@'H'p@-P@Tp0 0C0  $E @C-@4Mݟ$3 30S`sV4Ѝ0 0C0{ 0XPS !$I0S 20Sm  4 㠒;$px *-?0( P$D20S 00  20S  0 : SK0( r" 08"$410S10S61!0 0H 10Sx10S : S0: S y`x41萟 0IR 1 B?0 0 'Q ㌐p| , *LN\,|00S H''ȩ'Щ''hi''Ƽ ''(','$'4''''1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ ƨ0P 0 `0Sp fQPPU% Ѝ  B 10`    0S[  L0  $R,   V ȩ'Щ''$'4'%%H'410G-S$0@010S 10S,0000 0 0PI0`VGcpP儠UG t0 0C0 W kp0S$,  `YpP [`ȩ'Щ''$'4'%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG 40 0C0 W ,+p0 00 S "p0S$,  Mp` ȩ'Щ''$'%@- M @ Bp ЍT P 0@  QQ  00x%T ᩩP S  ꠅ&0p@-0PS``.@P /P PA-@P4 P!op,'ԼC-CM@. `~3 z3PȐ`T *F 0ӨpPPCߍw ? P@[3w0S ?@ከP?oP@ꔊ&@-h4 yz& 000/T'@-W40 ghB&@- MP<1$ /%miۿ400CS0 _0 /G-\D`HMp 0008T8$8t0000 00 $0S0 V"4`0p Q 30Sa3PZPZ10#/r000 0K|#QP10`#q/V 00D30p Q   #4P0 0~10"R/V0020"Pi10"=/2000HЍp(0: S P. S+@ xP00S`0:0 03V-V)V q 1X  ?* 3 0~\P F ;0L S0 00 0&qp10S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U c* XPV P 0%x'H'%0%V('a%{%m8@('$'%}D00S/@-4@~M0S~, QP~܍x'%0@-p@$0l00S Ѝ00 0a&0Q 0, `.mP%x'L0@- R8-P 0 0 -x'W(('KA-pP@` P@DTP`VA-pP@` ӳP@DTP`Vp@-P@T0` Qٳ@P 0 Q @;;S pɳ@P00T@ 0(0( -( -%x'('s@-R@T` V0a@$00 ?00S 0CS3P3/0 S9i-00@ЍpPڀ;;S" 00 0%0Q P?P00@00" /0S @@/0ES TT 0$0/0S/0S /0S /0S $0STڄ00Q  Q`-T( H -/(00 Z-$%x'W(M*`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     uP000S, @ 00pT0pS 0L$Qo 0(p T0$Q/x'%%mG-P`0 P ,p@P"ڰAQ"$Q 0P P 0$Q.@ ,ЍP P%x'H@-|A`MPh1P0S2 S VPLDE,00ЍV0App0 $0Q. , P0S(0S 0o$Q#. ) Pڐ0V 0?( l0 ` 0ᰳP}. 0< Q,00%x'x('mO-M4M S0`RX0E@FP0 0S 0 Ģ00rS '0S    G)000 '0  0" #T~4"#> D܍4ЍT 2 R - 1[ 0`##'# 㓱0S1夁0 'p 0  ܷ 0 #ַT>4!D #>,1$a0, 000p0 01尐(0C0ặ  ᴷ,00( ,0$ K'$ 0 ᡷ 000 p #▷#f'# 2T%&x'W(E@'W(P'5H'0'%C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S 1 fc 0S 嗲pP (0: S0 0h p10S10S PP n0 0 0S q4X 1 +00 0S000p000 S(00(000 P@0S '000S x0H(P 0+0t0&P 0X%H'x'dW(W(`W(lW(W('%W(W(%@'0'*C-M M\ yP,H#*G mP,#*SC$0`SH 0`E0S2*p'Pu 'Pp 0 m S( 1**2r0t0CS G)|)p)5)])\)PL'P0000$2) 2 `ލ Ѝ)&0S  R  sS SS YSP )yS)Dq儁)3)P)P@'P00000S()( )0S0 i'P %0P)@PP }P0000)P0Wi)tW(7Q%x',X(W(o%%%Uu `W($Bd 700@-@BpMp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S =)@DT  A0d#0UPTP&)PV0S p)@X`ꓢ" @2/PL0 !ᓢ#, 03%%H'%I'lW(G-鈑0@`pP@FaU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ AwP 80| 3/PtPPTT00S\ T(R <003/P 202W(H'%P'I'+Q@-AMP/M,@P+ p`pP/0P0 Uh0h (AލЍT0_"&/0P0 0@0 `(T'H'00CS0 70 /0O-S$M00`Y P$ЍP0,03/P00cL30S,!000SPER0 ? 0P! 0p 0P0U00pPF0P0 000/`F p !00`00Q pQ P0 S  PF '%W(W(p@-0@0PpP E 0Pp@| '%A-`PlplU@0@DTj@P U@0 00`PE '%G-P`ကpU0@0@DTG@PğU 0@0 O 0@UP0 ` '%O-pMM =@ P` X1 0S ᤦPt!:8 !GU00 J(5! BR P#?U0 P0PU0o0tPJC!8h @D 0RP J(L J0!80 `MߍW( '%4 Q/p@-JTUPߤP!0P PpP!4$ 圔0 40pgXV(0@-PM@  Ph00S Ѝ0 $ R\ 04 0R\ [W(0@-MP @PЍ000S0: SxPPU 0D ᲥP 0 0 W(lW(0@-M@, 0000S# Q0S 10S ⚥P'0S% X0 "?A3c000S&!h0 "?A3c0 դP b 0NS ^ 0X 2Ѝ0V 0< *0S ᄤp %%Mbp@-@P`uP p -P $0#/ 0 plW(.@-!@P 0 0@ lW(LG-P0`/Sp/M/N@P7 P. np /00 P&  P!00S  yP P0 Dsx ЍW(G-@P 00/S $QP 800Q  GYZP0 0u`0S O렐p0 v-P0S@$<lp@D0m40 N@ DXV(i W(lW(A-M`P@pxP5(10S Ѝ 0RP  0RP 0: SrP ᜣP50  7PW P ! P W0 @W( 0@-:(4@: SM=0P - \ 00[ P0  p 0: S ,kЍ000  t::P/  0 fA-`QFZDT@P0@!81P @$<sP10SP+(0 0 0 =  "4S `~P`0 eᔣ#0p 40Ѝ(tS|(tHP 峢00 0gW(W( %%iXV(O-Z#Q30` @ (tJM Mp4#0CS0 t3tP d30S \P0: S X P 5Z Z30S 0 "q"ɡpS0 "X 2P @$<P RPn (4`S42T2P ᑢPu Pa 0"0 + 0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 C,zᨡ @8Jލ Ѝ  ≡r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00`W(W(W(W(W( % %/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 .@0 X2@ @?Q*@0 0嘠P ͏P` hЍXX K 7 ` `@@"8X(4X(2@X('" S+0  +gdW(EKS@-@XM="r:(n0 cXЍ[7@-@PppAP Q Ѝ0 0\ fE Ѝ0@`E0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq*-0C\^* 0 \ 00W0!00N0 00N ^*N^*/ P@-*0S@L0 ? SR@C:@  ^:R \000Cs R00 S00 Cr@ T \A Cr@T2  0a0Cs R"  -0C\0S* ^ 02W"!0C0 0C S*CS*80P @-  //W(dA-@((PQ U?-QQpW  :WP`0 彣?`S A2AΔ0:S@0 R  0 `ꨴ-V(&&/s@- `0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&!PP@P0PA- 0S`Pp ㊉0P  T @R p00T0p0S ,m@P0=0gPP᳋V(s@-@w`P0l C300PЍp@00S S@@GPP 0 @D 00V(@-  _Cߟ&0 Rr @-/%@-<@<LC0bIC ECAC&G-p pC1@dW \P+p`0, Z/00 `O-lM/>_Po^@P= `P0p`ᐟ/00? PGP@  l?l/@p\?X?A0sR  S  R4?4/0, CR 0KV?zP< N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/ 4>  ,> > 0S  > 0.0.0-0==P}===|=-=   H-  g= 0@T pញPP\`y,  0!-1 @ L< -=@=<P? <;<,<,<,t<,h<,\<,||0 SSt@b0[_ P000SS000[`l]W(W(,X(%H&%&lW(&-$' %'W('!W(W(%'W(V(W( %W(dW(W(7W(<W(W(J%@%6%,%"%%W(%W(%W(W( vH&|%n!,%W(W(%hW(W(\'(P'f}W(@'W(W( G 0.glW(%K 0{pdjPW0000 S \0 0P  /V(d0P/X00@- HP808OP'  3V(W(W(&A-`  @?\, \PA *\.  Q R( [\SPQU !\@@]^.!Lo \0QS8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U W(p@-@@0/SN00N P`pPQP`Q*C0CT3A"0L0AS*pSp@-1MPMRP/ P  0P0SۍЍp.S@T|`l @ @qW( B KN pO-cM M 33 "@pP3]PW1`0 00S  g  0 ⃠Pa` 0+QRV~ @  +  T* R`DV;  `cݍ Ѝ&R* \R%1@\ 0@R R P BR00CR * 0@&P\P   (  BP+T- R* ` V$p0!#MS@ 0 8TS y8TS p  0i 0 xh@T *0S0T00  R S 0 }PW( .&D C-`PMM RP  \SP R P0S ۍЍ|@P p "P ;[0 Dᵄ  0Sᩄ\S R PPbP ᕄgS PS" SS GS yᇄ0 x0pS sS0S080 R @@@NgPW(A-PP 0SpC`p@PL Pm 40  R p`@@ @PW(L0@-@0T  S  僛0@PW(Fp&T1 RP p@-ZDT 4\p \Q Q 0T*  04⼸P  0S/  00p0S/  0`0  @0/S000 0D0 R /PW(W(W(t0A-j40@TPp 00S0o`0 00/S @Tt0T0o+ P0 SD jp04PW(W(W(2A-0@SP' 0`.S0.S0S/S XWP 0 Q CR S.R  S.R0S/S B 10S510S ;P:4 CSR ! Q0S 0/S0S.00 `R  00C00S080 `V">_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@&A-Q@pW ::0J840K0CS 2  `>0 01 5  d| (lu <tp @ |qp}  `=/ 0$  4 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$4X( .0 0~P0<x P J8P0@ P J-1  =0 0 0P J<t@h1XPE vD1UPM v}00 0zPP J}zPߍ P$PP P dP 0$P Px s 00bR cyP(X((hHPs XajV(p@-PMM@ d =\\  0PA UM>@ ; 00$0$0<0 0 0ݍЍp$ (X(p@-@ PP hp@C@-0p-S0S( Pݍ@P#x 0M0` S0 \BPPP00T Ѝ@`H&-@-0@P   ϢЍ@Ѝ/PX(p@-@ATp@0 R P OP ` `P`pPX(-P@- 00|0 x0x 0 0 h@0S XoO00L0L <S ,叢$ aO Ѝ@ Ѝ/W(W(dW(`W(&W(p@-x@PlϻhPP XȻP p孼000S   p PX(W( -P7@- 000@ 0 0 0 P0S xO00l0l h X9TwD 80 O Ѝ0@Ѝ/W(W(dW(`W(&W(&-@- ی܉3&0@-MM@P@Mߍ00/SIPt IP ׆p T҆p  0RP 0RP DHLQ 000/XX(@- 嘌㙉h&C-q`@$MT  t0p刌hAPD00CS0>I@ Pp< @Y@DOoB0S@$Ѝ0P: S  P m0S u pW M0圀 SHU@  0A@ CTA0 @00CS0,0 XX(&H&O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 DY( 8Y(@Y(,Y(J0@- (Y(0s@-0P`0W0`0@S P 0R@P@  P@0S00S 0ST P000 R  Ѝp(Y(Te(% @-|AL ^ XP sr^( \1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !zO-p`p됰P0@%S{0V0&S T6o! k0 00 @ P@P@(Y( @-0@!4Mp RT` 0 P@4Ѝ0@P S?WP@V P @0 FAP@$ P@♆ U(Y(p@-@P0)Sp(Y(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  ! ,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H / 3U! z! 0  @@P! 0  @PVb'T@@`@P, @   (Y(G,O-p`M8P젟찟v!@ r0 X@ 0DS'00^* PU @ 0 e 0DS00Y Ѝ` pUU (Y(C-锐p`  0BS0p0@SP(! $0 00P@@@P@ Ѝ(Y(G-`dP0@S! p0 00PP@(Y(@-@MP1`PL0P  IR NRpp PpEp@@0PS@ $1Ѝ(Y(iPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0@P 0,P@1%%@`(Te(@P/- 0/SSS00HY(0@-@PMMMߍ00/S \p p  0RP 0RPp@-`\0@P 0D0p@000"SP VpnpzHY(p@-T` RpH0@Q 8 [PP Y0pp@HY(T%G-pWR 0S)P nB000000000CS020S @T  |SS pOS\.U$0An424b0000@/Sp=FpPJ0S0/p0CS0pppW001000pA0P00 m00/ lS ` S00CS0<10S 00CS00W00 pR0S/S0@D000@,P  R*0000t/S0S P 0/0CS0 pG0S 00CS0000@0@0@HY(hY(dY(%@`(%A-`p0@00K~P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0KOhY(dY(%HY(G-2M6r0@TS@P 0.S00.S000/SS?X20PpTePZ( ,`V @PP `  /` E90E mlm@0-S0Sp1@T@d=SP/~Pw  0S .pP  `P n 0: S W .pPXP pW 0S .pPЍ%\b(HY(")@-$0Q @ Q @HY(>p@-L@60P000S LTPP 0Ses@@M 101)N00CS00 M 0 M0pn0n<i\b(lHY(%G-@P@\R` V101 <P (P  `I\TQp @p0T \0DsQjSh0 @0 p0BP!0 BS@p@00CS00 `M 0@0 @T0S 00CS00 IM 0 0SZ00CS00 4M 0 M 1 0h1@ @ @ @ @ @pp\@@%A-@ ` PR 0R 0S SLp0S0 R aM0S  ZMU  DMTOMUm xIMj Td@00CS00 L 0 AL%TY(Y(%% 0@-P& 0TY(@-@(0Q MTY(@-x0@T   @@@@ @z@00S 4060S  ЍTY(<`(%-$0@- R    Y(-@-   0p@-Y(-@-0@0  H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4L,P / lY(0/xY(p@-@D{PPPP ]zp` az`P Qzp` Uz`p7@-P30@T p06 N 1d0@T PMP0 0@ 0N@B Ѝ0\b(%xY(f(B @-p`P@U'<0P%{Fkk&Zg{[`[x ,06S 00S Tv Ѝ @0t0S0T.S N@xY( 0    /xY(s@-@ P`TЍp0P0CS0  000 P 0 4@ 00 ag0@-PM @T @@ 0jp +P   P@@ 0jp 80 @ 0 0Ѝ0@ _i @xY(|%X%@-@P 0S0S k4P 00 0 Ѝf(G-`0S q0P00#@dT0SP&@D1$@00CS0$10S 0Ѝ00S p U6ym/k;  R )P00CS00S UA0SyAU yPy@ #hY(dY(xY(G-0@P`^PM UG+릐 s)2Q0 U2$PP20S #I0S 2$PPPU I ^0S|2 0S@++T ^0S<"$0 0 @+^0S2 R$0S0S |F@ P0S nF0S fF^0Sd1 R$ R @T$@0S QF 0S IF 0S AF 0S 9F  0$ V $0?o2$0Mx0$ R  0S F 88J4I Ѝ%b(pxY(d(%O-@MPpu*0 `㠀堠堰?P@ *Vx0$`W T ^0S W P  0`SY*ЍTe(%%xY(P8PG-P* `0@00 0R0Cp0W S `S0p 00 P**S p0@)PD0(00$* 0$ 0$/%%@`(xY(A-Pp`@000^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S SxY(%G-P䑟 M^`AV $`)pWT0尡p0p00WZ 0S- |1|aj3%Il#I !I00CS00 H 0= J00CS00 H 0 H  BL^ $`R 0S S00CS0 p A 0S pS00CS0 0$`0C0 w) Ѝ%xY(Te(f(%C-@$M p䀟3) 0 0`@T+ 0S0 PU@ 000P 0t 0 SP0 0U$0 @ R^PU $05)$ЍP0Te(xY(%G-P,Eo@p0媢S' 0S$ 1a12lHjHY.eHUaH00CS00 G 0 G|aU000 &PD U 0S @T H1喍 B@G8G1*G0S  1$ Iߍ0A 0 000 0@P00CS0 0@ 0 00x0 B>00CS0 0S mGlkGD0FX00S i@00S c\Y(%f(%Te(`Y(xY(hY(dY(0 @-`o$M 0 00^0SP4P @'000p\s p%P 00S )@u>98u0 p000CS0(00S  '$Ѝ%hY(dY(C-@?mM000@H0?_00?0,@0P@ `'@P0o0`p00dp@Td0hP@0po 0lP@T 00/P0l $00`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0C7S 'x0R8 P>0S900SD 4.0000,0(00 0p(0&p  =&0S(7S%00S 0 0S= 8  x=, Yup@ P 0 t= K8 `= <=, R , ,( $P000==0S @U0 0P@IK/P  @J$ 0 $ R 0T@ =lA70s0S^AP0 Q AqQ9 R 0 00 Q0 -PP -P R 0S0(0(00(00S  8 @  (00(00@0 800408<000LP7 7H 00R{0( 0>$0SP007GQhH 0'000 000 7 0'0'00$(0x7  10103/$0 7 ED7D' 7<' DL0S $J8 6 6 @ R[ 4 0  V $C&@00CS0 dl60S tP 60S&,0tS5d6$6T h0 J5,,0( 30000+,0( "0xE$0(0S,$ h5 p50S X45,0S pjrtE; %0(50S F0 @0 V@P@ETv=0 0<0$0 0C0 000D0004 8\XO00CS0P40S P( p40S)T0SXOjI8 3 3 3 \ $4 03҉)ğ00:3 0 0S '|0R0#C,#0 0 3 Ch+J00S0prN0"0C0000MOI8 2  2  2 \ 2 @)Ÿ00 0t2 T0ST"00CS0 (2 R   02D0S&$mߍE:10S {0D!SS}1 08 L0H@IIs10@0@0S h1 @0S1 L1$ @0S  01@0s`1 R#0SH1   B  @0S @0S7S@<+ 0 00S *9p@,0S0  \<,0Sh@ D<0,0 0H 0E@Tf(Xe(xY(Tf(Te(%b(hY(0DSY(A- 1@PM`Rk0 1000  ;pa!XZU pA@ Q X@T@Q@A 08AS 00CS00 ~@ 0* 00CS00 n@ 0 ЍQ @@U P000mK 00CS0T00S D@@80f( % hY(dY(*04p@-P@@Pp 0S%SpP @p@-P8@Pp 0RPp@h- @0@ R0S P P\ 0%Y(G-`P@唀0吐00|Up00CS0h00SGC0S0 S 0S00#^PPphY(Y(%dY(A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @V$P`0W:SP0R@f('%RA-`P倀000|Vp00CS0T00SA0Sp00pK]@T`hY(Y(dY(0A-pPS R+ဒ`a@T"W p0000 @0 0 ]00CS0H00S `P `@Y(hY(dY(p@-P$@Pp0P0@h@-L@000@00 W]00CS000S@`hY(Y(dY(O-PM/`@ 0P @@@k (nP00š0 0S 0S 000V#   P@ 0P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @u 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp #P pP t"P R  R (mP0 * R; R 60@@DW P R  P@0000S R    BR 9D R5 P3 Pf(Z%Y(%}hY(Rc%hdY(O-`Pp$M `x%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQ=01 >@$Ѝb@DT@ P  p R   U 01W VYXU' [1 00al 0aS v00@0S v P >W 00SY0 0 S0 P 0< S0 X\b(Y(%f(%p@-`P0000S S@I000 00 00000CS0p00Spp@ihY(dY(0@-x@M0 0000\0P>00H 00CS0$00S Ѝ0@HЍ0hY(%dY(@-yP 0SHO-`pP@Md$P0cS @@ <FpPp vPP VP@ 9 RNcS @ :-0S2UA ̲P0[PF UB< P9 <@=T( 00S$ dB00CS00 u< 0 U< 0ROPU E<0@ T  Ѝ<@W P` 1000  `@`P1V>0 /-PW1  [ZUr<bkPUf<U~\~<U Ut Uh UXK<\b(HV/%3ff(lqwO- M$B$Rp0@T0`V% VV:V  V /V   BR <` F R   Ѝx! R  \a[  0000S(Q@@PsjQP@ @T ~p [ /R0/S0PW 0 BR r R  BR    BR    %4Z(@`(% A-(A0S 0PS0 0aqP0S00 P000xY00CS00S P 0SRh`hp0P RP000TY000CS00S ]4Z(hY(dY(8Z(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `ZO@{0S00S=STL00 <0 R0AD1U0 S 0S%Db(db(A-hp@R0@S`P  R R00PH @4Z(O-r@ᘲ0MR00$`00 004B0嘀C x4m0SX00`@ 000CS0D0S00CS010S Hh`P)0V00)PhP X P #X10S 0DC}0@0CS0 10S ~Ѝ0S`F`H`Z' Z$ 0S@ @Q0 /PH  p @Pp P0C0~00@00C00C04Z(%hY(@`(dY(xY( 2O-0pS`Tp0 Ѝ@1Ա 100   Z :[X0S 4@ xqQQP  PQ XIPD $ DoQP @800 @P  QE Q@PQ@  T* R RPP `P Y <YP@P@ P4Z(f(8Z($%A-XPX@X`P0p00W0p0CS00S 4Z(hY(dY(p@-P@W0@ p4Z(@-QpP0` 0S*00E@P`PP `R@ Ѝ `0P@@0`SP0S0O-0R0@00V00CS000S n0S @pWZ00萠g@ 0 Z>EꙂ! P00 R @^(hY(dY(%A-`!@S1p@!P I8%Tp1@WV2 `1N0SN U 0S0PVPUV 1Dpe'G 28#5#060S$ .#+#(#V+%(%U 0S SPPU\TP L WT 0 V<`(\Y(4_(^(%%'08 N R S  0S  P 3%O-`R0pMxB0 pP P Ѝ0S0S "0@0000 0#P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 嚲"S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S .\  @Vz   B/oZ"  "0d(hY(^(<`(%%dY( G-pPK@P EP1N0St ` C@|UT @xUBp;E `㜠@0S0S 0S0S/`@Y 0 X 000 9%%j'^(A-@_ PPT0P 0S nlP@ pP@ ZP@mt06 R0S@@PX` p9 0 P m\b(%%O-`s$M PPY30oV &P *P xxnU pUV \p`H3 R ZP$Ѝ3P\ ZpP&0?oQ20S P VP  Q6ZP@@=Y pW  pP 02 QY QvVP  3(160SI\  \@ /o"/ S [ (\@ Q 0p0I#Pv@T R *  W R #0PS  R 0 S0C 0 X 0 R00YXcX `Z^ R[00Vlb(\b( "^(%.p@-PR@\a000 R 0S 81]Ap oD!z0S 0 00E1  S j00P0  Dt@ RQ Dt@@@Q00R00S O0S~00CS0000S phY(%'^(5rOdY(<1p@-Q00@S#$P`0SP00CS00 # 0 $0@p .C.!#PlP000V0@0CS0800S p^(4D%%'hY(dY(@-Y @ 003\b(@-@ N @3p@-`@0 0 p 0Qp\ PU#00p^(1 0G- br0AUqAЍ CR  )0!PU0 R 0S\S 0S0S S S=S) " C< 'S:  0!0 S0B 0.Q"0,0  }00 S$0,"0^ 0  :0 1 }SQ0 0 \0$0L "0D  U 0"  @PE^(PUM%W]A-@`s布MTL 0SIPU0  S0S p#"TR 0 BRSD@0#":P=;@`3@P)'@PUV0S 0S |Pp `ЍP@DP$ 0S P wPlPcP`Q f `Q0 E`PV8 ? :0 S`A >v P6 P3 P0 P- P* P'xus^(e.xz|Ujmprugp@-@PTpU0RU 0S H@zp@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 p^(%A-0P@`Tp R@ 0N@T P 0S@@-PW\0HU 000000V0@ <`(%%A-P`p p P@ 0 AqA}0 G-PP- 0M00S _ow1q R100 0000 S a@PЍ0SF  0 Q S/R CsP P" Q 000S+  RA ``0S:SV@"00S"@? @00CS00  0 ( p0ST0 @$00 ^(f(^(f(Y(%@`(%%C-@M$Tpp``P A0S 60SP 0N# 0^0w P1U00S^0SP60S .0S } PP PЍP ^Y8 0 P0C?o20d(%%%%0^(0S/p@-P000XN@Pk00CS000S ITpP@T` `@V0`0T0@0v0S V00T00p@hY(dY(%p@-l@0P00NP 000CS0 Sp@000S hY(dY(p@-P@_PU\$p@-;P@-<P p@-P@!>pA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S %hY(dY(P @-({MY 00C00/%00  0 00   /%@`(p@-@tPt`0000S0 000D0 00CS0p,00Spp@f00O=hY(%@`(dY(@-D@ 00040 00CS000S@JhY(@`(dY(G-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SG E  P0)` X0`00hY(@`(%dY(T 000@0A00CS0/00S/hY(%dY(p@-$@P0 0C0C0p%@`(A-`0P0p@0@D00CS0%@`(( A00C 00 0C0/%@`(-A-@P(MHp@`DpPVP u T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@<0 P p O-D4DcO-@fP`M5pP0S 0S20YI T0S SW` aW@ HW`P V `Ph  hŸh00 C RS P cP D Z% : KpOU< T0: A:#@¯V`3TA @ P TK 0 T8PPqpT-U  \(U @ 0S@A01 (pЍ T0 0@QY  @ JP 9;{@ 0S㌧0qpl 0 0PL\b(p\ %0_(  BR00/0S0/@0S/ R /0@-00@00C S  RR R1\ * Ѝ000C S0S//p@-PP x@P  xP  dP TL:P 000C SqPppppQX0 0@- ^ @P U@R000/%p@-`@`P6N0Spv@TpIIIMI@I 0P p@C%(_(G-`P@R]Q6 @pA(0S  0- `V@A00CS00  0 @ t1`CQ 0\!S T@TP<8a0 R 0R- @TP@00CS00 K 0 Q ,P @1@XT@Q@pQ PGGpW, @-f%% 3=LTZ 40\+P@--|%0S/p@-@PPEPp@D8C8A-@1SV`p@DPU 0@P00` PRDb(O-PP0q刡0U`0SP  -R  RC -R0SD @0+R7 `;cP[ U00PoP0S P ` `U @-rP  R `AX @U@0PP ЍU0S ЍOyDb(`b(%P0A-B00`0Q 0S 00S0S006X pW:P 6P6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01Q0CPC0SQ 0S P0   000S 0 0^0 PA( R   R0 0Db(%Y(P0 b@-\@000D00S 00CS000S "hY(Db(dY(000C S/ @-C-P 0 Db(G-0p R` PU4\ 0S -R Q@ 0L?PC10@ ! ,YPP@ PQ@b PPP-U0S 0@T0:SF 0R@1T0:Y " @P'@ P0 T 0:S  @P@?:\00|@Y00  T@0 0CC!08 2A@ Ѝ%P@-HD0P  Q 000CJ Ѝ Db(Tb( $0@-S Q*0S-QQ -Q^ R0 P :R0S0 ^ HPP0=@:T  ($Db(@-G-dR@ 0S P@ -R\@@$0P 0S 0-SM@T@F@D@0S 00?q `0@B0A00!FS:0P:0`0@#1P0 0V:0 000CS0 10S 3,3"@0S`p0C 0 XZ0Oa`F R 0 0CS0H00S z@0S ^5Db(VgyhY(dY(p@-H@HP080Sp0u`0CS0` 800C80t%@`( 0R @-@T 550  B   B /@-@0S@p@-P@0S0ڈ80@0 2B ! ! !!  !!p@-@9    @% 0S/xqQS  0s0 S/00 0/0S/0/ 08 0/=P/P/0/ 0 0@-0%Hp@-`R`@PIP #t0 0Ppd0 Pp0-S0S0 0pV ($00080@p0_(,_(]%O-RM0p0|p R XT"T2Tb @L 0SRy RR00CS0`1``@u10`0@Ѝ\Y.R %H P&  BR 000;p 0 S B R y Y000(p[@X@  BR@ Y Y  YR   Q P Pp P  Q  R P000<00  K%k%%@`(%0@- @M0P S` @p0 Pl l "V0P U@ Qx0C/  1x0 %BH@-P@M(0 0P0Sp`@T*vpPT @T2PLP @0 P4Ѝ@%%pb(gut000S p@-`P@T T TH p<080@p$0 /p%Z((f(%f(@-0@UZ(p@-d@dP>\Pp; P 00008  P8 ( -p@&%%A-$R0@T @ : R 0 @ q8 0 00CS0!0`)V#V V v vZ A b`p! 0F S0 V@0000 @\V. |V ;V&P @0 ;P @0 @0 Pp&P@0 @0w|P@0 @0@0@0p P  00P000S 0 %%`Z(dZ(G-pj0@0 T T+P,0S)㰀" PP @ᘸ snG@`P  0RP `FFa@@T 0 %p@-`0$P P l 0R$, (@R   RPDPw    Q  00000S@p 0 BRp@ b080@ p%@-y0 000%@-@oP"p@- @fP P @0 000p` P #@`@`% O-鸑`P0 b P@BPp0 CR00 S 0@@0XX U @P@W W. V. 0@PpGW PV oVP 000 0V wT001Sy 000h001S@ %HG-PJM05@0 0 05 P00k400D$0OY`P c 0S Q1 # 40  4 =Y$0000 `SYT4 ` 垼84$ 4$00CS0! 0S$@PUY3 0RPPS p.0SP Px +30S x3|@|3|0pT00 0S  0 `PPB P6 \P p(300p" PP0000 0 0 20 B#200#"U0S"P R \00\0@0 $P00CS0 P@0000 @("00CS0 0010DPt Qo@@k1000S c 10 A0 SFp!倁V@0  0 0C08000n00 000CS010S)0@0 0 0 0 02 P B1 0R zz0u`@0PEPUZJߍ2L00CS0`bR \{00%\Y(%hY(%dY(%@`(50O-܏ܯM0ϟ  Q"/_@/0 0202280 `00|/20S@0S1@D" 2 pW `R00S  /00CS0.0R00S 0@0C0D0000Pl210SxPTP"PF 2P%p~@k<.U0@#S00 p6 p00@ S0p@ A0@S7p@a0@SaWp@ [\ P0000P,'P 0@Yp00@S gyp[g'P9`ppp= 0 0CS00C0~000p@S00@S0p@Iwp W00C0t00jA`0@?o? @2;R0Sp z\P3\Ppt ?Pp YW6;G S8 5:0 S ^@0 W0C *0?0'3?pp00s0 S0 0C0~00@00C0p$W!*00'60'3?00q Q~  B  ?pAp00s0 S0@0C0~0@0•3W5*00'90'6?00q Q~  B  A0'3?00q Q~A• ?p Bp 00s0 S0@0C0~0@000C0w300'<0'9?00q Q~  B  A0'6?00q Q~A•  B 0'3?00 r R~   B  W?p00'?0'Y/UP1>P0 |P!000P$@A 0Ѝ@PW0 ,  r0P) 0&P00 0<P_ >P &P 00p0pq0((0 @ -P 0(0  p #00@0F%%%@`(% `Z(dZ(vS0_(,_( pb(%  0{P B@ 80 } pL0 {[0D 00 B #PA}P@ 0000@ P5 }P' @ 0 {AQ'=0AQ@=0@Y0%[y :[4 #[5pt|0@ 0 p0K P{AQMY 0@ Qp 0Ap96Dr &Pp@<YA+ Q:p%pp02Q1S 0GS2@0  W z 10W2 ` !n!y@Q{q@p[p, Io}[Q 0#p0CS0p pS@'P023Qw0  00"0 `!6$0  0G-`Ȁ0@T@@0PU @ 0S 0 0  B/o"Z`0p 0S 0  0 0 0%@-0P0@-2aM0$ 0 10< 010@0͵1|0000RPI@1| 1Q @@00O dv 0S $Q. 4QG Q ,4  8000<  ,000 0 0 y0 0 0 S00aߍ0  p0 `0 `H0 D0 H00S>RS,0: 0\Y(%TY(%%`Y( G-Up0 00 P0    x5P $00pN@,'tP 0 R 02`      0@0S 0 00> P0, RP 000@ 00 00 R, ROP3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 `00_`0 SlP X0 R   L000`0S0 R Ӻ000P 0 R000> 0  P 0@S P 000| E`@`#0P00`g P0.    00PU# T 0S "0@P0@00S0P0S0S 000@Ѝ$00pr%.D%%A-Q@`pQ` @ 0p P0 0W@ 0q R$@@`HR ( X% R"p0 `4 P ^/1`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0%%Gf A-P@0 P. 000 `P spm@`h`@@P 0`0 U000 UPPe``0SU RP%%xp@-@|PP 0 @iP P 00000Sp &pp% !P/0S/80 P/0S Q/0b(A-@Pp`00p` P@-` 8P0@ pT@Э PP ! 7 Ѝ C@P7㑳㎳ዳ㈳ ㅳ  (9% 0P/b(RQA-pP`%k8VU``P``V@ 7`0 R@[8P P) 0卼70 %A-`P@xpT@Q00C0U U 7'@P0 PV7b(p@-X@X`0P0000'00CS0p00Spp@"hY(b(dY(p@-`H0@TpV@PU P$7Pb(|0p@- PR QP@ 70 bP C`7) p%p@-@pP0 S00C T  D6P 0S6,03O@dA T @0@p@%gfffb(p@-`P0 Sڜ S  6@P t0 R@U 6p0S 0 S 6@0S b(0_(%p@-P @0Pp @  0pb(@0@-@ P  R c&@60b( 0 P/ R/b(C-(P0 U0M0000p#0C@S0 ` L6@P @2@喲̻  bV J6 F62 R@Ud2T /o"Rm 26h`0"06@P2V0S' `6p@! 7pXP6TP 1 O养 0: S 6A00``!l`P!` `V'oPP ' 0 V U0S00! 0 "1P @' 0500CS000S Ѝ@rdT  0P' 8XhY(Y( %% t  ' dY(K Rp@-@`PP Vp ' x嗺5pPV u5pV s' 0P0 p  pG-` PppW@䀟  OPA p0S T Y  <G8  t20@ ,V  H&T 0S @V@ P%X ] k q ` e p@-P  @5p R  5p d0 Rp  4p 4p 4pb(%s p@-@PpD0 0RPPp03/4Ppb(O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P & 墹4PsɰPP jT 40SX iPSn4P0000 Sl\1 0R  Y4pP0C S Q&  P B4PP 0S( 84PP0 RPU ,40 500CS0p00S T0 00`YS0Sb(0_(%%%,_( hY( %dY(O-P0@l#lcMhsP P00P#D,p,`U4@D\T(Sh 0Ta000pW` ,@p00S0SʩP0SV0SSp0sS vS ϸUPp0+S -S T ᦩ <Q, R: P  1  ($PT 0 @0SA0MЍUF p p0      "TR 00喯X% cr   %5S B3pB% 043p0Y0 M I 0H ꠴-&- i ,_(0_(     h %4 T s A-PQT 00CSPDq12SK R@ 0r`0CS00 `0120<S R 0q0S 0CS>S RSxh R 00CS0N0 -    p@-@0TP R R R& 1S# 0 ۮPpR!Q QT " "D0600S0T0S 00S0ib(hY(dY(%@-@P @#PKP @-@P cLP0  8 % d( Qp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `( + A-@|P|p0`00 T 0000CS0H00SA0S 00S !@hY(b(dY(L P0  /Q Q0 S//b(@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: ɭp3 0S$ UEojp' W`RUK0@D>T000 0 í00 R1TPx0N R T  DR 60SЍQ Q2 1 @$ b(<`(%Xb(PO-@`P¨P pἨP 巨P0@DpSppTPA T媨P@DP:P5@<ᠨP, (4  咨@P@sSa0S 000 T $00CS030S @@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 447@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 @`1 R  T` F00CS0400S - 5 8 0  %3 b(hY(dY(; E + I T ] % b  G-PPE o@0p` TUG0S 00S 0@0@000CS0 00S ϴ@b(b(hY(dY(p@-H@P02`S@20CSpᝫV02pb(40T0P?o20S 0S//b(C-p@`1010r!Q0@S10C1 ЍqXPU X2弾Plh믾P 0S Ჾb(Y(?0!!R/P/b(p@-8P\2Sp@\Bpb(0-MM01`"R !R X"R   1 1d"1!d2S ,GPl1, , GP L!0,00G@P$1, ~@T0d0`0P, U @T 0S 3P00CS0 ! /ت00 0$0(00D>S ;00 .j0."!031b(Y(\Y(hY( 0@-`"dyb(p@-L@'P^0PPp0C/U00p p@-T@TP0 0P0 0 0000CS0p00Spp@蝳hY(%dY(A-@R`P`p j.0PPEUp WDЪ0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000U0 000CS0h00S =sDP`000B0 0C00e(hY(dY(p@-@P@0SH00Spp@00CS00  %0%0%@-@PЍS -@-   Ѝ Ѝ/-@- 0  ЍЍ/% -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`PP$ 0S! l噟0S00CS0?0 "  v00CS000 " 0S \pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' ~  %0Q%@-@0%@-0rS!  0p@-\P@-  Q%  0 `Q R @P@DR 000S=SA00@0p@pp%%@`(0@- 4@ 00C00 0 02Ѝ@e( 0P P PR00/0@-LP@^ ^  R0L00 A-鸀(  R (p`@pW p0S 0QPU  0S 0S   3/P@P00\e(0Shp@-@8PWUh 0Sp'SPVP@'ӘPP(p@J EF      A-P0`Sp@    3/@PP@X 'W "p0@=S0U0 0 00CS00  0 00CS00 | 0 T %O-@00Sp 00P㼀✠`V  X 0咖@PU* ЍY   [ QʁaP`0p@e(\e(@0 S =SR/=S/A-`P0S=SPERPU@'\0\p!0qV@pT 0S oPVpp@@e(\e(@-1`0@S @  PPT 0 `, X `^  `P Ѝ@@Px2 000G @PmpGW 9Pi TT2Hn`0%SbPP`pW 3sS0S`3pV`/ 0SpFPPW1 000 @P@@T`m>p >P 弩|㚩1l@P =@PPU0St@E>pWpGhꑠ0 0 ᢗ 0PV 0S  P1r0*Q{0S lQ0@ ]☩~ $pXu0 uZp $l&%0@-DMv0   0@@DPU$#@0 $*  ( $  f%PP@E L,  YDЍ0=bP lZ(Z(.$%p@-00S 0| 0x 0p0p p@0   PU P@P0P H0H P p PpW`Y(`Z(hZ(|b(%b(%%%%%p@-@0@咵 0 0@0PU@IR000rA d0 R 00CS0H00S ^p@@C0PCY(%^(%hY(d(dY(P/p@-@PTp000@A-@P`pT0   S*0 @A .0000   0000@ F00C \ /p@-@P P0`@  0!S0 0 0 000@0pO0 0  0 000 00 3  0 000 F*0@-@PM  0  U  0P 000 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /KP/H 000/f( 0P00/f(A-@pP 0` V  V t@00CS00  0@ 000CS00  0`f(%A-`@pxT [TP'T TG "T R傧 x1 p\0DS0 @@7T/T@ 0`00CsQPRA`ET@@0P0  aCQBW0CACQ70C00CP@V `R|= ``0 \@RT2 80 @ @ @ @ @ @Gf(~&@-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0f(&0 0XY(e%p@-0S @0AAḦ00p0@S tPP0 0CC``00px"Pp0`0PPE4EQ0 唦00pf(@-P0`V) 00Y  e0 0@00p 0 AdAo0@0T0 A$A^00 Ѝf(&H@- P@p-~ݖ `&~0P h@ 0\AA&00 ЍV@@T @ 0AA)f(r@-`0@T/ 0'R"R0PP Ѝ@ P p+0BP d0000 0 A@A00 Ѝ,pPf(&}G-v`@V@TP Lܥ0@`0pF ,0p@P0f(f(0O-hh,M0X0\8P P1@01%ԌPp PE@ LP Xp(p70PEAU,Ѝ0  000P@`V7 0S 0S\V $`7P00CS00 07 0$ %V0%S@600CS00 }6 0P`媵0p*S`p0.S0@*S@pZ\;P叵`p8創p@0xZ0WZ%Zo A0Js R %X0J S00 %S00 ;눅\P x ᗕ# P \Q \0l\ s00vG t 0 D\ \LQ  b '\ \\ "\  \M \^0? \^0@-000fnrtvaet BP0030  C 1 01U똓`P d` P  db  Pd  xs0 v0 t 0 0囵p B`0 0@ 0 創t0  倵#l cZv t0 O <"0P 00t W 1|j  1v t  j 0et 0^h0P $0'S"S {YX0S$ L v t   0# |8괚0$0$ Y t 0g#v t   0Xt 0NVBT0 H唣 f(%&&,0g(h堕0C- 0`qMP` Pp "@P 0 0p"@PC 0p W ) PuY <YvP0P( 0ES P  00S00H l^YPH0?S0 -S00H0,Ѝ, 0RX`7@-0@0 0 XE$TPQ ] PL  , Ѝ0@6$00 1$ PK } v A-p:#P008S@P3 0S0 =PP S00 ``cVtP 00 `8iVPP 00 8ڔP( ` 0$00SЍlVȔP 0 0oV徔P 00 巔P ` 0(0 Q 0SᥔP00CSD `0 0 0S           0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+$@V0@-0$ 0d8 Ѝ@-@4000@-@4ٹ000@-@(0(S00 0*0,0Ѝ`t p@-@PPÏ뜐8嚐<嘐@喐GPD[`⒐U\匐`, 8~`V0,0p @-@4嗹8 0,0@-@4卹8 0,0&"!@-8 @"!( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8 @0<<@00,0@-$ P R Ѝt !@-PtRnt !@-PiRot !p@-0MP`0@-S00(00P0 0  P P 0( RT  0 0 S40(03/ЍpT%(!0"E"A-@`PpQP-U@QSP00  PDP0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp"#$%p@-$@P0S !00Pp8g(Q+  0 BR@- ! M| 0- BSs^0@Q ^ 40 ? 0 C  / /'@g(8g('p@-hP@`V P!pJ`HV4!,!!08g((( ((O-M`pA P U d !TP L !XP 8 !PW $ !PU Y! P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WUP8:TU P !bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU P0U(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?P,s0SSUA t<ST[ TZ TY TX TW TUx tThh BPUbЍ0i0d," @T   Q !  0P녡t0 ! P Uᅯ ჯP ps))))))))))((((!( ()(((.(/(5(6(<(=(D(E(L(M(U(V(^(_(i(r(y(z(((((((((((((((((((((((((((((((((()) ))))$))))")*)+))2)):)C);)B)I)J)Q)R)Y)Z)b)c)j)k))* *@-酔 *&@-000 SA 0Hg(*&s@-@`ሔ000 #S@P}0S  0yN00S 0 iNЍpW+Z+0S/#Sp@-@,P$p{0P 00pHg(*兏@-PRP@ p`Wp 0R" Ѝ;0"S0SO 00SS  00@O&@-TPL0 *p@0"SNЍP,Xg(`,@-TȋPL0 p@0"SMЍ,Xg(,p@-d@P0S 0S 0SS 88@ U   SMPpXg(,p@-Px@Q dMP L0   P    pp@ @,/Xg(0@-@PPM 0SLD00Ѝ000 0AP0 0 /tg(0O-Pp`PPM 0S<;$ , P 0S  ߍP/0 S 0S @s?0P P@ P@0ST WpU: 0S  H 09/PV/` 0 Xg(U0-0N0q0@-!0S S S8 4 ЍS$ Ѝ+1100S10/7@-lP$ R\L;@ HL$0S p (L L Ѝ0Xg(1Pm(11p@-@P 0Sp@o0PS 0P0M00Sp"2@-顒P@@ D`DHp0S00  02&C-P`PM 0S00(p/p0 FP" /Q0`@ p0@6P T0p ,PH$0@@ 00Ѝ /tg(Xg(2O-Ppr0en `U TRP2!&L828B( $F, B0 >8 :4 6#4尀DR D ", 4S % 4S  4S h 4S hL P0S P0  T0S 8,@8Y  ЍO0S0 a`v`n 0 0 0TS !S1d7  `0TS:3  0Th# (  0@P,&03@3k3t3}3333BB3@4P4(G-Qt ,@Q`(P0QH 4QP4PQ 80S,00 80<0S#<0P:PP:P1 QB"7`8X0apSwp R l <0RTP)0< S4P0S9`(同Q (剌Q @P0S0 BS `a 0ph0S  0 S* 0Q*da 8Zi4x44444 5Xg(O55564!55N6O-;$M p*[bP 0$S  ߍS dP@0T[D@lP 00뉔 40ਛR YS< "$0f0Qjf/ ȏ,2S,!R !PP0,21S 1P P, @oP  0 ppdT1P8 P, @P0 0008?s0 R* 0S 0p P 0S 0 p1Sv   @1S  f/ [01P P%D Pm(Xg(t66VEW}}k6WEV626,7W7$i(&A-P@`+Pp %R 0R00000"5S P vL $0f0Q ,J(_  Xg(Pm(w7g(p@-0@zP  P$p@ J0@-0S ,Xg(@-P  g(O-@:`MЪM 00@ SPG  {P00 H0S`p :PP(T -@004100SPP(P݊P+U0P z(P X p9 0,0@P,0S  ,02P P pGGqrl嬊Pd,- X奊PPyR H, VP0R,0S  S;ʑ 0;v(pTP,00 MP ,00,0PU 0S,00e<P,00   @ 00,0P, 1\  88 @<P(U@ 0SX;U0PW(AP (|-7P ( . P0(P0,0P,0S ++RP0 0 D- P0(0,0P,0T0 0 B; P 0(0,0nP,0`0 L P 0(0,0]P,0X0 \ۉ P 0(0,0LP,0\0 fʉP tʼnP 0 (P0,05P,0d0 ᳉P  (Pd50,0"P,07 ⠉ P (P 50,0P,07 v,叉 P(P40,0P,07u 0 w@y4 x P (P40,0P,07^ 4f P 0(P0,0P,0x0L H4"T P 0(P0,0P,0|0: PaEy0S0S  {L0Y:3 QYڤ0 q&0H 0@2|sT(0S1  7(PG 2X( H3]00(00SH # 3  0 R L0( 2000"0,0 0 0,0hP H*@, !Xx Ȁ˕O 10 ,00 (0 RS P  (0,S 3@pݍЍ[ $050 $0 QP ,jP$01 0CH 2xȀ00S (0X Hx0S~81X{ ͦ0S0 (0 RS Pf  (0,S ڇ (0SUt ~ RXg(7"207727778g(58D8778`8g(g(y88&9tg( 23&9/3+@-`0pCPU V  P4@P hi Ѝ`P! 00i{0@PVv398$00S @-ό00H%p@-@5S4 0PSP p@0Pp0S 5S 1S F|Pp5S T \Pp< HPp(( PpFXg(g(4J :edArdA(:7@-1AP(000(;_5 S* 5S( Pi0S e0S005S | Pl)h0hPH5S Ѝ0< <mP0WEVXg(fd9:mdJ:H%@Yg(gd[:@-@P f/0@g( 0 LH%Lm(md0S/!  -3@-P T P 0S S@@ ᠍P@Ѝ0@ Ѝ/H&@-0@Q3@`4 1 @P%BB@-t@t0MQ C  P0cS CS SS ,;sS00ۍ0P(BC0@-MM@` PP 00YSP ,ۍЍ0pP9CIC[C 0 $m(&@-@M0 yP ۍiC@-@ 0@ $i(&$m(u@-YMM@p p\YލЍ<0< S <fGP10YS<0<0rdA}CCC@-*0gj zgzz'z'&z'z{zgzzz { Ѝ5C7@-P0@ 0$S0S/ Q0S' TQBQC0AQ QI00S 8@0 ᚄ 000! S0 c0As RxEtC Ѝ0zg{{' Q { zg{{{ { { @P(BCC@-\@\0MQ C  P 0nS00 yS 0*3ۍP(DDP `00CS`0p S00 P0S X0X /XH&C-` 0pP01@P DpGKT@ U @ 0@ yHPPF!p 0l Q V (PU PP pX Ѝ}DD \&O-PM Mp$z咯0@S0#1!+p+ P oP4 qC4q`C.P%`0 d p  P  ((p P  D>QP 3O[ΪPp08( p P  DQP t3A-0(0d3[`C, Tp P  DQP ~0,00 p P  DPP 20008 p P  DPP t2A0804 hp P 4 DPP 2A040< qpq P  DPP 1~0<0$\p\ P  DPP 04$HpH P < DPP P04@$43p3 P  DtPP 04P p P  D`PP r0P0T  P P DNPP |`0T0ۍ ЍD$i(&BEE>EQEmE(EEE FOFFFFFGЍ0X(zd@QQQs@-Q  p >0  "0 @0`D   _0    0  0  0   ЍpX(td@QQQRQ( p@-@PM`PR  p  ( FV V dPЍp (oH( p ,v> 0X(}d(@SS~d(S/S0@-PM @ oP 8S>4P 0 p0 N>Ѝ0=SX({dЀyQA-`0@Pp!匁0M00x!Hp0SP@XBT Y p  8&>eP qP p`(,0Q 0$0S* @P >QVLW  V 0}r0( e_PR0c9t00(0S0Ѝ00* *  (`@꠴-&jSX(|dmS|SSdsQ@-P$M 9@P p p=0P  0;0P 0P}P0@p@蔛<p@ 0tg @`a p@U@<}0PptcidyaraXrbmngntsXXXX0D S/ 3C5C$1 4! 8<0/`(0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@`( 213/P/ሑ(A-PT0p(,`{@{,0T@@DA?@?@@`(?0@-0@0 (20,20y0P!P30`(> 0R//G-`0(,Bp  Py E{@PP W ,20CS(20CS G} 0`(ZZp@-@`42SM%^ l  E 82<"@e  0(2,"^ Ѝp@Y W {<"82Ep`@hI m,"(20> X"\mЍp@8 `(%ZZZZ[ [[*[s@-P`  0SЍp00S@0"S1Ds@-$M@|y80́k $0 0 Z&A-`P 0p @Tʬ9 /, s0d  ? fuqp  RЍA3L`00S`@D@,~ Ѝ%^^`(A-@0@ @`pPpd1ČL0\ D0d^\^ 0^_U`(/_p@-4@P0S( }0B1p`(O-PTM0x 00$03p  @8 到A ⌠e00,< (0,0S7 3,(23`*E 0$4 0x40 ?x 0x  0p x$0: d"lP 280<p "' (Z ` RL` $R0 S 200#1-R0% TL L`P@HUt,0P00S $2 tP! 2 tP 1  tP' (0L00 SD aPx0g2(08 kE%KU\1D?C$<1\"00xP@1\"R@ x @XRx  X20P@x0 0X20UP@x0 0X20UP@`L` 0U$0000[ 00S  0(0$0 00 /P @TЍ P @c_`(%r_ȓ(H&_&_-7@-@j00CS0 8P Pp pp 80 P00CS0880 Y@o Ѝ0@Ѝ/H&`_O-a0 p7Pp/B$@0eO 0sqp Ѝ  R ЍOWt`r0S 0 sqp `BPE,| >0S %!``(p@-|@P2S 0h`n/(2|!1!1U &"U 80U p@@PC @E|@Tp`(ؚ((G-b@p,$PP y7 P UsW剔LI J$ c,|U0U 1U01 ;I0s@s \ X"pG' '"q!'|"",q!#34#sO8#@<#$(,0#$1!#(#!1?  !< #01 1SQ" R@ʉߍ@ xQS.82SbV<#  Ipp  000" 0p `1V0 002Rڐ" p"h2R Ci0.IyD 00b1 RS  0Q1R 0.J 62S0[ 0"P- x1R Ci0.J?X02S2S0  Q20S*F0)S  wb0)S  o0#R00S cꠠ0 K_0--C B U  0S;'!LP@2`(chchb%h^hjbbUj~aC-|M4RUP@P@lЍ(0PPB1P@P0a0aTS ЍC q  G 1 1 0 1(1!1<0;  1L1 ?0^1!1<0o  1 1?0ЍC`(j^jjO--P&zd@&b~  @-o 3&-0@-tQBM0S 0P?o20S@@Bߍ0@ Ѝ/,aF?!0 RSP  S % @OoBa00CS0*@ T 00CS0* P  @YT NTY@DOoB0 @0  0 0 S(H&&0@-M 03s0c00@St o8PP$ R!0PP, 00@ : y 0PS rP `Ѝ0S eU0S\0S‰\  0/@ \0Sp 0@ 0 @vp 0S0S喉 i@g0S勉  @" S @0Sty @D HP@ @0 @ `-0xP|"%  k T`  ` P @\ @X U 0 @``a YU PB R`(((ˆȈՈ@bʉ4OG-0@  0P Q< 0 PP  3 0`P t pЍ Q*P !URQ 0 l $m0 pH00W0p P  0Q0  1!0 1!$0 0 0( 1 0, X0`PT  P8 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pc00 QP    0P JP tyJpP1S1S1US1S 3S3S3US3S, h pP0p* p2 02 121300p0c00 QP V ZX8  C 0Pp00S1<01@040  0wc40  QP  C 0PA0O A0  NJP 4 0R  eYX`V P0Eh 06#++R`DX4 $0S,0,  RT0CgD0"P#10P 0 # 0QL \0  0P 0PdPd@v8TY^RRaArrAaU7OhɌ@-p@i`P~ P00 P0b 00QP  Ѝ 0P< !@ !0 P0b 00QP 4 Y0Pcꎊ8@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |D0 | 0L 4   P00SG-X` p@P Ѝ0PZ%V0 0?bVU D X0  X0 P\{O-@,M0p@l@$0`P PpP$P @,Ѝ j 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P  "~ @P@CL0p!S sP0S{ wp0p P p  `Z IS L2Q0 2 q "" @ "  @*"*  P0@ S 2"!"0  0@ꎍ!P p p0@/ //2)O-`@PpMܡ0P0S Ѝ X 0H sA 0B { / 0 s qp6JP0p@P x q$0`24P 0 00 D+P 0 0̀0` NPk { 0|` P \P0 0 <`P ꋏ7oÎBR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0 SO-0p` P\PP0S Ѝ$P  qQ 0 @T 0Q\("Q@ PQ A BST" R t D r   0 TS000  R ꤐ0 0 m I?P [P  I BPTR2 Q PE'aӐO-X`0pM@kPPX Ѝ h0Yl0L (2 R0 r00 PܑP" 0 STR rH 0/[P| h t 0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 哊("0 g_ QP 0$ P\G-@`PpP0S00S <q/p@q9WP$0S! 0S 0S,0( 0  P0S 05CP  PPpl Q 1P l0p<0P0Q*l0S 2Sl  hTP0P  RQ@0 P 09tm0(@-?`XPP@@\@#T@TpW @@T`L(O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0^QP fP0 Y:0 0 0^QP PL> 0 -P<0T 0B(ёO-M@L0Sp<`@DH S  uP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:\(( A-@/pp0%B?[`0S a0ES PC ?gp@@0T?  C0(0 PKt %/(O-` 1aMV( 0/ SP0 S@0P`,0@@D0$0 0<@D0& R# X0p1#r380#8 (00]800 QP aߍ0P@<`,0@`D0$0 00 Cp`02# t (|PW00q240pGHH04 SD00S    408 2400(000]800 QP (100  RR R0(10P PPL0sPPt!E0It1@tQUP0U*0" 00 0p  x1S TVP@ 0I 0000@x1`DaPP 1t!R h6XPP 1c t10t1#40L0s]?000w10I@P30 s0Qs ,0RG U 0`$00`P?x51 SzR`aP0S 0S TrlLR P0S02S 0S0Sz 0T2SXTSt!,pQP PP00@ s @ t1P 6D{P PPPPPPL0Is0PP@x1;@9``P2PU- `t1VS RP@ ta``L0Is``@P !RP ScE7PP0 1>@`PPTE K/T5dbPP05sP6 5P0h00h00U U0@IP0U*0RPd0x1ST0x!4P %4xQP0%8%\0 P0PEd0U03:T8Rr%P Pt!dx1Zb" :0 0t12P0P0$00`P*P(14 (K40PI!2S0P0 S0 $ U 00 ` 0U00 000 (@ D00S8 0(00^Z800 QP40(R(0  PI ё((Da>=6y|֓mȔߔG- p@r W pP\aPP Pp $ PK/bD08QP0Q:" 0PS00  Q pxPh`P 80"8 R 00 05 !$w(\yLp@-@5%SQ%5 %SPQ %UUrpQQp  0 0Q0 Q 0(A-lP`5p@ @ 0% Ņ@ŕ\(O-POMpP b5S5圢@TEOߍt ^P@ ET PT 5d 50 ! S$5"R$%P0S4dP  RR @`0d B2" 0Y JQP d d0P Eh0K/0h0 a0 000310 00 000T0 CX(%,5QP Dd wd0Pa}((Ŗݖ@-@ P r0 5(0/(0/(0/(-@-   Ư&G-P`pb@0S  0S X| vU ^TY0S 0Skb@ |( -@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  M@-@M Mq` @YPxPݍ Ѝ\!rp@P=0D@rOAP0: S0RP00 0PP %P81: S P% S  R  rPPlPPPU rPP$0@P(BDS(c}@-+'0P  0 00$Ѝ  껗(ʗ0@-4S 3/ (@-a0 @(C 0$Eaa@З(@-a@H8a5aa@O-`M$MpP`P"NX1 b: S/+c0P  rR a00pPP W UP 0C P"VSR V  V\PN fP P W\1` 0W`PIX1: S<V2"'1rPpUaPV9 PW002`` 0!$  $PPt HP5a0S3]`P S R SpP`-pP ``!\1 S R U9Pk`x%|!0#PaY $; PppU`( FPP eXND% ܍$ЍJ F F F@0/p/p@-P@A $( $(0XRX0X00\00`0ddhhllppttpp@-@ P AAADDA@@AHHALLPPTTXX\~`\`0p Qp` 0_P0@ S p@-0@"!Rc0p@-@PnAkAhAeApA-0@PJ04S->CVA->C?XEA9>:>C@A?n:>CF;A 0? AC>2A}C>G-AmF)AEnF%AE~G!AX J.X V  $$((,S>,A}S>G@mF@HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqx@1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,/E2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P"9<Q08u@5ppL0p 0SXsL X0 0S X r000 Sr:0 02P0 @S$00; ` 9: \08%@5  L0 0S^ \@P#H20SN <&t0 0 0 0(@00$? 'g60 P 0 \>U 01S0 A 00(!( (h h(~ S  ? 0 }/P000 R0T 1A~ P{xPu8 1 t0 1( @( f Pch=@;h( (((%(ĘИ$(O-M`@ ) P0G: 0 0@40P$? 0 52ܒ2Q{ p q Br /s+Q0< ,42匢# 0JR fLpQ 04  0R  @PЍ( 0?1 r0 4 Y: |10S<000D0`1 `0 0>1 010S 10S 0F` `$1{100v10S pm1pi1000 ppO((%(( % (O-P`FM M X V@l: 0 l5 RC@\`"0pSh <50S00  000S Fލ Ѝr00 1000D0y4 H0T00X0404QpQ\t`  5P"0S, 4 L000 0 HP" #0000S 7r0  0 3Y(.P 3  .P0!0K 0 * @pp  0 0S   P1 쒟!!-P Рᬒ L000U0 H t k 0_0X0l2  0Gj0  c000B\00S2jp0!0G 0Gh [ Y0# 00C 4 S 0040\pPAT!)ql1p 0p; 0;0  k#000C0 0 S (q   0xs00 p ) .p+p00/000 0 !0xs  p0+00S ꗘ( (X(% H8($($My(ęǙޙC-@PE`pXpaY x10S l10S 00 0Z P4 ЍC!`@DT< 1 RP0H  0A P P> H0S"00S T | 0S p0S Gpp ЍC^T,P D0 ЍT(((X(%2>$(0/p@-LP@08100@ 00 .0@0 Tp(00S/p/( 00S/( 00S/v7(P000R0SO-p42@ RPMhD R0R0aď080S  C/ S ! R 0C00 0@1ἰ? 0jO\5p!`S 0 000 ?@U (  R8 R  0\0 P3 `0/0/0 0 Ѝ  [ T R  P00 0<00/(((PTxɚP0O-@`:1 R0* 0I됑吱0 pSxP P* 0 T C:\500 :P/<# P 1R 0 0/."<0 P 09`0 C c00P0S   0 -0xP 09 T0  09400,00S Ѝ(`((TL( (O-0#M PQ P* HPX 0k:0 `\5 00  9@/<#| @2R 0 0/."<0p @x 09`0 C c00d0@Lr CC cA30B$ 0Q,040(0PßP0 8+10S 1 PBU809 ̱P XEʼ0 8/,80<01t!0<S0<0<0Ѝ U: p P\E5EE5`f5U  5 R T` R< ܰ(/? 0XTFV p P Q RF 0Y:P`0 FR Q`((T(( ((8((G-1P 0p` 8   00@ 0S 0 0 80PS `P` 8UH0ZP000PS N`4OQ$,$ (,`(PP8(1`( (V@-@8P Y080`(G-Pܡ0S1p00 B?3M PAP` 0@`8@Pp1 ?Z8X10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ&d&0SBP 1@0  XPP00Ϡ^P0d000 A ((4(@(0(,(<(}P0p@- P?@7800P 0 !SRp4(@(p@-X`0SpL0LP0@1CA0S000p@(,(<( 00 /L(O-H0MSP` M 003/ ލ Ѝ40 pP裟00 X+0H00@0 t0 /  S 0V 070X0x3!0S& h30S3S k0  " 0  0励030Z0 02* 2R2 t R<ʨW;000 Q o ! ZH"$V$++P(" 2 " Ry{! {   t R1* Q5 1000S1H  B/oQ" RK h!B0`  W+BLSD(P: 1P0S, P l 0 10S0Q 10S 03/ 000 0P  0p`V0Z (( ((P(GLW@-p@`MiWP !  P0B  p`V' ?j 00S0H0S 0 0 $|,x00Sll, N(00Ѝ@D&P0S (0`Ѝe(p( (`(`({$(0@-@PM \" (Q Q0 $[0ASЍ000ꁜO-T5,Mp0@P @Pn(0S @P,Ѝ` T0): SR 䔟0Ḱ0 4$刡  !  Q01:` V `3 V `! P d_2(0`S @P0!a50 0S:R 030  `(`\Ő 0\"  ? 嘣 ? F'0| M h3R0Z SZ T3 R #R 8,3 R ' 3  R0\ 0㵯 30 20 00C 04$0S4L3 2$ 唂 B *42(`20S 0 0 0: S S-  S5000000sS 1 00108m'1 1p Z7 )P 0080X0 &?0T @ 0`; 0 + 000A00S 0C600)P( d  0ˏT0 C c;  뫴 hD(((((T(((U ќ(( (((O-2@ 0lMp`20P#\P  ? 嘒 ? ;&0 Lp"p2 0R S X0 S 3 S <@X L$20p`M2 RpR\tR`Xd   X 1 R, L&00X0S  0 0 %U*L!00ST06 0 S0\ 0㵯 E20 20 00 04$04L3 2$ @  *30'h00S QP8 PC& PlЍSr  m(D(T(((U  (`(`((((O-`x2p2PU@ 00U000  ZPp0 Ѝ0c ?˿R0 0g4GC WV@Q TVg0U A0 %00100 @ G @T`T0p0T S @`A 0S@   T 0`9 0 U2 0 L%P 0 UF0 KF`0@S 0 000T000 *%[P000xt( (O-P(4Mp DWkW0 ca P0 c0 C003 X 4(-P  4ЍhD+a p00p0S ?A 400 0? 043@030000,T  &C @ @XT00T S @v0S @ & T 0 l 0p0`00WCb 1 Pe (pP 20020SU 뉑  400 0? 0̱ 0 E0 xEY@"H  10J(Pk 00 400 0? 0 10S4 A0 0000 p0 @0S$0Ye0000o W #$p y0 sq00000 $pchA ((1Q@-bK st&s@-@P `P0S 0S 0 dЍpVO-tEM` MP00S 0S D+p P 0Sލ Ѝk000S  lP ge30S 0S Q0S LU0SO. 0StI@ 0S`C0SL=0S 0S,4J 0 d sS80!"70  0 " " 0D@?!? 00? 0jD 0gDd!! 0`D0 dpP0SQ "04 0 R0  0"=  0,0S)(04,0AŸ80/R%78 <0PP0R [0" t0S dPUs @0S @@PUn $0SP@PPDPTH0S  `0Cn* l0xl$|0S lTl0p00S0P0$ 0,0UA:000S 0S Ht @1 H0S 0S$i0S d P  #P   00(0P 0SJ ^P YPP P(mw"FdɟPe<Ǡ(>DO-H0PSp`M W0R0: P p`$"= "0 S 10SQ /dЍ@ 0ȱȡ 0 000CSY?00 1> R. Pt! P!0  S D  pP   . 80< 0 @80< `㿺P0P 0 #Z0 S00@ ` R Q\Q\e(i(((($((00S/p/(00S/0/( 00S/*(O-M,M@$"[:[$0: S`@[ ` pp%P" \%P 0 00 0؍,Ѝ0 (%P  X%P h0S !  GP ]0S, G : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S :0S6  0 19* 0S R P0@4`PƟ Z9U)Q900x0 B?9-pQP @90S  0@ !8 0 0P080S, VGN[  Z8Ppx U0 00(p UtxPP0X Z{P h(0000pPmP7BPm" $0 S7Q770S3  V0;R0.*h0S+ 7('d0 ( #0 :P |870S !`` /h @ (.60S 0h0!60(%R/V+:<V3#\Q RqP   kPpQ^q U  #p# PE"`:U Pp[h RXPp%Q_'qP tPE! p 10S0A` 0  Z? 0S 1000S X50S 0S 0:  pt ?@$ 0S 1000S 40S 0S   10S0ꊡ  0000 04 $0 S0 0  00 0!kp$000$0 #600S40S 04 PP @ p td3 0R00 0pRLtRPXd00H00XSS/ 0S D30S= \P !/P p2 A0 \00&&`2 0@S0:000S08P40d/<0Q5#fP8`

hd=\ `P 0H0Z0`0A,APp`1PU 0\I85 @5D0LT 0 b32 RPlh ((0(((ʢ`(`($((((((((((';8(bǣ(((D(AtO-@5pş|M,0S%40A `HDLT T0AX  D5 $00Pxd p 0@, R< T5@|Ѝ0/1b&\% R  P  0`P_Q0`  0oS /  !.0`?00 1> (@ P004ğ %1#\ Q  0  D ?0 uD#3 0R< S< `3ē0S0x0@S 3d0, ? 0 llA`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  J0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0<! C0P0  C000Y 0;* 0 0VT0Q@`@ T ^@@`R0@3T5P`1:@P`$ 0@0J 00  P ~00VT 1PS QP   0R`* A ;CD((T(0 `00@԰ 0D RpT0!:p`P 0A 0RpS RTtS X0S @P@x((((N&( ( 0000@/00S/p/(00S/0/( 00S/$(O-D:M`PV`@@ M$:0S 0P *S *`0080< 0/[ y >P X P )l P9`0S 0S T)YD P00 ,9 #R0p00S0100,0z.(0 00< ?00000800$q 0P @pgz b 0#d0 @0C0T A000S0z 7>P0tJ0 S$ 0S '00YP7~`| 300S0100,<0.<'0 000'?0p0pp00ppP*0S  $Pa 0 0(`YPU @p ` yp( (80< 0 80< 0@0C0 B0 00 0Q.*0SJ  JP  0" RWލ Ѝ0S 80< 080l5 0< S X\0 00$000 (_JP 0S 80< 0804 0< S 4\`0 00$`S  Br p h(y ᴠb(P@180< 0 80< 00C080P<.\SP$ .P $PPcP3P`080<9l3 Q0 *s000JP. 0 0q$Z P0SHp0AS0 Ss p0z2G0S40000P 2 A#R0؀R 00 0[E#R0uQ& d20SX20SL 0 A(P    P000 ,0 0 #R0 R { 0pprR> +w 410S& 5[#R0 š!ȡ0S  0R ؀P0 000p0P``0P00C0Z?#IP8a (((($(J(M#e(Ǧwߦ((˥ئå;JO-WM M'0ASy0 G GP h7 +TG 9P 07 00@  6$$P 60S 60ԆF6 ,/X [?0p`06夶0qY0:6 R W8`PaVtPVzDWލ Ѝ`40x`S@09Z(0F0 E,0 S1 # (R! S000000Z!"!"%Zdx hp20]/  ,0 S1 #( R S),)-*-{ { xP 0E0Z *( R `,N>2",0Y(0!Q@E 0 aV!Y"YdxhQ@E0 a`V { {P0 (0S $ Q P00r|0SM! $`l\ \T10!Z00C04P0 *00000C0!" p0S@0~ 0 0C0y 00@t}c$((,(<(zP{((˧& (($(7(h(t({J00S/0/(O-̢̒0`1CMa@Tߍ0S Pdp@FDAG@D0 ddp00@00C0 00 R2PU 20S 200S0R0S P0:000RP p 1Q R?P@h1 R 00"P <1m00C$ P X P =0P00 0`0L00 pRpfRTtaXc]`00!Pa l0 0Q ,000,(<((&((((X(ѨG (xHO-쳟p3张P M`@?7 \P  ? 儣 ? =0 <\#\3 0RT ST D0 S 3 S (@ 00000CSFTYr P 80R000303L32   ?=7` a2! Q,S Q0lB*#\2<20S P  P 1 PЍS   ePh?00 1>!  R1Z 10SI0T!  0 S<1`0 ? 600 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 尰PpA(D(T(((U 0(((((00S/0/(O-plMX ;x2xx00,0SlЍ0S @d0,P70 $$P000P㸀@1 0 0D RpT04:J`1 ARpR\tR`Xd00X0\0@SH0 `V `%P $10S  0@P1P 00S  0 0S  Q\ {{00  0R  000 T  L 0<6렑((S&(( (*({(ͩөߩO-MԏM@PE0!n0 :0t0?0SX0S $5St0SVhPWX0S $Yk S Y R,d$?pW\ 0P%T਀X僀 H\:00!` 1B`01$dQd0ڠP0C00h01`l0R!B1d0d.0CW P0=SLq QT00H ($0S 0 |$5> *"d>X>0S "0 0ꬭS0 $5B111`R B- 100 S L $~0S% , 0帐- 00$%BR0ө`S<B11@%L0 +PP  H PP 0S  <PԌ *堐!<<0S B0 02d0pA?P0;3A?`0 =<0T0.L09 ;0WHQ RX0>F@ @098 84<ϠQ bh{ S X(,0 Sa?^ @PC l;0S @ A>+@B@  C8 P;"  @0尠 \ 0 000 :J*!::0S 40 0؍ߍ0<00

! "$5S84(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0 80 $ST0< T8$2!S\0P 7V=SL5s35 `!~ ?X00S-Z"!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0 3!΍0h0H0DlE ,#0AS0 000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX ুX姁0 8PPK,2!~00<0S. dM30! ST0T00! !0P SX00ԀYd3p30 0 3&3000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S00\04 ^(D(H((  (8(U /Iau((K(Ǫ&T(@(D(((9H(8 (](z(((((٫$((0($5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0P3 L!T0 R H  2 00000 D0FP1  q1*110S 0 020S QL XP 0< ST0T STTJP hFHPt2 L 0< ST0T STT_0" 020Sy0 S\0P S\P BFP 0P S\0 S\0T70`# 02 ppS $S00S0`" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8*!H &H Xp?!D0Y8 0 S\0D000S8*!H H XA-P`@P000T:Ѝ4pp X @ꓬA-A0 5 P0#R%(r`! 10" q0SR 10a0  a*t1h10S |0 00SP03Q0S4 P@ 5*< 5000S W0 0p@mTPUA t0UC P`0 0S H P80 0S ((,%Ϭ((($(0/(0/(0/(-@-  M  &G-P`p6@0S O 0S X|F ϳU ᷫT;Y0S 0S5@ +ս(,1?E-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  㦽@-@M Mq` @岺PxPݍ Ѝ\!r?p@P=0D@rO⚺P0: S0RP00 0_PP ~P81: S P% S  R  rqPPlPPPU r PP$0@P(uw$(έ@-0P  0 00$Ѝ  $(0@-4S 3/ U(@-50 @(㜸 0$4 5@(@-5@C444@0/P/00@-0@S 4@ (8=1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT8 4(((((T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/(@(T8 T 8D(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3} yh p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0OH3H3L3u/L3P3P3T3T3C ?EEP  94K44K44h 4- 5- 5d0Bd00000P5P5H5H5=CS>S>h p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P// (O-t4MP U `D``t``@qvH:4D40ŏ 0 P\dp LЍ ?,0 Py P\IP0S 30S|30S ph3h#0S` \#ST{ P H0S <80bS s*=0S @"\5S 2 2\5" 0C?o"20Rh [ŚT24 ᕁ(Ud $2 ?X,:010S?, A!(Ÿ0#\ P  0B ? 0Sg0S 0Qh 0S |!\5St1\5P l10S(` XA" L!0 0@! 0 * 0S b0 0 00 QL0Ph PE @X* 0R A喼<(X (((((L(Ȯ4((5(8 (T (L(H((f(@(D(( O-8MM 0*08Pp$P2֧ Y80S ᶵ9P2ç l0: S XH]PލЍ,8H0$hSO 0)00S %00 7̈ 7 8   ` 8 t8 [V``Z`P`D7V< ,P 6Q KP NB7P0 0һ76 R>0 0p 0<&0|&0P47p0p 60pw>p0 P0p 2S # *,P *,P *.mVXZ hY 4[ 0SV?관X V. 0*0  + <0\;P$V$ Q4C ?*rPPe 2S|3%8 S20#"20$#20PB 2SAt000000' 0@a*`02P$V20A\2@02 m+2C`+ `Fba+ 0| A*H  ?`0P,Tt#0`P\`Q=S/0P 5` ( 2RV0 SSc 5*< 5h3 \30S e0 0`20S 0孺d3 0 S` V 10S0DS@ 0(y2= C ,0"00 00t 2oAp'06# r00S10Sʸ10S0=S0S PB܁q0008 ` 0L%000P%X30,.da *5 D10S V0 0(,(0(+L( (>N(X(H(g`( (ǰ˰԰"NuT˱TҲ(*6[³|(hߴ8((MvĵH(%(Y(( (<((((( N((s((((ض8((4(,(0(<(@($(((=S$0S,  0`<<00P%X30*0 00S [0 00S? 0 >0S a{&PDa 5*N> 0:#: 5h1q t10S 10 000S$b V1P0a0*g1P 10S 0 00<cQ6dzP 0\b<0*Gl20 x20S g0 0r0S0L%r0L%r0H00q" T 000cH00STFP$c*43@30S 50X# 0 00L40q#  c400cL00S Pc*330S  0# 0 0x4 R.0E q\ `PVR d0SPt4d*440S b0$ 0 0$d0Q,%R0%45 S R! t0040SPTu*d5rp50S 20% 0 00u(0S xQ$ ]0S< x 0(%0Sv8Pv*\6E$60S |0<& 0 08%<5HSR$ / H00850<SN_Pv*.660S N0& 0 0v@%D5LSR$  L00@50DS%0P|w*770S 0' 0 0 7 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*880S P0) 0 0h P^x P8YQڨ0QTڠ r 0 0S Pi*t9]90S 0) 0 00S/ 2( G0S0QQ&d @0 0S sPpj*B:+:0S b0* 0 0 ]G0S WG0S EFQG0S-(Q\KQK RP+00S  E~0 ppV aF!` . R  ` )G0S72 #G0Sb]<Q| G0S G0S G0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4*<<0S U0, 0 0(=0S 4=0S(@M*P=w\=0S 70lmh }= PA P<= 0S= @kPL Y p *@TW.  @?00@1>0A@O@@JX.Pd7  *,@Z>P* ^ P;0.00 0 S 1 >5> > 9>`3VP?``Y (? 00@DT@8 H4L0d Lc B b"30@`P Y) ?0S  r8 H4L0d @ B b"30860S  Wx6p00^d`PT6c@ ᱡ86P, P0& 5000 60S 1S &P 5 5 @Q XU @ 0~pP @@  04 8 1`5P D50S HFDP 0 0  pp30  0 0 4 8 P Ĕ ,0S_bP`0 4?s0 S |0SctQPd0 4?s0S 8H 0Sf@Pg 04?s0W:PP/PQ ̓0Sd%Pe000 4000 Py hs0ScX Pd0 0 0iHE0S 00 0 0 00  D0S 0 0 000  0D0S 0  0000 0  0DD0S ppw0p#40  j0  0pqD0S 0@00W0  0 `1 X1Q1Q,+ 0S |itA 5<00.\!00T!0P!0#00#p RV !0Bs00P FP0S[0@UPT0 `SV0((("$(D("(0(˰8( (X((LBALL(kӷ6ܷ((i&(((($(00S q: S *C   S D00S @-4 * R  S//((x1p@-0`S d`$@ ㎳T D10S810S(ó 1p10ST00S 岳p@嬳R00CS0pP U 00CS0 PPYU NU NYU0 P0  0 0 S(L(((M(%H&/&p@-PD0@0`S & 0>Pp (9O-01 (1$100 LP 1 >P 0P  PPPpp(. @ (PT`00 XT nV jp WP @@ 00pP(L((M(X((O-@1$M`Hp /2#$`D  P 0 <w  T'(P U 㜲 0 AP$Ѝ? 00  ?  ؙ P 0 0 0?QR0 0#Ϡ?!0  8奲0P 坲 (in(O-M0P8 0`ĐpP/2#V 萙[ 0 Ѝ 0|xv@[ ЍO- ?  uP / ? _0@p ((C-P`U@ (1 U P0 PP0 0T2`p؀*0 L@D0T@S   8 H4Lđ0Ϭd @ B p b"31 ~0S   0P00`0@T Ѝ ((((( 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍ((((@-0P@T@TTd pL `l0p `̠V W @ 0 0 0P0@0@00 Ѝ((p@-`P@XMX  % `P @/XЍp 0@-Q0 H0@S +\00S PA008S0P00ݸ(/,;Cp@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT(((0 \P/Q/ 0   Lq,PŒPŃ , TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S* 3`30S ^0P 0U`dSTSPsPUU00Q A&P 0S ??@Ϙ͘P`"hR0"00S8 lr003Pb0S* xM0S* 0R0E>0*X4N  2p610S m0 00Se?]P10S Y? 1TQ `1*! X1` H10S @0 0H10S <7? (1P 0* 0`00S 0t 000S d0P` 0> 0^G[($(((((<((( ( (((X(((#P(L(:lU@((D(((ŻO-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\ S2 \P 0 `2 0T ? w0 %#,",2 0Ri Si r0S 3S 50? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P* 0`00S `* ` `Ѝ 0_S   $  B$ $ R$  B  (((TD((((U (((A-Pph0``ATR ˔@P<[0S @ -"1p0A$(<0 0 1S01/ 0S00/$(`0 5 /H0P 3S P 3S P///(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 ((((Q/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐpꈼо0` R P/! 0p P  C1p  1p @- $40` xR o/ 10#/C!000P/ @-A(\0` |R  /  /C! C!/! !/ @-,A,l0` |R  /  /C! C!/! !/ @-9Ap0yG-@$Q uql'`h$RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP dP`T `iP P9  ,Ǧp !0S  Fߍ<0H(00,0 00004008004004 04$0D0(0P W[  坦pU l嗦p* `d\݃` 8   8-j ,_j  [j Wj Sj 0,0Mj0 Ij ` ?p 0`?`a8SiPb 0  0**0P0 R  0* d@edA zd@#,=I[oA-@Mp`;@@ p@ݍ P@00@᭤T 0 2 "0 O-`M$MpP`P"NX1 b: S/g"0P  rR 00pPP QW 弥UP 0C P"V⏪;R V  VPN 墥P P W\1` 0哥`PIX1: S<V2"crPpU❥PV9 2PW002`` 0!$F $ PPt ℥P5Q 0S3]`P S R SpP`-pP ``!\1 S R UPk`x%|!0# PaY $wPpBpU`( F<PP XND% ܍$ЍģJF F F@00S/p/(00S/0/(G-pP1P0@0ʟ 0  X 3#15`05 à121 R0` Ppp0a0!R00S $:% 0%# 0! RXh000R T00!ǁ8P,0(&(((H$(%Q$( 00S/(O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S ?00 0 P0 T0SpP8P㊣p(^F(R/G-P `$ 0p>@V` 07@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1A Q `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 ЍJ 0A-1àQ`P x0xo QG0Sp@@ P$` pFQL @ @PQ0࠱@} p@-@P40S:a80Sh0h 1C0C800S   0ۍ00PP80Sp0 C[C, 2 ,0S/`0@-0@  L4,弍0,0080S 0 0 [C0@謍( ,0@-S ,0, C@TP @藍 O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00P U0#03?`[[U\@D `0P$0H5Q @O0$0 ND 0XR @"!L0<p(08p$0 0H(0 0 `,0`4  0 4 KB@$HP $0 P\40  (00 0LP,05S00SUSP3S` $ 0 B@7`UQ᫊ 0 00`F<0408p@004`<`3 00HpL`<0@ RS80 0 ,H0PpT`k@P ,P`3Ql 0Q 0CQ <zO@ $@$\Ѝp0,03(0?D00T P %HpL`VW }3`0, S24040S@p( D0 0 P  X Z (2( mBV (H ]`&400 0Q 80080p0?(00T` 0RZ@p (0< 0 P 80S$1$f/1C:0C800S   04` 0SP THpPL`P@ %T@Pl P0̉T`@V !~P` T@!u00P0T0$0B(LBAWRt NBAW*K  G-0,0S 0 BP@㓉`40S*܋Ѝ00qW!  0^@P   i@PpjF A-`0@c,0Sp0+ CPpQ H0H CB@ 0$P@DT@ka C-`0(Pc,0S0W Cp@ZQ |0| 'B@@PEU  0P !  0 P P Ѝkq s X0sC-Ђ0@ P@` 0 00 0P 0^Ѝp((X0sC-Ђ0@ P@` 0 00 0P 0Ѝp((p@-0PQ @`0P Rp   T0`! 罡@P 84P[3L((5(j@-,@P,0S "A00(@-,P ,\  E Ѝ(p@-P@h0h 0 SX0d0R 3?p@006.4 Q#3SRpp (((27@-0S S+,Ô2 R0 ELh `Q t)pmPCaQ* Q( H<`P 4!,B 5*< 50d30a3&210S ϶F0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S ᚶ0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*|0p00S m0 0@S Ѝ04(((((((4L @- oDO-0p M"##0@` 0$0L4@ 0S $HpP t0S@P8# 00" qp$4$巉BtUhUaU bU lP5#i0E S0 0p$ @ P80 ( 0 @0S ,00(# `! P P0V &ЍVp FpqP` h pbP `P0V:P0V$ SP p0[0b$$0 &! P  @P 0 S 0 00$ 0S Z(0,  $ 8Kp  @0 S 0 00$ 0S Z(0,  $ 8'|ps  @0 O  p 0 Pc 0 ! P4Dt&hgjBG-p@P` 0P V  ^00 000G R00`000O-0 mM$0P@@`004080 0bW, AW- LW% G8儈4傈cW iW0 p X$ppH40S ,*mߍ8 4h0H4: S@ @0(008`,0000400P dP 0 0! Tp əp 0Q= 0! $∡匱@P4 0V$0 0/S ּ<<Y:``"0 <.P0<0$嫅`P  P< hy w <V<Hsp n/B  n?< n/ ߗ0Pp < !$,$0 @#0P!S 0`pSpVxp 0S `0S  R  R 0S( m0$H 8H/P`pF0$pM 0$ pF =p>  T 0S ,( PQ S RPQv&zd@;+^ *O-P-@p`,M$P "嶏p($0S0$020S'$3pM P V 00C 0P0Ne 0M fP AP PP `pP$p,Ѝ`P 0`P ,  ?o  0y0 00 ` p 0Pqp Mp URp` &UG-@pPT!p`:D10S:  p o09 6X $$ Ap+ P%W00S $$ 1p YPPU `fV rV GT!P$$ x p$(&+Hd @- hoDA-@P`pP 4{\ X匝T  @@冝 0²U  A{ A_& ,P/00#s01 0"$#O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PG-(`$p@PP 0㘤I$0 0Q P WPЍ ^P-@-0  Ѝ Ѝ/4A-0 `$P 啁R%p0@ 0bQP Ѝ P404 R0/C-M`@ ]P0Pp 0S 0SS 0S$$U7#P0BS0S $    TЍP؀$T0      ꨴ--@-00@/ 0 Ѝ@ Ѝ/-@-P 4(f  Ѝ Ѝ/O-MPp`3@PЍ P uP 4S  0PᅄT0P$ Q$P 0S 4S $KX 4P S $ [SGڔ!0  p`000 0 0  @ 0.P 000 00 0 0 P 2 T`喘&P%(0,p 0p$S4pS 0  p" |0 J0 `0p"P` 00P0S+4X|O-$M@pPTsPP ? 2R 4S  0̓$Ѝ0 mQ Q0   RSRQ"  "S 0^000 00 P 0Pᛃ4S 0S(  0=0 000 P0 m0P0 <00SS P   0 0`S4S 0$R V P0 RS 0  000/P` H0H 0000 0   H>pJU0_M{O-P$M`ppHL@PL,x@P0C$4d%t(, 0840; {pd`X0 S; `kp 4044s p +ypp ΂]p@ H4* R9 : S$$4SB. Mp $4Sb(d,T0 B. :p (d,T0 $$0 P0p % 0l>$tW|(d,T04$t0dT 0i (d,T  0p!4S   0  0p4 $  | Jp J\pk 0P PIp  0Pp P IP' 0" RpP5:$Ѝ0 S0jp 000$0. q0S*+i/` " d@$;d@Rh~-R @-@P 4B BRP pp 84  Ѝ@Ѝd@g@-@Pp P Ph4PS 4 A- PpP0T@ `z0X0 t4 Ep( ?p8N$$@-"f$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /G-`P@Pp 1z PUP` A0 `A00 00yPU:Ѝ 1 00L0@0`hP1 00 _PU&C$$0A@-P@- x`R@dЍpP P 4 R 0 ꨴ-O-Pp_o!R0`@tMR(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 P m0 $8P  P P  uP A-@pP`P 5/p 4 5/p 4 pC-(00pS4P Ѝ$d@ 0    0d` 00  0 `WP 3lO- 0 0pP宀@ጐT`  {P `V H<  0 勀@ꨴ-8p@-P@`0 j@TpTO-P`,M p@FEL0     R  0    0 pl PU0 (P pՕ0 SE ,Ѝ8O-PQ@04p 00` ЍP P0S*  E `P0       04 p p#p p04pp  gl{0s@-S`@ PV0 KRP: pЍp%   iQ000 BR00P0S ꨴ-s@-`V@PL `l` WV0 ?o2R0S ; 0S7 00 Ѝp訴-@- iR sR aR p` p@-P@^P (`tPp Op訴-p@-@T 40`PSPpp訴--iR@-- 0 aR bR LR( sR% tR@#P 09P0S`00ap`(a0 /Q-?p@-@ M\P`4P0 0͵0,0S ۔ 㗔ЍpjrG-Q@`M QP  ЍAP $|pP h6B0 00 ` 0P !}xO-$M@`HP 0`$ЍPP 0 0 0 $0Y!<#P0*_Q P0 0?Y S0SXP pY0 P pE04 PU 0pqp $ \|P 000 00 pqP ~}4 k$ o$\ $  0V,S( 0 `$4 80p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0PL 4$$   $ 0$$?p6 *Hb00S 0@-@C^M E$媓E$$0 0# P#Ѝ0 @tq !ᐓ"`#XT 80 B @傓P8&"7Nl0$ 8O-`LMPp4 1D0J00 p  0S& ! R"|!LЍLRR a0BSS0 D1 0S  0!P @P   9 v|@ !zPట  h| T ?0 40@  T -@ 0  @ P@ p&Le-@H&A-p`(P@zP0 p!`P @00 0$0@-@P$0S |@|O-20SK@0SD00j@ DP 0SD0SA \^<40$ 400#qpp, 804<0YP$ 0I,0  8P bU@qU PH04 87pPTЍ0$$ `Vh0Y`0X0 0000 WX0 0 0S " [ Pu$0 0(000qpp 0 QP Р 0Z,p , M/p p  $ &D O-C~LM` G@$P0 0H%}p<50S ,3LЍqP sP @0p0$  0+qp PP`0$0G$$8pP0P 00 0XpV0P$0  0 ($0 040FP ?P 4 0 ( $ "2 . $00PR00( ,VU 0Sd% 0哒#80 08 Y :0 U P  0 <0P<0 0(, P00 0 W P (0( S,0,0U000U,  ( 00W  00SWX0W 4ST 4SQ 0S 4 X4 `4\ P 4 "$`0 0S 004 mC $ 0$ R40H Lp 401SD<0S0`01pw0'x4 $r/040s?pp^' 0SU0P` 0 p  U  0  %Ph` 4$$  |&h6MrD/MC-P0 @p`$M!!t Ph!||p*0S00$ P 0SF0SC \^> 0T 00S!Q` b$NP$ a@ P P TpT T  0$ЍP`|&O-P$4TM⓲(0@xp  8"`B @0P|`TЍ X 0 2`ꀠ @000 0 01R0 0|iP @P0| 0C`l1  00B0 @P0@0$ 00S+0"+ /0vYQ Y 0  0$ 刉0P|  V# `F0,0( s,0 Z 0( 00S$EK%U /0B@P0@YT Y *C-\M`0P  Rxp| %i& @P@0P00͵@ @    0 09@P 0 ,劉0S 儉 @\Ѝ*3<P `00CS`0p S00 P0S X0X /X␊H&3S @-xMm0 $8@s@ T sxЍ/BC-t2M`PqP0 LЍC90 44,1p YW 000 010 0!ppGB 800 0 P 0   @XWF QX9T 3S   PP4r8m0 $! Pڈ 0p UU Ѝ00  ppPˆ1S1StЍC賈2XQ$ @ l⪈X_impvNp@-@`MMPᎈ 勈 刈4S x傈0S h}  - 00CS 0,!80( h܍Ѝp A!0\0 0 DO7P G0 *P t:# BP1@P 8*xq)m30VeuC-MMPp@T hݍЍ0S@ `  f Pp  0$$9 Pp 0$$10o HO/H0 B P @,χ.D0 B DƇm0 $8KD⾇⼇#  OO-YMp MP! @  ⡇ B❇=H0Cr?H@0 00 0剐0 `0T 凇 僇   Q 裟x  ( 0 J'f/J0 BF!FLP NJMl#0yU0TStk/JD3 BF.JF? BE.JF? B> 90$ 0 0 # vP" % $ĕ n?P0,p >#nπ j[ 0000p P ($ m0$( 8@#.J(0 B#.J B#~J f@Z L d@TYލ Ѝl!F?׆l!0FH!F?Ɇ x[ 000080 ^P $P30 0 RC2A0 A0A003#0#➆ 0S 0CS 080` M@ 0⊆0 11111f?*L(W\mO-`0 p@lM "``  $-xpPZgPH46( ssP9POJxU`U HU& WU( AU |TlЍaPEUP @@p @@@@ @`@L}P( V`Ҩ000#  0 s0SP Vx0 V0 VP0=0 @ @@30 S\P4  0 0S$00O $P 0S0S \^0PU  { 40>S1># s  SP P %`@(VM?X?#P?U`1?`#X3V`3QA ᓅ  ⏅ZPWU (00 ' P pz00  P Do Q: $f   P  P X1  P UP1`P00 9   PUL@+L(H&ht@\( &p@-PM@P`4 <1 0S1L0$00 vp T  hP 00S  0jiR TR LR a0BST plRs0BHhPЍpTepD@&$PM0 Q /0@-$M` 0 0@P!!0 0=00<00;0\ 0:00(0參DЍ ppW0`Vp4C-`P y<Ѝ70 060050040030020 0100000.00 ,0 P |pPP P0W##00R R 0S pW4p@-`PhM" P@0@$00| 0 0(0 0P0 0@00T00T 00T01T01T00  (6/UhЍp4A-`P<@p 0R( S0TPU@4?Ap@-`0P$@@$Up p@4A-@PP) 4 & X!0440a(Bq/BR  &:,`C$P X P~ЍPP X00 PPZ0P 0S tXP0$$MPQ b |XPP xXP (0MP=b0 >P $0  Q4 a@P 4P?0P 4 Pdi P0`P00V00000S 00 0(02XP d.X0P,0 `PP bpP b$hPP0e4 !@P 4`P `JP @ ^>Pv H X>Pp @0 SD00H0 RL0( 0xp 0:qpT  R$4 "#*qp 0p x$4P p$$x$4PpW WpP( WP$ [&1WP `0P$0 $HbpP$HbP&? p 0qpy$p =Pp5 o  >P 5  =P 5 =P 5  #=P t5  C=P T5  2=P 45q ;=P 5  F=P q/  =P r =P 01S [r/s?`&(Ѳ Ѱ  =P s/l =Pu$$!x$4P~,p_P ,480C$0 apP  a$$p0 Pqp\& p0-t< >P`3C<pP 83< 5C$< >P <P2 b=P 2 [=P   U=P 2< S>P $ < 8 =P# 8 Z* 0uZ$ Bp #$ wP$4 "p#qp0$ wY$ 0`!\R8008(0 000(0 40P0 `$,p 0$00 P00 T0ZXVp0$$qp@y$$Tw$4P0H00`L0p9$4&pk#qp[$$6w$4Pp   & -   .       D    F 8 X \ a U k      C   _   0@-@M P + 岛 0 0S(p@ ^ 0xp V0Ѝ0 'i @-SM@P, 0 % %$ &&4 '@p H0P0|00t0`*h 6XB00DL`|`p D Sߍi@ i!i@-@   0Ѝ10S/p@-!MPM@P% PA. (01P A!Ax)}P 0`0?oS c` 06P ``(}0 0A. 00P0~P A A|v|0 0A. 00Pl0_P AX XA\|0P 000#4|ލЍp( (. / 8 < C P ^  s@-1PP  t6P m `@TЍpP  00SUV  U|@  0 R !FO-M@ Ptpp" `P"/  e  aTP? WTPLTpP WplTP W P:P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, # [:P_ 0S\hQY @ wpNl lWZ L徫X (t0㵫W 0k0S, @ hvP@ `vpd HQ L 40R !01Sp0S 3/p\ |] 8 Xvp \ [ 6@ `vp Ѝ     X <nA-peS@P@SPPkS^`P TS P 'TP`]@r^T @- ;P ЍuA-MP pH:@P00p`ЍpP  a0 Ivp !0  ;xi@-@p @A-P`~SpP00VP@?0V  FA-P``SpP00VP@:?0V  F@-( 9P00 Ѝp@-8M@ P9P1 |'SP zV0 Q0s0S00VPP  bS@\Dh A  U4 PKS`\V8Ѝpi@-@BMM  p 0S 7  /  0((@0S700$0/ 0d (ך(@0S BލЍ<z@ xz@i"70@-MPR@P UP p0V" CU 0 0S $pЍ0Giy@-@M   pЍi@-M @8P0C p p  1Q0r R0s0, 1p`Ѝiis@-`Pp@ @@8P0\ x+@P`墩U PL ! @mRP, C㒩(cЍp7@- P@BpX |HQ P<0<( CC@,0 @R@ Ѝ0B`j7@- P@pl #BX0PKHQ P808 30C) BB@R@ Ѝ0t@-`MpQP/0P0ЍTP@U m`@P 0 H2p70 P@ PPNbi@-$Mp~QP00$ЍT`>`@Px0 0 `pP0P< P`@ p06٨obi@-,B y Ѝ@E@-000 0  Psp `_@P㭨| ` @spl P0 R00bS x/bvU xxPxi Qjs@-@`:PP  =p wy0dvp@-` MP@PP 7T Ѝp P    S  PQ@YZDvi 0@-,M@ P7P0 -  p,Ѝ0 0R0s0S 0 $0SPP   P@ ZDfp@-P:p@d@@zPPL0L. CSQt Papj7@-X@ P6P00 Ѝ0  p ;DV@-5@-M X@6PH0H+. 00 0m paVЍ3iF@-M X@s6PH0H-. d00 0M pAVЍTia0-M $009 P  wЍi@-@4O P(0(, C59P@`j00@ P/a CRWC/A CR=C/@-K00@- M@ 0( 0 p8 Ѝi50@-PM @P@\P@@⹐j {G 4  dwЍ0@B?@y@-@NPP mH`PR?0L`@0P.C B00 0wt0@`Vm`.l0PR/C B0\ L@ @@@@wXt03/`%B&b////0 L0L0/%0 T0T0/%0 \0\0/%0 D0D0/%0 d00d0/%p@-@pP 00p00D S 0A0CS|0$P3>Pt 0@p%@-p0( 0`P/ R/%0 O-4M@@!2T0(  D6qpďI P(0$`!pSp D@T PoS@ڐAP`@ ptpP`[T000 [ W  t R  P Q R. 0S $P\(P  1/P o@0S  pp "SR(0 SLإ\ 2/P W0(ɚ;6eO-M Mp@p U pP< 㴥( I`P  0Y000 r6r/u ٓ p[>Jp0BT ʓ pp Q hu u@ p 0 Q (u%_X[ ⢓`00@0 0pPu9 0I 0劓 48I0S;X`PU 0 3/P:㸢 "r▕0r00S:0 0r∕r0S X4u  ,u 03/q I0.opNI0SŤQP E"%J` 1 `E PIEP @0 l1 LAp 1 LJA@!1 ,t `` #%J`!1 IA @@ |1 A!1 MA@ ~tPPU_ 03/P 03/ݍ Ѝ0i~i%ii(i*5M XO-@PpP  p =T L@KPT! )'L`P X&PLU @1O0S !t+V)VSrW @P.Z  9P' 4P! K0S 0 L0S 0M0S 0 N0SO0`S PPV sEb(&@-,MP@~pP =LP`( q tp0S h㮣 H82P00@ ⢣0  唣,Ѝ%%$(8i(%%%@-P@50 P偣%G-@KPP0 H`@ Y㌀COp5O᠑PP  ᫎpp @ H@@@\@ &&2$(p&s@-@~K@PB00ЍpOPOn@P <` 孎P\u u&$(&s@-@TK@P0{ NPNE@P L` 儎P\u kЍp&&$(&A-@'mKPP0 |`@NNPPp ;p4 BFJN@&&$(&@-@ \1PP0P CD 0 S8800 >00Ѝ&&$(&&0@-M@KPKP  KPpKP d0P P P P3 4P5p sЍ0&&u& &$(7i'7@-@(dr PP HrDP^ P! (r Ѝ0r @E%'('0'6'1'A-M`@PK qpp"P  (    m Ump' (( pt"<@T d8PZr\2PLSr RU TpЍ0 Pl4XZ@P $@mp 卌Q*r t 0R !r k)q qPp L`r X`Q$R@ r qmLP:ЍAP[P\ 0P R   1 q 0 RS>qq $ q0` R P U 0pD` PH%(8i(iE(D'O(V(j(%p((('1''(((Pp@-P`@+IP V  1J`P jS`gSQ 00pITpYSA-@T >00`PpWN0 p `@@-MPP"00Ѝ`0 00p0@ 0 P L0P  0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍf;0P 0 , [p 0 @0@-@P R@ jO-`@pP,(0V0S 8WP$P$P 40S 04S 0S(0p(`8P0S$0(PZO-M00q W$0m00Ѝ`QB QE 00 3/PP0P XU =0᭎P x,,0,h4@[T /@P00 D0800X5T (O( R R["00YP 000 Ps0"CQn BQj Qf?5^ XppWPPZ Ჰ  $P 1-KpQYWH 0  FpA 0STt -PPX!0 ⡟8!100#R0S 0o8^@  0YPpG@T 0CS0 0r xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@Dt@S 0q@0@Dt@ T030ZJ@XTl +  HPOQU< E70 0 0`0*****A-X Pp@`P00c60P 0 p 0 `P0O-P`$M@ HpX) P W0  Pp` 0p0  00 *+A-`p$P@VP0`0P 0@ +A-`p@PVP0` P@(+A-@p`PPPU0S0PWNU0PPP ! P000S0PWA-`(pPJV@P @0 00  0pPnW@0+C-P,`p-VP X0 (0$ (0,0 0(000@pLW Ѝ8+O-p@`MT[HL 80 P\:  pPHEQ80T U:80< PЍ 0  0p- 9pDP08pN/1Snp `|0 &h P,00P0P,00U0,`(0DN/l%ݍЍ (Ki+++ @-p ?Ii,p@-d`dP0S s@ Ppe 'gp@@pP@@%P(O-(pPW` 00S`1 000xSP p<14! @T Z  BP 1! P `IR  B`W    S.P Y:WWP P0@DBt@UWAq0@D@W@Dt@@t@@&&,,,Qp@-@P&00S#0 000xSk`Vppk`   ,?QQ0S p@$$k 00&,,,,&p@-P M@ )U U( k0P0 Ѝp 0TPTT@ ! !0P!!`RPP  @H 0A-p`Pp@ @P(1 o AVf--p@-@P`M   `ЍpG-SMMPP|! p\!#`FpI@)0#30 Sd0 00#00pH0pM/|P41S (0Y CM/Zj -i (-p@-`M@ip 0+SЍp噚P  J  ш R # <ep 01S |0/S /I}- i- 00S/@-@j(-A-P@`TpP @ 0SP  &-A-P@p `PW\2 T]PH0 000  (p`--&:i@- M @ph  T(P00 Ѝ0( 1p -.9i.@-(M @p   m*P00(Ѝ 00S D (P02 ( pę.2..9i.@- pp 0QSЍS   i9.@./0` S $S HH @S/8 S $, @$/ //P/PPP/p//0t S $S $S PP @S/@ S ,4 @,/(/$/ ///u///G-X`@p1!0R  P A^QT TxPD@YZX40PE200G D券JP/p//@- M @pld 'PT0T 0@ 0p@@$G Ѝi///i0@-@(M!  0P p@  0 pޘ(Ѝ'0,0iH0@- M t@'Pd0q T pD 08 0zp$㸘 ЍW0/i/i0A-M< Pp! ⛘0@P "` # 0(0pp0@`@$`<0SPL100 0(00080, Ap&~ !P@0 @ p  :R@00C00 BPZ00ݍ@ T0S hH@0 @+P0  S 0z000i800&0000@-@4M PCp  i0P % 0(1p94Ѝ00i} &)1@-@CM`(  TpP 0 P P PP  8 ! ll pz l Rїhlm U#0P 6p 6S30S xh0\P 6vp 6SL<30S 8g 0P 6dp 3Q?gI0P 6Vp 2Q8g8 C Fp 0S0 g8 ;pt 5p l /p 0@ P&Po@2Q 8gCߍ10S g10S gg0  `0000pgPU0``0` Rڬt1000 0:S R DTP4cg`pPQ [gV pW ,PgUMgH0S LGg gBgg9g`0Q 3g f8i(i12i 2(22&2) 12?2i8iii2292H2O2W2&0]2a2m2}2220@-@Pp@ff-df2/p@-P M@` QP0 aPp@@D Ѝpi2@-< @$P(0/ Ѝ2/@-@ @$P,03.  Ѝ2/0@-MP "M a@PۍЍ0@D P P+_P@DۍЍ0@_0S0S1iS23@-X @$PD0D/ I zpѕЍ&3/A53@-X @$PD0M/   ]p崕ЍQ3/^3O-`MM@ 4[0P4 lPgE7EYP吕7U'S$0`0@ 0 0 @`F( 0Rt*P} 0S0'V 0).0030070 0;00@00E000 e(@!!0 P 8f0 /C BRX      -Bp8$ B2"!0``F ^v E040800IcCP S@BA`p7 0P0a ae!0@"0(0(0SF e0$ P0B'S$0؍Ѝ 0 0<'S   BS>C'0C'S Q:Ɵ"!! CR   ##9C0C<"!% &S&2"!2.B&>C2"" x&2"!/B Q 0dv*Sz S P&S   2S% S`r 0S R )SS &0C'Sq00 0S 0 tF t0d0( 0 B( @ R `uSGd X>d 0RX 0d`D0S4 d0S pe0  d4I3&⩐`YP0  @dp d0S V60x$S0pH@d0S  }dxdp HcHAHZ 1wq೐p `Fv`Z hav`V XdV'0Sl  g ,Z, FdJT#P`# $PT# P#Pß P 02d<3J,#S0S cF @"d0S9  d4Sbd0S*  d뭏 p`0WW   "|0c W'h/A@c0S LHcHcp  H≏HAHY1ೀ  `FZ0pg&Vp ,, xcI!PX! $PL! H!l P (c41JD  VS0 ,Sx0 iE4`4l(4 $(/ /43240445P 53>559533p/P3P@52355314333333334 444!4(4<40@-M TPp@@AЍ01 8@i55 0 /%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  NN ЍЍ/@-@zN]`: 0S/@-(-@-  qNmNӿ ЍЍ/-@-  cN_N ЍЍ/@-\00S 0  0000 0 MpЍ(q:@-@G\H\ \p0]|p:::p@-pMPP2 P0S 0@P 0 0 00 0XGMp DlP@@ ((@,P0P4P8PSw00!031 0@-Mt 0L@P \c HLPP @ (@@ 0lLP 020Ѝ0%<( =@-$@4P ,3b$PA +b,_<&gP@-d0 !X|!T@0 6p0\ (0000/,?A?V?Ph0h@-` |!TD0 6p0\ ,00 00/,?A?V?P-4s00#q^0<\ 0000/,?A?V?P 4qs00#\,s0Q00/00,?A?V?P-H 0:# ^4 0Q$0000/,?A?V?P-H 09# ^4 0Q$0000/,?A?V?P 4 <# \,4Q00/00,?A?V?P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00,?A?q??V?@- 0 00l^P Ѝ-%A-Pⶇp`@WЍ GP A3MP@ p7@-P@U0  ( I Ѝ0h~@A-0@nS0oSp@ pZ~P`\=JPxI0nS0oSJPPJPP'@@-0 `]@&O-M MP1]Q0SR '|aZ|]0SK \]& X%]& H%]0S;00(! P   P00@P  0S P@ ]ލЍO 0 0S 00S 00h0Zo  ~]0 0` PZX T,ލЍOo]AAlCAAeCAzCC(CCC@CCAAp@-PQ@@pQ(0op9P0p(PA- 0nS0oS 0 O{@P0Dt;P,WpW*DPP`8;sFp@,@P@(WG^G@- ]ZxG&O-@PM po0`<"P04"4 P0("Np/ 2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z WpH `xrPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00  0xP@vx 00 0< 0ft[,0t0Z00x0V 0;;0|0Ѝ蠴-&-oI~IhGGdI-BMMI^@0 P@M00 \ 0rVp0 @0 0/ 0 ~eYIII7@-@P ;0Lo SϜ 0 ׋ Ѝ0J@-@:0P@J@-@s<0P@J@-@ ;0S 00S0?  嫋ЍJp@-@PአP (奋0/Spp@JJJ@-r \YJ&O-p0000@P`ᜐ (,唰00 Mp0@DTq oP0 PwP<fw8 O3&--L KL@-M@A>0 0D@00 h0Up@0S SD 9F0 $- 0!YMLMLLp@-@PP (0/Spp@MMM@- [XN&O-p0000@P`ᜐ (,唰00 Mp0@DTq oP0 P$wP<ߊw8 O3&--#P8NP@-M@A>0 0D@00 h0&Up0S SD tF0 $妊 0X|P&PPMP7Pp@-@P|P (嗊0/Spp@XQmQQ@-  xX&QG-`0@P $p堐0 Lp00@DT oP0 dvPPav  NXA+㏻Gꨴ-R&QR@@-M0A~H` 0P0 @Tp 5'XRp@-@P P ((0/Spp@nSSS@- [XS&O-P@M P0`TrP" Lp)@20 R. +x   &  x `!p0 *00)0 &0_ TpM ЉuPfPMP- 9P GP p1g@P UP|0 0|00|0|00|00|00pt`x0 uP卉uVPZ,0p0Y00t0V 0;;0x0U58T$00|00|000Ѝ訴-sU&US(ThU-MMJNP0 @PG00 |0Sp0 `K0 0N/0 4 {000 0@(~Y(WUUUV7@-@P 90Lo SϜ 0  Ѝ0V@-@480P@V@-@90P@V@-@ 80S 00S0?  ЍVp@-@PȝP (0/SpQp@MVWW@-ˈW@-8 l0 0}0000000RYVW&7@-P @8P00S\ 0 墈 Ѝ0Xp@-@ PX0 R0(pvPP(咈PVp@!B(XO-@H `p01H PxLLD%Jp850`FVQ8 52@FP 50S  4 40S 4 0<0074a08:$0000000d4Dt0@90;84giPJ04P 04I_0(80@008 0MtPP0       +  @   ' B D# R4#  $# R # , @ ( "  )            s20  s0$000 ps0 000 Ls0$800 (s0<:00 |s08:00 rs0@900 phs0,000 ^s000000s0909 1R@11r0$0000 00t0,00w0 00x~00007000+ f4 ~ ЍL%[%[&0W((-(X[[([[[[[[%A-RMMIN@XPpD`p`00EL y눁H00p$xL0`Qp0KS 04  R< pL04@0 p? 04n/`  0jyHP 0 ,PEP.0D P! D4W 4$04 0404040 40$4 0(40,4`044<$@VRݍЍ$T(\ \\\]\p@-@PpP (勆0/Spp@z^^^ R R @-n/^0@-@MP`p 0,P000 _QPPЍ0P0 0 00Q0  P0P ts@-`/P0@00 OP0 LЍp0/s@-`P@"00!  P0d RPPP @@ 0 IV0Ѝp0(^(002P0/@-@BMP' 41010 0000000 0P A< VH00BߍBߍ@o꠆_G-0@`p8Pp3 pϿ| Dd0Dx4<40 8r0o,l<0(000pE040p<0< Dp PH00ЍpRPN PG  U0($XDY_O-$M@0 (4`Pp0 @T .V0W<00$Ѝ 03/ Z0p 4P P @0 ` s0P":@ 0 `  p00P LH0@3/p!P3 0P 0T@Pp 0 0 VU꠆-_0/A-PMM`p/ P@1L# 4ND0@@ 0@00 0@!pߍPڀ@T ߍA8Hꥆ4(C-P[ 4M@@0P` :T0P`P"T ] 00T 0 *P  4 0( 0``00S0 V0S`0000 pp  jPP0QqqD0D00V 0 000OPP4Ѝ 000<0x(S___4(--0M 00H0 @P (8 zg Ѝ__@- UR_&O-P@M$  00p 0@"@0"@0 "Fp20a0CS t2g@pbP 0p00@0⎆p ! 0 pPӃ p P 0S R 㴃  t㭃Oz g!!H1 _P ַ0S R  d  .z ' 1p0 r+崴~Np h 0[4S08pS @p @Ѝ?B-&b_-G`d`aaaAbb0@-M MCN@80P0 0E@%(00 0Mp < 0 @}S zS wS(40P( 0pS,k20P , HiS0@fSލ Ѝ0@_S[Sbbb c(cc7@-@P 20Lo SϜ 0  Ѝ0c@-@20P@c@-@30P@c@-@ 20S 00S0?  łЍcp@-@PᤗP (忂0/Sp-p@)cdd0/p/p@-P@ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P ᮩ᫩ᨩDDᢩ@@ᜩHHᖩLLPPTTXX\~`\`0p Qp` &P0@ S p@-0@"!Rc0p@-@Pda^[pA-0@PJ04S->CL->C?X;9>:>C6?n:>CF1 0? AC>(}C>G#mFEnFE~GX J.X V  $$((,S>,}S>GmFHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqxw1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,%2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ 0Px 0㋨`0 C cà00d0 PS CQ c ( L((U rs%As&^s rp@-Pl`0@S     @00Sp0?00Sp0?0p%(t0p@-0`S[\@ _L00S000000B0E0p<(%O-MMO⾟D`, <%5_Q0uPSi`50FIFp%?D0Sdd/nD? 0?D4'Pp؍ߍ 2@ŒD 0L 04;20d04 0]0 00@4T@:T @:T @9T @ 9T @8T @8T@@04s00PF0`p 0 40S7{ 3 0 000p0  `  Z X  Z0 ``ao,F␿ Ϡ ß\ ^/F222902?"""0Pb 2@őD L 00 /4;2EE 0d0"0 0 o 0S,2 0r 0` 0W9 iEp`xSi`10E\E/0`22220&OD0? 0 0430hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0 0@Dő L0 0/4;$0 YED 0ldh 0@ `Ì0 1m%(L(A%%o,((TO--)MM,0=0?0(8$0DD0D`0S> 80pW:,0 0  0 G(((0(D(}P@P`P @4 P@  4pD 3Ep@ d3T@  5SP@ *a 5P (Xd0S0,5 Sx0<0(5002 0,%S0022Q04IW 0QIOxrx" 0 04 0A XIA 040A 8I8 0 4QI/ 00 Q*I& 00Q(I 004 QI1 @00T(0D%\3SB1\Cp@WXp\1X0SHiI X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001;I @4p 0R`0 a 2!$ D(<(%%ss ((st:thttt((tu0(puTu (uL(%RuT(%(((( Q S,QdS18$Q<4R:xH  @0\5?>C0P4p3x00084%$0<0D0t@姄0|00匐XL5P5G   ? 8`F  ?  ?∄ pf pG8#PE0 0" 0 p p4%p8$``05<4Rp`H$11 84<00x 0 08PSPK @ܸ`@0 ? @`0PP* ?᭷@P`(6#R0:㽸`@0$- 00[00 1p&"0 ?001>0[`0 c2# S,Z Q Z3?001> !00   BBpQ0㘢Pp0/2#$ 0  ?ᅢWp1Wp#T0p10G 0>E  ?8PPB@TP` 0Pe됈  00B1  B[1 ` U"B !!0 R0CQE0E ?P 0 p@됈 0 1 B[0`0US  B 110S G:e @P`x1 G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 0000\60S|0p ?HL404P@0 @6Rp9'(BS@00 Qv(7\5?>C0P奁%4tx0eL70(1#T a2!, A3 31 0  h@`0 04 p ቻ 0H$4  E$ ( B, @%LV.  R*h (r < ( X ( \ $( ?.@Xt@+@B@A.@B,-8 Hu p夑 @40K pஂ0 ,p B8d A YZQ !ᔂ0 XZ R ŷ{A/  <pW $?.t{ 4Ąß Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423倂r0S.xz됺 z'z'|z {' 00쑟0d0 CSQ c6Rc(+S`PkF @<0 z犸 z'(Ȋ00 (08(+S,WF 00 SP0\h!P !0@ 1@0p0 Q0X&㛺0S`@ R#F PP0 뀠@t7 j0JF 06dK0`0S >,(^Fubv0(}vv8(H&ht@&v<(,wvvTU sTDw(((XwL(%pw((8 ( `00S: 0 #$B 噁$0+V. ~|00S  s 0=S,#0S/0$0 1H@ pp4@PP04SP0 0R0 S00C0> S< 0,00P0hA 0,0S9. p开8嘥ȿ+" < Q \%`R 0  ᐡ! #0@(0 0 @DU@4A,420 @R40 `0```0T0t(lb 0 崹p2 I `0 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%RX# R0C00h0$l`0 R#00B1d0 R*-%눃U` p 0 0 0 (0 0C 0(0(0 S 3`R` F $%R0 l ! `(4 p  R2d+ 4RT T  4P%QXԐ R0 d0 0奵 墵  0   8 @ b`Q `+H0'H ({P+H PH00S , 0 B2\,^   00/d A! a,3 1 L&0C$01=S,00CU wb010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0 80 C  0C1448000C ST00C@ pd`h48 0 RT*0C14  4  0T: $5Sl0 @0h pp^:S $%S0! !H`$p$p(0W,x0S ,4 j d,04  0,4 $. 00`  Vjp0S   0帀0 X#` x0,y 0X\%Ϡ H R     dp 0G g!<X 9\%R 90SP Q``ƌ` $$T0*`S` 0$5S l01` p0000S2dᤳ0*ST0T00! ! P5RXԐ S(0d0 0    (0y00080@ 0hS`0?0`@$00$0ppS $S00S0@Rl倐HGꢍP00@~8p`0x164pYU0IX!@@l00@0T: @5A$\Q 0@08(0  (0d0O@ 0NN nC 01sp0S<=0S0 000S.LB08C0S|= 0Ϡ5,"\Ő\   0 d0/ @ `.M3,00 $ fB0000P0>0S0> 0,00C0S0 X>0S NB0S B>0S 0 ~ A00@P|:x*,EWP>0S`EN C>`>0S303040404 0#pCVW*DqV.ǶP\oV.GVv0S  ?0 PS?\5=S,b??^ E?/0 0S 04 } dLĒH 0@ `Ì014 ,$0S0S 04 e d ,04 0< 04~<)ݍЍSmfG-`RM@Xr qPP dSqP`T `P P9  ,w<p D0S  ߍ<0H(00,0 00004008004004 04$0D0(0P 8#W[  M<pU lG<p* `q\` 8 µ 8 ,      0,00  `➵ ;p 0`?`a8SePb 0  0**0P0Y`  0* wd@edAwzd@:xwwwwwxx+xA-@Mp`;@@ cp@ݍ P@00@]:T 0 2 "0 p@-@PhP (p0/Spp@{xxxR/ɗG-P `$ 0p(@V` 0!@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@p@-P`bjPP D}\@P  $0$o cP@p(x(O-4MX0p0\00``P埵0 0,, 0S P 0 omS2aSMS ASB0C0`b0CX S0 SSU0@0 0DT dS$ 09R j"P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p P8o0S00 0 004 00P4Ѝ(yGyxjyyy@-,@ $@A =(y&0@- @     G-@0Pv tᲳ``PE0 00000BoH0UB?E ᴀ((P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p(0P  C @-n co`/s@-PL@` 008%V  @nЍp((s@-PX00S@H0`ă5#040<%V @hnЍp(((\10 PS/C-HQ@@MPM`6`@fa 1p P06 0 T:@6S-O@ o DD6ۍЍC+ 0 Q 0ˍ14 ^ 3?\ P;0Tᳮ 0+ۍЍ(((((G-hB` pC%PPH"m 0F040( 㯘06# R 0 !)m0 <0 0 !Rm0006&0C06 0  B 00C0( 6V0: R`$dl g2 WSQ( 0t0C@0+'> 0(b S 03S0! ,0pᐩ  U0B 40P40  0AS (00 0  ,pF0L(-000 6 0 6< 0g,(2200U( ,0 00 (p|Pc`$H% $0$匌0@d0<`LPL76 0T0<<0<X5U#<0S<d8 X"0<PU ḫPX  20L VR0400& \p#  @ \ 110B0㞖f0Fz0&aPeeC 0CP!Pp\p :  #P00 ` p0Z0C `$00SE 0j 00S0 :#*&(:C1\:0 0t:Ѐ70;,* 0 ( "*; 6 !0H 0 0H:得Pp<D 4ZH&/0S\9 R0H0ekL  X&' d  P &X p \ ,p0&s0&$0#0  0vSs0Cp0 0 V0( " Br  0& 0 `ve BRp(0 x0Sv 0Su008@ pp:6PPXP 0R SHq SoឫP@p0S (7L R d0  P# 0`Dd&oobe+@Eܯ&0#֯H6 C 0 ᓔ)6 7l0 BԖ t6g0CT 00C0CS : B_47! S> 0S0  C02#&0v:yP0 0Y 0:YG:e3006`  0(01 0 0 JT2  060 5&ȥ(6YB:P0TSL0S d0 \P U7 50SpW,@61 210!!!0 Sl$ ᓢ"" $0d0$&S: 060& 00.:xG`W0A 0L4#00 0;:pX0SNVPEPUJ 30SB *:W 93PU,CL0S \09`0 u PP1 P# jyx3646l0H0p0t0x0408630JPp`, 9iuP 9pg jK264H0p0t0x0b4f&! 02/!"6 QP*dX P 0 l0#PPP  rr0v `P f P  6 \!PU:< &U":0U:  "0 "0 h℀(L0SUWU: <p0SB:W\: 0 6P((%(M(xρ%%4(r(%QSN((((΂(-d(H&ht@&׃$܃Aͅ%A4%@,%(((d  0P0  W:h  吣  p001p1Ps 0 !GP <`U&`06!0U00 h hBL0S `0  l1#'$/%x163sH0lp0t0x0J3080&2l0P f E 2`p,2& 0hC0Df?o2U+du=&0#76` c2HѨ H0 HD23CߍW?G-`RM@Xr `hPP d hP`T `PP P9  ,-3p 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  3pU l2p* `g\C` 8 x 8 ,     0,00  `T 2p 0`?`a8S[Pb 0  0**0P0W ⸘ 0* d@edAzd@.:L`sA-@Mp`;@@ wZp@ݍ P@00@1T 0 2 "0 p@-P`aPP DS@P  $0$0g [P@p)؆)@-`p  x@P00S0?0\ 0S 0 gS\F\GL0 \ gL|0 SDKT ЍE%KUJ%FZO%A_0 \g@-鸬H D7<<GP4@0 ,P7U@4뀇&ć|A-p`P@㹬P V0 f\G-`RM@Xr fPP dfP`T `P P9  ,1p 0S  8ߍ<0H(00,0 00004008004004 04$0D0(0P zW[  1pU l1p* `Vf\` 8  8 ,Q  M I E 0,0?0 ; ` 11p 0`?`a8S[ZPb 0  0**0P0U D 0* yd@edAzd@+‹΋A-@Mp`;@@ Yp@ݍ P@00@/T 0 2 "0 0-<\   RS  0 S& 0 /)Q@-$ Q: l~O--@MMh V❪0d00h00\00|00p000 0L0$0l0(0t02000040<080H030<00404p 040F00G00H0040P0050<00S00|0000000S00?00H R00S t0S Pth|0p 0l0- SHd0h 04?i/0.pD @|0@ Sp00 D.P o 0D@/a\@P#.pD 30P |Sl0S 1 : S  R 5 @ 8PPP0j VPrPE_oRb pPU p  P P@D <3m`Tbd0h 0 0D0&ᇠd0h QP  < h0#@ F_0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100p S0T00RS00 R0 R0S0T0y / 0P00Q,QP `R  V 000-RV 0`S`SU [ T @0S X0S2|0p 0/>0 D0p{ 耝p`ST(+qpv @@0S ?W01?0#*@0cph X0S*Zp_ X`[ 0㑣ZK Y  Y* >05ZR[:L0Sd P!0SV@ 2PXP UU L0 0P U PDIJP04!,A$ 8!00 l02(,`PP `l~+&>C+ 0< S0|0| 0$02#l0 Y0000 0l 0H0 30R08 0R000L0L0S0 Y@ $ p0003Q t R t L0 p 0H0( S ԃ0S d(0HՠH00 (0100\0S" Y0( R030"S R&.80S  )p% P  P:( ᴤ(0S Y0( R00S $4 0$0 Y000 @0,0 0#40+40`00 01@01X01T000 0 <0$00(0x0,040303)00000 0$2?@1c4 04v 08#$0 #(#< 0 0  / =Q p0Q\0S000t0o0 00 R  PT p偤&?  D)po P^ ( 64 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CQ`000S  0! YQ0R0( lR00S LY(0 00 25 010 0P B24 01(00(0S p@-P`YPP DK@P  $0$^ RP@p)ٕ*   k B*{@- S-1c A 8 / eA@00@- 44@4P\P 0B"" *-@=B'(*0/p/@-鏤 /,n&G-`@ P pV!>0}P U0 0  P@ G0P\0$ 0Lu^ R 0n^ U   *-,s@-pP@ 0  1X 0TTA.LЍp P `10 0.*F*I@-03S   . ЍQYA-@p M0 0S P `匾1 00` 0! 0[.))U.1 (P.E1:K.@1AF.a@FPVX`F: Ѝ8.ꚗ]0@-4M@ 0P0S 4Q 0   R 0  9   0 "0!4Ѝ0@.R  )   0 "0!R 0S 0S 0  ( 4Ѝ0@-4Ѝ0*'< @-'p](*MH@- 0 R* 0s# p@0 *P `00CS`0p S00 P0S X0X /X.H&p@-`K@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hd`0$Pp <10C <1$0 810S81*P&&&@*0@--@4MT N-AQ`I-dF-hQ 1A-`"R d2RK9- ,d2SA t= hk0:{PPS['ΞkHk>[E{701 < = * + (+S  PPP - 0 @@@ zj{ k{[+S[,4Ѝ00B:k{{'*k{\+S,?@@-C6?Y@`*g*ĘP&**2q@-k0d2Sk**@0@-0S0@d2S`2"R2P&*@-@ 081 P 0q)t@ t0 t 0#-S88<8xS`S)?S DS .  <(8(Jy*@0C 8(K+ C 0BK+ 00CS00J@*a0CS00    SPK 0@P< 0@0 9 90S9 00K +K  ėdI  ,PK 0  PK.  K   ⩗  PK P 0K. (80  ⍗  @Pjjd 80S D8  u ` ޘPR _?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?0-I?Vu( 9 t ⢘`PK PP D70S@'0 0C!0R3 70S0Sy K  @PPOh V p t0@Pp f pt@@hP0X#T0 0T\  TpW pDS  0QSL0Qŗ0P@0c0X\0D`X0D S@0S) @DU2 PP HPP<mK { 0P@0 K. 'K>< 0/ &@@dpP @p XI m0S$0 0C!0R3 40S0S 0P`0P `0zP c=0,C0 0 S;.000 '+ ⥇0  d0d0@ 3GS p 1 01 Q 1 \R \??p@1cE0D H`R(D# R  DW'  Z   Y   \0T0S lND00D0, L0 SH00H0H P0S  A  QP0S>$ > ӕ  <PcݍЍ ƕ  Ta ? 'PP|A80S  0 fP  ⨕ ` P ⛕ 0 Pxo ⏕` B  PPj@t0SC 5000+ L<h Ǩ@<` ++P+Jɨ4+&Ϩ"0+t&8>Ea+iΫL++gfffѫ\ "38gp@-<00iS03S !37*Ps#++Ȭ@-l@he0\ 0 L @4 0   + +@-`0@Px0 B0PU1 S2P T0p0S 0@ SB8 0( p'& Ѝp&L++&C-PD1`0B8! Y!R!tM@p  10S & tЍ000iS00S 00S d `P $W @ 0 b P P000 p 0p, W@000p&L++(&++t&=`0@-@X0 B0@T1 S2@ 0P   0S  p&L+G-lQ0S `` @P 0S 484a4qP0 0@0C!R! 1S1 R TP`pȀА U0(@P 0E!0R30S n | X[%0S+ @TP` 00 @$ +&C`H+L+@++r+O-0B$p 0Q0US`PP PP" @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@YO P`P30S  $x#0ES0 000D30S ЍY& 0 X@00020S ?P0 $_X0000 { 000S 0@@$ 0 0@0010S P0 YQ: 00 0X@60000S X0000000S~ @0 0 n RT 0@s0S w@ 0 @$ 0 k@WH00S 0 T,} D(#4L+~{+&ǭ&+>X`1A-0S PPf@`D1 T0 :414a PU @T*$PQP@`0S 0D !0R3 Pp U 0S 0S  |#P0S0S \0S < #l@+&@+++L+ή0A-0S |P `p @T V @TL$@ 0S$p$00>`@+&+G-!1 RR0堑S @Pxqx! 0P0:ЍS @L`P 0< )#000W PP@:SR  0#c Q Vf`P0pQ0 _000V000++P+& X+@+CXh&2O-0S [0b0 -Y1PpP@ 0pP00Z: P0-:p R02:10 R S U+:SR00W 030"S P} 0000 S' @@  W0:0 SPh[ {\ Xh"000P@ Ѝ+&ίX+@+P+~h&C-MM@P Q0S @p T0:ۍЍ0S 0 <9000@T`PP@p0 &  Y   000PU +&@+0p@-0S tP`t0 U0p(i@TP` 0Q0F00S )@+&@+A-p`P@P !p?pDorP 0L0 0C?oR20S  P 0&^Jp@-/0@Pl{ 0Pp SRp+@-8P뗖0S$$ B0A A!sٰ+&A-`0p0O0000 SPڤ/0>+b P0 P<P@O 0 |0O0?+<+~&0@-@0 0%0@0Ѝs@-@P`P @TZ TT4!?0 00? +"+R  + Ѝp&$0L<S/ @-閆P<+~&@-<p @,_P0@0~& O-1@`pVCMv Pap@0DWCߍ貀TX B/ᩔ0S x ] ⠏V@0PS 0 ?2/ 00S 0S 0S0000崐(h X:0000Y&*Đ0S %0 0S 0 000R*Q l\ 0S D`W0S  `+6++&,@ZXD+O-h3p0]MS TTPcPC H0@#@S00RS $#05 BGep2"!CXONRPP "2R W 0"'00RSZ 0|"tlep`"d HNPH"L  Hp <+b  P<>P P ]0?0H @P 2OPPD w  L P !OP7Pt]ߍ+&8+++~&<+~&±& X+(+HQ811,+g&~ &x@-$@0 00: SX+G-@ q `0S+ P 00S ׿P0 S00P R HRڄ00S t?  Y`xP 0 Y00:$00S $&@++&&ԲG-AM`P@spP00 040AލG/0 008/P1 00C 0  R+h X 0 ~ 0 D n<+$&'PA-MMp00 0/R @`㜀GPP 0S P@ۍЍ D >F`D @P 0S ⨎P`<+&p@-0@ @P QP @p@-@,@O-3tM0 S ̾눣00RSx3 l3l#0h2dC4#SXC#PtЍO貾@c C4PL 4 "+)F0@`00QAoԲ`L<` L\0@ 僾XK= hpWW#XI@P ;L<0@(d0PxSiSeP 0)0@& 000 KL<0@ QEBf A`~`8TD5L 4MtЍ0 0C0D10S 0pS%0` S\Xh0SS   .8.0d0S X00%<0P!xaap 08n+&m+8++~&~&&ӳ<+ +3W0++A-MpM`@PP 0pp1d!d@P TT:L7C< 01ۍЍ aD D< CpPU U`k p0P  x0S p T0TP 8 8 [Eܴ& <+ +X+#NX@-9P@-L@4#S 0 / 0#S 0 &@~&0A-@P` 0 P0: 0lhp ?|v0@$a@00S$`V SR@+c0++} 0S 0 0/ R  /0Sꌵ0 `0p@- P0@P*D` ?Bv0Pp UTp$/p@+0+0p@-P@ 0 P0: 0|@x` ?v01S 0p@D0 $ P\@P@ p$0@+0+ʵ@-MPM@T 0``p/VVP   ZP @T@ۍЍVP @p@-/Pᴒ@P@p00/00@P 0S A-P/p\0@oC 0T@@D+wZU pDP@D4+G-pPᓊ`04PSp@P`0PP0C0 T`4 $D@0+ +G-頡FPTp A`Pt&0@(0C0V$Q@$0( 6I00v`PPEPP `6 @$@@(`/# 0`0 @ `P`:0P p0@0 P $* 0+ +7Yr@-@00$D 0+0@-S@ s0S 0S j 0S d0 P[X T` R 8dD0&F$ ЀP 0S00Ꞷζ0+p@-@`PP|)0S ? 0P0 @/zPዉ^0P 0 00p O-2p0SlM -|20SHlPP pT PH0`000@,Q 0*` R 0@*@a0Sg@01 $10 %1 08`008<0@ w9A pd NIlЍ 0`0V@ 0 0/ 0` @T`$ u000 0 0($00S0,00S0(0 0S000$0S0400@0 1S0 00@+& +68&C@+0+(+8++oC-20MS wYr 0s]P0 00;000Ѝ PP d ` X8P ю4 $ $@0@D)`P eP z  u1RQ rQS $0!SP P0h0 >P X1 D1H1D10S0|"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t2 R" +&@+0+ķ߷& 9ak+(+X+8++¸/!F)"! ꀦf0@-P X+&0@-Q 0@T0 R ||價0AS@ ЍH0 D-P( x&P+6+&# &mMp/0/@-x 0 RS T0R H0P88Ѝ S 6+IX+^&A-D@p 0 0SP( ` `s `6+L0@-  Q0 0P ,0 Ѝ6+X+&@-0xP 00S@%*S` P@` 40P , 0 fЍp6+X+&ɹ0@-0@S 0$P B5/x00SP`P &qpH0P@`M 0((@89 Ѝ+6+ +X+&p@-hPh@4S 0SPP *xD0D P0000$R0p4(6+X+H@+<;+0s@-0@SP  40B3/p00S\0 pH0P`@ 0((`Ѝp+6+ +X+&p@-P,@P@pP @Ⱥp@-X0XP0SpH`@P eP  7@p+ &6+&A-P1a051q0S :p|@P 00P7P)χP!PR 0B@ {PB 0 m000@A a+6+4++H&/13D<+G-pa! Q` \Q 0 00D! Q 4q4$C83(S$1$A?@" 0 Q5 I!1Z/ , Q, & 0 00`2 D uQ 83Sx00"@0A p !-↷00@ J FЍ+o&ZX++e&+ɻ+ػ+O-Tp0EMSP8a  ,, @$3po0C 0T*0 ?o2W03S 20S " T  0S Eߍ0S3 000 |"0S 0t"! 0dDV V V-   B B B 0 0"p+ 10S 0@  B B B 0 0   B B B 0 0X![ H✆P 8◆P# 0S ζ V    V2 p0S    V     V l p T D +&ȼ+< &ͼJj{ 0P/00S C &6+P O-6M M)$ PR P  50S@ލ Ѝ90嬕e@T 500RSQ 50SM\5pE9S)0D0e0000EH0D# 880@$3|B 900 (4 S B}@P%DB9S; B. 0 4B [T U@ 40T 949 dj j#3NY0 0_\|3B 300 00zBw⏅Pp`g(4 S B>0305 3 R g 0#p   *"00K b(@ 2B0 050Ƞ30s33P03Ƞs0 20S )Tx0040 S X(L#R Q0cÝ\V I $ 8OB 1O  1 )a#0)90S 0)(PU @10S1$10Sh 0 X `y 0W090C/W pC0S 1W 0 pWJB:B6`FVU 4S 048%0 ZBJ6+,P+L+X+,&4+S3l &++&18+(+lؿ>X+<;+O-dCd5)SW0pW_`R00yu0SW  0PS9 S00P0S 0S 姴09 R ?oV20SJUMU5D R4 pGW`pVp``労\2 RD R: R; 4<820S>,P: %+ P<(4 R $ R 3   p}z`wP t +0/ဳ䀣 0/00#00 20 0 0/0?,00#H0?\0?d0 0,0刓吃(pX``P420R000%60"`20=S" " \" R0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h0 aR!S  xx#3 d\ P!0!! ,AQ  69-0CS   R0 R R 0N\ \0\x0=0- 9!s+lT6++&k+ &!&BZsC-2BMMP0000 00 Qa0S q䑟=0=P  RP!0AS[0 =0p㈁0W`1lqTP  RP 8!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڔ0=ۍЍ|0 p0P0h0d0S Pp 0)dꂺX+X+T6++8++n&@+ ,O-MEMM 0$P0@B@@<hSD 4 4R 4S{ #404P |DQyD$` B D 吃夠PEN␓{D0S[h 04<`#4 "SQ A 0P3/04$!0P+s00@ @"͡3( 0A E6/0@0 GR00 G0Q0'G2P004SQ 0P3/04@EP0 C 6/0@0 4S; 4$`0?0;DC0 4P'x P~ ׍EލЍ `4SQ 0P3/G+p0 G#͡0 0A6/04G+p0+ G4 $  BRPEN0SP @0S1P@0S( 0$00S  B0SP D$R00S5 00S \0l 9P tlx3  PPnP0SZX+T6++ &X++& 0 X+Q@-@0SSX+0O-M< 00 0 80 4 @b  P b 0 @0 0H0@0LP0DpPP:P S  S  S;  S 0 ``ip SK  S"  S<60S  ,,Y(60S i 6f0S -PR 050S  8Ѝ50S P 0 L50S  << 0, 000%`,,;0S40S  40S   P 0 0 8 Z0 0 0`40S 0 H30S  30S30S  j?,P~ 0> Z 0 0 8P30S` P V0A 0 ,#0 0 020S  s20S620S aPo1 0 ~~Z 0 0 8LI20S 0  m "`f0 0 0DY10S 403/ 77 !PDZ00 0 T10S00S 0 0 8 00S 0 4\  03/Z 4   00 X+5&+}&+ +6++Pt&c Ѝ@-0  6 ЍO-@p P4 aT00SP Ѝ -QP  P P ADPP@D`FRPP @-@0 0 0 Ѝ@?@-v @&@-~@-QAMp M0W@`0lq`Q`\0j p0P 0u\0 rAލ Ѝq0R S 0P01 ?t0-; !R  0GGfl@Pau3 3Xu<T0 <;<@D@ D Z0R0`G #R+@W+H@-SW+0@-6S R+~p@-P#u uuxum/l2@Pp" P: 2 ,-o$ p@2|\S+S+@-Bu ST&0@-h@  0@ 0\Q0CS @C&p@-@Pp00Sp8PU``p840#U :PX0Pp4P8P P XPp`P -7@- 0@P0 0P0S0! B Ѝ0@Ѝ/G-P`M`P s@䠟 T0D 0 S `7`Ѝp | J ]  ^p!0 l 0`# $C0  .0`  W0B4P xs&vlq@-@`Pp@"!0# U 0 xph . X6P@TP(P  Ѝ-,Mct <0"0!0!0 0 ;0[hil&-7@-Lt`P @XT@Z R 0@S  000 Ѝ0@Ѝ/h &JY+Op@-PP@ Jt0S 0CS 23 0 0p;tp@ TT 0 0 /t, ,Up0SpY+Y+X}A- `(p 0,pЍ P  .O@P  PP 0pЍAp01Sd0 \5 0T2 0`p 0S ` F$%P `Y+h &C-q@1MS0`o1SP1SeV1 묁XV ЍCVS 1S  D1ЍCdV0p0S) S S  rX t@ V(ЍC   yrX   or X t` TT ЍCcVЍY+h &&J4 0Q 000/ Y+h &G-AJM1MSp#=qc`0 Pq c4F0 0 F]pp 0 S JލЍ;X P0qA7J.H0 0G1$HL  $`000P Ppr Ls0S8l1!0 Y+ .K}A-XQp1`S1S@1SFV1 1SV AV1S A 0cVS D@d0S VA0  p1S XQ 1S< AVY+h &&JlqdA-a0 MSP@ 0*000 00l|0P    RQ  XЍS @0  0P@H[+A-8Q夁X@`!1  0 0AS!pRS4V0 1SV AVS A 0aVpTPDP@XU DA 0VY+h &&Jq0@-P@0$M00PP0 p$Ѝ0 R  h`*d0 0 1S00 000 0Y+JO-\q 0M08@ D @CT Ѝ0ZЍOR`" 1!0  @@0:p Y dPP  @@ 0 )p R Z ``0T 0CS0 8,$Y+Y+<c0@-P@0,M 08PP 0 p,Ѝ0 P  )!! 0Q P0P5 08Q( Y+h & p@-`@0M 0(`` 0 p?Ѝp R  )|P10 01SL0 D1S*{GP ܉!Y+h &G-@M`Yp2 0S 0 000 (^P (P(0U%`(` P@P@Ѝ`(P$PPv (  PP$0 Ip@ЍG(` 0v ( 0C$ S  )v%Pp㠡v00Y0S Y 0I00l!,,pH1! < 0(  (`(Pv ( m (V((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! Y+' &/J6C-M⬀p`` (mW0P0 0000 ]PPQ ЍP@P3 PP  PP 0p%ЍC  0R  e(0W400(00 P( 0SQP x0 Pp10!00(pP0Slp1SX`D0S 7U 0t $pP'Y+/ &Jv0@-P@0,M08PP0 (p,Ѝ0 R  '0 0 1SL< zZ{e[jKZfke[KK{K+S,Y+JO-xrMM00`S@ sTPO 'P, H'J@ tl Y:0@@ 0Ep.oTٍЍm  ᬸp  Y  ' m "QPR !,%*1 21 0T 1S1!T0 0*T 1!0 0*Pg0 D  @g 0 D oY+O-{JM M`P@f03~<0f0`400pc?c8000S0P0S@pThK+!W 0 0P+4@pW4pr4S U08pA/0 :<0 Ur> r.0 014@:@#TRT 1S- $ IR:1t| Y00 ! \ Xz@0(3p0wG, AW,W|pG y, W, W뀀pG  y, W , WpG  y, W,t WpG  \y,P W ,@ WpG  ,y, W, ~WpG  x,uW,qWpG  x,hW,dWpG  x,[W,pWWpG  dx,LNW,<JWpG 0x,AW,=WpGX 0 ',0W,,W 'fHwQ `( ] YX'0Q00S? 0YS; XQ;X PD0j4EH01HpL001`00pD0 pMpL0X10@s{Xp&4 0#Q0X00Cs 1SL`X0@s9YG4 0BrYPE pW.-x ,?/4 pS u,V,갠Z 0 R(0 R pP j 0 0 0P3A7/%00D0 Jލ ЍY@ 䄟 RH 1 H0pH0S# 0 0 @3SH  R8p$W"RZ 0 00@0P0@3A4/`4IpY 0 0 @3S 1R 0) 403001dP  0*p 0040 [*Y j0 S P40Sr0 00   $ $  0`p`08哫*0S P   B ( P R0X0,( 0P$0 ,( i$0H0pp p0p@  !H0pp p0p/;㨀H0 H0ppj0 Sp HpP  H0p"W 0 0H0pH0pp Hup0pH@P0P Ap ppH0^p 0H eY+ & &Y+Jl<\]+L\l|\+$h &O-`qMܿ=P`[Z@P U#*0T?SD00UP.0p0x809p R  `1`SH~P`  h00 14Ph0 ,&@P}0_\, :@)Ge&l1So &)\+}Y+0.T0hp0e0SV@@T T TN0P 00p0@L @@' 0@0& 000.000h 00PB \0p XV qߍO=e0S \0pP0 0 0000( 0, 0M0s@-]e@ m0 P=g ^pc }`_ P[ @W 0S  OC JK&t0p@-@PT`` P  p@0p@e h^+@-M @ P  % Pۍp@-IMM @` PIލЍp P0 s0 lmhP 0S 0S0 0S   P'h^+@-M @ PDۍ00 R   Ph^+H- p3MMPPYW@D_P 03_P@ X PM 04_P00 S 5P 彫P00 S ) 峫P2  _x 婫`Pa `2P X_P ,TPP0 0 U,00P`P0SưX QJ0 P +J tP Ɒ1J@ Pp10S d 0__ 0dY_PPPUX$ PcU 0 [V, )PmP`ZZE_oR 0PPcU  84S J P pYp* 0XHPLORh^+\fjx&f>O-pM M`;pj/ p P@@p p p0Wp10Z?::0S bލ Ѝ00WM@P @Pxq(0IT*20Sa00 0Z0@17 ]0V98 Z RP Hc1Z. @^PZ 0p >V㧉 0Z 3P )cZ. pZeP cZ. _KZZP c 0Z. _C|dxedAh^+}0p@-M`0 0RPPa0@P\ rRP Ѝp@8P a 0 0P : XЍp0 S C/p@-@P\P`\V pp@^pO--Md `P\0`1DV<,<}ЍJN`0PH0  H0PD0 D0S  4DH2QU U U;㜴x0@\\|6〴x01tx00Sx|U@L0\ 0S0R0SX0 0P809 PH0`p 0D80Xp*0SPx ?[3S00 P 3S00 P3S0P P|0S|P@ 0000000 0% @|08P P@ @H0T`0,4PD00CsD0;\0S 00T0[S40Dt,0僄  b 0`p ,0 @;p ZH@0hx0@c[80J~S01804Pod0S 0` S_ 0p@04L0@0?h0?l0L0?p0X0S8 z竸z@0相0SGx ?c[ |08tx?ɏ 0T[ {{'0 0@0tC0{E[L< 0P=[0t P0, 0P0@00,04 h00400 l0@000L0T 0p00T0JnU 0 00pD Y@7>  Tɚ;nG ?4 $;p <H L0 !p @0x C?4 ;$p 0 80|0 {{'000000{0P x,ʟ 0Z` 0Z 0 Pf 0SR40T,0[Ⴤ0S00僔'  pa 0p`pz $;pr ,0@S#04$;pe I0 x 0jZ `0dZ,0P@S# 0XZ0 P0S40< t,0叛{ჴ0ST0P 0 b0 0`@p" 0 p4@ $;4p <0< ?ᚃ#*@ 0'p  ,00S40嘰04 ;$ @p 0 A,4 A{ {'n F`{008|0P PT0 A,4 A{ {',0x`S#Ɵ 0{Y<0?ᚃ!<0 0 PY00  0 PY 0 PY |08%Y@@-` &A-@p4S`  PT0DPEE$UX  5[PV00,[P V0-04 P $3MDPE@D^+ p@-P@Q0  0 p[P@ R 0S Lk#Pp 8J00 0, 0p$]# &+,H:,?2,2,1,J@-2400S (0 0 pp$ (++Rb+G-XM0MS0 DpW,Q`@`$$Q0 nkQ+0AU<P 0 0 ]ۍЍ0 000nS ?S aS ppS qS x0  @0 d090L0崊0 8-<+ +T+bH&4+s&A-X`0S L00S 08P8@p0Pp004++<+ +@-@L0@?2@00Sg&,0, 0S00_&(+++`:,c+C-RP`tM  4ş4@ !Q RP ğE R`S X0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ L`] 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+]I`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 N00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&&$:,5:,$6,$2,+PA-@@P@T - @P`p0Sd \0 j@ FP ,04 0` 0@A &+H:,2,A-@P@p0S0P0`x0 R `F R0T @ 0S 4 P@` 1,+P+ &p1,?JP@-, 0 GH:,P@-, 0 ;H:,P@-, 0 /H:,P@- , 0 0 H:,+1, P@- , 0 0 H:,+1,,P@- q, 0 0 H:,+1,Op@-PAM C0@ 000 0S0! 9P7 0S40l=PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0 Q000S0&'AލpP, H0 P @0  9Pz\:,uP:,L:,H:,O-1M MP+ p4 1ݍ ЍPX$9P @@4@@/ ,P_ 40S d_P 4pPV / 3Ps垏0S30S 3Y30S7 0a@P0 |30 0l3 0# T30S0%Q03@OoB0B&Q 30S  2` 0dP0002`P0 0R " R `2 T" R E@P L2\"00<2 0H (20S%W 2@OoB0A% Qo10Sk 1pP0001p^, [Z 0PA0S0 ,`V 咟Q 10S 00S2 0@P- 0! 0 000| 00S% Q0@OoB0`@b%Qx00S  `0 0P00080`H:,4+D b++,+8+L:,P:,\:,<++T:,G-JMMPp 70@ 000 0S! M8P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1doP* H1 @JލЍP @ ! 8PJW#P0ʡ Z0S @$00 R000S00 'l0P0<4qp P0ST00@DT:,L:,P:,L1,+H:,p:, 0 0 0 0Yp:, 0 0 0 0Op:, C-KM MP* 2 Kލ ЍP"7P @`2`R@\2000/UP 82 0S@(2̅- P0 Qo` 0S 10S 1 1 2@P x-p1@d10S x4PT1 0pP 818!00,1 00S P- 0 0 0.>?0T p orG&t0h@Q00S x0p0OP0 00P0pHH:,4+,p:,L1,+D b+++@-,L:,T:,P:,<++A-PAM N) 0 $P`P0 0ꌀp @G Dx @0 0\0@@H;@C0+|6P Aލ0S 0 pPH:,H+p:,P0@/lP@- )0$ 00 f0H:,p+Pp@-o@P P `hbP X]P (pU ,0Q0  C0 <pil+0@- 0$+H:,P@-( $0 00S/0坄H:,P++0@- 0+H:,Pp@-0o @PP0B 0S 0 s0S P (0 0pP@tP<P B4P(00 ,d:,l+p+ 6T+H:,i0@- [ 09P+H:,0@- Q 0FԒ+H:,@-(@(0 F 00S 0 T+\H:,d:,0@- 6 0i<+H:,P00P0SA- $(0 !0ЍPAaq0S000+0S 0S1000PPsP00kP ,C97`0H 0QD084A H:,X+++ild+4+z0@- 08+H:,0@- 0L+H:,P00P0Sp@- '0 0pP`P@P# 0P n30P xl00?o2`SP@8 8 <00S000H:,+il++P00P0@-S j' 0 ЍP  4P 0vPd00}S`00S T0T10HdP 40 0, 0( 0H:,4EP++Lvh1,@),<),0p@-PP0000J8@Pp,p dHp@(P p@'1@0@ 0S 0t00H:,ܒ+~+@-,P00P0@-S & L0 ЍP 4 4P 0 P 0H:,h1,0@-M P& D1 Ѝ0P0! c4P @1@y*P0 /@Pg*0@0 S 0 00S P |P `@l0 Q\00S  L0P 0gP000$0PH:,4+D b+h1,+<+@-Pr& 0 ЍP 0S t 3P 0S0TxP0@rP ,0 $ 3PH:,h1,G-pQ@p`HoobpQP>10S|1ЍGT`pE8%& P1 Ѝ@j5V@ 0 001"T9pX /(`P 0S 0PP 05|0@0 A `T AQPppTT TV@T 7@P <P 0 ЍGL1,+H:,< KA- MP% 2 ЍPR0S"N3P 0 1CANQP 00|S 6P xP 0|:Q@p1l@C) XP#@HQo`010S 00CS 10S *) 0 0 S v 2P0 T.>00R   ]tp!"Ql00S  \0 00P0040@H:,<a4+D b+,++<+@-PPM M&%@p1@ۍ Ѝ(`9@PC@@NT( BMa@P@F/WP+@00S p00CS0 U0000 `,  l0 H0 N,2P(t@H:,ml++ +00@-MP 0$ `1 Ѝ0P H!E200CS0,P@/0S0P~PP P@N ST0S0 @ʴ0h@P @PN SU x0xXT0S 0H @N S (0 1,H:,++0p@-p@P0 p@K$\0\`0XPS 0S/0S0p@  $00pH:,<),@),+0p@-`@P0 p@%$L`LP0S.0Sp@( y00pH:,@-,+1P00P0@-S $ 0 ЍP | 1P 0h PL00}SH00S <0<00P 0H:,FUP++\h1,P00P0@-S # 0 ЍP  T1P 0l@PL00}SH00S <0 0,P 0H:,FP++h1,p@-MP`+ 0ES+ >@ 0 ۍph1,@-Ph# <0 ЍP $ 0P  H:,@-PM# <0 ЍP $ 0P  H:,@-P2# p0 ЍP 0S L 0P 0S0,8  0PH:,Pp@- # <0 p00@PP0 PpH:,P+!0@Sp@-" @0 p04@PP,0Pp H:,P+,Pp@-" @0 p04@PP,0 PpH:,P+<oQP@- " $0 00S@+H:,+SoQP@- " D0 <@0S k0S H:,+@-0@-P000P0S z" L0 ЍP@ 4T@P@$L QH:,Xp@- M PZ" 1 ЍpP! /P 0"p`1`)~0S@1D0 0S 1(1P%P0 0S 0@T 0~%`H@P ;L d@ 80@ =0 @ 0@3/H0T 00S00%H:,a+i~c+ +8+`:,0@- 0T:,H:,0@- 0В+H:,PA-PPPPU㈀ !00P@lph0hP}00`0 @00[=T,0P AQ=H:,P:,+5:,$:,7@-PA 0P00v}00 Ѝ0P!0P%0S0P 004B0@0S 0 S  @(B@00+T=0 S +<= 0 .PH:,L:,+ ++$6,$2,P@-00?o2 P C!0 0@0P 0P pP 0H@XR0 L< B S00Y0 D+H:,ilH++000 0@-S0 00 P+8+H:,+000 0@-S0 00 P+J+H:,+p@-@Pp@0@- 0\\:,H:,0@- 0iX:,H:,PG-uR@`p]P\T- ,PPgT`( ,@P`_k$g$V; W P10S- D1D!@1B0S 0(`PKV1P1@W 00S 0 0B0S  +$ ($t0Pp0@PPlP XP HP V ЍP++l|++t+x+xe| @-s0H:,P@-< x0 pSP \00}ST00S H0H|@CP 00 0( 0$ 0H:,P++(h1,@),<),P00P0Ss@- 0 Ѝp0` 0S P@P Ŝ0Q R   LO 0Ѝp@{$Ѝp@BH:,L1,+p:,-KfPp@- $0 p0@P0PpH:,P+A-P0 "0Ѝr0S2{P70S10S 1{@a0 ` G;0封S Cb"c! !    c#A P0U0C00CS0<\  P?00CS0@8  P7 (! -PS0 p00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 SH:,++<++++H&3P00P00@-SM  0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$_U@00H:,+_P00P00@-SM 0 0Ѝ0P | s,P 0(qp L0@0PO) 0,)0S 0000H:,+hP@- $0 PH:,l@- (0@P0 @ +{P00P0A-S쀟 00ЍP  ,P 0/`P PPP 0S0PH@H@@-p : D9 900a_H:,EP00P0O-SM  A 0 ЍP  +P W @P@ 0S0@VH`X-|0P 090hph`h@Р0000 0@0C H:,Ed:,p:,P+Pp@- 0 0p`@PcP |@]P XP@)p @ @000 (60@H:,Ē+Ȓ++A-p`P@Pd0 A\P 00-4 0 RU A +P+@- PP   R Ѝ@P  HR  @0S00 Ѝ@`pH:,h &+0A-p`P0 AoP@PLp @AP l00 00H:,+#Pp@-O H0 p@00Sp@000(y0$@$P0YPpH:,L1,+4P+a0@Sp@-/ d0 p\00Sp@L0Ly0@@PP806Pp 1H:,L1,+fP+ @Rp@- l0 pd Rp@T0Tx H@P0P8  Pp H:,L1,+P+O-MMPPQ  3 ٍЍPʴ#EEf*P c@3pY 3 " SHP`@)L^80p㓄( @0S (30@ @c0S000p`J2rx2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )b 80 F`0S@iR0@S 0 F)b70uF`P1%x d1 0S x10SL1h`10S ,0x00CS0.  E 70 03/00S 0S 000CS0 S0  )t7z00000h0 Y 0pS7 H:,+++8+&++P++$+@-@P ٿ00P ӿ00PͿ00 -d0lM _T00S LD 0d P,00pp(+++e+-lM@P00S K@ 0d P(00pp ++e+A-@P p0 0Cs0S13E `BP@ 0 B RQ@  0 0Cs0S13p@-`@P:;P , 0S!PR x,p@l|,}*`~(P %;P00 0l,+S!0R5IM>p@-@P 00PU 3E ,JPp 00p@-`Pp@0P< 0.0Sp h0 Sŗ Ѝ00S 0C @pP2긒+PP/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&G-pP(P SR@ (APP0   APN0 0010S / $;Pe )`@;P 0PS $2` P):` ;P P)P ::PP000S`UK ⺕0S 00S1 @RđR0 d T@P0 0 U g)d)a) 0 011 0Ѝ @P/) `5 0S000@) 0S S St0 0S 0`S@.)H0PU %),Pl+0+k,+i - BR0 R  P R O-@M M tPE$@N@P0DHLP0(,$04D (0p0,0DHL` 0 0S 0S X 0Sh@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;zK@P d־P TѾP D̾P8< (7000S V PU@ /SKV@0S  4P @0U0C?o20S b4pWp 00C00p0Tp pW HU5pPpUP 0S J50P00 $ 0R 0;00IIE+ 4Z0<03 0 048s)3 x30S7tZ   (@90P0 $3@@(:|90P@ 0 @ (0`0 @h0 `0PPx P00@sPS 'P Y0@ 0'T00SPeU 0S} W +X44+X4+X3XP+ '40!0 4Pp80L YA+ P04E>0000JP1@@DcT@@/ 90P  00+L 03 08 04@ 0R 0S00}St0S @0S 0S@0P/0JP0Y8<00 @3j8+S++@+h1,d+<+H:,&`+O-kMMP|dUZύLHD`\X1 !0P`0C6xQ0 B?(p8 DA'XH&La\&PQ尡V?Ⱑ0E?oT20S`dQ 0S PVV 0S#UU?0Sxf|0s0s0s0s0S0s &X?0S0 /pIP&&?0S 00SU  0n 0 /x=0S !~P' Uu8MD-6>O00(0SO !N(P$/>N0 0 (00 N=Q 4t=0S2@=P R( (@@-0 Rg@lBP@<0^ 00|SZ >\00S;0J\0QK\ .< < ::!k,d2p;`0S00X  UL k ;/ 0S 00S 0P 0S} %@o`а?pPp 0S :H0PU@Y :I=pPX |p0SU 0S_ d+0 00 P#P %7P  0ix!C_/0t1p1l10E?[/ p x10l1S 0S tAT# 0S iAP d [V K l0夑l00S 00S P p_%tQ:Qύ[000D!, H!i8 P!0R PP000!E880,10i/10T`P VYF08 ,@ɒPP0S8 , XTU`P@Tv  p 0q_0pP7/IPX80S +PPq/ۮ@|'Z1 lV100S @Pq?/70S00?o 2h#PP0 P60S P 1S$ P 1S$6vF V AP@3 )d 1\60T6sP `00@T z? sDP Q00@T k? dDP B00PP TN`UEP< 'r(P<50S2P@T4dL! S&QQ L&R H&pSn `40 WE:e0 0- 4Dpup 1& UF@05 ?4@T Q?10/N,0 /@ L!&Vv40SlS`V < PY= 0 %0!%p0S0A%W%1p@00S`a\ST0EP@0S 30S 3 ,@@ %V P30S 3 @ %T ,BL%.&pa⌭ 20S $3>p`tR0D0`0#@ D0DIP> 4pPP`@(PPi ~0< R 1000@ q#@pP`萟(@b>0@h0|! D0P A@ pP `(@@0S Pp@(PP-ࠝZ  0h0rPc ⻐h1Q00S e+$ d+h:,| &xf+H1,    D +]   v i@++ +8+++Y + + +     X&&L    W 2  1   P+6Dml !L $Y Ȓ+o*d:,t+@Be+T+p+s+7x:,h+p:,`+cP> PG 0*S0 GQ<0-S8 ;QP00P0,0 /R( *R0 '0Q@(0000S!0 01/6gP 0, yd0dBdyP 020SyIP r"` P `P t2m Pn000P }P P  B"qoP<0S S WO D<0K/CR032 V 0S|"0 0 նW5V6ZD Z8 ,p#2Sm#<3Q0SQ?0@0!3 (SQV3 T`Hᛶᘶ0SH40A {u00P 00S0xsl4 r|00 P 00S& 50S004 Dn(0st4( @ 0QP `th0S050o5|2S % R 5 P 65P P P EP! 55`0Əs 00@T@ @V  $P|oB0 0 F 2 @R bB0"0C?o2? [B"0 "0A c0 S ;S0 VL}=P 0 R RT L0SD0S00?d'"0 40< R /$ $ T á @"͡<἗<P p"HRL á0 #PPW#Pp0S0S}H80SH#@P p婪T(`000 R0PT0% 0 pww0XppX0 Xp\pp tAtP #P U 0 |pWH90S @90SD90P`0V0W B@M0 @040SD H 8PZ0S= S D0 S00 @P(.>0S *>0#S &>|0pS `1 R R 0Ha# 0>tp uTЍ ? 000 $@0 PP=0S =0#S@DT|0S ld@"\/$0V 0 `{#N"00 "@Bh++O-PBM MdEdP$P QL?0a>0 PPP0p`5(p 5 P<$ P@+40S5V $ 0D  /0XD S00H00S+(( 0S 0 S     R  T!$PP$p 0 OL/@P$p 0tp9# ap{0tSS 00   |00Bލ Ѝ@H3@a 30S VW@@cA  /2 0Z WW T 20S 5V  R x" R " R W WSh2h <202fW @2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F3g+4 ̌ H:,++P+++++̒+`:,H1,L&+-A-` @T  0 ЍAЍ/0p0$ P jxg$. h0h a7oa0@S P 5/a+PH:,g+4 r̒+uO-@FMs M` ( @: : :0$0h30(0$ 0H,@J0P S;寱0  ] 3 Fލ ЍFJ0 @,Q('2@@в@aGT  ? 2 8J 0 PD0P2d y?P h"hd& T&0S 00S 4 00d  PP dN@0S00?o2 PN :0@6I6 D01@dp  l& 81 1D0(66S0d00 0d0>A0aPS 0P P 00S x0 0|0)lP@0H x@0 0,X@0=m++zH:,H1,P++m+"+$+0O-FJMMsn0pܖVXv600S00p  9P塣X l6  d60 9޿P<口JލЍ(60 0 00⭿97S 50SZ53f5य़0S# Ե0S5 Q U 5R "P 0S 500CSL5l f00\=0S P97S( 544(%(t0SX0$000(00000 PI 4-0000Z40܀C XSX @4`0(  $   TD CyP 3<!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R |3a0 R0S R3(0s0?008'pP30SC97S00000 ھ0S   0оp堢宽008'PL2 0 00 00Iⴾ 0 8 嶾p\ 087P<r 97R] Sȁ 0S [Q0sN0010S ;70:70?70>7='<CL0S ,0< t1, E=P!1 R  < 0 !0ZP 0S 0097S|0 T0S [[X  S\00000IRg+D+\+Ԓ+m+L+H++++++P+tH:,}+y|i+&\m+ ,C@-2Bp`WLM LЍ@ ּpP=  ϼp7 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/@p 80S 80#S 員PM圼00+0(60 8┼pp 80S 80#S 傼 ptp 90S0 00 0 0⋽.LЍD+\++MbStg+0A-H`D0 82Vp  R`RBR RB`2b  Q  ,#00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPx40S4Obm 3 3K pb Ѝp30SCP RuPHd& \3 4LS P@04000 3 )bQ nP@$R000 0R0 0|PP  HP L'@P  0 2$@12P0 S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S 0 0S PU P 0S 0S T01SQlО $0 X:,2,D1,@1,1,++H:,g+T p:,h+܍ ?+̒++A-M  @P0 8 4 t(t@@Ph(h@d( $ T( RS D8Q  Ѝ 00-S0S 8 7 770SN0<00@0D07 0=PPGEG@Wn 0PZx7,0<7P3D"PPL7`@0 0wK0P [0P6Qx AQ ,0 p,0000@+Qq ! 0S 6 @0szD0s{xFP00<0Su40Sy6$ 0 0  n 00|S  0fpD,,0S5P5<0f ,,,0S    5P<0,0p,0?PX0: S 5 L4 i0 0,0D4Q PU>0 00S,  P 4 440S!@@\4@@0Sh4@s `TP@40S 4=040 4 (h 41S $ R 4P I3P P P CcD0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c 48 pcU|,00@ k400 0400@ a480030CS,0"p,040q402P001!P X<0S <0,3/0,0@44@m1 R0P)40 SBT1#&0 ? 0!$$P400@0 0 0 48 p 400@0 0 0 o$P0 fw0#a噜@#D ,0S <0,3/4Ep+h+x:,h:,T+P+++2,1,$h+̒+L T H&p:,=H:,\+xs!h1,X+Ē+d:,[|+h@-GM , 0 0@_$(000E@P˟_. +,0@@P40L0;K@;0 0;00.oDD0S>;0SV 080< @ t+ RD00S0X H0PLKNH<41<S$$.P $00|S $P/$4@J30SR F30 SN $ ): 01RS 41S $00-S0S |: xd:$ dD0S $ GߍQ0S : <0s^@0s_JP϶0080SY00S]9 9 h9T00$0S  T$ シT/00Ph90S 20 S$P$20 S$P$ 90SD8Q0SPIPP?D0S!0S' Z+80S F(P  8d(880sS3<8  08Pw00S  -PlGfS000S|P 7 H7 R0WAT41SWn$-P_x74!(07 6 (0p(0}p 0: S 0&0&071S ' R 6P ӥ6P P P F60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p('Q*$巚$00|S =@$g((0S$ @54! 85 580$ ((0S5$吚_00\%p00(0q(0P5P001!SPL10 SE480S 80(3/0(00%0L0S04 SDQ  40S 8 4R qp~ `⍶%'0$`x0pr3X@$P϶  0nf /P$)D0S s0 0 @ 0(@IP`\ T0(0 00<PP sZ,pJ P @`@#4#0 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ 140010 SE1(00@N 1,00(00@T!000t 04Mp@ TL0Da0L0 TUA @(, cp%P1 O1#JX備@PbL ⶻf3\00S 0=<@ (0S 80(3/0p+h:,h+x:,T+L++В+h+̒+L T P++H:,\+X:,1,X2,p:,&+Ȓ+d:,=xst+܍ /0[+@oQP@-X@ L0  P @ 0 +H:,M@-@%00 4ЍdQ p@-P,@P@p1P @h &p@-T@P HPP  0R  p+,(+p@-T@P HPP  0R  p+TU+0P @- Pp@T Wp`W VL\ P  R/ &G-@p`xM*T oTP ЍGFT8,~,a,1  CQ@ ❺ QPj ЍGy 8S 0S tgP pP  0 {@DTЍP 0 hX0    03/ (  \+ &8 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/+\&p@-H0H@8D0 (8080$8P  Up$808++8+@-A(8S DZ0 S 廹 0) P p p $8S 80pP\ UP 0S ,8S0Z (8S 00CS0 0 0` 08 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝpι+8+H&"7J T P/@-@P$AP  :/V@-<@0s5(00pp0Co`&+O--0 0 KM00- ̀0 P 0 0SZP=9 =:k{] A08`Y0' P@ M A{ QcP@0I0,0 0.AP+T+:,h:,Qh+x:,p:,+P@<00X (p  `t 0寷{` Y    /0Z C00 0f ◷`  Z f 0 凷`< < f0 L!w0` U  S  RS0!1D0f 0;#;Z0S;#;0d ƒ>#/+"+ 0"%+?;#;0@#5;DE "E0@S(PY $2@V0TQ@2QML"0 P EP A  Ak{H{7{jJ"dZ` f 0" `< 5< Lfp 0#0 @0S  P0S S dh#@p#d0 S30ppyKߍ%U[0DEX@-,T0@ R0 @00S 40 0,pp],@h+++-$M?0 0 $Ѝ0-4M 00 000,P4ЍO--pMM(E|Uᜱ " pᓱ4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S 0sX0S (P 40O,40S` $1>` $S 06 6{ A0( A{{zdWdp0f0# 3`3Q-AP %AQڗ`3`#sA0 f2 ` 0 ß R#3SPS0r 1D0000fm/0`  $P(0 0SZP=9 =:k{A@2 AP09 A { Q5 5 P;!%#3[QP qD d 0@ f0 !奵1`P0Ft1p Rf P 1*|!3^2?^01+0T!P0⃵H1 000ss0S"%+0!gU6 Y`0Sf Q`|0 0ppMߍY@.A:,h++T+:, >l:,@x:,C:,QI^++kp:,@~|x!P P0  A A k{I{7{Z`0U~<0P  pP<.<`g0  `  @-+@V*@p@-Bd00` pd00CS00p ,P P00 @R0S"P7d`Qd00CS0*p "P \Pd00CS0p000S8A PA p0 0 `V&wp0 c`Pd00CS0^p 0@S P,P \Pd00CS0Mp `V0 0 %Pp@:,d&:,A-pp@`nP@ .PP d@P PE  P@OoB@:,O- U0mMS pNDPd ?*0S mߍ0P.0͵1u4PPd(0P/S SUpE P\4PPP P,$0CS0 p, P P P0 PsdJ#%P P %P d0pp P 0? hMvdKvdHp P 0Sd0ppP0? .vp P 0S0S di0 P P d00CS0Up`2`U P Q82<0 0 dAQ 06p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 p P`, ^0#S^0C0 huP\\ Ꙏ+:,+H1, 7 +h   &++! ++@-0 @0SP  P  0 00@ x0 lϝP T0 LƝP 00 ,彝P 0 &a!f!L1,k!w!|!00CS0 Sp0 S0 p/1A-0aS0P0>P3U %P 00.S Pl`1hq \HT1P@  D(P00T,!,!,0 $1$ U 0!P0@p000 00000P0 0p0S000P0T h0h0 @U t0\#P$0`S값+P+!!+++!!+!@1,D1,!2,2,!L1,+( 5"!!p@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p++D1,@1,8),+\+++++ H0@- 800S ,0 0$pp]a(+++:"+A-@'Qp0S `0S pp*00`P㌫r0000 0S p`0S ppx 000080xT  'p++\+`:,<"O-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ B>4P/S + R+ N P pVp刑0儁00g00000000 0S P1o@19 k70@ R 100CcSppW00 0S 0of000 000 $RVcs@jsPPZT{ (P004+8+;,++Z"\"j"P+d:,T++V"H:,+""A-Q0qS0`00@S Q`Ѝ0&RYP P s0 R 0000@ Pl00}S0s00T 0S$@,Q 값+P+L1,+""+&H:,O-a0AS04M00qSP Q 1Q4ЍPH P0.0tP00` P$ PHl!P@1(,!.2 (A 1 0  ? $@, $P 0 @ P 0$0忬qp00P0}S0s00U 0S(@<pQ I값+P+L1,H:,+"#+##+k##@-,@02$ P# ?,A-`Pdp㼚 y@P  s@P 9m@㨚#@-@vP@-, 0A- 0p0@S0`P0LP㬀" P 0S 0"S x0S R00`P"S0"S0 00<),+P+H:,$$@),+0@-M M P  @ Pۍ Ѝ0:Ph 4/S @ p P;0@TP/P($*$O-@pP`V1@@P`3:`E0P԰0Y/  0T@1PSZ 0 10S 0vP0 R K0S*00 0>0 Ѝ:,+@-$L0@0 <pp pP0 0SP0 0$@Ѝ+ht@:,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C|+t+P$x++@-0 000 p0S R 0Sd0000S b0Cs R@ S0 Ѝ &&U!7@-@P0S 0t 0p0Ep\X@0S 00@ 0,5p( Ѝ0@ Ѝ0Ē+z$Ȓ+$C-@\ᄐpA`\P ^T1:00"\ \ L|9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!+$H1,8),$<),@),/A-p`P @oP0  T  `00T  0@ R   `FVp`00CS0 X PpTD000`000 T00$$H&$G-̀P`@0崠T㼚@!p@-@PPptP p0@-AAM M^PAލ Ѝ0PE⃛Pab/0 Ġ}PPh1LA`1T@㗚哚㑚00$!0u t傚倚|+Z@u ⚲U 0S S 000 BTR   T xd儡l  10D0 S B/o" R  0C)&r*~)*]A,&****\@,@-MP Ppmp pl@PL\܍@襠, H}P \܍,0 < iK,*L,*)&p@-P McP'@e?o2P0S ۍp@0P55-` `әPPPۍp@gD` 5  ۍpiK,+\@, +*!+p@-pP!P h(@PpT[P]8p@@0P L}l1s0Sp0p@*K,&I,p@-P MP+P/o"P R0 ۍp@>0Sp`Р@P\ۍp@ P l! r R< < 5垟 ,=ۍpiK,H+\@,O+4+6+&g+o++@-  A㖝&-O-P4M$`4~`=@PȔtȴ`0 `4$$p0Z$ dQ Y  Q|x$0l P0\$\40X4L@4( 0$<!PS pP `U Ut @DOo0B#10<13 B0lS010S P    Rpp@ tS`S FS4 9S/S0Su(#a0CS00 yES2PPS2P'Pu "PZ xPP[ W|2 @|P[  dPW @PD D(2!00=2 1 0 060S1/ P* T/%,00!0 0 㐡 0,P ~ D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/iPk0SPP54ЍPK,dK,I,E,&0&J,004K,J,I,A 0E,00&/ 00& K,1&I-,-/0///(0E0M001@-E,@-@M h \0P0 0D0@10S  10S0S@Ѝ⧯P  T00S0@HP| 0 00S0S 00AP0P@0 S090. ,e 9 E,J,I,I,m1 t A-U`V7P@ @Ptp{ 0Ph% /Q4 x LvzpP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,P004@Ѝ0400/S@ P w w w _P_H_@ 0SzQt0S {p=0#{p;#s00S: `x`P`|` R  V \3Q 30S t!: hExPX3c0S 2Q P Eo2: @*xP 2 : "xP 2l!: xP 2 : xP 2 : xP t2!: xP T2h,!: wP 42L ;h00S0@oЍ00 p0 P 0S*000F, B 2H&0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ? H,2PP 80 dÅe"Å^ P?d" @pef"/F, I,p@-t}p@pP 0TSp 0T X0h2Sl@l T 0T * 0b @2&&F,220@-P@4Mlf(4 0<, p"lR < 0 2  s0-   S 0"!8 0r 0R><r> 044Ѝ0F,&@-`0S@ ^P0S 0000q20\ @wyF,33s@-0Pl00@0p`h R R  l R  T803/@ЍpQ P&&F,2A-$q`AQT 0SP ݸ@ P0000 0P  P0  P0 t P  ddG\D0H@H  "  \ &F,"3'3+3034393&d&I,,0@-1s0S 0P !& L,(0@- 宓@0 ƓK,hK,J,p@-`BM P⻓@0 S0`01s0ST01y0 0Pn00x0 BߍpB/ BR 0⒓00P Xy0001J,&.4 L,K, 0?o2 0/&H-AM M^[,r,WT00000P0000@0 \Pڶ0 đ OP0SS WS BS 0 +?P  7Vdq0S &10 S0Y` 1s0S ؠ0S Q     |P Y 0@^S00CS00 S00 P0SJ,I I,hK,F,& L,p@-PH@P@p^ P P W P @& 0/@-Do/A-@PP p 00CS0 `V - PPጂNP0 P00XAW) 0S P0000 !0S0R 00 @404O4A-A`P0E!S qp0!0P0CPSJ0 `00CS`0p S X0 X 0P"SP, 0SP`0P0CS`0p SX0 X ! ؘX!И0 0P0 P8000P lP弘0"S0T0A(8屘0 0P0 p$L,H&84&\4_4c4k4@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 m4A-x@M P0 =`P`VPP2 00pPF 0P .V @P  @0S@0SؼX(00@ PP?P PPP P 0!SPx4$L,k4&|44p@-@MPP\1 ᑗ 寘@P`u00u0ۍp0 \P 0@ 0000S T՗  *P00 f (ZP&44I,4p@-`@;PP 0 8.Up$Pc@p|47@-@P ې y R r n@T|兗 Ѝ0(R( dܐ0PwP O<rP K(mP I,/6f@xt yt 36(L,0@-@M@ 0(@,0 0 夨@P  Ѝ00,Jx0 ⤐CPPPP0S  p00@SPhV (L,&I,@-& (,⇨V6(L,@-@  mP  E0P3P xth ڑ X2 ͑cЍI,xt yt s6y6|66f@6p@-0M`5PPS 1<1s0S |ΖxAxs 0 9 0Q <4S,Q( ,0F R  <P 81P` *0(0S r=R化 00FS0 x僖h偖P0Ѝp\XTP Dq&6I,&6666(L,6)6666 77%7@-0 嚏@7I,6-@-v-@-v0 R   ЍЍ/TM,-@-X0 R   ЍЍ/TM,A-ARp`P@1T _pP9;`@DO-dM@P}0P 0X}0P0 0 o 880 0(P400Pp`,@@0,@ T R3 U&T  (0 (d(09p ` Z0 000_o 0,@ @,@0RT ZPPU  w 4 JR  (0 R 0S0c~ ~ 0S dЍU 3 ` 0@D(0,@G00(0 RR 0;0@D(0,@(0 R0@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80!(+PP (B, R  8 %Q  R P`(2cplh`8@Ht  SG  $P $0`000S(2( 08 40TU (0 Q@D0T,@(0UT(0 Qt0(00@DS,@Tg7u77D777TM,7788S7-8?8Q8g8888889O-lM(${`{PVpp78@ 00Roυ p  0<0`2 @@000p 00D@P r.@P FpP@0S($+P @ }} [lЍH<`@40S( (坍 Pl  , Fp, 0P¯4 0>?P$06?P<  B,$( p( ,0RQ @(S<`@ 0CP%<0%8s00%4s00u0 0'<0'8s00'4s0P 0w0拓 $P@g7&C9I9N9]9o9C-阑p0MS@0P x#`0` 00Nqp@  ?sp$k@`0 P 岓00: pppppW0@ @ ]@Op`6t0` }>?@h@ #00 S @.  C8 "ЍCt0&9999&A-MpHP`ЍA|0@: SPPT@Sz`P00S 0 00iQTP1 ᛌp P PU0DsLS<(    99TM,9::O-0]M-SP MPP50S ]ލ ЍOv/f]ލ Ѝ@p ὍP$ 00S0W0S 0S]` ypP  @pt0* R\ D RP +PP,su :`ᛍP 2d0v: S+ p 3 P@`P|3=|  KP pd ` 0 0LF0 00 0S0S`- ׋P`6`v `0S 0 @ЋP |V ȋP `z{ R 8MRK ᛋpP Z P w!1Z[  0ᜋ ܌.ٌY{p`l: 0S'HQv00 0l!壑 P: b  0S- ZpP  W ]ލ ЍO6{P-B\ 0SWpP P : R S00 R0S )PPdST}TM,&94:C:U:c::7q: ::::;(;b;g;H&;;0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@ `P 3FP00S D00S  40 -F!NNgX hM,,Z,.&@-tH<@-lyPp@-P@zp 000/M,p@-@P0-S@@p kGP0Tpp0p@-0@S`@MP0@ 巐 P@ЍpPU Ps 0P0&M,= =@-@P @q'00S@H M,p@-@PPp00Spp@ M,A- `pP@P000 PP0 0 =#=@-@P P0P00S@ M,p@-``MPU= 0S: MP1 @@?T.  D `00@ C @ F00 *S ?0`? XP10EE>bP `Ѝp$=, 0@-Z,> >!>#>=+>e,0  M,0  M,@-@(=St00S h00S\00S L00S  400S  ~0(=M,d,M,, ,$,0P/0( P/|M,M,0 fM,0 $ aM,0 \M,0 WM,p@-uB0@0S 00S 00S  D<0S <0S 8S0,=t00S  /\00S PH0(]0Sp@ IBP 0Spd,M,M,$, ,,x,/@-0  @ M,$00S/0 R/ ꀊ,M,00SBꄊ,0  M,0M,@-@P1 P. +P@@0P-0Cs0LS 0ppӑ`P0-0Cs0LS 0 0 rw $pp  rw00VpU  Ѝ0  0.S 3>@-@P .P  P P ЍQQd0dQQD0D Ѝ@Q$Q>>>>>>/p@-P/3@P 0+SSaTp0+Sp@p@@-@@@    0 0M,> 00@`/P&p@-@lP     <00S   2z @p  M,ԉ,D0@-0S 00 @T@ok@,M,@-@0 0 0@M,@- Bo 00S FA0 &>M,G-o`p`Cqp B@P VGBp PPVYpGWVpphp7/pXUt @X@TZV G '>>>>$ ?$0 0) 0 00S/Z,pp@-@ P 0s  @B@p&(?G-`0S@p )0   ?990 VY†T00SZ LB RP /@&Z,=?P 0S  R 9  (0///Z,MO-4M@T YR(,0 Q P0Q 05r:p$ ("` "RgpT  rq$ $$Q  Q Q 0r#P 0 {   {  P  0000 ``0 PPI,(p0劦᧩vp}qpW [! SR@ 0?  0qp/ dAЍQ P"0 0PR*x2@0S 0 0 P P 0 2  PP900 S`05:`l109p1 رqC   0@! R!T / R   07 0 )ϬTS? 0A0SmE0=A002*?00S3 10S/P,  0 09@@ 0 00*b>p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@Z,,,@-P X00S S 9(,0 @ T Z,p0@-@TI0 zqp0@ @}01pZ,,,p0@-^ 9 @ 0@&)60 P@ ^@TZ,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/Z,P0001S0 0/&7@-P R I0 0#0 Ѝ00R 0@!"0@@qp Ѝ0@>?Z,?0@- 00qp Ѝ80098<@ q|/ 00\ /Z,A-p`s PP"@9  @0@  P09   N 09 r`AM,Z,@@A-p`VY@  @ @ 0 qP0 0y0 )T 0 0p0@A Z,M,0P /Z,\ -P0S0@  / P2:1S0BS /C-@,QM@`@|0S1U?:ЍbS7 .S6 00C S 0  ?NP k>cS@U:`>0@0CS000000C/  0?NP @@@Z,[,??p@-@P 0S`PpPQ P@dPQVL">P0S  p P&T&?A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o2Z,@-XMJqL@DM@M<M8MTr,3,!4!!!8!!@u@@P&P\,@@T\,?@J@Q@Z@&_@e@k@p@ 0p/Z, @-p 01SP0l  Q``GoXR @ !P04 (10T! WZ,@@X\,@ 0S 0S 0S 0S P//////@-@0S PPPT0`1s0T 0 QS0@T0 R /!0 R0S //@- 1@P 0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0?<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@Z,0p@-P@P QT4@pTT@DQ0`VD@S@ T0CQ @7@Z,@-\@PHP8P,00S@H\,@\,T&p,\&@-\@PHP8P,00S@H\,8\,d&p,\& Q p0/Z,P7@-m Ѝ0P@VP @ $QP r0ll 壃0`T! _PP <0X!$0T(0 0P@x\,@Z,@-@MP@G0\,l&00PbAA0CPQ//DA-RPp `2@W@X@Ѝ`NP@h@P, PP@@\,A-P ` @Pt0 pP \ L@P  A8 $@lT REWEgE|EfEp@-Pl@P TPPpDKPpp@ U p@PpEEEO-MMp 0@P! I~P0: SP`lV   dEP  @PP1 LލЍ R R R00 P P @I P @P PP 0"SU T 0S0C0 7/  $EP 0mS EEL+&EE`+&EP d,s@-P@`B 90 00 BЍpp@-@P` R p0S  ]`@E@-P`( @p0` G Ѝ\,@-`@ (8R808Ѝ 8 0 CS  8 0C 8\,d,p@-PQ@`1 0S S 0U P 0U VpP0S d $0Sp@ p@ p@RpL+&EEE $0 (((( 80( /\,L+& 0( (( 0( /\,L+&C-@㼀`p0S Ѝ @P0S 0S 0 ( ((087P 0 "PP 0[,\,7@-D@P@_@00S Ѝ0 NP\,@-PP@X9F`8 R8 R8S Ѝ 0p 8 0S08z7 80 8 00S08l7\,(N,0@-@M0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS 0`\,(N,@-P@`8000 00C?UR 0 R00C8HiЍp l 0P 0e0S 00\,(N,s@-@8 R 0S0` (0 RP 08 80 8680S Ѝp0CR80S 20S608\,(N,p@-p@XU P8PE`V` D0(  p8Soppp\,L+&080S/@-@\,p@-D@0S PX. 8P 0( pp\,L+&p@-|P`@+l0 R(0p0CR0R: $0( mp00\,L+&7@-@ @P@P Ѝ0 AP 0P$ /\,0S/0G-0PS`p@U @0 pP0@@@ X EP00ii @ 6P00,P R/,@-4@$P(0,0P  $8 \,L+&O-6F0p`SMPp(h- (R008(h8! 0S0S Ѝ0S08R00(h0PZ08U0x88S08"PPWP $(ĕ?o02Q0 P`Pڈ%0@S0 eP 048PЍO0480480488080 Szx0488S0S S 8S0S S 048804880S W048|048ЍO048ЍO048n0488S 0S S8Sb0S S_ig8SY0S SU048~Q04880 S80 SGrp80?08<0$48X5(pPWxpG(p V(PX  PP hH80S 48PS8P jh088 0Xl28Q V 0\48 #Df  00 Q XPP@Ed,EE0 pC-@P M!00 0 B R   0.S 1 `! P`EP Ta5 Ѝp0 P`000C/0 !EP00\,E08(S/\,0$P00 /\,00S/ tM, O-鬡MX[$ 00! 0S `PO rPgj@0HQSQ0Z00~@P7 ppxP0: SppwK P)dp0 R'0 Y& .u~@Y  K0Hs  ;tm)TwggЍ4pP00tM,L+&8,EEE E800S ,00S 00Co//M,M,M,p@-|PPD@T p@``fT0S S VS 7Sg@ @d,A-@0S00S 00SF6P A0qp  d00S R HPH@p S` h~p`&d,M,M,e,x,Z,@-;p@2G-@ e9T00P  00`p|| 00ST V0 h000S T28 ;f,Z,,,A-Ps @`000{  n P0;0 Aj x t3   T Pp B?0PP  W Ao S d,Gp@-@PpQ0%SS0C Sp! Sm0 !0C Sf0 7S ESM /Sp0  H/0 0pp@!p@{=0P S+S@ $AP e0S0p%p 0p@ 000SpO p@@0!S $P e$|00Sp$lPp@%T00SpB6H80`Vp(G&p@ W3pd, FFM,tM, G'G-Gp@-`@P 0np@d,A-`P0 E@@P@p/00[,0S W DT T A(0{d,5G7Ge,;G=G0@-AM0 70000.0  0  0  0 0  0  P0 S2 0h ]{PU0 D<< 40 Ѝ0d,?GJGVGbGlGwG}GGGGe,@-@0|+&0PiP/d,< S /@-0 02 Ѝ?&G@-@*0@ d,@-|0DM@T 0S P p0`P VDЍ`F0PS Z,@-@0$ 00@S 0d,@-@@P@-@G-0-e`C@M03s0؃0?000S0S  >30S \0S 0S4x3.P 6P d3Pw0S CP T3Pgܢ0S(80S- 08E0SeVYP0SeVi0SM /Sr *S1 S S(P%UJU!$"0ES00 "6;P f0Z 0S :'0 c!707S iS U U[00E.U S``dP eP PP0S`>0S P0 HP zP >P 00`P iV\0iS 0 %* 0SZP0@T_U0 ,0S U U =U Y\ Pd,M,M,,,lM,d,e,G FGe,#IGGxM,G؉,t+&&>FFH4,,,H, Hp,,x+&H'H5G=HXHM,HHHG&GHH0,HHM,;GGHHItM,I+&=GIe,,(N,f,`,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,YP& 0e`0,0^0@0S 0! P,P 0S_-P *a0ES000 *P *0 /E: 0*U @U !U<30S 97R0 <430S07S ;07S 00#p#x.10@S0 @007S9  P 0S S30S PP d0Sv7 40S] 3#0CSPwd ;P $0FcS00 0 e`!0 S $0!R0)?040S  /0 S 4%0!R0)?0 ^!R00 !ı50S!R0 !R0 0!ı{ x 5r 6!R00 !ıf(60S!R0!R0 0!ıT !R0s)?0H60S 60S >`@0 S 0/70S y0 S 0  6!(gR00 !00E 0R eSd0C0<0S d 0!0<0<pP0hiP0b`Q 0!(8 S^Pf3IcG\80S0Se=H @ \8 D 8 H 8 pP- Q,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ır ` `<0P 0P0 0!ıP *P m P !R0p;p; 0 >P }0P0 0!ıPs !R0;; 0i0P0 0!ı=`P \ PPXC=qpT 4< XP0P0 0!ı=`Pl A0P0 0!ıP 5 3?1<`P4)P #!0`0,`LPB(P 00,00  <=0=0S:P V_@H- 1 0 q)PP U U ?V]!P0> ^PP U U o!@0 NPP U U G!8>0S %L:PP U U.P$!0P.% (P0 0S .00S>0գ?00 ϠR0  B  ? 0 S /00S0?0գ?0/0 H 00 `? p?x?0S080k>00S/[,@-@0 S!0O-S`PpM`f`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0D80  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 l  80 [_P ` [0J0C[,O-pZX& RP f`P|` P [ ``F 0R@ 0R U *0@S0S  Pp%Ip@-`R P@ h]0P @@@ 0ppM-@p M@p00PCu RT0Ѝ` `?<P ?0 `P?p<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 ,M,e,p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#b 0 DPp@{T ^gP 0S0^  PA0dP fP pip,M,e,@- @ @,e, @-p@u+,e,'I @-p@h+0e,GI2G-pWmPP{P0`mpЍK\@P 0pqpt] ~mm?SZ f]0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*ptM,4e,lIp@-p@`PP ;O,;0XV@` `:D Op *p,e,lI 0 ,e, 0 ,e,7@-dP@ PP 0S  P Ѝ0,e,Po/@- * ЍIA-`QpP P P@P%U0P 0 P l @\T @P 6/P{\III@-~|0p pl 0hP X 0D H 08 P0 0@+&-&I I IJ+JC-P1M0SL @10SH 410SF Pp` Ji0@?oPU20S@ _P[e@YXЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P jPE%U@@M,M,M,G-@`M0PSS00/ @ R S"\R" :R R DZ Pp QP 0H3/0S@00ЍX7BP 3X8p0ShЍGM,@-T0@0S @yM,0 R/%R %R0 sR0/p@-(PPp@P@pe,7LG-`dJd@p00CS0 Pu U   0DIS  1(XWp@P0 P00@-@,P*7LA-@0 0pR`@0S00 R0R@@0`P0S U  P@00+&+&O-MpG`@ P!Q[ Z@P[@P) 00p00 0mЍPP P K PT VPAP WP00pWp+&+&rLA-@MphPPPЍAR@@=@@s`H0 HP]m W H;@WЍyLLLA-PPЍ0S `p@@@UPP D 0 ` B1mW fPVgL@-@@ LA-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0V@M,M,C-EMPPEߍ@ 0@qp `,{fPڬ嬐P ` P:T0S EP @  k0pS`P  @P@[,<,C-MjX1@0SGp0@QSP? HcP DpAp>p``s0000 0p0 0Yl V+0`@0$PU `UV P:0SUЍ 婻U@tM,L+&+&L0A-0S@`@+P0L l@ p^`PU@UUtM,L@-@@MP ,HP CoLLL@-M@P ްPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` ` P TP <2#@ Ѝ|P yPP  0 k LU P GUU @T ` vv`KeP ႄ@T@P@T 000d0@P<`.@i0SU ,tM,MLML0A-`V8@P'pP0 PЍA"wPt`@@@@F0 `2kTT@TT ЍAЍtM,?MIM-M >fP  @oЍ0@-@P0MSP @UUU fPI @Ѝ0@T@0: S *@T8,.&.&@-M@fP͡0 00Ѝ0@-M0P@ ePh0 R\P0 R\ tu p0St00Ѝ0M,e,e,/L@-@mP P0@/R@-@ (0@0TU#@ȉ,@-40 R\00S@2@#e,,h00S /pp@-qp -#qpP@ QPppZ,@-P#P3#0 R/  e,O-q$M0S@P`0S\0SO@yP`@@100CS zDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000] 0 0000000P0 000`0HP$Ѝȉ,ĉ,(N,M,TV,f,O-M<`p@P8@V |30Sp30`So`V L3``F`V`utV-,0S 300CS QP ""cf"QP "z"0S6 U`+20"`Px0X 0SJY/Y @ P\"VD"0 <0 ut (20S2"0 000 V0 0 10S*P10S f*qp@PZ v"Pq"P<1Aj"P  !qp 410S ?"P ЍO0G0 0 ЍO!V utS 00St00!20 0Q*)@P7ut`bM,P,x,,.&xM,e,<,,&|Mȉ,Z,,\f,H00S <0P/000S $0@///e,T,x,M,'G-(pP@,`oP"V 410S(1`V``ut 10S100T T0 00!*`*00oᨂY Jk)qp00S@P W ЍGi!Vd V %M,ȉ,,\f,,O-M`[P P @/P! ЍO"!qp@PV00SЍO0Ak!P0 00@WЍq!pP@PT p 0Z qp0 @PZ,M,,,A-p` qpP@VЍAu   0@2Ѝp@-@4P0SPpPqp @M,0P  P/.&0P  P/.&@-P@p@-@PptP0S 0 0HS @ 00C0UQSQp@PQ  B 0M,.&e,0/e,G-`@ qPU  P9U QY* ,Q'QU&8~@{0 "0XPP00040000 (@0@000S < 0P00DP   0.&e,P/P // / /00//000////0/0/p@-@4PPP P4Pp4/O-M cDO {rPX  0 (<P  0'XQXQ> 00  0 'P*Ѝ=ЍO <O-P@4M(0X0 ,0ut@5 P4Ѝ40ST400 ?Q?(~'@PPp,d00 0sp P6zX  ` ܳV0+4 jp` P P@Pᜣv V{! `FV@P,0S0 \3Z0 A'D30pW0= 0$} `P" R $0 S S`) P P  `VʏZ:~P `@T_A[ x20S  P0 O (0 S  $PQ20S 0 @ 1 R00 SA@ P Pd p 4ЍO V  P0 0PA R TA0  Pp``@P41`!Z 0 0@P_ V V@P P P P P@Put 0 0@P_}l00S V V0 0 0S t@P`0 ꘉ,\f,Z,,,f,,(,,\,d,7@-P@P ,0 R  000 Ѝ0f,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = 3Z* P+Rz( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP P P 0Su p0P ꑉ/&e,?&H&kƉdI$0 RP  /e,0 14/e,0 Q/P/1&@-04 ,    00xV,pV,V,lV,G-P㌐剀nH@jHPT`ppP IT I  !  I I @`匀e,A-8p@0PS` 0P0aP e,@-@$ 0 @ze,P 0 R   /ԉ,p00S/p@-`@mPPPpP 0S8@pPp  <,e,ȍ̍@-@@ZP008SPl0 0m  i;D0&<&8&4&0&00ԍe,lf,xf,f,f,f,P/0/e,0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00e,lf,xf,f,f,f,C-餁P0@SpM`$p`xx!0 0 0S]0@ 0 / @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tPH,,̉,,e,&&܉,,0P$0 00S000/,܉,H,,p@-H@P0S0000p01S 03&Pe,lf,Pp@-`0 p@1X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP [,e,|V,tV,V,hV,O-`CM00dwvP1S0& 1S8 t| 0A# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S u 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[90 `0S$ Uz% 0R 0Q0tP 0C001萄 S vI  0e,̉,f,<,(N,lf,,A-p00PS` HP ` P 80@0@D@ 0@0TЍ<,e,(N,p@-P@ 0p@2A-`p@@PGE$1S 0P $@@f,7@-8PPU p Ѝ0@@ @ Ѝ0<,0 (! ,!/e,0(! ,! /e,P 0@-P/e,P @-@P$0P/e,P @-0000/0@-S@ Q+ 0S \Q@AOoB@0Sp IQ S Q0 0I0S0000Pȍp@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010vS00# pP0Ev0q# 0dc F# F#z 1R P@#1 PR0(d0 d0 0  0U*P0C0#0E001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0cP 0S0C 0Y` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh jPd  0 ЍG(_V` P V10S t! RS 0  m_PP %P P0 PPPP0  B01S0R4ABy@D pP@DT0CR0S*A8A@DvP  0 )0S pA<,e,xf,f,lf,pf,e,,p,[,,1&g,DA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S a00S$1R0$aʈjPt` F F)00x$<0s0$10P0 0S $e,,p,i,[,f,@-(@0S =Z00e,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Ո0 0C0S Y10S0 0S L G5 EhY 0 0R  5x00S U d00SX00S D00SX    e,(N,,,̉,TV,XV,<,<-0 R!  ^ !0e,04/e,0 R 00S P@0~0/0P 0/\!4 0 / B  0/e,, 0 /e,qp/G-p`@P[pP 儐u U 0 > 0W 00V@00CSaP -P 0P8@Pe,,,PG-P0P`oPpЀ@ 0@D P  V 000U00C0C0y Tʌ%P 0 BJ 0 Q@ @D 0@DSBe,,,G-p`P@0@@0W  S #R0C00C0Ѝ PP   B 0 ppGA-0PP@q1`EP q 0P 10e,G-1@l`Pp0XXqp00 R00STDP0pT@(N,M,e,p@-@ppPb P0S0Bp SP1&@-p 01&80P/ R/0 0S 0 /i,00 0S/$0$ R i,H,e,A-X@ 0S0dS 0p(0,`P` p U` 0i,0X0QH0H 0.4 00/ 0 0Xi,i,Xy,A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0i,qpO-PP10SPU @PP0⼡p`@` V  RXWA 0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@PPAp ` W0 0K0  0`qp @TPH,i,,,P0G-`p|PU0  SXW@ U W0S P)^P @P P`@V0 0 0 0@00qp0SP`4Ph`@W 00 0@00qp0SP`V@i,,,G-`P@\pတtu00V00S 0SP@`P@tu TUPM,G-@Pk0p`Ptt80@ p 00 0`Pqp080Ii,,,800S/,00/PP//,ȉ,00CS0 Sp0 SW0 p/O-0P-SP ~ | z Aw ]yPp+PPqP@P0S,Q@ 0S 0S%H@T |A? PTPP2sX ? =   0 ) ЍO;`P @@ @_ 0A $ U?dfhwze,nG-@P $`P( mpP[ `~   s@yz  0Z Pp@ ;p Tt p@n T  40 r pꋎdfe,C-`Gqp pXqp@@PPP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   X,,؈,.Pp@-9 $P" 'P= P !srp p^P 0 &- &P >06 pPtd0`@P\0 L0Af&P,@m_006pM,X,ՎM,,G-@p`dP4T#0 5T Ta0'0s000Pp0 >@6T` P'0X,@-o0@-MPh@P  " srЍ08!P m>0 00&M,X,@-HP!sr@l 0! 0&X,@-d sr @@@60P&6 =>0606ЍX,M,G-6@PP`j>T6k.sq 00P6 >06PU p >P0PPЁ  GP X,M,0,@-P ,0 0R  M,l0@-0`  ^ @^TSa04S '0s05S #M,X,0@- @P0 QA6R 00X,G-pP@P PF`P=`=p6W @X,00S/A- M`pT@qpp6W @ Ѝ 0 PUP4P P0 T,X,@-  0mS Ѝ 0 Q0 @@P 0 S# > PPP0`0 S  Q0 R pV`PPp 6=p00M,17@-PU0P( P@ Px0 Ѝ0%00S@PP =PC<C Ѝ0@H00S< Ѝ0@ 0 0$0 tM,M,&Տ 0 M,<07@- R P(0(@?@0 Ѝ0P?&M,@B0,@-P M# @0.S 00S Ѝ 0S 00 00S000^ @ ` RP0@ 0R 00@0@$P?&0,=D<07@- R P(0(@?@-0 Ѝ0L?&(N,@B,@-P M# @0.S x00S Ѝ 0S 00 00S000 @ ` pRAP0@ 0R 00@0@$jL?&l,=@-@PiP  @ Ѝڐ@-@PP  @ Ѝ0Sp@- Sp00S p@t ;l0p `iP p@0qpP@ 0p@ tM,<,0,P07@- S Sl0 Ѝ0XP@T0PP ;f@ Ѝ0@;0 00c ?&?&9P/L0@-0@S 00 $0$ @ꔉ,M,,HP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PR; Ѝ04@P,0  0 10 x?&t?&ȗ,|?&t,J0/0@,P/LP @P/Mp@-@PN;  !9P0UxSJ}{0@0xv6tkrp@0L?&d(@--0@dS!@S1 CR&0C  R  0Q0 . Ѝ@A C#R  k Cr Q 0Ѝ        @dP @+ԉ,6BO--PN<M`00P@*0 S  ?  0p00C/  0?pT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ g,2&2&@-PMP M 0@bݍ Ѝ@` @:0SpQ0  x@ݍ ЍU X:> HݟP0S4(f:2&\g,2&wJgilP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000+&+&@-PM 0  0 |0  @p[h P 0S>000H ;0Ѝ004@P u귓,,P @P/g 0 /ӓM,P/00S,0/@-@0S:,0/@-,@0S0 0A00Ѝ,0/@-,@0S0 0/00Ѝ܉,0/400S/(00S/@-qp@Љ,M,P@- 00@ ^S00S00 Ѝ00 H?&@@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S\ 4Ѝ80D@0P0 00 EOPȉ,ĉ,TZy0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R  E C R    C R  S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  Zhv,є800S ,00S 0P//,,ĉ,ȉ,$0P/0 0 0C/4,M,ȉ,A-PU  @Ѝ`p@ZP|`V 00S0\V0S 0S`@W ʹP `@$V00,@-0S0*00 0WN( Ѝ *  MN@,@-Q00P 0R C Ѝ8@- 娝Tj,P/0S/P 0  //XoP@-/Z 0LP/@, 0@-L   Ѝ@,A-`@Pᶼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @Pp88 0 R @@-PJ &$PP 0@s093@!+P0P0h0 P @0+S9P B7⡼=79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0Pxd   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0fP.00S @,,M,ѕn@-@PM @PU`p0@ uSЍU  j  B U Rz  0H"00CS0 U0S U3/U@`x 0 AV00SXS^U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 P W 0  0S00S000ESU U U J 0S0nPS000 00SD000V T+e,Frp@-P`@ֺ000C S0 ` 0 Br ^ ST00p pS 00 000S/P/h,,@-XP H0H@ 0S0S  0  03/$@걖,2& 80S/S/ 0CS/$2&O-@pM0Q 0S [; 0S0 0 Ѝ`V$P  ]0P  AAQ-P $YQY0 V0@@Oop B0 0S `0 0S Wp0p2&@-1PDP0LT?&/@-0M @20S4݊P 2     D2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  D2 P!2 R@ n$10P@ 000 0  R  RD0 @000S T0 0S T \0!PL 1 10S 1㪹0Ss 0#So @ꈊ,,<,,,Pi,,T?&Z,H?&,@-T댊,@- ) Ѝ@-P6`u@r@@ᨹp0 `J Ѝ\@-@s6P  c,G- @$pP` 0W )!0 L@@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 DЍMb@B40@-0@@T CP  0 X?&,e,@-@0@X?&0$R/ $徾ꬋ,p@-20SX` 1``FxZ@P 0 @PX SiX12`[@Put0`V@P004S S S ᢩ0PS  0 QP04 叩0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 C?&0,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c  PU Y< 3T eS5PPA Ppp*@ '$ @@Z 0 p$ἉW #l "R@ #T<"0S000P ;04P S@ / Pp 0S 1T SP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U0`000020,?&H&,,&0@-@PP |ߪP lڪP \ժP J3P_3?&Ϭլܬ@-@PDP P@O-x1M0S" @`0 ЍOsPp000 0 Ppxy@`Ѝ00S 0 00S  0P @``e 0 00f0 " " 0S0,,,H,<,0@- LLPR^0S @T 0 B0,?&0@- LLPR^0S @T 0L B0,?&0/0,0/0,00S _/0,@-KP l2Pg2P#@-0<,//@-L@X 6p0 PeS0PЍ<,\ QR0* /QS QQ*/0000/@-@P "000000/0S0C 0//0@-  0#A3@0@0@- 0@SPR? P &*`Q  1!` PЍpA-`pP@T@  G-P`"F$@p(, ɒQP 0$ GfFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0  PЍp  000@@0 0 0 0 0 0,A-^\^ ^Q}[\9[^V ^\00]QQ$ ]Q0\[Q`.FqQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00\p@- Pd00@S S R 4@D@U p@D0 @ &˭1C-p`QpU@P0\`0Y 0 +PA \Y R T R 0 0P@0   [R .0Bs0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@ 0 R ЍP,߭в,00@-M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00l@ O-@T0tS bS rS aS @{S000pW` Gp 0S0QU 0V[P 0 0 PUP(b`P@,,%O-pM>4Mn0  PIW ܍4Ѝ000Q 00  R Q  R  R   R @    0S 00@0p00pS 0S @P#S ;S @T0@0 P00 0P 1TP  0S @,SP0S 00@TP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q S ,MP  <,0 \\^ ^00\ APP00S0I S SP0S 00@:0S00).p d 0S 00@0S 00@00P0S 00@T0S P @0S( X FS 1@( RP0U0 ӥP  P\XX $;S I0Px $^P I0~0 , 8 SR0 (  R 7哎00H00 PP R00C0 0C S000SW,X, `P0pL\RC [D Qx␸0S <,00S ,, E 7P00A R 0(0 [^ 0  0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00ARs0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y Eᑩ0"S YK  0S 00@<,0 [  RR , S 8x Q3 0S #-p p  U@P IW[ 0SD @;S> BQ0110P\SSpE ND  PP< , @P 0S 00@00 HUpc0H Gp Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 0吧 ⌧p000 XH 0S  p Ub   pYP 9)0     呻!pQ1 ! 0圧0 $(┧9 09909 00@,&E,:De?&vWͮOX, kYn{@,p,D,O #}Ѱ Hm&A-D@`@PU@Tp00S PX0T0PD0 0pS0(DP@,,,в,̲,p@-P @P000P @p@&@-@P 0  @0@&0p@-PPUph3@P 00CS0bp Ňebp0 \bH,A-p`dB R3 RQ R P$0SV0(  R R 22$0P ,aP0 P0!1PQ$00P0PT0, %PP (00S(0 #R nR0V ,0 0200#0$0,0$0a( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0H,|,@-|@X0  0S 0S00CS0ap X0  H,G-D`X0pSM00S 0S a#3X 00X 90C\ `00d0崃XP 00CS0 ap XņX 0%pP0 W0 XPލP3 Oap0S +0*P 0*P p4S +.0p0p4S \2PP ,aP j00\0*Ptp0`0d0S00d0000S 08S0i +P0  `0  0@ @`00S +幑+兑 P0 n`+0⫑+0J⧑bP+Jfc0d!HE0 P8Q*a+\ PP `0Y1P\a ( p$pP*\0pp!K* 0`PS(00?1PX3000,0\`0P l000S SP@  0  lB(00(03H, H&0,,6,&?h--AMM@A> 0$ 0/0 @0 _x,p,--M MA>$00/( (  0Oۍ ЍЍ/x,p,@-T`@PP c 0%pXN0 % Ѝ踲,@-`MQqM0S000@03 0@妥0S c 0_ 0 0S S ` 0l0@P *0 / P_ 000ڍЍ輲,,,,*@-@P  PtZ_ `p\0 P `P 30P S x A_ Ѝ輲,3MG-pA唁!0`PU , R:(,M0(0 &U# \U   0 R`Z &R\RP` , R:(,M0(0P    "pr P qu PE ,  R:(,M0(0    0 꼲,&A-@P p0R`*MW00  0P P 0O-p/MlO00`PЍ080D?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0  P0 R h>0R*SL>0@o!P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S8=0@oP 0-=0C>S00 L0 R: L L `0p嶝00c0S<at<8 00 \\04 0T<0S ",H0SP80S4PU 0`  EP0800A E4 0T P "0 | 004 0x 0 dd 0H; 400{ 0 4;0R, <0p P0P 0S WP 0( (P2S 0` H,:0C0 0S0`V: $l i00@ X:@Y0S T 0,I]  H0$eP y0 H$0$ [0`V: $9 6` 0 0C 0 P 0`V:P  `  0冓[ =p  R0P `V:`:0r0(CE -0 aV :a ` 0 0-0 SD88 00 ,h04 0H<0S P*0801 0 P&80S"g04 0"<0S  80S04p  G⼔`P <0 00Fpp40<  0<0S V 0400<068 00 V04 0<0S zL0 R: L 1K `0p^00p[  R  Q 54 J4000  P 04`Z Z Z000 G 0Y0 00 V~ Z0 0RP  0X ?0   PQC p0V `XOdH0p0<Hp<(0000S Xt04 0S<0S p P[ 80SX0sF@$@}%p@0 $[Q0 0  0p V0`0  `?0P  0 RS0 0 p0V R`0 0 !PP04 0%4 0P %P"0 000S 00P80S0s"%p 4 0$40P $$P P R0@u0`pL<0p<80S4X ! 0`Rl0#0V*0000pW(p0 1(W0 \;0H  ! R 0}P 0 pW*0$ ("1 0X`xpH0`0h<Hh`<x0h0G0| 0+@p,,,@,,`,Z ,&@&\ht@{d,,g*Բ, &$,<0 0R0((Q 0{Q  @, ,p@-@P`Tp0wS {S sS 0p Y$P 0 DZ0`@p J$P `꛴G-`pHPPU00kZ01@ R  *PVAGWp0!p!Q <0As\S00 0  4Z0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: WpP 000BS 갴<,p@-P0`@T P (P, 0S)0 0 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@<,ګ- 0@-MMPg#@P  PY :#p4Y+ O# Ph#ۍЍ0۴޴H0  BR Rp R+ p/H&&@00CS0 S0 / *H&@-,A˓0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@zdD,0-01S ^00oS^ P0\ S0S Q0S Rr P0S0S0 s00Q qR  -D,0@-  `Ğ\ @ T\    %R    D,-p@-TA0 5S <0S -00$!<Pa0U&!0! R8  (P  l0  ,P  c0  4PP wp@ą00\P P @ G00, AP$$Sp-t ,,&p@-@0` `L&T  C)t@d lP`PT p ሎP000ST @H&&D, @-@P P:@P @0?SP@ Xp Ѝ/㮟P@LP 0S SDr40S00W$)F@-ŝ (%녵&@-0@<TQ T0B0 (0001S R0Sd0d@1TPT T@0$ @<,(T ,  @ (D,ѵ&-@-| (%׶&7@-@Pᑝ  0S 0@T 00 Ѝ0}0"S sr@-@P  p _WЍ<0A-@X``# ^p "RG ^<0d#N R 2A& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,{0P01pL--01//00/00/00/00/00/ 0  /- 0  /- 00/$00/,00/500/>00/D00/S@-@-00/@-@ⲗ,- 0  /-$ 0  /-, 0  /-5/00/00/00/V00/^00/f00/o00/|00/ᆸ00/ᐸ00/ᢸ00/᯸00/Ṹ00/ø00/θ00/ظ00/ݸ00/00/00/ 00/O/gb@-0  0Ѝ@-@ +@-  -{0@-%R  +@-- @- 0)-,- @-, -(0@-% R ,-  @- @- 0 -- M@-- @-   - (0@-% R z- < @-  q-< @-  h- < C@-_-< @-  W-  @-  N-  q@-E - e@-=- e@-5V- e@--8- @-  %-  @-  *-  @-  - @- 0-- @-  - @-  -  C@-- @-  - 0$S00 @-- @-@DP d 0    0@-0 |1冈L- p@-P( dP& <PV 400C`F V$P SuP4P 0CP  @@PL,p4P P0S 400C`^|k1SR !0C B/!?1C]!NRAPN P  ^Aжq0r0xP00S11A)zP`PxP@a@1S020-(PJ @$3@P, #0@S00 2P0CP?P <P>P P2P 0PWvP tpP1aIC P vO{1S'ʰ1 :C P v@{P 00P1 RE40S 3/Pf PP f P,ЍPR0y ^] 0SpW 0m 3/pg P 0`B P Sv f `zf00x00AM%0 b02P 00P000 az}f ꨴ,ι׹&=m-&|-S&R 001/ᨴ,P0 R0//ᨴ,O-p`*@PP [ ! 0P @ Ѝ0劎00 1\$<0*P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @ꨴ,ܺP/D0 R/0@-A1 P e@< @ꨴ,O-dBp0 VW`@4h0p 000M Ѝ0P@P 0S 00@ [& 0 ;oP OX0S IX000 00 `[0S !oP 5X000 [0S oP &X #X0 00U P0IS0SPPn0 00o0S nt0#?C S WPU  _k0Y!0Cs0S( 23PP PEW꼴,&VUUU @O-$MH0[S0P 0L`"Dp? G0Y0 0S 0g ygwPnn n@` 0l@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  03hnX 2 g 0  BՌVU P0{ P>  PN P P!VUA`E Dt@DP`0g gg@`"PD P AP;  KR !   ` D0zt0@0!P`1 V0p00@  \)`"[y`F`FV0p00@  DPEOt@DU`E¨` Y @ ;yḇ@T`— R   BV0S 000 0 0y$ЍOt0Y S 꼴,  &&A-lP`Pp `m@m@0T `P@ P KP輴,@-P@p 00T0* Hp@Ѝp0 00_ 0l` 0@ sG@t 0寈P B W&,h0p@-P@XP0Ps H` R :+P 0S@@Q@p~W&,@-@?輴,0&k꼴,0:k꼴,-@-@00x  Ѝ@ Ѝ/-@-00 i Ѝ Ѝ/-@-  ЍЍ/@-@@@-@@-pP@`M,0 0(8 0 00`Ѝ@- ЍO-M P`@pl@lUiT0 0aP 0D0PSX 0SU L00SQDvPPL00PT]y@DO@W <p |PRWpV`KЦo`0 S`K0 q@PD@0 %;PT0 0P00L00$T 0?Z  r b4wbbЍ00D R00S 0S L0X3#Ppw rP 0 [r똰'FEdd >0 EGgqcP`FE`dd꼴,-@-,, ($ +Ѝ@-P@`$0 0 H 0 00`Ѝp@- Ѝ@-pP@`M,0 0z(+ 0 00`Ѝ@- Ѝ-@-00c  CЍ Ѝ/p@-Pk@kp輴,@-7@- v@sFXA$XPU % }F00h@PU $T }F00000S$$ Ѝ0-/ / 0-/ ,&0 O-TCM@0PD0`@ J&@ ZY{PP  PECߍPpW  @ hpPY Z  ` 帤 @ =R@8寤@0À p av2 2 2 &2 ,0 2 1@-n0C-MM 0p@{`P0 7PP* P gP 0S0 0 9 6 HPP P 0 Q000PxۍЍ00P 0 +30 0%32 2 ,00S/ 0P JI@-4--@-TsP DP <@R@s!P@/ 2 C-@M @I0S0z$P,  <0S#$|P  m0Sl Y0] )PevA@PafDL'lD4*oA^&'ЍP@R<m~P'P'20S p@`Pz'.@p 0$!P<C~ X t$P 0)AT PVP @P poPP 08+Q !Sp 07'SpT+pAW32pp0W3:X# x@PQ  R@4Q p0Q  R@X@P`[Vp003/P,00  h0S  R l 10!ep-L-$ -U7 @-MM+@(t+(tB+(tB+t(?PލЍBw?P 0 T @@@@@ @@@@.&B(W>X7 _7 d7 -MM+ t+L `t+ t+0Xt E?P  9>ۍЍX7 _7 0@-@M 1@@"#P @  qP A0$*!PRU)QX]&Ѝ0RL00S 3/P 0$003/0$!*G@P3P/[P+W@P' @P# 0P| B;|  0S 0_ Z'P ?P4o0m%()00-L-b{7 7 -|-@-@M o0@@\>#P* =@  q8P 00*!R00$Q )f@P  0S 0` 7'Pk%U()Ѝ-L-O-`M!  0X#*0S ` 0 SS 0p0 S00C `@0 S:uPP@ B pQ %S0S iSc %S, dS A0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 r&7@-@ UPU  3 zyA00 Ѝ0lP T! H  bym/$ 0 [)0-7 7 7 7 7 p@-@Q`T8080P00S0S   0p@50--7 7@-@ PU  ,)yA00 Ѝ06PP x y`00S H 0EB[( $-7 8 8 ,-/8 88 &s@-8Q`@9jW{ M`d`d{ B`df5d`6zf 0 A l@Pxx?5뤀P @X@D_G_ zЍp|-]8 `8 &c8 O--}Mp@` z 0p 6V  0S   P R   0S   렵P Zx됅P UxjpPU Pg# !  T  VS 0B? 0K*P ,@PP #@00^PYP: @  |: :0S {:( P w:D4 E  3 z 4$"0}ߍ4\3 34奄0"!03140`040&2ыҋ 0T40   T(0k P500  @>"!!0# `  PW i XT 2t 0S l2P tt?0S$@0  U0 <"QS G E 1P kw 1 U0W$2j!1@T d& R@>0XC0@0S@ @  0R0SQ ᨰ$w0S  )aP 0 T^xk0  PS $2 4-a&ptbt8 f@-0-8 8 8 8 8 -8 8 8 -/9 8 9 9 49 0@-0,MP0 00 0\PPP@P DDK@0Q ,E ,Ѝ0@+dl a&&79 - -O-iMs?!0Z P 00iߍOЍ/\Ax`PD1P 0 Ab&`P z[p P@' [P/pT00Z&>U0P 0 "b0GSW 010#S 00PpP@ P7'U9 --O-p0MT@X   p$p凞 `V  @Q'U` }tPP}P@P &>븤H E0zRPU m0'SP0U*S / ᭅP0 0tX/0 0P }0@ 0 0H0 #yPX1Z qlp`PUQiS(  2S022SP0220C2  S xS`` $w$00 00( 0`,VPMUSSS MPPGV   0%S @S B* BU 0.S 0 0~P1ZpF@P] 0A0 0@ܝ R-6KgdTw00 (i@0 0 (aPAcBcq0S  \V0A 0E?oX20S `k\`$h\acYwV @ x 60S. c@bQ\Ew00CS0000=R0S Y$0S  `5Tf(wWU `,\`X L&\w?jG0ЍO Ѝ/9 9 9 9 ht@|-H&9 9 0@-CMl+PP 0S .Q's@P 4nCߍ0 Pn ,,G-p@ 圀PB`AT:00Y W ,/Y 000 rP EQ 0 @&9 A-`Pp p@ E ,pm PH@,A-P4|@1|opl m0S DQ0Q.SfP @$ $im em,9 ,p@-M 48PLP   m 8PLP z qm 2p@ (  bm QPU |@ &tP Pm 00 ` '@PЍp m mP!i,%i,,8i(,9 O-NMX6Q >MWxxT &`ێ,Pz0尪S { W:-8 4e0 w=C$ C/\w G00Sw=0ؽpQ>e0 lP400`{0 |P40  U. ,Ur0YR? ;/ 0pp @*<: R0 :P'P P 0X60,0:P<J0.̟   0/P `d< B 0 0u`````XPp(00ۮtl= +D01lq0,ݍ<Ѝ>0a X`l I|`P  C|P `;{ 1sS1lS8+2 0P%QPH YP8;6|`Pp},3l*0x*0wn|P\8 0\8VW*0yU *0z*0}\8p*0|xX:U :H*P0Q4 4* Q9ʟP \ʟW^ x9   +9 @H- A)| 0p 0HAop p=Sr 98)a0dd DP 0H0 H0Aop ( ABY`P( 0Vi RrPSUp`jvD  ! JH p00n`<T(0~D`<q{P P(l{P <f{P a{P }JA[{P V{P Q{Pg0:4LP '0\6S '0' `P f4x lh`$'[7S0  'O:p& PX6 A Ay0\8_P  P & 6 jP `(\:4S $ 5YP 0: APڴ  6VF\80%8\8nPय़` j ! oP0%08P  j   oP0040X%S\880\8P j 0S %8P tj  `oP000S\80\8'P0S\80\8`: 4S3P h 0@?S X@P D3[j 0{C:$P0R#R#p$|ßRl#hW%RL# 2M  "0S2  P 2@T {[wL HHC* 0G0S t"dx0S h"qnp693S5 U\ "R?0ⴂ0N?C0C `.`0  0F0`cPx9A?Fێ80I,07>E`I00x P"H pU0S >xrWW5S (!$jorXv\pX60S`0 <IW4 i9 ; : @,?,: : 8; ; ; |; p; < "< 4, = = > > > > > ? o? ; ,p? D,@ @ >@ ? ? P 01/9 X@ C-pP@,M&yP3S0 ` 0`:00 0`@0`00n/00 Pp 0P/S/00 0 /S 0/0 0%R  @ 0 `@ ߍh@ l@ s@ p@ A-`BM|@xPlP3Sp (pE < X800`0 0  3PBߍh@ @ -- ,-@-@ @-@-0  0^ P @0@ 18 0/P $  =Ѝ- -0-@ @-0@XPL0  0@7 P | |0|` x0Et@1P0/Q   P 1 0/R@0@ Ѝp, -@ ---$ -@-M@DUP?xP  @h ;\@gU 00 0:4!SU *00 0 B%"qgGA1@P@+ 0 aGAcGaGA 0S  !(!0S   6 4P\6S @#U 6!nCߍ 0p Bd@ ,@ n-> : ,@ ,A ; A ,,A PA ,,A ;,A A DA A @-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%phЍ0L0 3/@P 0 @P  Q 1/P @ @t@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T u pvP00 70S 0S0S$ЍP P00 S nvS, R ,0S R : 8 80R:P3#///A-@M`Mp" *0P pi Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTTB B A-`QM p@ AP wPP sPЍvPTP0 pvP@$U@@YT @ @TH0 @ZPB C C C G-Pp0@0Mw'PP -`0 R * PЍ 0L03/P 0 t놁0 tD @S$0S P @xe @te`-C p@-P`o0@0S 0p@(0C A-0Mq!P0`L0 3/P< 0t@T 4/@0@P0 s 0s 0$0S ,e$0 'eT \!e es0S0C, (Ѝ-7C HC JC MC QC 0S/p@-P@K 0000p@KO-p@P|M YF0P,0+`u,sP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00pP ,0<<0@D@0S >P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0ꤠ  @-Z P 0P 0Pp PQ` QTPQH "P <0P/(/$/ /B TC ZC ^C p@-8@Q0@P@DPp V0Ppb&p@-P@P  7d d00ppC @-  p$b&@- { p0b&G-@PMP N/w d0 0 s0S1 0S XP a,P ލx0S x0S1S P sP @l0 1h0$1d0(1`0,1>1S nP >8%0`>j@+pԠ+ @p>d   +> y$0q"Y 4p <0S 3Sj `Tt v v0`0? `p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(Pn 0C QX > 0 0B,0! s!4吀P0#~0` ^I^P\XP f^P ,0!4!k`~0#`Z`|qD2P  @000@A0"p0N?P0S J` RvKR Kv0`0K?(081l1~$10 100 P@a C 01/@P00pЍpP@00003/003/$AmD O-`UM MM.x0Pet.t QiT,BFjiDAU@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯N℗ 54, Q~W <S P7h4F>D0C207\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @ t00, n4E "_5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$#@p00,0mS` E`40S N?,$$d4PUX4 0}108T  A z_ "u_ q_,10!,1 101$14141(8H!L1 1$!0L1H!,儣7$1(1\),0, 1401$141(!>8!A $$!ŸR   C^{Xy ŸH#v0Ÿ$1P00$4; hx2P >{\{ $10T0$10NP00: 0 ]0H55S Pg $003/$pnPM pQE!> ,! 6$H0@;S 1 HPhP? 1<=S; $10A>@C418!<100S/ @` 0bWQ!!10b/r0@P,1014181>@C0(1}1S0}1$1S p E@-|-H& ZQC 8b&L----wD -5E _PP$030/0@o//BO-P@ MMAT0*!Rp0)A`T0 $0   P T Pp ,*'0t$0 `$](pP H4\,& ܍Ѝp 4^a0Spp0 P0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0 S "S S/ Pp  R <,pWP00P0)|2YP0 T P& 'pP 0s 6&P }d0S "878 ⩌O@d0S !8(\0 @S ! 8v`0S !8lX0St! p!S0 80` D}L0@ O@\0S ` R !8A8 fD@D~`@x@YD@Dq@RD@DjX0S0AH@`^pQWppc  ^L-F C fF D 'F ؜ B F -8F >F MF TF [F sE oE bF {F F F E F F E E O-uM0M*QU$e UF&&@&d Q Z &0 0 6T Q  ލЍ4 )qW nP7 FPm' jP  @dP' @ pH0X l40lP40 ]P P U Z@D`@ 2 p PU   c0SJS   : 0S #S 0P000P F`P14s10`#5:\#\S /%5%;%0@`S D% % ~+bspp`0 0 ,0S T0 S00 P0p0SS 04  0xP;8.5/P>0400S8RT0RP S@" SA0 0 80kP80P QL ,0@8aa<th<0X !L! 080$ 0 40d( `6 S/  S" 8Q0PEv $PF_ kP005S0+4^[04  v0 S r0 k$똰0L-G -iG G G G G V-H I wD !G I lI F B E D F F F F F F G G G wH F E C F H KH "H pH E O-@BMTM) Pp ` }I@PpTp$;qIPpppoPP@BލЍ D [M0j@0@ PM>0 $04@(8 FM>0@00P@<DT@0 8IP p0I-\0A00@3 0 !!I, A0 $03(408@00S0ؒ;  I~P IP Q P 0\Ѝ輛 O-p`JMMԢPppp HlP)NU\b`H9PfPX` EpGGYK IiP 0 000!10P T"XT1P T2X"TPZNT"R0 0XpPX 0H,0B1A 0101P0000PPP lP,Pm0S9 0S)XeJݍЍQU&P 0Xp$1Q QP SU T"P 0 003/PT2X"S0 S(0S 0SX+(0S003/PT2X"SP-X c& 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> ofJ 0@o/b0 !!/H,10/*hp@-@4P0 `'X1111pH,O-P@p`ԐԠ԰0/ C !  !0  Pk00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 ЍH, ` 0@-P@M/.Qk1, 00 0d0@00 0T0@@@@1 0 000@P,qߍ0 H,O-Pp@`4M 0SpP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   0Q R  pW0 0P  P  H   4@R,  8pT  TX $ `\ ( ` , d pA- 0R 0  DQHa@1QRpB   !LAPAP0 \A0Q     TTAU @@H,K K O-PBpXQMU<28PX\1S2\U \QUЍ0C`1X`1S[`qe001PS \1 XG+01M<0pP@T 6Y ЍH,N c&@-@<#0@- 0 Ѝ0@- 0 Ѝ@-0@M/0+0  0Ѝp@-P<@0/SpQ `Pp@c&@-0P  --C-$M@Y`pPP 01 QP) 0 PP0P00P l @`0PP0L`ySa00ͅ0݅000͕0ͅ$ЍN N ~L N -8---O N O--,M`^$^U@qr[ XpPe $QUP@deT10S@ ^PPEUN XX0 (b$0P0   @$0VSS00Y00S ^ P E H $U0 0$0  0 $ VRR   P # 2R @D c0@Qh^ `P$ T@,Ѝ 0,-U ,U U V G-lF`0pSPhM^PwT0S oT0 SgT0S`T0SkYT0SGRyT0SHKrT0SIDkT0SJ=dT0SX6]T0Sa/VT0S$(OT0S000$ R$000 "0& W40SU4 QQ00Q00Q00S 4 ehЍG( T0SWAD4W>0 P Q Q+=3003 0S0 hЍ3003 0S0300 0$p3 0S0 0TS(0p`@ 0 SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@d0 # 8W P0 RS R>0 GH0L0 @H0L0 9H0L0 2H0L0 +H0L0 t$H0L0  \H0L0@ DH0L0E ,hЍG !耟SH0000 #0PpG0  d :/ 000(00,4% ) 4Q W U U 7V ( --@V $  8 > NV 0> ' 4V ZV aV hV qV xV V V V V & C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/0@-EM0@P 03/P 08 00 @@003/Eߍ0@-`,MHP D@0 0 0PP@00 RS THP pW SP00H P00P0,Ѝ @T@0/W  /0 0HCH P00&V p@- MP@D0 L f` 0  040PP`W\H0Dd ЍpWV G-%(M@PU T L@P`4 ,VV !R "2 Vr PpP`"pVp$UpWb$U  0 U0 00 00 0% 0Mpppp%PP o(Ѝp (U V  C-40PS,MJ S S S ,!S SB P@P? `q``X 0heb e_000 00 000 0 00 0 0M`P I80S?,ЍU  @(  O-P@0p(AMP U   b  p1#`0 !(0#@  U`P $P B00 P P pB00P0Z@! 0 A@BA0  0t!+C @0  L!!- P0  $!D`pPP@!@3@P`0 -PU @D@0 - U! @ P .㨰嬠P00 @p `D/.Aߍ #"0P0RPV U ( -V ,,V 4W O--L5M0<p@$P qP 0`P%Q4  0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ QX42PP00 4 04PA00 00PPPq0S8@P 0P40 0H03/0S,0P p p0C @P0D P000`Ë@0SOP pv0,01v0(1PP ! B BP2"Q%00i<  R B _<"T T 0 R80pPn 0 R#,500y6000]Ѝ<0X ∑0L0 3/ 00X0 ,b0  * 0L P  1@0 B )R R-PQ0R r Q0CFS0TR000US0a0Ѝ@0  ll-PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V FJ @C-P0 /S`Sp`` [XtT00U0,`0X @,Y ,Y C,U T8 T, 8T0,-X O-0MS@pأЍ`  W0@ 0 P0S% cS2 %MS) CS, GS R 0IP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-СOMM P#0 P0P<0@0@0Y0P(0` 0H03/00040 00!6 0R 0  0(3/ 0Ps`` r S08 H&a0<&PUa`v0$0800s0,00&$0TFp(`DpWP0`0T0d05R0h07` `pV S.` w`U T&` oPU ` iVU 00 00PLi4P0@ X000\PS400O>=C0D0<004 0H$pBUL0 R  |Hi0 000D0H0 F0(HL0S pqJP 0S80Q00`Q0S 0L0 aA3/P 0`0` 0%003/XP\p0E0 7#`@0o?HX` X 0 Z0R0 `<0S@00 00S8P) a`v0"T$0$0,0-T0,0$0&$0倒 X5( 0^H0 p*(0  0OH 0( 0FH 0 (p0`00d010` Dl0h+X9+97 Y`*pV 0 LhU 00 0dLh0 8LhH0+,0$ Q00Q03S (0A( 2`K9op 0 `%D00`P3/0A` X`Q4VP04`L(OލЍ X 0BZ0? X 08- Y Y Y ( -+Y &Y RY Y !Y Y ;Y EY @-@! 0$   0 P 0"ġ0S 0$ O-Mp@( P,`|1/0@T0P5PZ0YP0 0rG @p0lG@Tp UYp 0 `G X00 $P $ T<000$08900p@3/ 0pXn0%WQ@XcUpF0Z0 0唳+Dtp 8FpW000 0Cpÿ D0-FpWP70W000 000W 000$0>-&Y Y Y ( -;Y RY Y 0@-@M0@L0 3/P" ! !XQ 0 0 SS@Ѝp@-`MMMP;` k@P K 7 qMލЍp{dЀ@-@P DlGP 4gGP $bGoYZ [Z gZ p@-0@ 8M! 0`P@@ 0 ,P8Ѝp@GPUJ0 00  0 P@oC-T1M MPM C  01/@P  0Q$AHL Q>0 R 0S vP P 0$003/$qL-$0pQ@-4io #"T R0//s@-(@T@ЍpH0P0 0003/@P<B/@-tM`P @0P p@;@&P  70@Tp@tЍT0@ Tx0 Cdd0d p `P D 8a[ -l[ {[ T,[ [ -[ [ /@-@@8[ ///@-0@Q Tǻ@2o?0 \ 0P000@-@4M0  tGP0PUZC0 00U00 0  04Ѝ0T,//A-pP@`VT0S0S XCPH0P$1U,C0U00 0X0`p@[ T,0SR00/p@-@PA<0P4`" 6D0# A@$!p-( -A-<`P@CPp( 3 AX,@-Lz \ @-'p@-M  F0 hI0S YwPL@L`@U 0 0 ܍pc\ -h\ 1G-1MP`@1P!t1t1t0ppl `PBL@G廽D0 [㵺4ߍ j@P eaA C@P 0=SA?A@0  @>T@  uP 0 l9P P 9@ UA9:|\ x\ u\ \ \ \ \ -\ \ \ \ 1A-1@P"`p1P!P0P0P`P`P0  @zw94 g-9:\ \ \ ] p@-0M002 00`P 0@P @T 1T 1TO/11 ,PO/11 Ѝp4] ;R 0@- FP h<,@-CMp P@E5P W`0 0p0SO/11 Cߍ5S| |p pPd`X 60S  S(=1 1-Y] -"-] ] M;ٹJp@-P@Z1 1  p-1A-@`phT,@P 0D@``0 A_^ @-@0 强 @0c^ "-@-@  iE mЍp@-0P2@ !pM<`/    0`<0x1 @S0 Qgv@ @~qppЍp0P  `Ra BQQ pQQ 0@S:p @-Hy0RH #@-6.0@-P@04MS!1PP Q*   P +U 0@S Q 0S4Ѝ0#-0p@-@ ^T00PUPU' \$ST <p 2@Q.^U@P@@ $ $ 0 00C 0p0 ` ~p@-,@P6A0P ;pA-@D`DPp0S&T00ԗ@"T 0` , 00S@- /,,C-麋X@(p,P0`$ 0АYĐY T  T:\0WaU|U VP P 0U Ѝ ]-V0  a a a a @-@P$$0 ?夵@衵a 0@-0@S0d Ts0"S  @0<00R( T40 ,#-#-G-lP0`Sp@;S S 2@1+1:X Wp  QBp\T.@T&RQ0000(Q $E<p Q 0S T v, 0@1 00 0TRT0T"1#-{p@-P@u@op1O-0@SpP`0 PQQQS RK0VȰСr0 $P 0 0"00=0(Q $;p0, 1X#Q  F vQ 0g,0  R [ R pR L0L 8C> R# Ѝ  W1Q:`0,b p@-P@P0S!U 0E p(0"PE0U055403 0(2#p,#-#-40@-0@SiDP0@0ӕ,` C-AP0`SW!U 0E p0쀟@SV  Ѝ 4 U(@0q`P `4p00 0@0^?Pp\0 H p- `0P |0'p(0,0`,#-#-b sh1A-0PSp@` 0 PQQA S90 $? 2r 0 !Rv?000 V ! (0$0X3,00S0001RPp0S0 00 0W1S` ,P@- @400S T ]㮲Ѝ=O-X0MSM0 @=\0@S0 @@`0Sb0/ @@d0S0G @C@h0S0c @J@H +0S Tȳ80S 8< SRS80S >7, 0HPASTPPKPq @@`P)~G2 @ U, Q\00`0d J.0h CX ?Ÿ;S"@70!,00@03P@_oRݍЍ 0:S 000a 1\0  0 0 0 0C0 ;0CSLLPb b b b c #c &,c 0c c c c c O-0TM$00 (00 40 0800p000@,0 0@<00$$ 0!$0 0(000 P 0ST`@`DPQ 0[ [ !1R  8 [`RP`XP` P40(S80 00 $ 48R0$0 (P 0XX0S$ $ `P;S S2P11: 0S DL 00PA`^U:PU2QP0 Đ(Q $=9p,0S ! 0S E ,v)<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQU0E"1#-{p@-XP@0S=!R+)r00 S @ 0N Dp#-O--BM MXt\0姰@P 0P(` ; POpɱBލ ЍD0 VPά Q 0  0 d!rpPu0 00!$0`4X00 0Fv0`F;S P |她PV +RQ 0P \Q SC0Rpʩ0S R2 S - S/ S0S0000000`0 0 P 0S  ( 0 R$ ?! 0$ S0S 0$ P0k edAd O-DMhPl`PDЍ@P >$6#Sp 0 6P` ;#S06p0 d00到`0\ h0X P$`P`t0 (0KH⾰000 00 00p;d @-`X0Sg0'. C;\0@S0h - C`0S0i/ Cd0Sjp0!. 2Bh0ST0k}/ pP S 0&ä Ѝb b b b c O-p1MP<UЍ` РPE0S Y08  0 0 p1/[ S@@@ {Q {Q r@ 0 80R0 0p1/P @#-d A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-ǭ@P`p1S 3/`V@Td0@@ᲭT0P0S@000S4000S(0000Af #-#-d v p@-@4`4P0Sp@ݯ10S 3/@#-#-0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 00//00/00/00/10/Q@-@@@ 0A0003/P@ J @J5f C-B`0SPEM;06]50pS.U50 St& M50S F50S@?50S(850Sk 150S00$ R!0004 0U/ 1Bh e%0P 010@P0Qf ,-Vf 5f C-PM0@0` P " `b0  00 03p!)0@0 03!0g0p@  @b­lld3@\岬 0 D!@婬 @p0 !埬!p 0`䀟0 R % P%.Ѝ 0p!倬0i ` `$NT 0-0ȗ0@p NR S3#:@`0Qf ( --if qf A,f f ,f f f A-@0P\03/ `pV@@@P< 0쀟DV  \-V0 W  0  !   0 00$ 1     t   Ch  0SJCT T0T4 NG70B@@4 rA,q l ud f ys@-P,`@01Ѝp ,p@-0(M0P,03/`᭫0@ S:0 00 0 0 0 Cp` #0A0ኩ(Ѝp0X O--PM4,@PЍ ƫpP 0p @r @< 7 PZ0H03/0S@`G@`@0 0F`P t" 0 Q!h2A 2I0C 0000000<"  0(0ר幥"X0S<("0 L0P 3/P X0P@T`@\0`0 S8P[ 80S ,1 0, S001{40P ∡0L0 3/00 P0uF 00$ $ d 00qp`|@p0,l0if `t80t$4`@ p[!0@ pTd40 000 f0,0[d⨧0$10=0\$107`\0@ pd0S300S< p0 PÁh ,`3 000000 000 0 0,0p₤p` r3d,0^Ǥl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV $}P2Q _ЍZP^00SZ 3/@@OoBS U@0&0010@!Rl!@!x@|@pPpt@t0S|0X*@3P PQ 0!@x 0T:x0S@ +at@OoBD@|0xT:U@L-Ig - ,, RD Qf 08  #- u: t -sg >O-UM8 SP44@`[D 0P(0 pP(! Uߍ0P,0i30 40S 0RD 80S:(1SK1<00I ,H!0L\." @ 4P#H@; $ߥܥ 00@P P@T ( (0B"2 ,0!P0S 3/P20 SU@0%0cD0`{0{S媥u1@82PU?000X N 喥 ,H!!L䱟H@P0#`P`T@傥P ` ,@ ,0,000 0040' @ʦ ,   0 忦 ,0 ⶦ^},40P1:> 0J@0 000000 0000 0(0㹢p` D♟D0S#, 5Q7ZTX ,*((,&v #-#-Qf noG-/0@JMM`0!PP+P& 0S" 0`"`C!p/3P T` H 0@T* /R  ܶPB2@ m+w P:72?0 `HJP+0: S pW(2>00ꨠ t!ǵPJ>0@0/S~0@!+ H S᝶P`+< P*P 0/S`0oo`bS +p+0&000 SV+t P*+ P*ាP1@ᖵ1@`ᑵJލЍg g g g @-㱹*@-M @PЍ(0  Y@P N P hfP:00p R G-`!PPp X`p&@P=Ѝ0S @ p,P0 \ KpL$ P Xp0 @ g g g g A-tM `PXP HP4+{T@P@0 @ <2@P+JYJ.0Ŭ+JJx|J.0L㶬LtP 㯬PP|<k, ᦬PPs+J*\0J.ᖬPPcp+JL JB`D PPLY+Jl5pd0\!0J>⣺P 0.bP UT ލⰵP@[+JJ⯵PPp0J.=@+ 2P h J>+PT h h h !h +h 7h qh yh h h h h h h h n&g +Ah Fh Oh Yh /00/00/00/00/0@-0@4M#|0$P 0)P\ #P0T0670 PŢ @P gã4Ѝ0-i ( -8,O-AMAd2 ,000PB,0 00000 80s0`0Q, p $  ?(0 $0L 0s$00 0$l5 h%T` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&L"@(F@@,0S:((0"P:P@0@00 +0@080s=0 0@( Y ӡW|Ѝ#à!@&(00T1 0'X!00 Ҵ*80`0000Y9(0S` ` 0 RH03/p`0Y80s Hȟ0Q 0 0 0  BR0S0pS 0Yp08 r  *   * PU0"0U  YP R 0S  Z$p0    P P 0$ PU$0Y0 0 Ypp0 PUYj0Y) r!P%:p0 0 0 00$0 0$0 0pS 0pW  $pWZ 0 p 0P Z$0 0 S&D0 0S #0  !2 P2S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp0 0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S IP 0 0 , 0R 0R  `R  $P` $P 0 Q ``T R T  R X `( 0Sf0L0( 3/P <00S D0SS000(( N L0( 3/P 80<00S (0, S004 Q 0 `( ],0Q G0Q0Yg80sd 0*0 PZ 0WYpq  !QQ 80s 0  00UPpp~0  R 0S  "p 0 0 0 # -hj L-x-m i i O--`M,p#@PVZ pTpPU Pp0Z:`PU`J6ERUB ||03 D&00#h R 0  80s0`F`pHU p 'h0S 00  80spHY pPp 'h0l0 0L03/, 00Y:pPp2p00P80T5ЍO@p0H03/,0$ 08RPP0$P(<00WP:< R2*p,0, 0$` 0S `0S< $`Sp $ PR( P`"!PU` P0 Sa@D S Z0S 0 `p8P0VS:00S40000040,0(pWq닟8`0[:pp8`"p0< p 00<<) `8q ,0,( 0L03/0 0000 0V `V0$0( 0S `" z!`V`P p0o  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P0H03/s0@08P0D00Z}*p0 0 `<080s_00\ <0 0RV04 @ RD0 0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0    V00 400P m۶m ]-! 0 0Q4 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc ʛ00040$0$00(0 00 0S(0  0 H3/P+ X$ 0 03/p6  0L03/ pPpP$0( 0S pP"Q  W00 40 00040(0$00(0 0$00c<#$‚0  0  0H3/P0`u 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S~ P0 P  R0P0v 00040(0$00(0 0$00c<#$‚0  0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0 $0`0(0d0,00Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8剙P  0$ 0S0p0$ p  SpB`P 80 p0R:pYP Y:PpW00 U0#S Wp`Ѝ L0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0hp` o!8p 40U 00 0S 0P*p ` 6$_80s0 L0 3/P 08400H0, 00,0+$0T00X0pPF 00 80sh p $P=p@-@P(M(0S[(`,`0 00P0F0 P P`0(PP,(s(P(Ѝp000ȑ,1(g0,`(P|- R8,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1X!S<1\@17H!L0X!\Sp(0 ,1P"#0@0$'80 ' 0 W %&, 080000, 0 0Ԗ0Ж80000  0'c)00H弖LH0P (P0"W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000pp 85P,0Ր>XpW* 0GS0.(>P C$ 00S H @3/4pGWp @ 0L0 3/P 00S 0Sp003/G0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0^Q  01/ 0S 2 ;C!$Є  0<Pi 0 Hp0  @D@0 ᄀX60X< Pl ,0SIpP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0$P 000L--i p408` | #- l u: i m i 0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002   Ԡ`0SQ,  R) 0 0#Q! Q0 2 <{# 8 0 r  1# 000 S   < 1 SR0r01/-!0 /-p@-@$P x1SP 003/p@yx1vP$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0u  ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0I⨑pK܍ЍIℎ+R*<o=(02#8 ;c&@@ u6O-`0@PMM,0h1h0p 0S (0 S> 9 H  00 0 <0.%#@~40kP`0V,p0U 0000000 0 00000000p 0Np`ލЍG*ᓑ,0S*< #0+,0B#X0S000C0C0000S0 0,0B$P- u@-@-0  !<$10(10,1P001.@-@0 0! 0O-4M\T`Xhp(0P  咕"\ @,@;/,P R7P 4PpK p WpF2 u 0" ( 00 0庐`ᜍ;(04ЍO/Pܽ4Ѝ[;0p@-@Q* P# 0 P40 Pp <0dp@ PT80 P,0 P(00 pm 0n 12:n 35p@-PBM `@  2 V` Pؒ 0Pϒ Bߍp`ĒP00S0`幒40Pp`峒80PS<80  4X0S0!@$埒 0P嗒\0 `0S @`冒d0Ph0S ҩ@l0S ȩ@p0SH ⾩@XT`bt0P^m BDn CNn EFZn G^n hn IJln KMNp@-`M<P@F   1U%P 0DPK0 @0S    8PU@& 0 P 0܍p(0S p f@h,0S H \@D00S , R@^m on Dn 9ln :;hn 0p@-M01P@Q#    T 0`N 0S (0S p H   D ,`V H܍p8忑  e  1 0`N 0S (0S  %   ! ,`VP堑 $0P!㗑 0 P呑0 Px勑0 Pd兑0 P0 P8y 0 m qn on tn wn C-`RGMP@8 C"\0S0 `F` t0p⇞ 0S *  H& `,p WV o$ m`坐 0`0"  &ᗑߍ@劐 0  0S  G `PV| 1 `S0N  \m 0  0S @0S@[  ߍCZ<0040!00⢧@0Fo$ 0DL03/00 O0S !0∧{D` 0S  (8`Y0(p x Q0X 8 < RFO    Y 0@ /6@ 0  m R0_x 0@  m n n n n n n on n n /tn n n wn 7n @-x @+0 @0p0Ud @n @-D @000(0,0000@d @rꐯo @-hQ`0@sKMP!   0 1!S=0 Kߍ0 00@ @@0ƐP(@UTpp (`0 Ủ0  0`0`p子=P=@P,@ ]0@00@PTn&um =>ln ?0@-QTM,0$0`s@|!   0(⧌$1!B^x 00 0=40S!-`!BM0 00=80Sx!$!B>x 0X6#0;!   B.000B/ ˒`VxX 00  @8 PQ+< 0 \x S|0L@T܍ Ѝ!-3-wo o o o o o p o p p $p +p 2p 9p @p Lp Sp Zp ap hp lp 0C-pP@㰐,M0T  0^ ^ 0S 0H @♠`P aV@,Ѝ@-p C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S L L0S004Ѝ0CS@Df7#(`,0$4-p 30S/O-@SMP 000|#,p3I`PAT3T@ *D3P  #s 3Ѯ  0B0 ɮXƮf00,0 P0S* XZ'0 FPP Tq 0 x0F/0P0 00O4P00 d,P 00 w$P 00 40NTߍp-@4-p &-q p q C0S@- 0@S !1R000 s0S/3-q 20S/O-@`P]MrP2M T]ߍ0 L0@ 3/P P0< $ 0Z:X]vU Y xZ $1 0V!7 0 0p!0 01/AS B$1S8  0QH $ 㕐RX[ 0S (ˈ(>I1P/S L(0(0 00\0SvU (} z0S `P0 1`00!15:%  TP p Q 0, ($!` $ AP^ 00 8a4Q101T!-4--Po q r q n q q 0S@0@-S@00 0S/4-,r O-P2EM 2@T P0 |2P p|1S$ $P| 003/P 02P ( - Eߍ$0 R P 01/0P 003/P A10SX PaPE  <0 040000,00800 幏pP@3@0S. $P+ 0 x0D 0t-,r d4-s !-q 4-s p-p @4-Cs A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0t-d4-p-@4-!-3-\0p@-T00P DPPp0AS@  1SA}-L--0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"#-l0\ Q0/\P ^U Q0000@-#-0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@Ep@a< ((G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P Ps Fs Ss @-@PD 5|0 ,0C(080<U 4<0 0 0x`0 6/Ѝp@KЍpPs @-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $į<   <U M0$[P 0|! [|Ѝ0L-a@-80@SP`4Mc00 0P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0㎊ s s s s 0p@-PQ0M0@$ 0x`0 6/8 o`Px1Tx1a1S0C€10Ѝps p@-@P 4 P  TPp0S@}p  P APp0S 4! B!  P  ,Pp0St`  P R 0  Ppp,r s q s p s t O-uM Mp, Z- H0cS_ Ca0SSzB0S 㞀PBԒ0SzIJB0Sz2 P     P x2@    PP2 HD     P 0x0001 @@K @P @ PHPP< , h@ ,D@? 01K01R0|100 PdP0}p@  Pcz~ 0S10$1S 10 0Suݍ Ѝ PaHPkPj1S |!R {ӧP "Tn&-p-@4-!-4-t-d4-!-3-$4-3-4-3-D4-< L--@-@ᇪ00S @P!-7t @-@PЍp$QU0 `P PP> C  01/P ,00 H$L Q>L-80S @- 0  /@t m O-`@Pᐐ吠吰X0r2 S80S00 00 S80S0|1 P S$1S00 0_^Yp@-8M`@8  T P $Q勿$00S U 0 |1 08ЍpP ᷭP P Q c ᧺ P ᣭ  gP -A-Mp{P8 g U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `: WFP2 p0803/PDA 0!! `b8# `00  3/P"#"#00 03/p p0` L03/g &o` 0SWp`@`C88 0U  0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv  0 |1 0=t @t  -G-`RM@Xr (PP dP`T `TP P9  ,p  0S  ttߍ<0H(00,0 00004008004004 04$0D0(0P wW[  ːpU lŐp* `\ n` 8 @  8[T ,T  T T T 0,0{T0 wT `  mp 0`?`a8SڗPb 0  0**0P0״  0* t d@edAt zd@Uu t t t t u u 1u Fu A-@Mp`;@@ ?p@ݍ P@00@ێT 0 2 "0  /O-4MFpT(t$ ,`&X\p@T  0yYY 0 0<R- R 0Xppͱ @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >t!ዑ000㓛#000X  M  ,⼌( [: !{T  P ؀!\R 0 0 B@50St 0 0@ H0 0S4 4 0u x yd|d&y {dЀ y :y By Ky 0$\ (00t S S  S00/Q 0P/0S 0S P//!R80@-4 :CR )r0@/Oy  80R*@-0M@"P0 0! 0! P0Ѝ/00S/-ep@-,P@0S0S< 04 p-@-@0S-A-pP@0ST 0S` @ P<0@P`V@-s@-S@P ' dP (}Ѝp<P }`P (PP )P` P P(  `P` D PdPPP 0SL` P ~P @0`0@0{y y y y y y y x p@-M  mP ڔz R@P"` yЍpaP0S 0 (q PlzPyy y y y O-@QMM@P;.,@pP}0` F#pw p㶉00p$@ @Q&D0S8 CR0 ; 0 ∁P[0D04@T.4@0@T50@`T$00 0G p P P    00wP  p$ pp00#L؀3y@0V  00# l#:000G 8`#APQލЍ04 040RP8< 8<0RPUy00 S 00# PD tP #xP@p Y #YLP@k P # xP0'% D00S00 D zأ0 S 0 0 0 `开@0x0#Q@#000@10 4㥀d@y z z z @z Zz wz z z z 0@-M 0au 0@S( rxP\dwx0P @8ⴎ8 P$0$  B@Ѝz sz z @-u0SЍ@-@M uT0  CR$00S ЍwA-pP@0ST 0S` @P0 0=00<00;0\ 0:00(0JDЍ ppW0`Vp} < G-pP8M@(P2 0S 0( " " 010 020 0008Ѝ70 0600500400300100000.00  ,0M P #00R R R l `P ;P 0h#(00202000Xm } p@-`PhM" P@0@$00| 0 0(0 0P0 0@00T00T 00T01T01T00巉 (6/UhЍp} < O-PM@8 SHo*@PT `PVr``PT\0(Ѝp!SQ0P ؁1/T 00ı8 O-DM 000 0 0 0 {p 00@4p@T0@4p800,00  (0$ gp ,08<\`?! (0_%"T0$ P_5#$<0_.8̅P R0^W \ PSuT h"?L1 0@LH0 R p ? 0 /G$7@ T S@``000 00  0 p  R02# !"8 0/RSYL0 V`0 0P0pZnYXDЍL-/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    ;pЍO-h @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p-x4-08S^>/xD-pM- p@-@ 0( 0S0PS 00Sj ippM-Pp`NM@< Рp`0| p ` 000 ;$PP <3}p{Nލ{ 4ꠅ ydG-xM` @pᜐ堠iP" !0@P 0S PU 0 R=H!H0 bB00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZD   YZ  mȏ Ӆ ۅ O-p@PBM M`/0);P( ↤0P@0P0iP) Y  $;$  h P!14"S5 0S {to@ U01U01Bލ Ѝ ~h0P0  h?XY$0 0I0, j?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P峥%@ឥ@Q Q' Q0PUTi 0"0S0S0@0iP P `@@=02s 2 02@F @DURX A- 0MHd l1lR/ fCRPh@P( T00֞ 0R`0 !?020 2002p&04 pi0Ѝ& 0S" $0Q00 L03/P Q 0D Q 0 SD S003/Ꝅ >x4-P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ` 2aaa0q1P eip`T8B}P08} ^\ 0Sp`82S04@11111111108 q2aqR 2@S22I040TP 2SX;T0S   O-cMM00 QP ,00#.;~0P 0`cލЍ0 Jzp \6X&`RS000o?00@ , DY 2S 1S,2,/ 0@0 Ḁἰ  &      0S@p!?⩻D  0 eD U <  `fPWbV x R $0X&0 2p.1Wp!p'q ?p? @p0Wp!p'q??p$0f@P   p f?WU E ,   p fMh?W U `d@ Us@-RU0 B@n@?`\0\ CŠ"; P0@0`04 oЍpL r @-@ ^ @ TD@@@ Pp` TPPVPU Sp    L"4 0"8 0.4 0@.800 0",<< . 0x4--O-@|MHp4 (P   RD }$$P YY P^ 8RP QW# 40 RQ }_PbV VZY RP``P`V W4p|ЍRE  0 nZZ 00` ^ V ^Z Y  `VRU` P  ( U S"!RQ8"H  @08    0 4  D "< ! ", , "S01@ 5 @ D pF W2zP Q PY Ƒ Y ( [Q"R$PQ  R1/ ( "#(SW] eY D0@ S(0, 02o(0HHLPTpPB 80 Ă2 R020S PP f}00S0 0!40S`1 0U0 <0 1R o 0$  RQ   0ST0`,2 Q HWz?x4-y І  ŤlO-@MP0Y00000 RP8L(L0/C R4  XD00P}/ $00800 0 U"oQP RP"4!8$ 0S40$ 00SR 0XSY l70XYX7$004 0Z00/$ 00(0800,0(0, Z00"0 <0 0@0<0 000@00400 (0S,04 08B4Yz?u?v/0808 S 0 S4 1YL6BT@q?r/`0sh2`0 (  R   T R00S4000D0zdpPD0GY50\6o_P 0"P0S PP eW0$ 8 @ U 0 o?0 R S RQ ' 0^Ѝwτ (0(00,0/ o_S㴂!P# 0 F00S4000@ P0X\0" 0"P-0S PP ;eB `H ` 0  00 V0R0 2@ 0C0 0(<0"0 ^,0,0^ X0\ 0PPT0S PP eƙ 0T2S2 R800cP@0"2? 01@22rMUY $00`2`2 2 S 0  p 0 H 4L H0Lpdp L0S000 XRH` 0@@H@ $  $@T$ 0T @ 0 p`  V`V X`\ T040o 04"PP@v0S A<PP dE<PR3C H0`P002S 02#38T 0Ro_PPUPo/ @T \ `TV R \ Qx4-$ K -ǓC-dM‐@Y`p 0P 04##0 PPPY dЍ003/00S 00 4 0!!2 P02V 0P ( pP 00D0"#"# 0 cP8

b`P  ^skcsۍ ЍO-p0\M0SQ `DbP04!y P0c0@>S@ P0y P0cp0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝ L-G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/L->0@-@0M w410810!a0 P0T0P a0 J0PU ! 5/Ѝ0L- @- G3t@ r@-@ 0]  yvˈ &@-<@0sr(00ppa0Con&x--$M?0 0 !s$Ѝ0-4M 00 000P4ЍO--pMM⸤D s " `s|4 0 Pp0 PU00( 0R0PU00"R0*Pğ p$PD0S 0s 0SMߍ0S @P 0Xb3圓0S  1Fx|#HS 06>{ A0( A{{jodVd`0k0 #(x32Q-AP AQږ2"cA0  k2 B x 0Ÿ R#3SPhS0 10`0 L"k w0  $P(0 0SZP=9 =:pk{J1 AP09Ы A { Q> 5 P;!%#3TQ0X A  d 0 iJ/ w 1 @P00&0` RdP* 2"%+0!@U/ w@0Sdx yw@p0 0 ppqY@.Ax-x-x-x-H x-xx-M x-Q^ G x-x-@~ !P Pྫ0  Aḫ A k{I{7{Z\0Uk0P  7w`@<]<Pḕfp0 #w@ W/w@-1@w-@SRG-@  "700pP ąP:`X:00X0 vPЋ @-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  VP&p@-@P|pp  `pp@pU700@pp@-P 4`epp@  ;pPtp@p@-M@ qp$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M Ep 3ݍ ЍՋ p@-P R`@0 @ )q0 00S TUP3PE ЍpA-@Pp Lp` j 0W0 xW0X U` 0X P 0 h0@ uЍU  0 P ׋ ڋ ދ ݋ @-`0tM0F?oP2p @pp ppop@op X2Spp L0V"4 - }tЍpX"opp@-P@@ppPppp@-@0 y bo0 S ! 0PUPUp@$_0S   0 0S __0S   0 0S  _ _A-p@PMU `0S@PE7  x0PX00ۍXN700#S @ Q@BPE@C0 00 pLz20S .0#S @UX5 @-M@ H np8[oۍP  N p@-d1`0SM LЍp@J@>  <P  0 !   lnp0 S 09S 1Ѝp0 S   000 00P0 PS @ \0 C p@  Ѝp@ pb p@-@$`P[Pp0 @ `P0 001 0pp@-SP@`xM  OAj0 0Gnp@) 5np$  /np )np  #np  P  D0  p(AxЍpt nŌ 0 0 s@->@P`Dp @ p0 p`$Aq L01p @ 00 p$A^ЍpՌ p@-@PqP  m0}1LpP`qpR m0"18pp@-pM0 p @ mpm@pЍO-QMM700ۍЍ }  Z  @`V >m@pP` @-`R00 ЍPp@0ST[@PT  Q*R@00 S   0 0S0 S *6\P ` ] ] o 00000`0 @@P0   @-@@k L1p@-S@T1S"d1S,tRU6\RUp`bV7\\\bp1C\L10CL1SP\0P11C\T10CT1SXʹ\0X11C\d10Cd1Shʬ\0h1x2,P0Cx2xbVt\tb`2,P0C`27@-@0 PP$ H1 0D1<1-@80@ CB Ѝ0@6 Ѝ0Q@-@   bglP p 00\ Ѝ@ Q @ ,0. p-Ѝ@ Ѝ tQ@-@  0A  9lP p 00 Ѝ@ 1S}70|\YP| 01@ 00 pAЍ@ ЍT @-t0M0@Q0$*p Ѝ s e w 081/@-@di'P0S yP 0800L0S S@BP'꫍ @-p@\M Q t0 = Mp\Ѝ賍 0@-800@@@?P@-@p ?2 @ 껍 Q7@-@  ,A; _ Bkp & Pk Ѝ0@ P 11P,|1@ R  |&AQP x`00CS`0 X(s@ P06 p ,A Ѝ0@ X0 X Ѝ0Ӎ &H&tp@-PDFkp4p@ @!lp p@Mk p@-@4P   0F8 p@, > p@-P`80S0&0 Pp P W  g03?0 0S %/0p@-8@` Z40 :0HP PpP  Pp%pp@-8a%PUp@- 0S/8p@- 0p\p P@U  <%<1 x1pQp@ 0Sp @-t0@SPLM 0$Q0@N(p 00 p0 `P  LЍUP @  P "U` H10D1   O-@PP 0p4` R ( 0 w08   Z0 0 XU HP  *< 0S 08   Ѝ0 @-| R xDH!0 ЍA-@x0P P ЍAp E 0 `  0  [ 0x1PU 0" 0SZHP ЍADT 0S 800 P P ] Ѝa y A- M@`; p[,0PSL`$& 800 + PJ 0Sz PuPUv 0 `8PU=,P  D) ЍA#0<1 xQ EA#E;080SK $0P    p0S  U8 A ЍA W0 0S V  P0S t`QP  +t R EP 0S X; 0S 04# ЍA Ѝ谏 ˏ ܏  $ Z  0@-@x P $ LT@- L0p@-S@P` 08PU $00P  X 81 0800S>? $0080S  p,s A< p k p@9 @-@@O--M`@0pRPU@T.Ѝ <P X  R$ R#W 080 C #0   C0800 ?@ G@X 0 0'|fWUP0|$ 0|x0pR ^ A-H@ CPPj q`0 ,Up 0 ,pЍP- P P/ P5 hP? PPQ IE@6 p$P  H :0801 P #P @p )@yVD!\10B0H1x.h 9@ix bPʟ 0P h ܐ ̐ @-@  A@t ,fp `3P<1 ^,,f0,1ЍPH0/M<1 P72 , Q/@-@ z 0S@C-q`@ x @P00@ 0S  >0 Sx   0@ Ѝ<1  0H pPp @P 0@0PE5V ( x PP 0S  $0$0> R>  **X  0S @0 S   000x1  @  0SP Lm 0 0 S   0$ꖑ đ ڑ 0A-M P0 0E0@!0E#gp}00`+e`pdQ^w07S 0 S X \O0E 0\!`1  `Px1 ,Mލ % R Pp P0 S   x0  pP 0PPUyUxex  xk dx1p  P  0S 0\ 0P  S L`Q@-@  p A@*p07S@Z0 S 0VS0S@h A-`R@p@M P'P U 700 "@ЍAP"R 0S 0 r>XU%  *%P 0S <0 *2h p  } <0' &tV>P  *@ЍAI@Ѝl O-P@$$M`plP   eP 00A $ЍOxVPx QP000 PPPXURP   7 0PEPE 00X  J ST 003#OZpPs 8118100x1`V+ VdPx1`G 81181kP NP 6P4PUPpP xP 0: 0 0nP00P 0S 0 0`  P XX [p 000 0S 0 0`V81181$Ѝ  P XX  7p0 `00V0 0 0 :0F VYx1<1 :<1 0Pc R @ [oP V @(0Ȁ0 00  YB Y 0HȀ0YB !7 X V xx(0P 0S PPVPP0 xv  0 9 & M  p@-@>Pp0?R02P?00H,003?00> *> 0Cp耼p@-p1PSM"`! $@P T 0p1!V JS 0S X.PP <@tAtЍpp>0S 0x1@T l1S   @>0S@ `l1S   0 @ D)P 0  @  B.(0$pl1S  " l E @-MP0@) \.P@ P`pa 0H # ^  @@@P@@@ A00\  L00`B#bpЍ\ @P^ `@@p@P`A 0p@-@Pp0@0D0X0\0PP `R0 0P `R000r0p0P PuR00840P PkR08<0pp@-h@`T@@@0St#dPPT00ptQP dh@pO-@RpD@T@P ЍP@`Vt#``T00@OP 0 @QB<84`(``` 0`6b@R/qA- 81`0SPp@j000S= @T@T2 0 S   00S0@0 @@00000pp10  0PppW 0 S   00000@@0aq0sO@Ppq0@-PM@ 00Ѝ00S @T00 0  0! 0!  @H0  @ 000`apR000q0C0p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M@`bp p P 0p``F\ Ѝ0S *p0 0 0CR00B *S0C00ʚ;G-P`p $0@T 0 S0 R  S 4  0pT@QT 8@T 0 S <  0`0Q 400@4@N@P0S 0S0 @@@-@^300 Ѝ ^   ʚ;@-0 Ѝ@-@P`pQ, 0B0 0p"#~ ЍMb@B0@-0\0Q@ PUPUR PU PTP4PP@PPS00@"!030@-@Pj`p 2`dP@P@-xN@P  FapO@0 0  0  004  800< l01ap`qp0@- M0S 0 p    Ѝ0M-@(rMp0p0S r 0PRr00q0U0Sl7L 0R Q00 S 4  003/00<00P$|M@M@-@ p !_p ! _p`@-q@ ]01p ]01@ _p@-PM@`   0 T _p 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MUV0P0\ЍU700@ p`R0 PU B0>000 <0[  ,> x PP> *|긜 @-@T=@Q/@-@T>@0P/- R 0 R00^ PG-`P MC0(0S @ vP P oP:v`P 0!00 0   08S0 00 Ѝ080 K00S # `pP `P0P 0iS.S  `P04S 040:S&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-000Q/Px1P/$0/@-@M  +  0 ]pЍ~iO-YM `F/@H9X0IpPpYߍ0pK 0S 0S PP@ Y eP @T0SL0YP 0@S0@S@@T1S X1 [PAT1S@\1S`1 MP5\1 S S R@L1SP1 <P&L1PC_oSRPU@XP04S 0s0 P?AB@@$P00SLQU !JPPdh1 P Pd1UP H@ `  0[$0D  H `0 S 9X001H \0\p X0 PB000S0 15S4 S  CR.T X L@@7S! y r R02 > 0*T81 000S p S 0 S E@@0?H0p 0P0H0}>H0 @f000L0PPPޜ ! iR @x A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @[[-Ȁ 5S @0s0 50A % 1@ A  + A+": A !9 R50,@-`p@P@ Ѝ /0PX0J.Jp Q, P ~PPꜞ @-`RpP$M 0S0U00$Ѝ/@P 0 00 0  K0S dU 7P1P, T/00DU 7ꦞ O-`@0p"S0W"SpG` Y PP u 700 ЍTU YP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R  T0 `T 00T 0T 0000 0    00 PP 0S& T  ?0 `P0A\0SP0S  r?T PT0Pꄝ &P /0 S S /S/P0/S S S/0/O-M }PPЍO=`P ЍOH@Y@S    pWH}PP  ӛP 0QA00Ѝ={0@S. TP( 0S }@PfH@`@G0P 0 @ 0 0 @ @Ξ p@-@P H` 0SPH$` PP(0S $H0(0$0p,e P,e PO-@/4M10C`pXPS00 pHU- :`Pp $=P@ JP7 7  '$ !0P`0@T\0@T U0 @2 0H050U( H0lh>0P #H0 F@PA t014ЍEP 0 2pA 0S PG01@U  CUH070 0  p  P! .R8 Y 0R77@0U   0pP  H RU H0@1S{|@H000|U EP0H0r ,0 00 0 K,0S4 a J|U ,0!00 0 ,0 S L Uv <1F80w40xbt000 0 PPP00 0  P  p@0  @P , UH <180w40xbt0p00 0 PP00 0 P  0@H0:0H P 0<0UH# 0S /`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 ,K,0HSL  Ah 0A  ap  P 4p@AK0  U \U ,c`P 0SU0 pH0 50h x050,0 % 00 0 ,00,Y`$ UPPeU700 5$'0 5'@p 0 .  0 p P" H0@40U 0S 4S 04S0:006S 06S090 PU- ,0 00 0 vJ,0HS  U H0P SPH0;00H090U ` m`,pP C`P 0%?\ CEH0Q7;0UlQ wP0l1 tpP0l1 \iP0l1 &P pD0Pvp1tH000U10H 2{FP0H 2s >P 0H 2k 6P 1PH| ] H000WH020RU @ 0pP$b H0 S;70?H020:H0605H0;00H080+UV <1&8xb0w4t00 0 P000 0 P0P0P@U2 <18x04gtr000 0 P00 0 PP00 0 Pp@0  @U =PD 8p PWH0p000 SP0<00 mP WH p P  ]PWHp   XPP  DJP  0DP  >PwWHR  Bo|P  ($yp< 00yꐝ n&/ F c q t Ÿ ߟ & - a } Ġ ͠    + D ` z ӡ  "  ? O u ,6p 00lpP3 $ (} H,8y  P B+ P*WH B $p =pP ((O (L H$8H  P  B P  PW ,0 00 0D 8H,0HS M mPE /o"B ($P/xP0H (0P 7$ ! (0'0 ($P/ZP0H  (0P 7$ ! (0 '0dU H0^X UDXXH020SH0 000M5gH000EH000@H0 00;H0 006(07600R 2 | *w 450S00T01=5 =50H0UB <10(@0P@47x0'tP 0SU) H$,CwP$U 81 800 ,0 00 0 ]G,0S0H0800 (PP0 0 P 0 0]H010H010H000H050H050H000H,';,UH090AK3O0\ U0` 0 YAKοOAK OAKҿO+U \0@T$(@" |`P  ,00F,0 S8pPPH  ]`P0:0)pP { {{,0{0F,XCPsJP;`Pp =Ppp"CPp2P#`Px $CP%P`Pz CPP`Pv CPF P`P| ~CPpQ wCPyJ qCP9|   @28|?o2= V [ 20Sk YP0, ۔PPA@CPP`PqM2CPr ,CP p0S P\00CPs (CP .CPp 3 CPp :CPp CP p 0BP@p 0 BPx |0BP(twŢ ޢ ܢ   * 0 F L @M h @@ " b l 0 ̣ Ѥ   < N U n @0BPuI \0BPu |B |0#BPu: 0)BP|4 BPws 06BPwl 0 BP| BP| BPvV PP0P0uB`Pr u`P  R  R 0,PS0P , S%00 0$0(00 `0X`0 P@}@ @ dY`0P ʎIY\0PY YU@HP70P7H0"800H080|H07 00vH070qU &6P0X2iX2S$H000^H070YU d`P 00k`sHРP؀J P  PVJ6 sP P+1Ȁ0'H040"H030H, 4,H020U= p0 epH  H000H000H0@00U ,0 00 0 iD,0HS ~U ,0 00 0 TD,0HSl iU ,0 00 0 ?D,0HS T KO-pУ@`Pr8P lP `nV<1P ЍO{R('RZ0 078 ЍOA Ѝ蜞 O-S@M5 P 0Q  8p`tj⬰<1 0  0@0jEp0@   p   P@ X 8 *  Ѝ& ¬ -G-@`pPU T =PPPy@@P  TL?0S DD0 !v@D@DYT 0: @/@\ A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90 ?8g<7S:8?@gD7S;@?HgL7S<H>(>A>> 1`P>>1`P>X  XP T0 ST=47,`0C476<7,`0C<7/D7,`0CD7(L7,`0CL7O-MLM`h$ 0z=PTWbxP E3&7 E0 + 0+0 0P70P7> H0E00 0:00 30000% p N +8 0 E 0d0 E+ 0 P#Z 1H@[0X,#=P0047(P @5: ؍LЍDP #PA0 D  D 0 0J<DP078t2470x24,0<'哸 R38>@,0D'哸 R-@ >0H'87\"L'<7@7D7`"H7L708 p0  +@0S R R P\R @MJ0@ R (#P0 00 a?op2 000S002p0p@p(0 DDP 0 0# 00tDUP P0( & D8 P;P5 Z$d h⊐pP#22C8(, ,0@0S 0 S S0P\S  @ :0p  Pphqd+rPd p(0 P$0S P $1 P 0S P Ppp} 0 0# 0 Pp Xn0D00D00 0  0Cb 0 S E:$ E000X 0 x-@ ̭ Ⱥ 0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HGU( IG:A-TpW0 %T`@V0? C.CL0LS @sP spX X| |00 S HH0P 0RS 蔱 p@-P @Pp"<@-p@-@Pp PPpT Pp@1@-0@DT 0@0T0S0@- eB@_ < T0A-p `R0080810@: PP?W0A U t0  t0 p@^0S d pS0S <p? @U4 |J.P P @$T T0Rt0t 0SnPt0 t0 88cPT0$0x x0R Pg@OP0S J@c t l A-`P Pc_ @T T0pS@p@-Q Mz 0 zBT0S0e PUx x0 BPc_`@P 0 8 P   Ѝp <  ó G-} G*:SR0M" P0 (   #P  @0A0 0(P  0Ѝ lB @T|   T0 R0 0800, P T8p(0SS90SSPT0c | `P 7 R|0   P @T T0R88oPY0Sx x0R Y' TT 00 XXXNPR OP T T0R88=Pk0  p0VS p/c_ @TG 0`SS-90SS)PT00S8 00 G*: S R  j p 0S 0S @BT 00, @P Գ  & Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-40; .0S Y/00@ P@-40QD 0S F/00@ P@-L0}O 0S So-/00@ P@-H0a 0S Sp/00@ P@-L0o 0S S$0@o/00@  hp@-@Q0 eCRP0_ C|C0`S0 SQ 0X Np@p0 p@`0 p@I꾴 {մ ݴ 0P@-|0| CQh0i CC P R !P BR #@X@  p@-PP M0 ]0S0S 3?@c@Ood@T $S y0@0 Ѝpr/0@``Q !0000P 0 CC@ x- 'A-0S00@Pd` pW >/0000Pp 0 Cx-( nP@-<0<.Q(0v CB!>000@ [ @-@QXNh C-`TM@ P `ep) 0 S00`"P!@03@000C>S00p"P!@03@0 ܛ -3@- P cp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  pp蠵 A-0Pp`@S:0SS 0? C/C  RS* R0 $8`V1S* P a 0@DpR: Q  O-A 0MTP` 0 vu@@PAH{@[081 0S  wp 00TPЀ NP IP DP ?P :P 5P 0pPp 0S h Cp X61T!R D9p 0;1#3K00&&*pа L0S% %S  p H p P p $  p : pw P0S t0$0Q0p P pe 0Sz08!Kּ0x1Zs|Mp M ☽Pw p@ l媽P0hd p1  tp+ %P %P0 x1`@ $p X00SXppW0h 1SP.vp@H{sP  >|p ]GF upp%` lp~ 0S P rQ Z T  Lp  r"BLp4#P{ $Pv Pq xPl Pg  P P X00S 0Sa Ta FQp\%P `V%RY pTr0S]   Gpg 08!lpM^pJ0SL   < 1pQ 08!p<HpPB 1 R6 0S  P4 Ѝ 0Sp pl꨷ _ Z i q y h Զ + 0 ; 6  # , Գ A \ e F 6 R U W p p@-P@pp p@RRA-P`@@pL0s  S$0 U@ p@@@dW0S R H R U py q Q p@-P0U@S 00p @P@Wᠺ@T:Ѳp/ᱷ &@-P`1pSMAT  p@x Ѝ `PЍ@!R 00 0 0 p@ @aV 0 !p@{`P ⮢p 0S |00#40  L< SP :6,0 %궷 Ƿ ̷ A-PP 0S @0p 0S @@H00 S U   ^ @ .S0.S00_S-S```&00  @R"0T0 0D0& @- @0P PT00Q    &DP `00CS`0p S00 P0S X0X /XBKH&p@-h1@SPthPPE @p 0.SSPP XP HP 4ѺP 0  .PPĸ ˸ ո p@-@P'Uh 0 I0 I0 xI0  hI0\/T,L)D& <#@4 , $      I0  I0  I0 I0 I0 {I Ip@x DP    ' 2 > D N V ] d i q y ~ & 0(HLǒ -\ \` Q^ ,\ ,@-QMM@pPZp  0B BHQލЍA> 0!>0 0B Hp`0SPE@E p 0S:0@0D꼹 O--,Md`pP.  g|`  @P?2 0S  ƹP@ eP@,P$ X]P$0X2 2넾00,Ѝ P,P, R ᩹P,PE0S h R* 02d0 D6$ R, R 凹P 16$ R R ,Ph!@P !!!ݹ ҹ ٹ P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@ֽV00ЍPW̽"0$?S 0[ PW RPPUT  P70 ᬼ.0 I@0 0IU:D X0 0 `TT  DSPO-Pp0` 2" Y*Q@ U Vu700 Ѝ$@@P`Fp  _00U V 00  P     @3 \Do   ' T/T$)\T0 U V@@U V\$0@00@@`FPpU V @`Fp~&ĸ C-RM MPLp`Hp< @d<pF Gp㜓 V= p ;4 GpTN    0 4Ip PB IaP I/    Rލ Ѝ   20V002 0@I p h @`p1P 8$vGp @T* pP0P 0S4 w `@T*T  TGp @ b p{ t h /r >Gpm @ 0/r   2/,Gp[ @@ 2/ lI  %  ۺ FR  .0I/P: I/Gp4 0S @00SP%<Fp$00   A- @pTPM %ЍR` R ޻00P0S 0 -0 0t0#0Q0 A$ V0B  00 0E O-4MX@p 0S\`d` (0S<0 `p40 4ЍO 0  ,   xp0,0 ,0SPFP ,@lp 000 ), /4ЍP V0 00 0U0  吶 0,pVp0X0 0 `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  08,P8 S : [ p@-P@`P 0S P$`(0Sp,e P,e P  0'?0@-MMP+ p P0@ۍЍ0;0 C@P +P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@@T   x0x@ `DPЍp`Vx1@P c0>0S *P PU@wP PPG`D/0P@-404  Q 0 9 C/C @4  A-` (M%00>0@SP  0'0x B0epp Ÿ0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xSPT (Ѝ0 8 0>0S ˹0xPT A-`lVPPFPPp2X@p`Ehm,P hpl"h20 娸V0  Ul20l2@-`@MpP! D (@ (X( 8p>PU@ Tv700@Ѝ pi///p@-$aMY@U 0]  *PPЍp 3"Qvp 000)00'>p^p0000@ 0>pl w 00 " 0 >p<l Ip 3` & p@-QUp@p <,0h1p@,@->`GMV 0P0Gߍ@PF/ ᬷ9  0*l0 p 1`0 DF? >P> *۷0 F?> ii@-@M~P4@ $P P@Ѝp Q@0@-< C0SSP`/// $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  <  ἣ P=p 0 00S p,Ѝ08i(p@-@MP  `  ⓣ  (P=PЍp:iO-PQMM@3@ CT0S(3 CCpW 3  CC@H`"0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0 0FT0T(@)@@F᏶@  弱Ӷ T0R  B  @ Y? H1F0FᶰF @T0  ᵶYI @T0 0F0FᶰF @T0  XP ᚶUPPEPP@ D$r ;p`ݍЍ  =  YI @   C-`p"0M` 0$`  0r,pP @T*Ѝ`*PPA   0Z,p=0 S *@ ``T*x0V*-00*T00V:0 (P| P@Z ( ᮱Y 0@P @-`@DM pP@  ᱵ  1!> U 134  R2$ $@0 DЍUi@i@-l@QM  ∵00p l2 0"h2;Ѝ@-]MM`@FP#_:p PP VR 000S0S S SS wR0S HapVPS CQRS 0  Vxp@P V$0 Bp 0S$H`  ᛡ h;p 5 $ L J80Su S S00,0S  R000@0S  R00@ H @ 0 Hj!>50H \0U;p\"0S 01S h_Qc0 0 000 0 0p9URZ1S SN F F]ލЍRIx^@P= t@3 3P0 0- H)@;TY$0S! HԴM PPN0 40~Qii@ @-40 000 0*Ѝ 2S/2S00/@-@@坵V002@-S0@0 @@叵V0002S A/< A-PM`p (P.P'@P. 0LL`09p0 ,!J?9pPY0Sp :p PU0S p 9(@! (w( f:p | P_:p 7/PP T:p j&P Ѝ@B K qB@V lBpBfB@O-@p`0$M00PU  80S;P  0P0S P弱 00SU 1 !  N0P00 0ճP0 PPP0PU:000y $Ѝ@-  9 ЍgBp@-0M2S`P@x (⧳VP@0 \(9ꎴ00ލp@ x B-$M^ * ! 7$Ѝ@-@!8 '@'@-@pp t9p`~B p@-A^ T500p``0@D^%"000txœ\p@Tp0,p/0/Rp@-00@ ^  0s# R0ppP0QRO-M@@00`1Q V00ЍP0p Q :8Q@SH ϲ넂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C X&P 0 B0 哲 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S8Ѝ@-@\0S \0\0@-@`q0 `60`0@-@08$:@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@BX p@-`PK@N%Pp00,000S00 /0KpcScO-@GM`АQp  Gߍ0RS*R?  0 000KC%PP d0S  FRV ( Q  R l(Qh 0 00> 0200BS *⋱0 360 RS00 Tg K4 pB' `$pQ@ DPV VdP h00Q 20000$0@00$Q DQV0S <0S 0GS60000<0@0V0GS 800006 S0@0 0Fq2!31 0 d %R  GR0+  %A C %0 @V 8    GRr2   0@08 R  GRd3   0GSY 700 0 0t2@,0 x" R 07 ,04'R SK6 FP%*p<0fSV (1S 0 G0S=00(  ⦰(100@0S W0 2S 0 GS<0 0 " ⍰ 20@V081 0 Z00 GR P0@  2S P :0 GSQ0Y0 0 2 0000Y00 @  "@V 00  ^00GSt0`0`@h 6S 0pGS^00 &A . 60@wV.;(, "r  P V: ART ,0.,S P R:(, "r   PV: ART\  ,0  00D0C0W0 0GSL900000@CpD 4S Y 0 GS8M00 $A ⾯ 40@B?S6? B?S6s 00PD0 KS:KUKe 0 S0P0"1P W0G R 0   ᒯ @@ 04 $S [p ~ cSc5 7@-P\ R&@P\m0S x0x08  Ѝ0P @ 00pꐸr& $@-PR1 `0@ 0p\ 0C R1 00 R0  06 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000000 00yp0 00mp0 00 C-@PTM -"P@, 000`0001iH00 P00 x0`  (C#0(10: P  P( # 8@  ' 0ta P( ``(1 (1  0(t!p0 +"70 (P 0B y>``v` P( `"(1* (> >Qߍ 0*"  T \ r 0@-p M$M0i0PS` G1!pp2p@,0S i lp ۍ$Ѝi@ +0 9Pp  `81Q50 00pPI P(@  H&$ @- 0080@P PU@ 0S@ ( `P@Ѝp ح00O-IMPpPHLL `PR y @P0IߍOH"0,0B"600 04400` 0 p00,0 PS2 V30$a2@0 0 !,0T;0 ` OP ;V@PIߍO@;0 P '7V`` 0\`0T;0 8`$;0 P @  G-@pPQP,tb,`x2S#PU`,@ ,xq8P`j8, Q 0S ,9$\8 tP,`0( H @ RG-00!`p@0PT:p T  X ⢑00U *"0 pЍ0R0  ֬ @;0 48p ;  8pP p@-RMM000PS`B S@ 00 0pۍЍpd p p `F0D:, z8p VZ @- 81SsQ S0 00 0tPЍ 0SJDPD3pO-04MS@ h@@ `_0P o0 00 0 KP |3 00 y0 @PX3 0 0S0@0e)00T0u @P0n 00 0 %`Pe 0 $ ( _X]pPv 0$,0(,8 eP@ Z0!   Q*"00pP 0$00S  $0 j0(0p,00t0$(,8 -P@0Sh0` 0h0 l 0304Ѝ 00 !0 pP @ |Z{0p$00S,0 P@,0$S  S S0t0p0P !R "R_p( $>(;,88 P@ ^ ] b O-P0M040@`0 `2''`pp'`W9 pW6l0S,0S`,0tr0v x2S`,080w0v 847S`,0\r0v `"Rtr0,p80x2 Sp0匳0g47S H9 0` Spߍ0(000 `2(p(`  `(-9 0 8p (` 0 .p 00 `2,gp 9 0 p,9 0` p'0z0,804l0$ 40pl'0k@0!04,0 40p]`]`d`k,0 !P !404ǜ R10 `"`P' 00$100,0G0 ` 0 X00, }R0SOQP 0H ` `  00,p6S  ,0 !P !0 `"EP 00@ 0  0lp,`  @ p@-PUp@0L0pp@- P# M7p 0` 0 ` 0@/p.@ Ѝp ` 0/p )X` 0/p  ࡩ00; U100/p@-p@`P81/(080000'0S  0R  dp`L Ѝ@3@ 000pA@ Ѝ@ Ѝ 8O-`@p 0SP$H` *000 0 0 `00`0! Р80 `  $7' 00003H081y H ЍO|<0 $7뜳 {000H@0Sp3H000s$80407 HgS 0v0008 R#:kg{{'{z40S' zkg{{'{ z0زS+d0S( $0P$h0!Y7 00"R::kg{{'{*zdA8 S zkg{{'{* z03$67 00H0S0ST h Q 0R<0S 0S11H000s8040 P14 P18 Pp10 #\00@0S0i ,0.0 0p 0h` O P0 /0S00H s P 0dh0 ЍO Ѝ ?? 3 > 8 ^ f C I t] P W p@-@P9T  (00@x1S0pS|q |-0|2p -02022p R Rp0A-p@`0P S pH pph0 00 00`ppd0h0  -0 0 0$003 0 AA p@-P@UM R 0 Ѝp@0H8003  l0 R,  0i0P% 0S" <0S 0 $ ``5  | 0 @<0 jЍp0 Ѝp@n <O-R@`pP\M$P X0 #3P 0 RT0|00 p` hPP. cL0S0 0@S@0#/L0} }?I00P X0 "2P 0 Rzgjzzz{T0Nd0S  $$ P $[ <Y y& H" @"p  $P(P Q ,  0  <  @ , D  0H  <48`LPPPTP+pZ LpS 0 0bPPI  0v` 0h10 p E000d}@0`0v P00 0\ 0S`ev  ħ04S 1S0810 p  FX @0 \Ѝ7S zD@ F c CDC  @-`@pP`f0 zh0X $7S R @`0L0 , ` 4 0 Ѝ@4   @ @ p@-P@ $ 0 00L0p@  p@-PUp00CSp@0@ +$q4  (;000L0p@9  dA-`P@ p_ N800 a B000@ 0<0L00A8 % X  YA-P`@ 0h 0R0P5 081HAp` P!081( AP     Pl l 0 ]B@x 0d 0 P{ $PA h00h0 C-p@ PR0  R $ RP508Ȁ `3  i@0S NPP ? P0 P lHw81 0S; 0 S<$1  0 <`0  @ R 0P yЍG 0PS 0 PD0A "0 00 0SЍGЍv H cSc 0p@-800@P  Hh00h00L0p@$` Ffi  \/0S/0> d0S  0R/L. / O-0M0 0PS000p ,8 0`S@ T0S 0 ЍO> R*ʀP7S Ǚ ǙY  S:1  @ !  Q 0 S:500 0dp00 00  ЍO Y 0 0Cs0&0S0 S0L0 \p    0P 0 0 E0SY0@60@ 600 0#p0 0  `P | 0 S 081H{i@06P >P0S0 0<S<0P0Ѝ0    0XP 0Y6S700S0 l00 0P R`532Y@0KSK?34%05 -0 JY0S0 ?  P   C [ i+0 l4 @0S Y0 % 2)  Br  Br0  3 $ 0P 0   0 Y 2 0  p3@S R@00Y$00D0<0<081(?0< P0 P5 0000  000 0P00S* P *   pz @ 0iЍO5600 0<P0 (0S * P  pK`81 000H 0 000 `0`Y0K\0S   0X!YP 0 8 R @1ЍOMY 0 cY 0 40Sg0 00 P0PY0 ),/ x ЍO : d {    ! 8 S [ > k } p@-@l PT/ 0 Lp@ `D N\P d  p@r`$ O-4M@PP Q0 4ЍOPE чUPp @RL RIpUD:paV@ U=:$ ^P3U0:" R-   UP% 1S 0Q00R0<2  ;4  5P .  04Ѝ0 C 0 Bi Q p@-` MQP\@M  t0000x p 0S T A @T ۍЍp 0\`V \@Th $n G-`Pp 0x1@TT 0S R T0S> R*}P  0 @ A- p`@PpA PU. 0 HA 0S 0A\0S 0A G-0 ;M0MNp`p Dd`8O0 P480EL80H8$0ED80@X@8<8 ` m@W0|` 0E 0$p$ݍ0Ѝ`   7@-PX0B @P 0S.0>8 Q0'Q'+ " B r R "'    00 Ѝ0@p}u zgjzzP+S, 1@ 0 Ѝ0zD p@-@P0( Uph0Spp@XO-P`@T Q Pd0S r 0 0d0G)P0BQ 0S 0P -  0800 |#  81- 8 0 $ 0R0hd`h08 R0 , 00C0 0800<0  P`00 *0 00S $0 pWp1s00 2   0P C @Rj 00pwpWH0H0Ht0p < 3 0/@-0P s0 @Rp@-=00p0`PQPE@ ` @d@$,b p0P @-P 1S P/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScG-` x1PM@T+ 0S pW$ P ⚘ fPP@h0 d0S4 t⃘d0 0S ,PPPЍ|0d 0|0 00d0 00090 .P p8PP  |b  PP$0 00 PP 00d8dX<V PPq |0x 0|0h0d|00|0XZU 0S lP 8 g P  NU` P < 0$Q S "  Q  ៘Pp h  5< 0   `ipP< t0<0t0A0 0<0 807dxQY X- kP ቘ  U ZpP xАY $0% h  5< 0 5  `0<0|Գ */  p@-PP1 yC  p`01S 0S 0S 0S  (;0 @T 0Q0 PSP 0wU d0S0h0d0p@S m ` p@-@T PP@0p G-Pp`P@Ѝ0E @P00 4 @P 0P000000 000)<0  m&$0 P pEp)0 ppp0S <0 EP  0@R 0 0000@@ @-@T PQ0 8 00*:SR h0S dP HS` Ѝz$`  Pdp (0Q,0Q  ! `P Z800000( ,0BP0S  0h dW $0Q 0h0d`80SHV  0S/0S/   O-MPH0<`R8 0@xP00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs @UЍO4 @PЍO p    @@0 0(0 C% S3 0S/G-P@M T 0p `xw 00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000pȔT P 00p0000 S0 @00:S 0S @\S000@:S @x-&0@-P:P@A0 P\:R \:\P@\\ @R0/r& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO0E`VK `0P0E@ PPw 00pCލ Ѝ@@];04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S  p PP ;000P p 0S#0 0 0p8`@Z + 80P R 00SF @ @ 0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D h 0SQ Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0> P0@DJ`F  0S ; p 002  @ ` P D,0  ,0@PE P0S $ D0A00T* PP 0P:SVrx-r&n @-0  0 Ѝ@-(@ P S0 0x-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ cy0Pv Ps @ hS Q0#P ލЍ Hy0P P 0@PMS0 PP U L#P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  x-&q p@-@PDp@NG-`= @P@ d Pib 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY~0TS @ ASBC\ 00bC|^\ 00:0 0 0Pd 0:SS0AR0@A P Pd p[ H A-p= `P@ d4 PPd0`F 00@0S @Ad Pn Pd0 :RRAS@A ~ P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P "Px-t G-A0SRPp`ʏ PU00Ѝ ᭇP00CS0R Pp0 Y( P , P LP00SW  R00S 047σ,P R   S@T PR   R x- |- y-@0@-0S |P dPx- -@-@[P08Gx-p@-P@PPpWQPpx-@-@FP Q 0@87ST x- -p@-@ PS P@p p@-@P * 0@87ST x- -O-pWP`@P @ ЍZ K P 帑PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  ᒆP00CS0Q Pp0 0  htZ `PD j8 fP -P00SX00 S RP P00S  CP =P x7P \1P D+P ,%P$ :#P8- 0@-4@0P  P8- X0@-0S ;@@0@00DJP0DЍP8-p-@-@`0P0`Sp 0`/P PP Ѝ8-@-@P08D8-p@-P@PPpOPp8-A- P@`pPЍ0 `(0P84SUP @8-@-$ 000B;P Ѝp-A- P@`pmPЍ0 `(0P84SUP @8-@-$ 000B;P Ѝp-@    /0A-P<<`0@ =0p0D0& SQ 0@/0PA/A/O-@PD⒏pDpG``b0Y:0z  Z# 0@@Dx 0DA\0:Z: [=0 S: p `$ Ѝ `pt-A-@`Ppg 3a -[ 'UA  0@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pzp TT0 apN@ B<0@&40 4/(00S 0TЍr& t-A-`@ 0s P00p0pGWp0PP @P @pT 0@@PP @t-p@-@P?@0 ?@0R:@@pP pt-@-aM$0Sj Q1@ 4/1@A C"+4/%0AS&0  S00PpDU7/'0pS(0  S)0S*0  S007/ ,p0# Dn7/ p0# Du7/ 0p0# D7/ 4p0# D7/ p0 7/ `w0 6/0 P5/Ѝt-r&( O-Q<08@0(00iPR @p⮍`,@48pT:(㙄)<0( T:(㙄)p@0(pT : Ѝ  名030IP@`(4傍8p00 D3#00@ `@4r<08p4  b "0 0, `0@80@00 4/0SD0 yt- r&( p@-@0`,0DPSp1S@t-0D0P/t-G-0DAMHPMU`000PP, p0,0ww0@00`o`SLXp Xx +mpo A>004@ptpG0SkX$0`S D"0ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00I\\希%`D| <富0,`\PPDpAލЍpP ^P 00PpWA C9RQ  0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0ӑh0 :/1, !ᣐmP 0H0t-r&) : --: I 0H0S/t-0P /t-@-DAP|0`SDM)0S&m0S S fe0P 0P@ DЍ xpW*P 0 00080pp@ 假`0peX0 7/0S 0SP 0 P0DЍ@t--r& G-\qPL @0P12C001b5R 0 0&0S  )h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rf00ʋ0S0PS W&0S,P P,@GJt--!\  0L0#0t-@-p0M  L0@31 ^AP 0C! 0Ѝl,t- @-L 0 0@11D ^Q       t-A-@b@0Mu L0 @2# p PW%cP_  Bc p\  ZT$0 HD@,X#1010 2R01   000 S" V00 S ⮋ ЍA X 1(410~X0威42 SV Q`ЍQ0S ЍA`\c  Z l⃊@ll%0S Z d0@0t- A-Q`0MS 00S` @P9 0s$@Ѝ pW   @50p0|0S0S @Ppp00FV@@P 00T l@9p`W 0S:S* 0ފ 0p0ppt--O-`HqL1P0SU#,@T,P@P5 &0B1 `P 18h L0C R P!050%Pd @T: Ẋ 0 p[L0CY1T*Q@@t-G-qT0So:\0`S&; 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  0B408@S 1:X 0@D8C 003 c0?o< @@D@  +PP  IPOPP 0 @ S :    b01"!00000P00-0Pt-r&A-p0@@ `P PP0`0P P@lo%Q *0S  {t-$00S:@-@@Rt-@-PP` U(0SP@P )@T \0@}T0 4/똎 00'0S 0 $( @`Ѝpt-r&( O-$MPpPeE00U0SXc )Z@ D3@L<3 4/ҽW(0Sp0eWD@XU0XZ5 0PPW00 # 30+*[@C@dQS: BL{P5 KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   `%Q   p0@P0'0S 0 H0p|$Ѝ*0S  t-r&( - @-M@pP0aE(0SWTP )@T; 0@a0 4/0#880 P0Uu@P   '0S 0 x( @1Ѝr@P %Q|0S0S PH 00t-r&( O-@QpL$M(0S@ P zP'0S A p$ЍW %0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*D4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp<`0<0 0 zpP HPP% 0   DS  6%T#2QZ J*0T00S  D;ULP )PU @0@U<0 ;4/ܻPPl 005t- r&-( @-L0@'0S 0 00 0*T Ѝ@Ѝt- M////r&/r&0p00/&0p00/&0p00 /&0p00/&0p00/&0p00/&0p00/&0p00 /&0p00 /&0p00@/&0p00/&0p00 /&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/ᔊ&F p0 0CSp0 S P0 /p@-P@,`紆Pp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0p000 /&P/ 0S S//0R/00p00/&0p00/&7@-@P@@P 04PSPE 0   Ѝ0 &PQ 0S///s&03P 0 / 0 ACP 0ABs0P r CoSPS//O-MX@ @ЍOSQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!൉`PE`0r>T 04SJ:`\H㌱  VT  QX ( Q   u G Z P   ᄉT0`[?oT20S@ p@ @0R @T`0-@0S S @0V @ X 1U@@V X*H 00`00P 0 00S00/L"&i 00S00/3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00zw Ѝ0S/1>3 !/0S 000/ -0S*p@- @PO P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!n0`A-PRp `@{P 0!ᆇ000A-@P`p쁟0 SV1 V00W W0Sc0 P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (WN0PA , (0 ,Pꔊ&&&A-`P P0PS\ ]\ xp@BX T 0| ᷂PEPp$s&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00 - 8 0 s000/`Q'Q!//&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0n0 "0 00 0W -p@-P@,`ᲁP@tp Tp Q 010// ,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`ꔊ&&&O-P 0R@pM @6 P&  $/ P 000Ѝ 0@  LPP ЍO 0 PS@ ᝄ 0 00<00S*^Q0R08 ]R00-R ((g Q* ]R -RS\T0]Sh-R0 S^:0S006000S80S 00000`d0xS ,ZGV ,0Sl40Si$0Sf<0Sc(0pw_  0(`c0 @`F p@ #Uj 00C0e-R [RS :R =R| 0S: R 2S0S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``G0  0I~P   0y S0<R$ KP    wP  $0  0$ 峠S0hS0`0`0-S]S0`S0`0= 0 S:0`S0`00S0 -R[ QX]QU -Z00  YJ 0S- Y0`S 0`00S0<Y00 Z0S  Z4 0KP / {y400!0ⱐᲠ40  =P0S 00100  0P  +P{ U [ 0]SS0<Z*0 P80 P <0 S P p`v`00勰P00 0  EB#ЍORZ =RW ]RTR :R ]R007 ' & -&&&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&&&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xIPu 844U\ 0CUUt0SU 0`B t  | 0D OU &83U N 0  , 0000h30>@0S* *Q2  0  B  BI   B0  B=Ѝ 8 0S 0S 00t200}PT\QR {RO00r0PS;* ,R8 Q 6 2000/ ]U0 R  !   p0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \h V 1L  0 S *R \R )R003 0S00000+ -)>{^ ]&@-0@``P?Q $0As R % S 0 ^Q [Q \Q 0S Ѝ{Q |Q?20V:0S00500 @0` V1@`(P G0 S*0)S  ) V 1L  40 Sf:0S00p4000 S**@?PQ{PR ,$  "!,Q 0S 00300\0 0S 00300?P  *P 0 B5  B   B0)  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0@20z`o ksi0V:0aS0`000<Q >Q q`x+P {N &   B 0  B  Ba  B5 "X A, k0 `S0* ,R-  0000< V0 R   0 S*}Q00@ R 0}Q 5000S 00 -&^ ]0S G- `M pQpG zpL:@P 6W: ЍPEPP P $PPxP @P 0uPP6    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0$GP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 f  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S* P8P@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U! R0>P P PS 00 00H0@0 @000 0 R00d000G 80S@ 0Q10CRZ/TUUzfdf -Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0|P`ꔊ&&&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@ꔊ&&&O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  ZP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(&h O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0, 0(0 000@$002   0 X @ Q  0 R  R  PZ$P  (    R    ``S  R  Ug h V pt p r _U RQ v   _V R up  r   _U R w v  _V RQ ppX u0] v  r    _U_V QO  X 0FP|u  p $ V    upv  w( ppu  v X pX wX0wq uc v _VX 3"  Q$,ZS (  `X S 0P&v u _PU PRPU00000S 0R0 4Ѝw`Vw_SwPu4&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0800@ 0 YS  D>31># R 0800@ 0 Y_  DS S- S* S( @` PS 0e800@ 0 \Y  DSU S S 0>#0FϠ2@P0  @P0  0P P 0/VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  UP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(&h O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  OP ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E0  ?oR20SpG pGP x0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0/PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  NP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(&h O--lM%PQ0u @%Qp ppm        Q 0"RS. 0 YP,Q 4^ 8[ <``F0 0`Z01S` 0s vQBo \R 0C1!S` `0j0 0Q[0 000,@4H80<@ Y PP 0 TX\ L0`o Vd 00 S`FY1`0 0 0`,UP XD0S 0 0D0,E`PD00D0 0R < 0JS : MP Z Z `p4`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$0 0D0,PP5DQ/*0 F00,`PD% 0 00,P0HP 0000 0D0,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y*,Q 4^f 8[c <``F0 0`Z#01S` 0s vQBo \R 0C1!S` `0i0 eE& 0Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S7 0 0D0,`PD00D0 [ ` 0R< 0JS: hLP Z`XD0Se 4P,0@P4  p4P (HP $lЍ,0@ 0S%00D ;0$0 0D0,fP5DQ/*0 F00,%`PD% 0 00,"P0HP 0000 0D0,H0SPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80S 0o <``F0$0`Z"01S`$0s vQBo \R 0C1!S` `0h0$0Q0 000,@4H80<@PP 0T X \ L0`umV 00S`FY1*`0 0 0`,7P XD0Sc 0 0D0,'`PD00D0 0 S` 0P< JP:$0 AKP $0Z`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$0 0D0,4P5DV/0 F00,`PD% 0 00,P0HP 0000 0D0,H0SpPHtDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPppp pnpl-Ѝ///@- // //0p@-8P00@S PpIcP p-7@-4P@0S TP Ѝ0P -@-@P 0S wg@P/]P0 0 0/ /0 0 0 0 0/////0P P@- p /| -t P P/ /0 S/ 2#0/<O-,Me`pPR0@X$*$0S$00f 0Z0000\0 0 0 R0030#$όZQ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR#  0 B 00Y00S  00C 0S000b 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SB0 S H$0 0CR0%2 L R1000 S 0!03 BS t0 S 0 0%Q $ P @ <$0S$0C[ 0SW 0 0,Ѝ 0R3Z0B\\00S SC @PTP>: 0; $ $ 20f <Q0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ { {Ѝ$Q0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`&ț0O-M@0p`W PV P'Z P2Y PyX PV P:$  VW Pr V  VV1  V VZ  }V wVY;X% h kVT 4eVЍZY!X3  SV ,MV  CV <=VЍ 3V $-VXVZ  PЍOm |L4lTO-@Q0M0R0`0P|$0x 0 p/P R nRk a BR  $  , fP Q DfPL Ѝ3 00eP~Y U000T0003 0$0ePNY U070T070H ePY} U000T000 PePY U000T000YW U080T080 oR 0ePT000U000v ~0 XeP 0 4eP 0 `ePjYL U080T080U0 tuePz 0 oeP 0 |iePTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t ePYv Y0 heP 0 eP h(Lp 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  @p, 0 ip@ xip@  -p@@@di0 PtiiPi0 PiP`Ѝ~i00@O-1M M(@PDdPp \"(` p (-pp^$ @D;@h@ 0 0Sr pءp 100 0`00p@, ` )@-0p t0)0d IPGP 0S R i001ݍ Ѝi0S 0F\ R Pp @0`!@DD4 [@ 0 0 0V   0>. 0p,R 41ݍ Ѝp FtHxgt0@-P@M 0  PKp (Mp@ P I Ѝ00 0{Ѝ0@A-@@0s/ PP0P 0"p` ``\0`0hppQX`p h``E0`0wh 00p@-@PCM0 /XP2 $pP@ ` @\h000t0 @ 2{@P0F0 {@F5]0S VS00 SCލp|@@0Sh@d00P0@  P@1:)h?00@#h00 @p p@-QMP4@SMZ TF /TXPC QP0s, 5cP!2QaP 0`!pO @ 0@]qpF @ p> ۍЍp+0si/0p0 +Sg@0P0@  P@1:g?00@%p 04g0#S5p@ g00g@g@ܜPXX %@ @-sP`O-$(X,p.S`P@+Wu00Sb [0 05LP:[$" 2Q%> !4"0x"3S20*rW00Sa [0 0L P :;! "#.0P@AQ#Ou0 {0Qp w{_ K P :;$" #0P #[0 0KP:t' 00{S' w{P c 0KP: :) #0P@AQ#O[0 0K P :[y'@w{ 0KPy: )Z@0S20o2" U%> "Xw{U yK P ]:4# JP0S20S2">" R01Q"Oj0S20YD"""""""""""p@-@M@ P, ``P pQ 0S 0P0 DQP]*`P. PQ0.R  RQ PPf^`P PQAppp!~`P pQs00 |   ama.m.pmp.m.h, @8A-P@U 0U0PUP!A`FRPFq ``IP 0!Eq1pP 02P''O-0PMhP X 8 @4PP0XPhPTP\PlPpPtPxP|Pt x`pl, (` <0+{  +帋 P pPS![Q00<0S 0S 0$>S 0S1h! R 0SL[B 0407+Q !POT d!$ *0C 3S00 F< {{~P 01C /AFPV$ 0P  [ `0% [ P$0SP (Ѝ00Z`F* 0C!< R Q!h! R@, Qp0(0<lx0t|`t0p,0x0lp| (0G \9`00W1<PSQ_ }Q) ^, S*P008$ 0P 1<`@(Q( !hQ0Wp0(0<lt x0|@t p, x lp0|@( P 8$  L A!h! R"0, SS:p0(0<lt x0|`t0p,0x0lp| (0 00W\P<Q`5 LS 0,^0F <P0A  0=R@ ;@ %0@Dh0(00(0000,00,0  F 04P S F"x  RQF#0 SF P\0s F`0d   0 Q0*0^*{ r0s{P T80<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS $R" :"  R#Ό01"?!x"0w$00$0s 00 0o000k0S <\ }H NR LX \ @0DhT 0Rk{{AP{$hE` &0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dS0 {{ {{{{{{`0{0{d 00(0S  R $ R Ÿ\ :6Ÿ$4&60!$ 0Ϡ! !>0T"!!!0C 82 P02@.3H0/#0Ϡ R  " RD#L .@0L  ?8 H D<00 0#!/":N6@ 4$&60.$ 0x.>Â!!!0C@ \0RDL,"΃0,ώ #1 HL  LH @00SP0D 0 0T 0 0[{00v$0S"xl$0S"xc0$0`xq<L`l""""l'.%Q(\)\²0 4080DP @V:($^0Q<P0L 0=RH FH %0h00c @D0D0@ZD0@#:6D 0 0@ . 0Ϡ.>! 0!!!0C" R 0L  Ό D"L!Q@X?#"  ?00 #1?B! H " H D0 L@0S 0\ 004 0 20DP :P0 0<R$0h00c 0D0@CZD0@#:6D 0 0@". 0Ϡ.>! 0!!!0C" R 0L  Ό D""Q@?#"  ?00 #1?B! H " H D0 L@S0 \0#i0  0C0  BQw $0 h00$%S 0dR  Pe@D \DDDQT&@0TP08<1  \0H Q00000S<PT8< F ! 0 F! 0 ! 0S(0S <5@0P : c 0D@Y0D0.:@6 D0% 00@. 0Ϡ.>! 0!!!^0C 1H02 >0.D0LS@/2"́ ?0 0 #1?B!  D0 @0SHL 0Q 004 0F000$02p rp t t   0 RR  0 & F% F RQ#u!F RQF# &f(0S@0$0D00{0<\v=QqH NRL0X\r@0h@0D0D0G0 000$0@0$0= PT#RN RK  \Q?% 8&<0dP(003( :60 0!$Ϡ0! !>)0!!!0C P?00.!?@ /" R  " R D D0 @ 0#1A0H h0 0%L00@0D C00 00S ^0  $0h0 C0000S ^  0@D h0 BQ0 $0h0  vps; 0 *R" O-Mp@$^08l0^0W`0 T' 0 2c1 0嘐0 0<PP/ 0v> 0`0?d000P0?T0 00#?<0 0$$%"P˟$@ 0000  000T ;0h0PM 0TP dP> P? $`Pj0Sg Rdʰ R `ʸ R \ 0 0` 0`@Sdp ?O$@T'pET0}Np0`@dp0 ^0@D 000000 0H0H0PQ0l0X0v^D 0h080P0 PEt PQP0J4 0px|PUpR[S S  h@p| Ux Zt 0Sp0Xl0 Rh0 Rwt [[8 P0:=C 0p00@t0p` VPw x0S ]0t0p00@ 0804p0 h 0P  0| 0ȟx0\ Sv. !0#/!! !./ŠϠ B ǟ0S ,?.Q!Q00#1 ?Xv.C BL\S|  Qxt Pt@] 0 =qp  A 0qp `p V@P0 ?oR20S]00ߍ 0]0h0_qp@p0 T   Q+! !pS@-NRp* h0 P0,Pa000 `0  ZR 0`S 00@ \0h@ \0S 0V0ZS dh `0hP0? T00h80? <0~0h@0? D0u0hH0? L0lX$`\TZP M`\T00}\0S@Tp1ß"bZ2*:##c2S$g\0S- \TP)h<PP  hß嘐dT0CL30@p>L\0h00 `0@4pP8P ? /( Rß&0Q 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 EMqp> @p(pN[#00[0S @㼰p h @p[00@pߍ輰[) [[ʔ 0[0Q  s!P [T00[0S10(` #ΌQ0"c01 2c1@Te[T00X|el)\P(\ ףvɻ %I$@-@ LpT at X00 R 0 R 0Q/  /  Y  DQ 0@-0P S@@H  ^0 S  Q 0#0S0(0/dYH  Q j.0 0#  Q/X00Ɠ\ 0@-pPo> 0@" \ 0 /PXA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPPWA-\@`@DP pH@P0& P @PPVO-@ M `P< p p$0n@0PP P p $ aP pP0S  Ѝz T0 0V T  @0`0STVA-pPQ `@Q *P 0@DDB(000S  i@- M`qPPp* Z 0 0@0S Y0"S# 0p000S0 07/ ЍY0"S1Ds`0pX000S @ Ѝ1Ds( \hhh@-@\ Z@WO-PMU@`  PP2SPS PW Pp B `Xa `L`@ P) 0nS: P= IP0 0Q Q ~P P 0 IB"S0 000P Ѝt0 00 S Ѝ0oSP  @ fpO-BMM@p:Y0d0`  0iOP:vIPP  8\OPn00RhP PC @P`J% 0 PP&p S0P0 0 PPp tU@P" 0 t0dSPkPU0 Pp` pw  0TP~ 2@PP0 PpM P PX VX 00BލЍP/U ` P Wp:X0SL  CP C0H0PP0 p=  CX00 X 0CPT! 0  _0 0rX00 X 0C1gX  0x F#⏟Y00,MX00  0CPBX0p0 @ 0 PuCv5X00 @ 0kCPlLzd@8-{M 0 { .PЍ -{M 0 { PЍ >-{M 0 { PЍ ?0-,M 0 6GPЍ--0$ S   0/ 00|SpSp@-PBU@pW? $0$`0 6/pS p@-PBU@pW? ((0`0 46/pR@-@P 000l3/pdR@-@P 000l3/, Rp@-P?oU20S@p 0 0 P5/Qp@-P`UV00P00S@p$$ 0P5/`TQp@-P?oU20S@p 0 0 P5/Pp@-`P3@PpW(0(@0 p@/Pp@-P @P p$$00 0B3/pXLP-@- M  0qp@,,000G3/ Ѝ@ Ѝ/O@-qp@  000G3/OG-- M` P @K0Sp ЍV4400 MP@:/ OG-- M` P @u0Sp ЍV4400 aP@:/\PN@20!P (///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ /////p`P@0 p`P@0 @-@$ MP#055050%A0!0%P$00$0Ѝ R/,0p@-S@pP($ARp$0S*> $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@XPDM@p, fT@ [a P @: [ [|7$0P$  0@X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S>3 57,05  50Q,0R 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0DR#00C R700C 1L5$0qS<3 57,058`0,0 ?R0@SKT,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQ `0p@ FQ)Q* AR  bQY fQ ?R0@SP  b8@S B;; C c3<2080 S ,0 S,3 5407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS=3 57,05 0 ,0 0bw@0fp`F2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P [P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`W  R `S` 0P0`S<3 57,05 50,0080:Q,3 547,5 5,@p`0%#jo%#jx<%ju-M{0{0Ѝp@-`PM0@ 0, 4/ЍpO-PRM^  `WpP+/a@CP L0  D pp Ѝ@0S 0  D ppS0S Ѝ贠 S0S(0D @p0D @ ppR0SR00R00|<0@-$$@M Ѝ訝O-EM MaX@P+p `E> T0P@(T 0 T0P@T 0 0EAP = =UEލ ЍR00Eލ ЍR00@-@`  pMPMP, /T 0R rR  P    P@0C QЍP  rR 0rSX 0 @, <0 Ѝ@vJR 0 (A-`@ p 0P/S /SP @0 Sp 0 S d8 "Qp@-IMM@`PP p 0: S \0 040pp IލЍpQO00@IލЍpQ00p@-IMM@`PP p 0: S \0 080Dp IލЍpQO00@IލЍpQ00 -{M 0 { PЍ P 80Q 0 08080//p@-@P PP`  PP u |CP  p@J+PPp--00 M (0  ЍЍ/,P --M  Ѝ Ѝ// -@-MO<@P@ 00  0Ѝ@Ѝ/t,0-@- M@OP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$' PY P@ 0 @bYP XOW!,Ѝ000:Q!0P00,Ѝܖ80p@-@P(M ' (Ѝp0 00 ꄕ,p@-`@P&Opp p@p@-P000 0 (M` & (Ѝp(,p@-@@ @  `  @PNpp p@kؔ,p@-(M@PNp & 8 [(Ѝp@-@PP P  ,M` @Np & A,Ѝ8,C-PP,M/  @` p`FV`R V @`0 @T N ,Ѝ00 0:2 0,Ѝԓ80p@-@P(M h& (Ѝp0 00 ꬒ,p@-`@PpNpp p@p@-P000 0 (M` A& (ЍpP,p@-@@ @  `  @PHNpp p@w,p@-(M@P:Np & 8 g(Ѝp@-@PP P  ,M` @ Np % M,Ѝ`, P $ Q80 @-8M80@08 Ѝ880/LL0000 0<gR 80880Ѝ/hP/0@-@0@0 M0S 0000 X0R |0PP h00FCn0T00 Ѝ0D GP0+K,,|dO-3M0PP 0 @0 `0Dp@ P P00U tpp0 0C Z 2ATT00  RF LD@D T]:[ 2 0000~`K bM0 V0 W8 \2ATT 0`Fs 0Ry IM 0  0 B0SH 5M0Ѝ0 V  0  $M ` 0 0pHX;0S2 0  Mv 0 B@ 0 B  BL`FtY  0 B  BL 0 yz L 0 l0S 0 Bc00Ѝ 0 Y]L 00 ꨋ,p@-@PLppp@ 0RS00 /p@-@<0<00P  @Lppp@ $,808 00 Q0R00 /؊,p@-@`PrLpT T   p@pp@-@P\ \  ` @ULpTT  p@p0,O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` Bp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ0000 00w꼇,@-@0@ 000 @T AP80@080蘇@-@P AP80@0800-M  uЍ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U P`? K͌T P? F͌(Z P> F͌(1S tP1> C͌ X bP@> JB͌8W PP= ̌V >P= ^B͌`=@ 0S078d H0P< `P P  P P P P p PL Pp(, qP P`P (aP Px PP'( Q780D0x100C40S000C,0h0Hp0L`P$$0PQw ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @eT, V   @@dqXhP 0Z Piߍ P 1 S  ,00 0! 1S 0D 0| 0p@p000P,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@PぼP`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0弿0P@@X1(@P0崿0P0$001T0孿0PPP1 PX0奿0P0000垿0P0, 0pBPBHPP@ 0T8`<@OH Us,` p@PW 0g1pV@10P00 00Z00 \Z,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UfT0@0p8`<T4 ! , <B B P $@0p8`0[/To0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ セPP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR 0`0 0 0[0ꈰ  0PU 0P  0@TP0 @  0Z 0^ύ @  0`V 0 Jύ @  0X 0Q̍ @  0PU 0P΍ @  0PU 0,0$ 1@,  BU00p@8`< ,   , 0 H T0封.1D|Q*>p@T[ 0p8`< T P H00 0R_ (0Sk ,0P0 P 괆8XC h!(0ST L0!11 @ T p @妼T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@.!(0R1P@PB0P@ T  0PP0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @0T,000 @,0,0Q@ 0@1>PpP`Ź Pp W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `V,0 0@ 0 `Tq$0W1`V W  0 z0P`}0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a P咻U,000 P,0|!0RP0P1`@*0P`. V  0 @ P50 0R80000S / 0p8`4{!*prQ>{ R 81 R 0SЍQ L0 0 0mEl0T0Ѝ!f _d  <0l 0̃ S/ O-C@p`ᜣM[ +(p( $W㮷0CS0SLष3㰷8ⴷP 3 0/# {% 08:x{rHȲ pŸ堒圂8ırtrhÃqlr(rdrq\r`PrTr弁qLrxrDrÃqٵpp<Ե^ѵvε8#˵:ȵ0'ŵ#µ0z# 0彵H#㺵p-㷵-㴵`_㱵|㮵o㫵p㨵r㥵y㢵z㟵{㜵@|㙵h}㖵6A-\`'^`@ p 0\@(`V(PO-8g887M`  `P `0ǟJҭp 7 000 S00 U0S}`p  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0⽴ $Q B q/ 0 ;0 宴p4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3 `} pS 83003 `n p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#s p Sn p  0 s 00bR40 ; 0 p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 p E  `Q q 4 00 0q0cR  0 ` Ѝ 100#?c p; 000#?c pv/` 0 `00! 0/~ 4 00 40 s 00bR 44 `8WpA<QT`0(  0 + 004 00/$O-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 80S0:3S L00D00! 0*u0sO $A0 00PK,p@-@P<ppp@p@-@80800P  @<ppp@J,@- MP7fpP 0@T $T` @@TP  Ѝ<V>0K.P0@P@P@p@-tQ@P)9P $9P 7P10S. (P:  p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@Sp0@S mS 0C;S P   0@S;Co 4O-0lvSp@`MTf` `ZP *T0 ʍr `r 0 I"R (0$00 03S/5PK CT$$5P 9 0XSڈ%$ |%T 0p5"00`4S03`00S5 p0S2 4S, 4S 0t25W】匡Tp2 1Pm 4p2[& LAT# `P P Q@ᯰᬰoH5S4S 4S0?o2ᙰ44Ztx2 PtY  %8P3[x2  8Px2?;~0x2W  8Px278x23Y|2 PV x3|2hЍ0 D p$h l $ <%$(JYi 7P Z 7P [# 7Pp2?;~0p2|20P?0 rr 0"H"Rp2[6odcτ00 0#d#lm0 p _F?2? 0p2ͭY?w 0`w b2aP`0  0 0l+`p@-D@D0@Ppp (0l0m 00 p*`p@-@0@P:#Rt t# R- # 0ppP`p8:p)$dp@-@0@P :Qld^p- pp#P`p  :($dp@-@0@P:#Rt Ó \ "R-- , pp#P`p:pL($p@-0@DPSP @p (0008 <@%8 pp',@-H0H 0@0:#R#R"#0:D'@-`0` 0@ :Q Q- :&@-0 0@ :QQ σ #ppPPo :t&@-0 0@ :QQ σ #pp(PG :%p@-0 0P@ :QQ tà Ãpp#Pp :hp4%@-0 0@ :QQ σ #ppP` :Q|$p@-@0@P:#R  #Rp @8 %8 "R--  pp#P`p:pp8 :#$,@-<@<0@00:3S 00 " @-8@80@00:3S00" @-0 0@ :Q&Q)   0,0̌,͂ $  $ "p"p#4P`S :QL"p@-@0@P0ʃ#R(#R+ P-0 , 0  -0,$0 0$0X0 R0pp#P`p0ʃ#Rp`!dp@-PPP. 0@` :QQ! “Tƒld l pp#P`p :Qpph d0 0 ,0 0 d,@-@ MZ4%qQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#cOP`$< 0 000:P/@-0 000.T0T 00:3S 0@-pp .'P`/X0X 00 :3S 0-pp@- P`/D$0$ 000:#Rs/$0$ 000:#Ru/000 000:#R s30/t(0( 000:#Ru30/40 000:/p@-P0P`M0@0 0ssp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝpht@LA-RBP0@SMq QP 0S `[ 1 P00ppH1p0 Q41 1`p0V0S  d100V0S  034ppK& 03, pp:/%ЍP  QÁP 0:|   000 0010 ` 0@F100ht@,`@-,@@0S-100@-$@@0S100@@-X@M@ 0S Ѝ< 000 00X10 0Ѝ<@-h@M@ 0SЍ E1 0R  (00 Ѝ 71 \@-@B@2@P$MQ :cVT0r3ppp%0Saqp 0SO1p0S@ 0  B0*1`00|PM 1@ 300 R 8 C 300 X30"0 B :3,pp4 BP`$Ѝ0`00|P @ 0 0R` 00 `a000T @8 300 0PhH0pC- M P  9V L`/M<0`00:3S \  Ѝp  0 000:3S/I8T0T 00:3S 03@-pp$P`/@-<0< 00 03, ppP`@-808 00034pp$P`P0@-PPP M* 0Q0@00xP 00 02000*C" Ѝ0|P H00 020000*! Ѝ0h/0@- 0 @P0:R M# P P&tP 000 20! Ѝ0`P D000,PP Ѝ0h0 000:$!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@Tp\#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-呢Pp4S-`@PP3@ 0 00p) ,u4, [ 0 " z' 0 b lЍB0  9lЍOM0O-:$M$pdZ0  r$ O'PUv P0p 0 p + Vp(:0PSH7 0  ᑡ@P$Ѝ0SH S4 SpV  ,p0004S$ЍOAp @0S S SpU  I,p`Fp@0SF0Vᨀ *HVp P @FXp  +p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ &TP/ { @p ` ̠PPE @0S 0  `PЍ` D  P 4A " 2Ѝ @0 0HP0  0 /404 000S :P /<0<0 0 0S :P /P404 000S :P /<0<0 0 0S :P /404 000S :P /t-DD 0\ ʌP 0 ,@-|0| 00@T 0J#4R B0pQ 7@.P l @808 000S :P j/HD0D 000SP:P4@//000 000S :P /L0L 000S :P @-p @g/lA-0 00pW* Z3$SP! #R`@4Sp`3@Tv ArB0tQ 6A.. -0    p$000 000S :P [/O-00 0 MX% p `P 0 ᢟp @ᖜP  0 P喟p@ 0 5@ Ԟ Ѝ@P  P /p@-JP 3S P`4`絞30PV寞  0s3 S 0lP 2 $R 0X0S 0D3 20X #$04p03pp贠Hp@-jP F3S @P4Pq30@Sp@jA-`Pf JSU?sW< @P3$S3 SW*0N, SsH0S0 WP3PSSpP4S{pp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `P LTL VW PT VW  P000S<080 ޞ0 0 TxO-($Z Ap`P᚞P@8P ( (T2垞P* T 唞P 0 ( @00 (0WXT P  RX8 @(  !(@0`x @-? p0   0 `T1@A pP`U@  0000 8A- Q@PP% pW# 0 0S0!,000 R   R   R  P  4`T `TX *P Q Sp  QW02p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S aP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pgp H0H 000S P@ ?# Q@ 080//,(0( 00Q0/X,(0( 00Q0t/ ,p@-P0P0 0@R`  P@ ,0H1`00 0 0 0"U,00pW$  0$ 0 00 0(p PEU` 0 ؗP@@p  ph" Ѝ-,0 (0 M0 Ѝ,- M0 ЍC-@P M(p, P00S 2`0 GR  0 O@0L"Lb ``8  0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00&0   0T S00% , W10X0PXp T0pGR Wڠ`P`W 0  pP Ѝ80  080 000 S0CpC#p@-`@P6!pp 0p@- M Ѝp@-@T T  M` @P!p 0 Ѝp8,l l0 00S X  8Q Q @ ,@ /&R//,H H0 00S 4  !R@ ,@ //T,`0P0 T 0008!R !R @0<@0/6S//<0P0 0 0001S@0<@0//l0l 000S X *" (Q Q @ ,@ /&R//<,$0$ 000S @ /,P X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` PG  @ D000T $000S0`H0H 0 ?o20QQP T//`,000 00 0RPT00/,A-`@P`$ 80 ! QP}p~ PeS 800PU b 000S0`0 00 ,?o20SRPT //0PPT00/,0, 0000P/P/,0, 0000P/P/PO-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !! pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!pW`YHp0Sa>0 S;,0 0D | 0 00P0q}pI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPYx0 00,p@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CF40 00,\000S  Q R P (!00//ؕ( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝ(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0谒O-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dpʒ `| tp Ѝ@0 S RQ Ѝ,9P d,020P 00X p  ``F , B,(`aaA0  T p0D`4P  Fp`,004@ 0T` p0Du@U   PB  0SQ 0 0PC 0$ 0\R =@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP ,PQ8 0 /$ $\/ P/|PQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ETpL @10 0 QT$ D 0R U EBp: x0 0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q(,PQp@-P0P`0*Â$ @P uT00PU pxp 0QDP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0S0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4zڌ`@Ps |{툰 {Pp,p  PP0_ Y4% 80!S0` ``pX08 0 T``0a$$ <@0H0|08 @!\08 `0d0h0l0p0 Ѝ܍P4- 㻌P' 0*Q- Q80 SpG V P  PʫR Ѝ ߎݎێَ@ Ѝю  A-0QM@PP(C p`QAR   B P1 \.X) P$,P?PP H0 DH00R00D p0$`P!b@0SЍPЍܾ@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI ˎL1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @x$0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0$,@-44@M00 MЍ耺QP-D00M  ( @05Ѝ0P8 /00@-MN  P@N000 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AAlO-PDM4 (0 X0,00S80  S l0( S࠳ࠣS࠳00CS࠳h ^@4 @D,  p04\00\0T00S@t80<80808080ql00s0SK0Cs0p008 P(@T ^700qQ000, ,0 (0q`0s0S#, ,  P(p@@^ @P8@hPuPC ^hP4@N~@t@~PpH~^ ( npH^, 1 00T<08 <`! 0!1a S 1  0Cs020Cs0Sq 80rD 0S 1 @t@PT 0uPs08<` 00 000 h00 h (000 0 000CQ00( @ 0 0AP8 h(A^ (  h   BQ 8000c(0 pRp 00(0 R 00SX 000 0 1$ 0S0 !1!0$1Ḁ{0Cs020Cs0Sq D 0Sp1L0|100 pC 8000` 0D0 !L| p. 00MDЍhCpPp4p 00 (pQS 00ã080@0808@8p@@pDЍ [P [M 80&PU0,`A0s0 ,pNq ,p  B   S ^030S@;A-U5P`0%@00?C5Mp 00TP 50 05 0@0@0@0  00P P50 0@5 0@0@0@0  00P 40 04 0@0@0@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0y @0;@0  00P L30 0h @0:@0  00P 30 0W @0:@0  00 P 20 0F @09@0  00P 20 05 @09@0  00P <20 0$ @0;@0 004P 10 0 @00@0 00P 10 0 @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@000 @~h\|x0@-h@h0@P M006S 0  Ѝ0(0 000  Ѝ0@v$hp@-tAPQ@`7 Q`1000S 1Sڸ0  @T @TU p0 0X pp1S1&0C( s00B0Cs0SBB 1Sڸ0l0 00:h2P000S j @T 0 0ꤨx -M 0ЍC-P@ p$P `?LH\/ ONI ^pGPE ࠡPJ@$ @ 0C@-B2@`P0 M@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0Tx0 @00P@0 Ph0p PX0 0L 0` @08@0  0pP4h|~x~\A-@`PpiTV,1 @ 0 @A O-/dM ?, 0L00*#Rt,/@ T8  (   ` (`RU(080@80@ @ ?0Sc,?@8? 0@000D L00  0SF (@@000h0S80@0804 L00S8>, 0(0\,0!0 s0  S^LPIL00"? @ t@T,0Q0@t@T80(00S&L00S= ( R , LP S800,0 1-$00Q$0 0\( 0qQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00ap 0SL01H@804 0,0000[,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YpH @ R T0 00P P 00 SPR P)!R00S 00P ɟ`V0 0CSp SqVp4 0 AS0 S P0P ` P R  0R  `9,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sj9, 0@000h0S(00S8000S3 80 ;8, 0`V 00Pm0 0CS<0 HD) D<0NN Œ Č Ȍ N LL\oɟ`VWY8 T0V T@00D R 0 R PPZy ! YR  pY $Re  0E0 p0]   0E  @000$R , 7@  a@000!R~ 8x6 8000Vr00C000C0'P6, 00S?0X *1h"0 @, 860H 0  8 0P4, e `p$t00S000 @0p 1P11qWX5X0 v@00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꀄ 10&0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0ᬔP0P0S^L L00S3(080 w 800  L,,20 p`dЍPL008 0080@080' R d1SdЍ( 0 0=x \P1, `p0, Q0A0Ո8! ,\PY @@YP 2P0@, QcJ   8@,@ APX@T `P `pꄣhflex`^t ]\dTSXSRQhPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0}8 0.00@ 0C(@ 0 0800  } 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pe d1Sb , 4@  TP:X X@ P S@DT H HH E@E0 0: 80R0,`0C 0B0X00@P `0 40 0E00Q PU U R0 R  X R RR)0SC 0 R$  9, @` 0  `f@0 0p0 `Y00P d 0@` 00 B0X P0 P<00 p 0 P0+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`rUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` K0  `@0 0p>0 `00P  .0@` 00 B0 "P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 1@000=, ,>@ 0`C000` @000tW $ v 0 U@`= 0 0LfP4Pj @00 pWU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`*UpH50S0X0S* 0 0 0 0, @p@0 0H`U~0 0 0 @000jP$pPd;hGp@-P@PPM/ 0`0 R    80x t00 0 000P 0 Ѝp80 @000! B/ 0C?0Ѝp蠂0 00괁,C-鬐M@P 048! \` d0hlp`PpPi80  D000 0 B0C 0/? 0ЍЍ茁@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  謀0 00x, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `~Vp`M|0P 0@PUpT` @~T @pp  ! !@-@P@v~T R/A-p0,SP` @T @`~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S eP$00C$0IKO-:z0Mx*p$P( ,pP H*00\c S@@s  nRXal HR @@i`40IS0c0@T ^OoB@TP AA  RR0|)\ 0  |  bR\ H)` R&8) R! CP'I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPf S ^\ X( 00Q 880, 0,4(0RJ0H 0@0' $P)0S700S00l0S# 0 S , 40R#0l P, 0S ~0P0$@P$@70 RЍ $70( U$(00 SBFf@`< & (00 S4$&P0C (00xP0S  CP$00C$0'@`&  T60,@(@0 R 5060, 40RpfF`@ 0 0, $P,04 CS (@Re 0 KRaڠ5%0 p p @d% 0(`Z kq`nR `F%` V ,00P0S 0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z p<40,04$!,1010y d 4`000P ^$ $@$#@ P(@h0 Ru ,,Zq  P+ p# J d# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R ; P $@@ lP "  20,  , o40 S _ ) @20$ ܀(B@0S  0P0$ 0B$0$܀ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0(A@0S 0P0$ 0B$0 @,0DK{J(J`dIDIHHHHH(HGGlGhGPGF|F`FEEExD>4>=<<<<@- ,(4 00 <@-  ,(4 00;O-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0 'tƒ A\ B\ ^tƒ    //c,1P0= 00` P7ʀ :l“3\0 /@ P 0000CS0 00000000000000000/|b$@-@P@M&\\ Y #3t P P 00 '000 0vЍXah`P -P\P Y͌# /`@-00  |00S d d0 8=0!D00 R 0`P/p/@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\ h0`_..آ0 000:h/ ^p@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &Ѝp]hT02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R R, !p@ '( V@ Ѝ1=00QM0SJ\1p20lP10 0O0剑Q:20h1=00Q!0S0p20 00 0/0剑Q:20t 00 00`0pU0!Q 00pI0!Q ,]h0 000/Zp@-x0x 000@00CS0 S p0 S P00pyPp0Z0p@-0CS@0 S p0 S P00p[Pp0p@-,0, 000P?v@pYp@-P5v@p0 000S  @-@J Q P\,Q    @/PY,0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0P`Pp@ W uP 0p#0C S-0 00$Ѝ*T0 S80  *2 0@ᖩ @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p rPP+  U  P `X(0 SCJXC0 0(0C\00C"^$Ѝ X TP P  D0|0ap H0@D002 T `V ` tV `` P|ꠛhWL0 00S,p@-@Pppp@p@-@80800P  @ppp@XS,O-`6lM0@P,0 j Q 0pt`Pa Prq0P0[ W   0<0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0? 0005 000p`P0 @R  <0T R8 2 0<00800C?80ttP0`FntPY00` et, t480pP p)K 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!p! Bp G" RX :     HU pG< S8 8 (P4`< @p$0,0 1400H0@0 @0 0D+PU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0? s2, 8 P I000 0P8p0i08 k800C?80sP0pGS00C0`FQsP00C00p000P0 0PS08 B! Wf 0 0H000尡pG WD0|0pcrlЍ80< p` 0<0T pR0`<0 yPo 08HrlЍ`{P0 0@0 0}00 P00 Gr R0S0 0?P4/ZXЍ G\00r R0S@0p0pP4/pWJ$Q# @-@ RM !R "R pPĜ\  00@bЍ/0Q # @-  MS S PpP$R ,@8Ѝ/G@-0@,M @ Ѝ@-@044M0 @ Ѝ8lF0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LN!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   $FQO-M  m EPP@ 0 p % p 0 5S p/ Ą`@Ḵp,S 0 0  C@00 S  Qr%S+0@ GS0  %@0iP@0@ `fv` 00#1.Q0*Q 0S @0 SE^0 @00% d dP00 @0@00 S*L0 0 r 0   0 0  < @ 0D@0 @00 S^4o 00PЍ0 S0^ ` 00 @@D"0 C0 0 S^ 00000 h0!@ @0 @0g0 S!00sp pp00p 00p 0@p p0, T \0@410 0rp 0  0@ 0ppTp0 S\R W' I00 S0   n  00w0`f Sv` 0S0\S 0 Sa0 00 $C%p%c%+%c@$</>p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp\0=p \ ( l A-@0MS0D0@!0@P0S? Y 0 !~|!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0Ѝ<NgA-@0MS0D0@!0@p0SE  0 1!^\RN  L !0 120B QRP `0 pW$P@TP 0nS>PЍ"0ЍЍL;kL>G-`0MS00! 0p0S[  0 `1` I $L0!b!bIO4ቐ გ1c1cL0 0#3cl 10B AP P)0< X" pW $@r0sSP @WXV @T mPHPPЍЍ9-?L~*S0 O-TM1lj`PN ,$  #0 : 0j @P 5 U000P 0:Z @P 0S  R 0X F #X =X =P 0000phP, p WZp  00Y*S k`P V30  Z l0S l0q,0@  0tß $ 112cA112c B LL00#0#pr!qpC 00P0q0pL@B P@=rH`@X 0Sp  l r0` lh@X0`0TЍp[  0 "$ L衟‚  H !1 2ਁሂBP㈁L 00@>p.  0d `1` $L $$H0!b4!b Lƒ1c$1c 0L 0 00 壀((!h!b!CyP㈁ 0tS0cS0Spp~G0@00 p< p0S `x kH|#, Ngݬ!kLy>-?L0x*SA-P`p0\ %\0@pS sS lS P0\UUW 000@1CP0PCV` 1E!00O-̟qM PQ P` 00S040 p$ z l@H pZ 1  RS G^Z P P 4 Z %Z%Z400 R,:@FjP 400@,%,`+P p` H˟,@ 0:ZAZ JQ  0JPPp0-00 >Z A0Js =R* =S00 C?QRp  Wp1PW -.R0 XZD cJqQ   Rp~ PA0JlRpY PA0Ja0Js Rq11OSt00qߍ|I@[/DhP 00040;hP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, T*R 0 ᭀp 40P040 P PPp1  \1SE 0C111SB Z0! Jr 2( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a d7@D!&J0AqVZ ຠ `OT` a 1l!01ATe @DAAAa0Js RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RU 1h BY!r #P`!`1`Q,*P  0p^ 40040i10Js Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S%   ?R ;R P0S %S0 01S2 0C11AT/ #Q,,*P  4 @ , 40,0PPp1BA0JS30J1OS!l!011@00@`:hPv 400`,Vp p2.h Pj 400p, i000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT> `V Ო```&``VP``P``ý`@oobP``V 2``@Q AOQ AAT @D1!ZAo!᪢Vp p2gP 400p,PZ00!Jo0 0媢0`0001&J0GZ @po0`00000-0 0|@V``pT@`V`pO@`fpK@opG`@pCoo@bp>|1~'  V8l-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/LA-PQp@M 0S XD fP (`V! 0v0+ V T 00  PP0T0j 00ЍT 0m 0 0 R T !T|\^P0S T`@   $9yp 0S R s0r (0 000ST00P ] p0 (0P ] p0 0`ͭTH,ƭ8X~~x~ht@h}}}h}T}0R @-M@0@S  ЍA-pPP U) W@`TV 0PS |@P0DDV  >P 6oA-PR pQ h00@ `P % P P |# 0 ES  fP  F0 000Q  0 R0 R   Q PAuPP0 QV \`Q  0S  0 S o W0C  s0_S0S  0 S Q V0Cs0S PUD 0$XPFPF " X< $0 Ž20nP; sPG fPY P?oR20S 0 0qQ :%eP NC! ePJ<ePL5$ PP 2f$P.f dP$$ W PP?o2?    0S V P(C-p|Q@x!P`M0 J| P ^00[0S8 @Ѝ|PP  p  0p R 0S 0P@ P@ @Ѝ 0 P LPP+V P *>PP004xx@O-M Mp:S$0S:S@ 0PS:S``E[ P!*  `0  oP 0P:S ۍ Ѝ@ۍ ЍC-8B82M@M0`PpP9 0/SH @P S0@IeT PI A@4aP 0 ۍЍCDV0P  L v{P"0 @\ۍЍCxB0P 0S/S יP @ eT0 ۍЍC0  PۍЍ p 0dYX H0H 0 (04ۍЍ,0, 0 04LvuPuPt,tG-p`@P  Y0@dT  OP @\PPHP P @T  @0G(-@-@ M00 Ѝ@ Ѝ/= Ѝ@ Ѝ/@-@~d|dzd@xdvd td0rd@od 0p@-PS@:pS cP!p b @-Q @TnR  sR) fR Q \' sR R\  Q  0 ^Q  R Q A- @X p`fS@X P0P@0@nS sS@X@@^ 0 0S00@PA-P% Ppp R,R    0S,S@Ba`P  9 5.`00ppp@ꠑG-\rp@`PMP 4pWV*nU< sUZ fUH0D Y+R. @bP" H0D@pH0@0 H0H0nUp@0 H PL sU: fU% L00L0 @[P @P a 0S0000Y 00 H0@ H00 (,00H0@, H0@0H0(H0, 0H0 0@ SH0 $H00H0$$PH00H0HO-M 9PY p 2pX` +`0( 80H00 `0P@^  P UpY  LX`  D R , R < R! L R* JЍP   ', R P   < R P   0 L R `P0 0 @0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00A-`p PPU@R `aP !0峀0 V00pp   0  0 0P_O-`0@ $M 0&P pbPpUP5  P$  a0P  0_a pP|@P P @@aPa $Ѝ ?aa0,P pU 0$0(0,0# @ 0S00sPa PU Y  @RPU  @RPU R@a0LP@U@0D0H0L07 pfS&p @P" PU!  @0nS sSpY@@pp 0p 0 _a $Ѝ(TtVHoV@plXA-Pp ``V@R b`P A0峀0 00P00 0  0 P^0A-P pW@`R 4`P 0` 00P 00 0P^0O-LM<  <+, , 0XpP |@P0|0`P 00ZPzT P:PzP_PP p pP V 0T 0 , P`4 ` 0100#$090400S% $ .S  ROS> =FpP 00p`v= <00P5 P 00 R,P `z`LЍ#"@P= pp`v ,0 S Q0S Q0TS 0 0000000l P0(-Z80]80 R(:`PLЍS@0@SI p@t`00 0 0f0 ^PYo (@[ 0 [P p;  )\[  R-Y %\^[\= @[0P0&0GS1v  0P (Y0 KrQ40E K/RS  [@ [l&,0  @ 00@,&,0  M p00 DUD0 0S)P Pm 0 i 0SZ v0 j 000  00 n0PB p (^801` Q  Q 0S00  p    D00 ?[}$v 0 S00P0@ P  0BP,  0  80o Y80! [0@B PT@@p' 0 000 0s0,P (a@p@tkp@t< ,0 Sg Q0S ` QF\RPeT` PP0 x|400 F((mP00fPp@t0n <00QL Q 0G R0 x S0 0WP680 M00 0S00 P   0pd0  < ` 00 00Pp P0t~4~|||{t{H{({P/$P00//{0@-MP00 f 0^\!1l!1"b2cNL 0@@0#@B!A@C0PЍ0赁Nd{g P0`0K?//zp@-MP0 + 0nPel b N00PEK 28@0#AB@C1dLPЍpkLz>$0P00?//zp@-M`0  P0el`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$C!d!b8A@C1PЍp-?Ld*S$yp@-0P0M`2@P 0Ѝp], 0 0S Q20Ѝp G- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00lL@-@P \\\ \$\,\\,00!R  !, 001/ 001P/ P/@--@O X@X0@0@0s H PJI HH @Lp@--(M C@3`0 @@PR  k{UF{{!00 (ЍpPm P 300 U  {kUk!00 PS ~P 0300 U 2 0"P  0cP0z200{kUk 0P PA  0cP0wʜ200U 0d"|2|2"P  0cP0P200U 0 0"P  0cP0200U 0 P  0cP0100^U ! 0"1"JP{  k0cP0Gd100U 0I B \0cP0f,100U 0V"0"dPS  I0cP0a000U 0Q"0"QPP  60cP0ʜ000U 0u"d0">P  # ??@LPGǬ`x,ȉp0cP0Y,000U 0 0" P:  0cP0t00I? 00Ō0U"f P  0cP000E?{kUk 0] P  0cP0!t30A?{kUk 0t P&  0cP0,300U 0"3"P  0cP0o20t0U 0_"2"P  0cP0ʠ20l0U 0"|2"P  {0cP0iX2000U 0Y"`2"Ps  h0cP0:200y{U{ 0 qP+  V0cP010h{U{ 0  `P  E0cP0Aʌ10W?U 01"X1"MP  20cP02D100uU 0 ;P  0cP010S?U 0"0"(P  0cP0Mʸ00\0U 0="x0"PT  0cP0p00P0U 0"\0"P  $؈nj@`І<PGl0cP0Z,00@0U 0J"D0"P  0cP0p00O? 00U"g P  0cP0ʸ00M? 00U"  P  0cP0%10I?*{kRF{U{ 0O P  0cP0D30l0U 0"`3"P  p0cP020d0U 0"3"xP  ]0cP0ʴ20\0U 0"2"eP  J0cP0xl20S?U 0h"T2"RPe  70cP0i(20Q? 00U" ?P  $0cP010d0 00U" ,P  0cP0ʘ10E?Xk{U{ 0 P  0cP0P10t0U 0"$1"P}  0cP 010 00U 0T P  0cP0ʼ00W?U 0s"0"P  0cP0t00P0U 0b P  ȃ|0GLdPǸd$~~~L~0cP0PP00\0 00U"& P  0cP0Wʘ00d0U 0G"0"P6  l0cP000l0 00U" tP  YnP  S,100 $101U"7"00 Ch100t10K?Q10G?c 1U"!"00 -10|0100 1U"x"00 100i 2U""00 2080{kUk!00 30Y?300 x3U""00 X30T0L30N?? <3U"i!00 30p0Z 2U""00 20U?20R? 2U"!00 20`020= t2U"J!00 h20h0;\200P20C? 2U"!00 20p0200: 1U"ru!00 10U?c 1U"g"00 s10H010K? T1U"U!00 ah10`0\10h0; 1U"C"00 O(10Y?z 0U"T5!00 A00|0E00`000G?*00T0s00(0J \0U"!00 #00h0000 ~~}}}L}<}}||||d|T||{{{{T{{ {zzzzz{kUk!00 300 3U""00 300{kUk=!00 P300.D300= D3"ZI I  3"UM"00 2009{kUk!00 200x{kUk!00 20p04"00 "00 P200D200A I PI : S@ ~m"00 yh"00 tc!00 o^!00 jkkW!00 cR"00 ^M"00 YH!00 TC"00 O>"00 J9"00 E4!00 @kk-!00 9("00 40Sj !00 ,0SE !00 $0S !00 0S !00 )P  0S !00 -DT! @yyly\yyxxXxHx0S !00 0S "00 0S !00 0Sm "00 0S5 !00 0S  "00 0S !00 0S9 !00 0S !00 0S !00 0S !00 0SI !00 0S !00 0S {!00 0S s!00 0S k!00 w0S c!00 o0S [!00 g0S S"00 _0S K"00 W0S C!00 O0S ;!00 G0S 3!00 ?0S +"00 70S #!00 / 03H "}P !H H  3"0S# !00 0S !00 `300T300%"00 "00 "00 "00 "00 "00 "00 "00 "00 "00 "00 I I "X2"T2L0 0 2(0 0u|20 0z ;T20 0k,20 0u20 01t0 0 1P0 01,0 0 d10 0@<100 %H!00 T10 0U00 0[0h0 0*?Lr0P  A,00040q@aR 7 8S1R  1PA-@ 0`S ! ($ R  3/PP! p 0P@8p0P$0(3/p@  $ 4  (0 0/84?0 P 0S $0S 0S P? @4@P/Q < @ Q@ P-@<!,< /O-/? 0000d?0$ R'4000  0p@T>0U 0PEt@T$0Sp0  0@p>0U 0PEt@T$0Sw  '$   0   0s 0@$ pR}pd=0Uq 0PEt@T7p0pp@,=00SX `<0000CSU0S4 < 007s@ Q<0F(0 S0(0a@< 03Zpx<0U0 0PEt@Tw0Sp @<000<0LQcD0*; <0\0T  0T :J0PEt 0@S@U 0P0,P0` 0U@@ ?N?P?5?dJ?M?aH?A?L?_(_ ^p]\:?;?0p0T0P0?0X00 p0tP 400 @v 50>040 7?R7@0p 0W 00pl50800X505l 06^[PEt@TU*U0 C00S_ 0 0006Q0 0S @0p 07s0D@CqW$0(\$ PEt 0@\-U ؂?606L0 0sU0P7s@De 0@D'q@ph0dlX70u0؂7sP0D˂7{D @C 0` 00P00X⽿p0P0tp0 (0$P$(0/ 80O?080i80}?080 0sSR: @3 0@|0-$9@0F( \ p T d \ h P x90V?090f@ p0S90=.p@-@ PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  , )0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04K0p0 p0 0 0 30 Ѝl0Spp l0@@@ ~S???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPU{@ 0!(3/`Px !8PUE  ( 0(3/PP00 d  @T 0  \!IP S>0Rp *p  BS>00p00 898P`oRS B P T U B T p 0BpP00  @T 0  d P S>0Rp:oRpS. 0A Pp $0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰX 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00pJ\S0b60s0P0X 0 C∀0S 0X\!\ ! 10 T" Ta T 00,0(00040080 00 0 00C$0 B U@\ q W3> BJ  p Wۄ2  B37RN q`36 B Lq`36 BC@g  @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  \X8@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\j \b$`\``$(@$$, V,(`@  $$(@$$, VpLF$(0$00W\(0`@]mHQ???GPELD, 0qR0C0s0\0@0qR0C0s0\00 6/O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0C ,0 S R 0 0I000S&  0 0S0  0S,0SQ: R-,0S  R0 0[00$0S,   0$ 0S0  0S,0SQ: R 0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00L6P0t,0S*  R0 B000, g00R  0Q0B0SZ 000#400q00*0SB*0 B000 B00,R 50 00+Zt 6l8&`6&6 &!909&tl0I0Qtl0" YJt0SW :W㴖 6S \0l S 8 B0 l0\000S\ R8 C0 l0\000SꄣZt0(l 8`R B  ^H 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l St0 SW S Sl 8`g00&0  W g0S~[0 B00O ^ ^  [ [ [  [ [  [  [ KoP᫲[@ `S`1`05:P0@&ƅ&s0 !ƅ0 01I>  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\000S8#  #800#"0 |hB 0 0 0 0 0 S0 S00ӈ R01q 00  R000 0C0%*W6B &R \ R80l0 C& 0 B )0<PL0DC0C Pt0*SVyl0\06^0Sxu\0l S 8 B0S l0\0L00S20]\ R80l0 CG-`<pPVq@PD Q00V0SK0儐S< (0s T Y 1@0@!A00000 |0 `Zp* 0S,t l00\ R&6S S L D 0 BⲐC Ȗ060@D0 0!1 0Rp pPWxVp@-@PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS $0Sw wpVnV`F0HSw0FSRs WqZoFo[㩒YhV 0!( `3/@Pm ! 0*@ȁ1PXL@TA 0`, `4(P6/ `,8(6/ `L@(6/0jD 0(Ė3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fp00$0`(0 y Ѝ8 80  000"th-M 0 >ЍA-PU| 0`0@ 0S@  00 0!(3/@P_ !gx!@ 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P7 @ R4 D SR0 Z&86@S@, l0ƕ 0CS vL DD q 00C h6&a&-> 0$+0;/ O-Q$M R0 t 0S!q"$!@P`p,ß  0+0* @$)z0(!y0qx0aq0t0@AP1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ 0(@0S 0P0Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4@H QPQ paQ"$&P%uPQ@D"T% r  Q% "r Q Q T% "r  Q% "r a Q d& "r QQ&T% p!T%$"C0S |0!qS"$!$ЍL!Q1C1@`pv     l 8 d @-PQ(0' `p@p`P  !1   0" C  P0` @-PQ(0' `p@p`P  !1   0" C  P0` 0@-R0@14P 0, C @$!0 G-pS=0`@: 1䠟P @Op  !$0. L #@Op 0S1H   0`" C    G-pS=0`@: 1䠟P @Op  !$0. L #@Op 0S1H   0`" C    RG- pph Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G.7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq(S(p@-P@ 0ut |0%(b$,7&c2L <^0 L NP N@< S@@0 #406 0C00k6 &S0k. 6ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pp5 DMP[Q @!M080I j\PĖ PĆ0\@ CSP$ R(㨆 pPp 0Q= q[P$尐6H0C6RƆp 0€00@ jX0@PQ- 0ඟ0 pJ`{P09 `;ST`+0HAX{T4T+ pQ}Qp0Wq 20|~6{`0,Z`;p HT$@P;0>0 0 0p夾0S01Y0嵏  0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00Q0 0S@\ R @02^02N00 R0@\DЍW@  xP 01LY 1R 6 G2#6pP^p N0j 0=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-M\PPRf!   `0  +M @Nk@^ᶰZ἖p S 1>@0ny SwpFP0N`ppP`p%TPVPeTEtp漖0@P0dy Swp @0`pp0`p#406@D@0cUSupNT~F0PDt@`@`@@0P#4``0F0d^~p@D[pF5 [0@Q p[ ` Q^kp徠἖0pj9Ys0pJ 0 00#4 0编0iQq0 `V0἖pW 0@S p`W0@T P`㶰[ Y0ʀ p ^C @0@Pc UYuP@ 0PpP0CPpP%TPV0PeTEt@ S6`F3@Ps0kp0p0@0P#4pp06[@cVd 0C`6A0@Qe pW `r 0@P9pd Ws0 @p0@D0p0#406@0cUSu0 TFP `FPDt@k>p@p@@P.pp[@nVd N` 0@Q# p[20@S P`㶰gtwp@ p@ 0T0 `W2 @p0@SЍ༖N~C[0k@6 N~4[@k0F| P`㶰00@S P`㶰%0@S P`㶰0T 0 i p@` 0 `aO-ʀ6MS 3003`003k^0 0300300! A@b9 Ts0@p000@p#406 B 0c^&6S0@ 编0$` pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಀAph>Ys0H000#4060cWsw0 p0@sW `D Br @g>Ts0=@000@#406pGp0cR#6 SvekN&0Pn2Rs0 P`0`00 @#4PP0&N0bQq0 k0&Ѝ 0&;p0v7 dTD8,0 00@-( ;0,8&̀J[ k^$ˀ0   G)0S0 0xS0 0LSZ=I( , &&0/A-@ k΀`P s0! Qr p p "$  aS2s Ak> u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ MJ, R 0Ip&]CP+(+90N  q/ ! R7@P j   Q& R \3 "[k. Z0-q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦| qk>0#40缦0j\3s0 J Z㼦yzk>0#40缦0j J\3 Zs0漦@|qk>0#40缦0j\3s JXM⼦k> / ! Zq ! 缦jR!r J^ἦ ` ] J  \ P+R +R ,RE R  Q ,Q3 "[Q6k S op3 s0000 #406 cPp 0Ck N.V6 0G. 0S0 0xS0   0LSZ=00IX  && Ѝ R3 "&][Pj 0 ЍO y: Zs0漦)@q:s::s0 r :s0q#r 0{  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P p@0 C`0@2>TUT @%P )%/@- MP`p)@P @²   0>p P , @P  Ѝ 0@0 Ѝ0@00@|,T  Ѝp@-P(@P @呲@pϸ 00p@-@(0P 0倲000辸 00廸p@-MP`(@P @ @k0 0=p @,@Ѝp蠸0@7,T @Ѝp0p@-S P@0 C`20@=T 0 p-%0P@p$yara0p@-S P@0 C` 0@o=T\ 0 p%0P@pb$tcid0S p@-`@0 CP0@J=T @6pp/0S p@-P@0 C`0@/=T $,0P@p'$p/yara0S p@-P@0 C`0@ =T $,0P@p$p/tcid0@- M@ =p  P Ѝ0ڷ Ѝ0ַ0 0 Ѝ00@- M@ <p  < P Ѝ0 Ѝ0輷0 0 Ѝ0yara0@- M@ <p  < uP Ѝ0襷 Ѝ0衷0 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@P9$0PPptcidp@-@P-$$0P p00ploobp@-P`@P  ;0@t#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@% @-@@B @-@@[ @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@y@,@-@s@C@-@m@Z@-@g@sp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P`T @P  0@"pp@-P`B @P  {0@"pp@-P0`P. @P  g0@"pp@-P` @P  U0@"pp@-P` @P  C0@|"pp@-P` @P  10@j"pp@-P` @P  0@X"pp@-P0`P @P   0@D"pp@-P` @P  0@2"pp@-P` @P  0@ "pp@-P` @P  0@"pp@-P` @P  0@!pp@-P0`P @P  0@!pp@-P`| @P  0@!pp@-P`j @P  0@!pp@-P`X @P  y0@!pp@-P`F @P  g0@!pp@-P0`P2 @P  S0@!pp@-P@#"(0P p 0P 0pgntsp@-P`@P  00@i!pp@-P`@P  0@X!pp@-`P@!<P p P U patadp@-P`@P  0@.!pp@-P`@P  0@!pA-P@!X0P pA&`P  P `(gntsp@-Pc@!(0P p0P 0pgntsp@-P` @P  0@ pp@-P`@P  0@ p@-@R 0@ p@-@PW!$0P p00ploobp@-P`@P  0@ pp@-P@P 0@ p@-@y@ @-@s@ @-@m@ @-@g@ @-@a@1 @-@[@@ @-@U@] @-@O@v @-@I@ @-@C@ @-@=@ @-@7@ @-@1@ @-@+@ @-@%@ @-@@. @-@@G @-@@^ @-@ @u @-@@ p@-P`@P  0@ pp@-P@P Q0@pp@-P`q@P  0@pp@-P`@P /0@pp@-P`O@P  0@pp@-P>@P  0@pp@-P`-@P  0@pp@-P@P 0@pp@-P0`P @P  0@{pp@-P0P@P 0@ipp@-P`@P  p0@Wpp@-P@P 0@Gpp@-P`@P  N0@5pp@-P@P 0@%pp@-P`@P  ,0@pp@-P@P _0@pp@-P`@P   0@pp@-Pn@P =0@pp@-P0`P[@P  0@pp@-P0PH@P 0@pp@-P`O@P  0@p p@-P=@P 0@pp@-P`,@P  0@p p@-P@P 0@upp@-P` @P  |0@cp p@-P@P 0@Rpp@-P`@P  Y0@@p p@-P@P 0@/pp@-P0`P@P  40@pp@-P0P@P e0@ pp@-P`@P  0@p p@-P@P B0@pp@-P`z@P  0@p p@-Ph@P 0@pp@-P`W@P  0@p p@-PE@P 0@pp@-P`4@P  0@p p@-P"@P 0@}pp@-P0`P@P  0@ipp@-P0P@P 0@Wpp@-PA@(0P p0P 0pgntsp@-P`y@P  M0@4pp@-Pi@P 0@%pp@-P`_@P  -0@pp@-PO@P a0@pp@-`P@<P pP U patadp@-P`D@P  0@pp@-P`S@P  0@pp@-P!@P 0@pp@-P2@P 0@pA-P@@X0P 2p!`P  IP `$gntsp@-Pu@"(0P p0P 0pgntsp@-P`@P  0@hpp@-P@P 0@Ypp@-P`@P  a0@Hpp@-P@P 0@9p@-@Q 0@/@-@R >0@%p@-@0 P ##p@PPw!0S r!p*k!0@-$@@R!(P 0R @-P Q o// P t0, @-HⅭ @-P Q @0ft0 Htg0 Hmd H 0S p@-\@`@@ PCPpP p@| DA-P`p! @P  o`P pp P` b U @" ""`p@-P @`Pp3P p@)@- v @P $ *0 0 0 A-pP c @P  0 0 0 ǨPR `P  ` P((0 HȬ @H /@-@P @ k0E/HⱬX }-A-M `V $P0 P8@P pP  0P8 EЍAЍ/ЍAЍ/>Q/H€ Ux @-@P a@ $0E/Hj< }p@-@P x0 0 0R0 P0P Q r" p@pp< p@-@P `0 0 0R P0P Q P" p@p P/0 0 0R /0P/<0 0 0R0/P/// 0P @-od  QP  QQ  "/ P/ 0 0 0R/(@-@P \0 0 0R  C0P Q !00l P/00 0 0RP///|, A-PPM /o00 0"P R Ѝ R0 0 p`P 0 S  R L  Y/7 P` ;!  00(l 8 , A-@PM 0 0 0R ЍQP 0 ; 0p`P 0S `  PY/W7 pP` !(00 [?-H-, X H ; P -/o<0"0 0^ R  Rg/4P/D0 0 0R /@-P gox P/D0 0 0R /@-P Po P /ol00 0"\ R RP Q 2 Q* /( fP 40 0 0RP /H fA-(0`SM.P@U Ѝ P0P  pP 00  0P+ S(P0S0"Q00+ @P \ 0 0 0 @Ѝ, gP $ t P 00#0 0 P 0S S R/P/ R0/@-@ d,p@-0(MS/ @{! S   P{ )6` `P %P +(ЍpX  (ЍpD P {  6$0\ x ,  $@-@Ex@-(@@mBH0 00 S 0 P :\03#/S 0 P \0///A-P``&C@P ;7(pP  *@P "?AW@$$0 xbأl  M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ |Ѝ00@- @PM  @ nЍ00@- @PM  @ `Ѝ0@-@P ,0 0 0R1 /P/0 0 0R / 00 !S R!* R0*/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //|P $0 0 0R //DP $0 0 0R // P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/XP/x0 0 0R / 00 !R0* /-  ^ :P/x0 0 0R / 00 !R0* /-  ^ :PP/@0 0 0R / 0 0 S /P/x0 0 0R / 00 !R0* /-  ^ :pP/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/hP/x0 0 0R / 00 !R0* /-  ^ :P/@0 0 0R / 0 0 S /`P/`0 0 0R / 00 ! R0* /  \ 5*/ P/`0 0 0R / 00 !R0* / \ 1*/P/h0 0 0R / 00 0S00/ P %:/$P/h0 0 0R / 00 0S00/ P %:/P/P0 0 0R / 00 R/! /,P/h0 0 0R / 00 0S00/ P %:/P/`0 0 0R / 00 ! R0* /  \ 5*/LP/`0 0 0R / 00 !R0* / \ 1*/P/h0 0 0R / 00 0S00/ P %:/dP/P0 0 0R / 00 R/! / P -/o<0"0 0^ R  Rh/xP/L \ /  JQ\/(P/L \ /  JQ\/P/P \ / Q/S/Q\/hP/P \ / Q/S/Q\/0C-M`000 00Sp pP Ѝ(@YP+ A) 0Q xRK  P p'*0 00 0S  P Ѝ蘧 P p:0"Sꆧ0"S qp  0 00 S o j0"S O-MM(@PlD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ P 03/P 00  $ 0:/P 000 WPMߍȹ X0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-3KM `0 0@R @@@$@@@(@0 0Cs0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RWP0/S7 0(00>S: SA 0S p03  0Bs0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8 S =SB0"SQ0SN   0"R "R RAC$ >R<0 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pm \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R4\ BR   ;R<@{  @d0 8T"R /R 0oP 0 +r  R:Y Yy*     SP(0 Rh \Re  uRa AP [ +r PW6I0 r    0 # <  P,!*-"-  ƠP  * --  (  " "0  갮 | O-Ÿ M @ 0Ds0S<^QQ@`Q  0>S 0 T @P (0SP  R @& ЍT" T& @<P0 S00sP  @P T gPy0S  0S HG--PMᮄ`@PL ,&pC l(pF 0F fppSp>0? iP P&u&  }0 `p r"(Ѝ00 \0Cp`` (`Ѝ &`Ao/A-PP GP`p @&@Pr@@@P p40,p0P4080<09`@-@ . 4@-(@@ ӝН@-@@O-4@T p`, ⽝P @@D¤@`T P礀Qㅑ8080 0DPZ PZ Pd  @-R 0P< P 4Q ,  4)`0 00 0 p@-@M4 00R1SP,0S@R 1`V, P` 0 03P 40, 0C40P" +`ЍpS" RЍpЍphZ<.0̟PPj?.0ş<co?.0⾟$$N?.0⷟눥 l yP 4 iA-P`,p?@P W 0 !ՠ,@0`h,@0`C-`0@SPpMF  PN 00Ѝ!0 .P ,0SV |!0 v/P ,0S(0S00  0iP 0S?0S0"S`0:S W0}S "S000"S v]P  WP @X 0 @aP $$w?{/0,  , 0p@-S X  Q P@)0@#p`0!.0D 0S ,0 00@-?%. 0ݞС 4 @-R 0, B4 P @ 00'>/0ƞo?/0⿞p T O-80M@ Ѝ@p` CPP @ ` @Ѝ娒  < PP0 4004QY  4 ,R\ 牱Q1v  ڛ P 0YIV  B B!׆,0 P 04 `<0 04 <0 BP,UM<U7U+Y& xx @y aP  ᵚPP( o 0,S<SS8 vPh @ <0P0`<04 y< !⃆,0P ݚYP  |,~\0\02.0LW?/04?/0TwxT4D 2,  p@-@PP 0S D  Q <0 0 p@`0/0ɝ| p@-@P 0`0VPPP d d0 0  0@S0<  pPp `0/0⟝4<Ԝ O-0@SP MT p}`40SP p `iP@ ЍLP P 00S 0r  A> 00/PY 10Z/ @0R+ P$ [] P 08P 0S P( Hqpc0` ЍO J P 0  03/P  40R1# P P6>/0 c 00C 0 P l`(@yTT?/0@+? 0T 8  4,  \@-@C0,S<SS?/0ɜ뜣| PG-V Pp0`WSW@6 404 S @  S3 E000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<<-B> 0b$$-F> 0Zx !ė 7G-PS @- Y`' T 0p 0R    004 00R$ vP r 0S 0 GXXG>I.00,0,S <2.0 PĖ 1 KJG-PP' 0 0R"#4=P 40S @,0aᄑ1p !  ,0`p40@T:8 408  (0P 0  Q@-P80080/pp@-@P80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ pP`00S@#:p@꨷p@-@P@pA-PP 0 0R4 p`40S @40S ,0P@ `A-@P 0`0VpPp0S P @T <+? 01@@V` A-PP /o0`0"Q@@T @0R p= @P @T 2@+? 0밵D 0P T@- ^ 400\@,/<2.0ߚԑ 0P o@-p@ T\ @\400\@/<2.0⺚눴@ @-PP M 81 0R Ѝ`@80  Ѝ@ 8P 4 0R S *,\$0 B!p@400C40<00<0``K.'> 0tHHK.M> 0l00N>K.0 0c, u v w P/?o0 2 R0S/0@ S/ꌲ0P -?o82 ^0S 0 S /<P/0 0@0R/P/0 0@0R/ı P -/o<0"0@0^ R  R] /ጱ A-`P @PBpP (0Spm 0P  pAT-`̰  `갰O-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L d⑙X% XP0@#r 1/tr0,Sx{ BAA-PP 0 0R44pP 40S @,0a, 40a@T:8 408 mp茗@-P80080p@-@P 80 0R@ pPR0@OpЖp@-@P 80 0R@ pP>4@;p耖p@-@P \0 0R@ pP`)00S@#:#p@0p@-@PI@pp@-@P 80080p@p@-@P8@@@pp@-@P x0 0RP`40S ,0AT p@p@n?/t⩒,x aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@m@44?/to ?/th됔w w p@-@P H0 0R@ pP`F@yp舓A-PP0 0R@`j4P%80,0!qW# P P ,0P < 0@ 40< GA]AA4?;.tn?;.t(@v $v 0P -?o82 ^0S 0 SD/p@-`P pP@P (0S p@ h  L0 //@-RP0p0 ⼑x O-IMP  @T p `0 R 2/0RX P Y  9/0  p PP @TL0P ⋑003/Y@ 9/T [RT T @T@" 000Q 1/0YR# P/0S% 03/P& Y 9/4R@TL0p Kd0P DIߍd0p ;h0p 4Y 9/Z 0 03/(0p #x w v v v `v P0/O-@MM(p NT 000 0\0+`P$  T%0 `jP4 0@ 4/@P`P@003/0 `OPMߍT00 0 P 0 $ \00 Mߍ((0 Ⳑ R00t # 0/0/@-@@iA-pP`PM1 @T. 0@0W   WT 0 /R C 0CW /RW  W0 0 B/Q d!0C@T@! ៑0@ 0.0 0M  R0* 0 0$cp@  U y0P=}@qPۍl?00@ۍ S0p PHdp ;p O0P@@t  p@-R 0@S PR:   Pp0P  , 0T90( D<:p0( D$;0( Dpr r xr p@-@Q PPpQpC-0 MS~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ&㼐Q P&㴐Q xPPU a/U`U"0E'S0 rP\bP ]P PU /U\U fPnPtPbPUt 0  O/r PQQ 8P(0F/DFq q q p Lp o 0S p@-P@ P@p 0Sp/p@-@QP Q  PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@>0Q/D׎@n #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@>Q0Y/D➎\m 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P p@>90-DJ l cA-PPa Qpp0` XpWW@PS  PL <V`p p0 8/PP`<`nQ P P 0S 0P P 0SPT T /P P 0 PDk `j p@-P@PP  1P0@@p yx011/A-\@`pP \1S 0 €  P 1P1 `p P 0,0A0 4⒍B`0 4⋍xk `k @-@^ P ^%QRS  T009NQRS"  TŒ 00Z0 4Qxj G-@R0(M0QP P 0 ` p Pl `0T?o20S00(Ѝp`0 j 0     Q /0     P /0 2/ / /    \ /0 2/ / /    \ /p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0V P0V00(Ѝp@ R 0S V00h 0Q000 00/@-@p00T000w@-@T @-@T000 000S/@-`pp000 000S/@-P0p000 000S/@-@p000 000S/@-0谋p000 000S/@- pp000 000S/@-0p000 000S/@-p000 000S/@-谊p000 000S/@-pp000 000S/@-Ѝ0p @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#l__^ 0 01/^001/l^0 01 /L^0S@-@1/00/p@-P0P0 0@0PS` PppZ|p/000 000S-/@-H-p@-_000 000S/@-5ćpAo//0@-p@P M , Pw Ѝ00;0 ?vtb @-p@M D cP pЍ 0;0 &wt@|b 0@-pP@ M T T T  0 Ѝ0, @9 Ѝ00:0 t(b p@-@ @ %080 ^t b p@-@PP $P(Pp070 ފb p@-@PP (Pp070 ϊb p@-@PP $Pp070  b @-@P  Y.<+ < 00;0 ⦊a @-@P (070 ♊(b @-@P $070 ⋊$b R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ӊ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pu80 0 @  0""048# /UUUU3333  w0 ֈ ъ00~[ C-@X2M0 LD P @0H P@Lh p`XP \@`@d@h@l@X唊pk p ㍊p` n{{n{ P  {0p[ p0 0S04@R08@<@@00000+0++0+ @1@00 0@0 00+X  "j0S lp@ C ?   Ѝ oЍ @G0 0 &   [ ,}Z O-PMp 0GW"S00`0v@P-TPg +T@`0@ ǿ 0  n 0 n P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R Ӊ "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ꥉ00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 |UW p psW ꙙV 00 0M0Ѝ6w3O-PMp 0GW"S00`0v@"P-TPg +T@`0@ ǿ 0  n 0 m P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`و00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $ⰆUW p psW ꙙS 00 0M0Ѝ6t3O-M8@t 0 `PT uL 0 `PT j(r Q P O O O N N N xN @- M|d"{@{ @0S H @0 0 |0 30Ѝ  @/dnnM -M{(,{ Ѝ 0 0 9/dmNA00/8G-@SP, pE`J3/Q# ./Q JLXP0 S0C0 PY 000 ⏄M O-I,MQ@p 0L R^ 0S 0) 09 P0S009`0S p) d)d  X)X    @~PT0+0CP I @p  q 0| 0  0C 0B0 0 S00Q?0 0X0-SQT0}P0-S 0 !000 ,Ѝ 8 H 0@00q p 70  ,Ѝ01 0 B0C0@嬧 :Q 3 0+ B R*vP 0& WY :R 0S00007@0| | -Q000 6$  0 0R& 0 `=uPr A 0Z @P @` Pp@T ᾀPL P2M v `  Q Q 0@RTZAgv 0 Z Q! 500S 0:S   0Sl5 00+ C :S:Q ? ,Ѝ0JS0 S P0S,ЍA~TPX `0 -W 0S 0 #TPX` H0  0S dH0 ,400S 0:S (  w 30 h0X t;R0S00'X03 00S 0:S RW d30 0+ C~0|  0S /0:S  X 010300 0 0S000200S 0:S 20MQ 0O00P200S 0:S hRZ< 01 S0$0002100S 0:S I00C 00!S0 0 00+ C H0 Z 0S lh0R|10 L4 h08F0 A88!0 00S 0:S 000+ CR@@q 0 ! 10T th0Pl((dL PL HK H L   L I |PH <G _HG G F F adF E dE D D D C O-pQ ` V 20 R" P@T60崢 R01-[@P-T@PC T"hRPP tPA -@s0P  :R9 20 0S " 000PP@:T0S! 000100S 0:S k1 0dw?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S ;0 0IP00P0 0 R0 >VWST0 5OQl0l 0 aD:p:D(C p9|hHB B A 7TTA @4A A @ @-@P @ 0/0 @ @-@P @* 0/0 @ @ @-@-Q# Q Q!S3r0!# Q010! 0 SL^" 0r0!#   ^00<H0 $00 y맂T00@ ? G-P @p0#03w0q0W`@DT@!   0R ! 0 =P   G00@ pQP@-pp M P@P `P% .{0 @p{0 PP  ЍG00P Ѝ@0`P8`50P`/P 0 0 XR"Z-0   X^"Zp@-@PP` /o"0p@ JI040 = @-@P 0@ 9I0A0< D= p@-@PP /o"p@; %I060 <= @-@PM 0 0RPЍ000 = 0 p@-@PP U ھu00QUPQup u00QUPu00Q0/0 < 1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P R}P0开D00p 00$`,@(P0RI 0 A-P`p@PB 0U0" V W- p`Pp`P}P, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`P00x`|Tp@-@PPM% U 0`1S ,0S $0S  pЍp4<80 ~0;0 ~9 t9 @-@P 0S# t0 P @0P @0 000 01 1 00t,0<0 ~ꋀ 0 9 p@-@PP$ U 0`1S ,0S x$0S q`Hqpp4980 ]~080 V~8 d8 p@-@P [t00CS00 PYtp:P070 5~$8 --M  RGЍ Ѝ/ -- M0 0F ЍЍ/0@-0P$M R$0 PS @'  S%y 0   B040!  $Ѝ00y L0 000 0 PS@$  `7 t7 87 7 P 8000S(/00//6 d6 G-PRSQU 8M4p`2 YL\ U8   Q Q  2  j VyV @P  j .@HyPV$!1 0 40 30=8Ѝ@@(4P 0t}Y) @P@ PU zP 0 0  | 2 B  y @Pd@P@XX0( 4I} X0C}k'Q8@HP6 P?5 5 t5 d5 - M ЍA-tt1 0!M@P0<80P`J p4 41p4؂PP !1 0 <8 309!ݍ0 }  @ 0Pp免PP@T Cn` x0P8T嫂PzP @T@QN,0,0 |&NpN7 6 A-!1 0!M@P0<80`d QPP 14qPAp4t1 pe0P5P  0$0(0,0000@ 0ppPP"@T Cn` 0P8TCPyP @T@0S  Td| d0 0 <8 30!ݍT00όD<0<0D Q|y&@M%5 D5 K@$,$4 O-ğFM MPQdč@`ᐤt嘄 T V Z XX ( 0K0;d 0P0S  0K[PW  0 RP(00obP  $Px Ps$Wj ,Pj(,RbP %$W , ` #3 0 d4 30Fލ Ѝ|0P3Ԓ MxPxPi /[P@@W  QRC0Sk SIT" W?@Y/ 70 ZN0 IEPB:0 y{TF0 p{V?0 g{Z8x_0 ^{0X!0 W/60/$0S㈀~ !P  0-6  W?@. 6 KF%pER0KI2 2 D2 2 1 1 1 x1 yT1 z01 { 1 0 0 h0 <0 0 0 / @-PP1 0M`P000@P8  {T p T0U0P @@P@ 0 0 0 30'Ѝ|/000U00000F|P 0?s00H]?a/ z|0@r|@$FET. @-@P @ ~]?f/ z- O-HHǟ M Mčĝ((ĝP "48 80S 0St $0S{ (0Sf IPD@PHh0  <0@pI P`6&@06 0!>0t6@000}?, @p0 Ip!  Pj8|00S# 4|0=SPX PUPVPU icP@`!|0#S< v@T <@00C@0 |0 倀0 00 05P%{000 @0 00 4P 4 nT,0$zg00$zg40S@00C@0  0p@D0 u  $@7u (@0u  PD R3<"2 0 4 30ݍ Ѝ0@S{x"0 "< <T 40D@0 D0 S  P @`V 40 <  0   DP~P Pޛ P|*l0. yP0. x$0S,0. x{i?. x80Sk0. xcz0S %#80}@`x6)t"\D,D, , , + + p* ?( ( ' ' t' L' ,' ' & & & G- PMPPLЇ@`pC VJ WQ XX tA,@Ͽ |0/ lx0 00!0 0$0(00  00 PDQ ,A,@K@e@0 @Ј 0 0 L0 30-PЍ0-. HxV0-. ?xW|0-. 6xX\0-. -xP咈 .@M"<% t;$ $ l$ H$ -MnЍO-PPŸ \M@PT`pတ儰Z Va Wh Yo 4P /x0?s00 0$0(0,0000 0 0 kPZ0Q Q,P\PePhQP/P 0S 0 /@1!1 0 T0 309\Ѝqq0 a@i0/ wVj0/ wWk0/ wY`l0/ w@ .@!\:\# " 9" ! ! ! -MUЍO-pppMT nW 5 [< 0S( 0 0Go-0P iPf 1 S S   $@ $ S^  000 S SR S0 R R R R  RQ@  B RQS 0S1 @+S6 -SYQU @U0S 0S 0 ~0_o0`R0+S4 -SF tPPUpxO XPK2 Pp S 0QUP @UG0S 0Sg 0 I0_o00+SR0Sa @SA0 7PP kP P0S @S0 #PP`sPPUA"1 0 2 30tߍ CP P0+S3 -S0S  /P`P%w0+S$ -Sv0S 0+S& -S P gl0S P S!@0Se 0S c n_ 50S Pw00 0xx?/ v``?/ v[D1?/ v, 7\7 (4   O-ßM MPȍP@ s Ty [ 2U0&M 0AN.0 ; _PX0SU r` +pc+b0 0 0PP` H`P2P0: SN 19~0v`2 !1 0 8 30cލ ЍPP 0 @`P% 1X100S`@10v010/ luT?/ cu[~?/ Zuv1|P d0S   S 00v00vP0 x0x 0 ?6 0  @`W1D  X 0 0@   l A-@P`p0M4 V; W( 0 u   @ 0⏅P @T@T 0 pPP d0Ѝ @^P``?A. tH;A. tV((?A. t  ^  ]- $M!Π00  0 (0 0 0 30$Ѝ@-,-|| $M!Π00  (0 (0 0 0 30$Ѝ,T,G-p PP`  B+u0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00Cx QaCQ~WCP00Cq PTaCQWCPACQ7CLS00 D0C?o2R0SW ? R0S*@D T T-@A CRS^ @ A BR0G?oD2Z0SX  Z?0T*Y 00As Pa0ASW0AA0AS70AQ P0 s00Cq P 0 T:aCQW0CACQ70CS } h0s   DACQ 7C|`0C0 s H@dS P_$`@0 sl   l G-t1@0P?  @RP>T !6*a,$bA!(@bA$͌e!@M l 8+,`&'pbq p)7 +0).)&,o.e)8`` `e.d)` !6o) *"( 4*" *(((e8P*/+ $ ("*, " 8 0/" *p'*''`$pdq p dq' p, o& o&o&$ `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&4`_?`/%/"(`!) `0!,`/"!! g1pd,)_%0 !_%:_%`PodQ `P%P ` n o],daa@n!o`,o po&po&   $M` oe!na  `4.+0`+(͌..`dA. pea$ `& `l$me.`_l P!_O%f _%)_% O$_%,$P_lQ_% ,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )`o.o&.o& `(p..4p0p]j oaa.o&$p!!, o&o&坉o&eQ0`ja% `&pi%`mj n篃i.!_p /%,/"_%$p"0 _%p/% _8 f!.iQ " _p%4((p_%(_%p`%fQ 珃P%-a P] b./f!`a!( "/ "''?a1,p8!++4/"/"p/"< 0 !!!m@e(!&f1e1fqp?0 nfpn10}e$Pa1n1a?f1?8@`O#?#?#]?#O$(`0g1$a1gA@?n1@0 .0<`,,0 ,`.e.g ea` Mςa ``e `ςmg 4pd.` dςe Ϡ p_, p,_%p%

pmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8 +LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$bge( p苠8fd.  f+d,dlʠeˌn{( pe+n{'pXP`"{d{g ,k+T`h+, dh+" h+APfjAkkAkP%P4]+AAA`[`b*Ln+lK'@n )lK$@iMXhKg"hg.h 0ll;Xd.dˌ@nˌb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Ckp7Ca;}d{0lK(0@$@dJL0nKd;f0h;'0#0;l;ae <$ k+* g$.ꩠk n8hnˌ P+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-Pp 堑? 10@@i00T0Y?W@` @@@`VVT(@T(pG   Gc ` c`i=V0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@-c  0Q- 00 R- xB@-d @4  R  *4 8/ x0 S\ R `0S Р@- d@ 4 *8/&0뙓xB /*(0"8 /:$& /--M  Ѝ Ѝ/0  0c < R0 00//@-Mp @ b`P`W P0D>S 0!3100 0aЍ>SD 0!3100a00a00/-p@-MaP@U@0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, ,  4  \A-@PP`p; =U( X0ES  S0 +0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0X0+00+0`0p@00(0]0 q_00`  p@-PP@F 0a `0RuSpWS6X0CS0 p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D _^ I@ O-0wSpTM 0@@ 0`004080<0=; 0(0` @(`@T%X7(P0p000000G @ @  0 a0GS00 `00`0@d`@PTЍ+W = W0 -S0000 0` X B R  = G/oS"!"   ( P:0,P` ,` R, ("@P0 @(偑  ( 0S# (p W:,Pw`p ,o`0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,PG`` ,]?` Rm, "@(`0`FP`(`   q`(=W +0G?o 2R0S$ Y,P` ` ,2`0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,P_ ` , _0S,0(`""`FP` @(`傑0X0 0!0($ KR; I?I00 KR<I _0 @$$0`0S_0"SB  V*(@ T:,P_ @,_0S(0,@0CP@(@Ty (2-+ 00 ` 0TЍ'pC  001]0 ~]1]0 w]oꔱ1Fso_00(0UpJ 0Xp+`-@ +B XR R  +B0 -R +R XR 0 -R  X@P`QpP0]0 ]~80o0P ]lp D ( 0@-@PPM 0{ P@{p`Ѝ0 0:0 \  t P 0 @-]/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`NP+NU PU  0   P@P PPr`P `000p@8000j^0P.,c^P$ Ŀ p@-0P@`T @T0rS Ppp@  P0+Spp@꼶0@-2$M000P0n 0Ss 0P 0N 1 00S$Wp@2 P! W0rSB 0 P0p1 0  T1 P @00S5$Ѝ00oP0T X@\4 ]@W0 00S  s]@PIT0 P0p< 0P$Ѝ0T 0 [8@0 [pdm |lHlļ 0@-$M 00P0  d 0Si 0P0@ 1 00S<*p@& P 0rS: 0 P0>P10  41 P @00S-$Ѝ0!\]0 @00S N]@P0 P0l0P$Ѝ0P 0d +[4@0d #[p hjXj$j @-TAPP@ MI D1p0S+41@T4 `0`S( @0Su0V0, 0S%P\0S   ?p  Ѝ\0@T0S hR\00PKD  088l0x Zph̰hh G-`PPHM6 p 0  p@  p@ HЍ P 0 p p@ #HЍ\0S @X@0>0 vZ=0P R@H O-P4M@P\px WnX0S1 `00 S 5/040 00!S5+0$0 00!WbW0^ Y\ X00Uh5Sd50 0 0 0 0@0` P(0`0s 5`0D0$0XU 0S30`jW ,A 0`UVW@P ,(05#K 0P` X $ 2@0 8$*&  # #. B@T$0#"A $1?"!":  #  0 `V4Ѝ3+00 00!m|3/00 00!e`30$0H\.d0La#0L0|2pST0, P `@!UP 0`V ^ @P,v ^[X"$:600%$0<"%>!!!0C$"0TP%"1 #1O"QX00 0" 0$0 0?S%D P @ -`1T101! T$?01>! R01"_0`A(0l10X00`d(00@t`dP(0 T  R.1@$Q5 0A`X0 0A$0PE `0P 0  `1`190T dXt8H0T dX~` ȷ GzG Q(\)\¸ d H ܳ SQD ̀ X 8 O-PP@` Mo Tu V| p0 (T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @@0 <0\; \ @ p R@p\ p W R:\#Yp 00 LXT80 CXVllD0 :Xzp,@ \?[*!]- p p@-@PP U p@qHHT0` XU((h0` Xp@]H̯ EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` $PP0 X= V  0s0S0 0 Q 0  ! 00S-*_oRe`VNP" U  !`Xxxt0 WT\\0 WDG0 WY00P   C-1 M0 M@P040`P$ Q? U5  0s0S0 0@ $03/!1 0 4 30<ۍ ЍlQpp 0EWV U G0 :W0 2Wtt0 *W P0$WD40 WD$ Cp P E0 D O-TTƟMM HMPč pTDe0] X@ 0SG VN 㰰XUZ0U@@ R R0 0C?o2 000RU$00 S0E0@b0S0000SgV $0+F0C 0@ 03/[o 0@ 0000,00G(0 03/P     0S00 * z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ P (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  00s0S0 P@T  0s0S01X04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0J  2/0S0=  000.SP _ %P 0 @J~P? @ c  2/0G(100+$0 00 `P0XX0C/Ur0W R 0sE00 U0S0 UV0 U0 U0$ 0QSW0/ 0 0 @  03/0~7E5E0y\8*d  /D   إ O-\\ßKM MPčp`Pؔܤ; WB UI YP \U /\@ @ 0\/\0 V'"2 0 4 30KލЍRZ/\3/00P/\V\% p80G/UW0G/ UU0G/UY0G/T@Pp PmP 0   R  O 0T/S 0: S+ S 0 0 0 0 PX! +0s0S0 0@ (03/0S0: STq*/00 R0xPxP 0I/TG 0 TV/0 0R꼯 ԣ m nh o SO-şM5$M 0`P000P 4 QD @0~S<   pH 0S/S;RL 0B0 4ZS 0H*0; P4S 0 0CPR- IR*0S0;R# 0X @H p S    hhh*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+p@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S  s000-S]Q q0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 CY0 [0!^0  @E  p4` M0P H *; P 6010Q@@Kp0 2SU 0M/+S0K/#S0M/S 0lS0TM/S@7@55?**|[-]8ܜ !\   O-`QM@pM R W T   DSI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(B 0SV 0F0C  0sS0 0 @ ]RR ]RR xdd0R/URX Wf@FU?R/JR\$$0R/BRRܘ  p@-@P`PM( V/ 0  0 S /0{S 0\ {\ P 0# Ѝp0}S0S Ѝp@T0.RV40.QS 0 ꠗ | A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ| \R@ @R@ )\ L 0 R+ލЍ0[/Q\@ p@-`P Pp@0T1@D 0CPP )@T*%000p0]/Qꄕ 0S$ -*S ?0Cs\S0 P0S Q 0S 0 0/( 0p@-0@ TpP"TC ^ (a`00 0DS'0 00@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p @- ! a 1 `0 QM MR050   0 0 5 30-Qލ Ѝ ,p p@ P 0 p @EO0 P@0, P 0P 5O-0$eP`M 3500S E@ p#S"%R0 P$ 0S $%P @ 0SnR0SЍt `p  0@S 00 40  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000 9MP  00#3R0000 4'MP 00#3R0 (# 000 MP( 00#3R04 " 000 0#S 20@ R@@BP00Ѝ0 S S DLP 00#3R0 (" 0@00u LLP  TLP3 00#3R0* ! 0 00V 00#3R0 ! 000GlPT '0@S0 @  \LP =QA 0P0 0 duLP=Q 0@0 0lⳝA 0P0 0؇D @ < |0Ȅp  T ؎ L ` 0p@-PP t@LP d@PDPPP u 00p I0 NT h ̌ @-,@@PX 00O-ȟ MȟpP P`@ UVYT{ 4 EpJ09, nOW lJ 8U} 0p00 2c110 0p 00S> A0$00 0>p P2P<000S[ 9OU_ `'T7 0 0 30Ѝ `s?0l0` Ⰸpp  PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S# I BqQ #S& H BqQ #S% G BqQ #S> L BqQ #SS M BqQ #SI N BqQ #S? O BqQ #S8 D BqQ #S E BqQ #S F BqQ #R 0S:U 0p0S8 Rh BD{P `0000  00  X$   840000   $   30000S0 @  # 00   pW p[ pzO000=@sO@W 0] lO000S dO0 0\OY 0 ![ SO000@LO@00f@p00,(@ ((@(@00,0rX X[  tPk|0Sy[t+M_0 MGO00N  Pp~pc Tpt0`00U0`0 0SCN DqpLp pY*0p0Z0 N0SY00M pl0S0/ `00C0'  LJp8pPpMpJ[= 3pCkp-pk@ꐕp   @ @ ԅ  0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF/pP P Ѝpw0wA-P`? A@0S'A@Q0+pPpPP 3M@@喿P  p0 @BAQA p0 p0 $0<0 Lwwvv p@-p`pP`P@T T0T0 R@@prP00u-uu-A-P@P`@pg0S |@@G R"@`YL@FP00M0@F -Tu4u,@- 00 t@-B`@MPxEpP 0S|0A@@V ! @p UpЍ t0P  R 0QTG B&R  8A@4PRS' Sp@ S'@z@ @S@u@@S 4ϙ@q0@@@4řq6@q4㽙@0P@@4ⵙq; @ꈁ T < 0S;!  1A0@ @\ 0P 0S l\10\ 0P 0S l,10 1P0P!0 $ 0 n0xS}0S y00  00 0000@GP̆@r 8rx qDq~ q\~ pp\pHp} 'o8onL| nn{ Pn{ nmmmz dmTmDmp@-`@@0S P Dp

02d Q@NS pP@J0V0  ! @T3 0 Pc/T @0 $ @@T S0T0g / 970]Sf /Sj \S<~ p p @0P@-@ P H 0 Q 8Q?o2cn n p@-p`@`PCP CP T00pT 00pxH 0 p`n O-0Ÿ M pc P   10 230Zߍ 咹PT 0 p H  ㄹP 7 R @; 0`  0P P& PP 0 pP 0 P0@T*p@  G 0 pP G - R   s|sO-0Ÿ M \pc P   k i10 230Zߍ PT 0 9p H  P 7 R @; 0`  0P ]P& PP 0 !pP 0 P0@T*p@ F 0 pP sG - R  q\qO-0Ÿ M pc P   10 230Zߍ 傸PT 0 p H  tP 7 R @; 0`  0P չP& PP 0 pP 0 {P0@T*p@ E 0 ypP F - R  o(@04!50;:@p@`&``4 3V4X4G1Y01000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C J@ @-p A J@ @-p J@ @-p J@ @-pPP `@-fA00p@-@PP  p@ 010 S?\T ?0/R//R/?0S/R/P/R/p@-PMP`V ⑳@T 00'@Ѝp{ : { T'p@`($ F `P,PS 00 R  O,@-0A00 0S@p`O0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`L:@ 6P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍnPP @@ @0(@$0x]TS\SO-pϟ 0 0XP(<Ѝ 0 P(000U00S  SG 0$`Ph08P p`C Py9 P5P p W R0 0$`0P 0p`C P]9 P5P pW R0 (000@ 000@(X(Pd(PzW0  GS(  +S{ -S 00 00$P P䅐ಐ/P:U X$P( 2c2c2,,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pP80  Pj5P7 p8P  `5PP+ 0(P 0  R9,0X0!0 B 1X/0 00; 0  0P(10 ,0 c0,@ 0PS,0(111v>C 0C,0  !/"b!!A0,0 X0 0000 0 L: ,0 @:,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(I 0 00X00 0090   0[P(X|X80   0IP( =0 P( X 0P( `8 ,, ,0 0CXP0(m000y 0 P(_000k 0, |,0#/A!b!b0C P0( G 0 Br0 S\0(0Q0X09@7 0 0P(@ c0 ,Q 0PS(, ; 0@0?2c11!, 0 0 0000X60   0P(X ;0 lP 0 0 S0 (0X(P0 0 P(%(P000 c0 ,P(00000  R 0s @`0PPv0 P@ `@ @a0Ka1c B  B0   0002 !/#b!!"A ğK/"bP 3 :bQ # 3,P b4p$ ,  Q000000&0@ 2?3c112B #K?###cR3:#cR#300#0010 !, 00C0 00@TP2 R0PR00D0PX$`p(P$0000PX$`p(P000,P !/#b!!0"A K/"bQ:2bS0#03|" 1 ,0 B00DRd , 40 00N(0~0 S!0r @WPO"  IPH 0 40N~ Q @(P0Pq 0(P00(PP @ ACLC|q \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0 P ( 0$0:0RO QXL l'lJ J n$IG P)\(\ ףE E D C Q110PE0,P ( $P( Pd#/"b!C;R, a2ba12TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @\ 0 @V~XP( 000 SeXP( 0000@>0S; 00@70S 0@0 H,0 0P P(00, 0C$0(w,^2000c^\0M0c$P   0P  P(00 , 0C$00(0P @   0P ,  p#P ( (0 b$ 900 0M0Ѝh?A-1@0QPHP P MO Q&t10d0 P1$\Pp P@@ 8. R(!  v P`U! Ѝ0 P0  $ PBa @ ` U:T 0 Ѝh H  0!:008= = *h= = = = gfff< < 6@-0M@ 0P {00Ѝ@-0M@<0P n00Ѝ@-P@b\6p@-@@1 00Mp0,00`@P< U2    P00Q Q Q 屿 0 0 ,0 30 0Ѝp 墿 p坿k: 0 P;@0 _840:0 X8<t,(<t,t,D; $; p@-@PP U 0DPp P @p8070 88U880 /8: : G-pP`' X- Y 3V @P0PES  R  DS 0PEV R  RS0@0D@ 80H0 7XI@0 78: : R@- 0BAs @Q 0CR 8@O-錡PP p MT WC A2@PH `3PH  2p`J v3(101S YV3 Ѝ0_20P@F2P* 0 0P $20 0  8= 0  8`D<0 71|900(0C0 r73t98 l8 RQ@-M @PЍTT [9@ЍЍR9 00O--M⠁ Mpō@P`pG p1PP pH @\AIX0 ^00pt呪0 Oͪ00 T>'5 q@Ѝ0,  (V@P * P |0 0 5 30ݍ Ѝ\0D0 6800@800 T7<7(66 0   M Ѝ~5--M  Ѝ Ѝ/ -- M0 0, ЍЍ/O-鈒@P p`M X X00?,a*00P @ P 300 00 P! !  D1XPF  *VP WT V[XPVppPpW` B 0`f`0 ᲩpP `PED8 0 W6W`!00 ! 1 00b, Ѝ0XP C0PP00 M, Ѝ 0 +6`rpPP V kpP `P00?0 6e4\4 x3 @-@ M,(0S2 )0 `0( `1/qpPp0)  0 0 PUR <0PU+ ЍPPTp 0S  0CP+700Pp+@-P M+(0S: y)0 "p0( p1/qp@`0/  0 0 @ToR <0@To+1`V ЍP@T` 0S  0C@o7T00+{700+p@-PPD (A0S5 @Tp1 Rp00P0 P 0S P0 0c0( 0P0 0 S,P ݪ4P ٪8P ժp@ҪHM@0 050Sp 0K0 &5eE@0 0 p@-@$PPᗨyRp@萨X(@- @@ቨvR@胨$(p@-,PP| S@up'@-a@P`ME P 10p00S `  0 XR` ` 0@@S6  V8 CR 6!0A0 S0Q^(:ЍV   "Q @^ #R.S(@A a  00C0F0 4 "^ #RN^^ N0 s0Q@-d. 4  R  *4 8/% 0X\S 040:8 R РS /RexB@-@`P26LpL0ppD尀 =T  w I5p+<- @-P`@660 ,A-鈆pP`@P( T.  r0 SSS8v S00 S 00500000050 3T40 3%0 0  00`50000  = 70Ls0 20-V00 ^V00;\ 40000 0K/l R000C000LS 0100C0 0?V`000 00000 \ \ 00y ,40000  70Ls0 0 h", 3010CP;\ cP3`b0D001~dP0j R SXc\Q l301K00 M \; =\J \7 00C00 LR0e0 D100C07" 0 0  T 00Ls0a" 0W0Cs0Z2 F0nR  \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00Ls0! 0W0Cs0 0 #\ 0 0 00Pi 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP>cP%dP:00Ls000Ls0 0<00sP00n*t,  - , + * * ( O-`RM@p , [3 X PE 0 0H P@0 `D/PB V0F3 `  [ 0U( 00?7.C2[?7.:2 0@SS0T 0 0@D0 T0 E0 Ѝ#400Ѝ S 400& 8& & 0  00  / A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@0081003/0P !p0 $@ 0V0 00 R (P000P3/0P! U  R  SV  0STP000U (/>3P,- \0=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@t00810 03/0P !p0 $@ 0V0 00 R (bP00 0P3/0P! U   R  SV  0SYP00 0U P+ A-@P| P,`Px rpPh  00^c<!"#b!0CaqV8 X p-PXU $001p00S \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(P` p  0000StɤP0000H0003/P 0/>3T X@Ŀ= A-@P{ P+`Pw rp Pg  00^c<!#b!b0CaqV8 X pU-PXU $001p00S J\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000('P` p  000$0S0P0 $000D0003/P 0$`SR: G-P0`00Sp 3/0Y @IOP / T 00 00 Y @IOP  T P00 D0D 0 p`P/Xl\  SR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP Ԥ T P00 D0D 0 p` P$/<L<O-PPM M Q \ /\E ᾵P*P:p/\ p P/ `K`\n @ /RR.\)  B R}/0  D0/  I p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/R_0W0[0娐 !uPP-U  _*   RW  /0/\0#p0 @/R0 X0/ ލ Ѝ @ ލ Ѝ.00n0 X 0/ ?    㫡PHZ000 T0>00O000J000E0?00@000A-@P Q P`\Pp@P ٴP`V "00"S ḣ000@p@-La P`M=  )00QP0QP ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P f 800  / 0 @px  x p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 - 00 {- pd D 00/ḳp@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D D-U(P0D ;-ph H O-ȟ M MDčpĝP$ 0x 0S 0S 0S t4!S S 0K0C04 8 0S:SYD H R0 0  Q!0A00M@04@@0B( 0:S 5) 00UePpaE40D P%'F0 :SS008$ 0:SS00=4 0  x    0  @-0 00 ,-H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 勬@ 00 0 0 30KH Ѝ/Hp@-0@@G0PP0p O-@`$MllPX20PX 00 0@`QHP p W  8P G  pGpPH0 S": l'$ U10 r 1$4S1!$6t@ 000H$ 8H0S "<100S (!1 0 0 307 $Ѝ U r pP Р , P 5SX0(, VT00#    :#PH GH0S)D (4 ˠ@-(@M@@0CPЍ$  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T ^'P0 0# 00Ѝ Q'0Ѝ0-$M  00 0P$Ѝ0-$M  00 0P$Ѝ0 -M 00 0 ЪЍA-p`p0PsM  l`P]@Ѝp@$'X0 ,̪p0'C @ ӫ ګ0ҫA-$$ rMPPp`, V2 @X0^00pAtA_0O⛘ `p00TAΌ 00`L PP屷0x @h0 0 1 30rߍL0F0 $V0G<0 $L 0   M Ѝ -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ//C-<< sMPPp`/ V5 @X0^00pAtA0O2{ PP0P >TA{! 0 0$00 @2 t0 0 1 30sߍX0G0 H$V<H<0 ?$g PH 0   M ЍO-ϟp/  M # P 0_ We 000!R !X P  P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS  000P0C0 pXP l@0 0 P 0C PSP =0 $#W H0 $#a`0`F p0p0S8@0 nP, 0P0CS0 0000偼0S0p0@0 0 RP0 0C P0 S]P 00 pj0p0SPP 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S` 0䈯P P` 00 000050p0S 00hʠ@0^T@pp,(0#TIQ 0', 0$ 0 0$`-QU ]QP0 ` Q; @$00!0SVp!p3@`0 0X:P0X00 'P& 0  B00  `#0 ژp PTPpG@0SW `P 0@0080偼0S P -00SA0p00p0S00 [P 08pG0W]p 8pFWp!> ᔈ m@(0H0p0+0AMS00 [m0H000CS0d000pWH R0XS 00 0 (I 0        0H 0 0(0 B0P0000F SK*N0 `p(@帗0V'(0 `@C8@ 0p>(00S P V ,$00SHV`@ T@0  R  R=  0 BV0 5 RmP/0pH  R{ @0H  R'  `V B   H 00 0SGP HX A 0p0 0000P00p BH H HQF@ t T H p P D H x  `pG00P0W0S`J 0000P T0$@p@00Lp0X0 0P00( ] P5 0  B0 0    0p P p/ p  0S $0 PS0pS`F V ' P0 0@00^P ($@X T 0@0 0c0SP [($@  0(v00 Eh00 @V1$  ]R Rt@Pp00@0 0P00r$  ($ n4X y@P0 0P 00p,004@iBP =P 8P 3P .Pd )P 0 $1000C,00W[ 0$@(k ` @vV @ ^(0R0BH0R 4P-@0 `%/V`p ,X@0Vp@H0 PH0 B   H `V  0SP H0 p H00CP>PX0p0x5Lp0X@P0 00 ?oV20SX 00 0 0p B0V 0c RP]0 xP V0 P 0  B0?0C  . 0(  嫔p0 P s PX P`Fp0S YP [[ (0 {1(0 SA-@P`p`0 &0@`@-@`P MDpL@0p0 000@H Ѝ A-8R@QP`w v 200S8 )0P1S010q G000Pv`$ pW@0PE ὒPP] 0 00P0 0 C `C0000  Q  Q*RQ0 <00@8 0 B`0P#00P0s0 P ˠ0/B0L0`0  B0 ` x p@-@P {0@p@-0P$L`T M 0S pW  07/@P Ѝn@ Ѝ0804 Hd0p 0 00M 0ЍA-0P$L`TpM 0S $X 0 8/@P Ѝ9@ Ѝp0 H.0$ 00 0M0ЍA-0P$L`TpM 0S (X 0 8/@P Ѝ@ Ѝ y0 H0( 00 0M0ЍA-0P$L`TpM 0S 4X 0 8/@P Ѝ@ Ѝ >R/H04( 00 0M0Ѝ$O-MD`PpZ@@Z T6 0US``$ZC 0S@ [= 0 `;/0S) @$lV 0S H[ 0 ;/@PЍv@Ѝ0$lV?%.Hf0Hh[y?/^\0HJ>s/HS0$}>[/^I d < @-$$@M Ѝ,@-0P$L`T M 0S 8pW  07/@P Ѝ@ Ѝ ?/H08p` 0 00M 0Ѝ\@-@`pPxx0p尀 T   0 Zᩓ$  Өԥ L 0fO-ğ$M `H0  0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT   ^DQ #2!Q   "  R  R  \00t0!#300@ 00@00 @0`PU*$Ѝ@0 0M  06P-0 S^^?0@0 0`0  3P 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0ŐP0U 0 Dr RQ0\  @`b| qA- Q@Pp`# ʐP=0D?o! D2]R0S =p0$!0@<  14 40 0 V V 0 P0 A A-P@p`PP.T T |0! D32 0 A_T %D0$!0@<  1x x0 (0D,TSI6 O-00ȟ SMDȟPP x`pt  ?o2V0S Y W w@㫎0P0  ᣎ0P0 [00 p1# 0 S@ PT- U T 0 1 #:P00? PPk@T`P @  TP 0@T0P00HC1S@1@! <`XpPD 0 (00S V <0 G0CPap1  * 50_?  Rp1  ' 50>  Rp1 00p1 00p1 00p1 "00p1@\00p100Mp1 L IP@T`|P$> i@MI? _ P( PzS? P 5TPS~0 q0 iYdE? `H T$ `p@T 0p 9/PM00ߎݎ#3 0 D1 30 Sߍ@@Ə0`S$O 0S,0  VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^\*  P2 0*A5)q @. 00 (0<$p vaP ~$0~s$@ 20 ,0T 0 0S0"700 0P^\Z{00, 0R 00$00S$0000P04p0S 0SV W``w? l4p00J81 `@`,P(崎(0 [PY4*(  $0@0S$0 EQ  ᙎP U@If 00P0p0| P @ l 0   ,4 L@-@ M(0|0x000000@  @ 80P @0 0 30 ЍHغ@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝd$p@-@QM`P0 0 `sЍp0@-@RMP0 0( P]Ѝ0@-@M 0 00 LЍ-M $=Ѝ-M $(/Ѝ@-@ M00000l0} @ D 80P @0 0 30 Ѝl< @-@ M (0}/ 0 0  @ D <0P @0 0 30 Ѝh X0@-@QMP0 0  }ό Ѝ0 0@-@RMP0 0( }PЍ0x 0p@-@QMP0`0 0$ }ό`Ѝp -M00  }όyЍ -M, }gЍ -8M  $}όUЍD 0-$M  0f$ЍT\0H $5h} H} p@-@PM# $`0. 6 tP P nP `lO00S 3/Ѝp0 03/0Z0l $| | C-$` 0DMRP 0(p0 0@0$ NPP 0 (0G,00S 3/DЍ ԇ00,00(3/ 0PP A-PP@M) T/ 0S Ѝ$@ 0 P Gv00 `pP mЍ00p8080 $T 0 $z z O-TPyM(p`t PP { t@Pn 200s10 RE s0!$@ !  00H $p(`Lp4`0 . ,IPM 8003/``tP"  *!0 0 1 30/yߍ         juP uuPpjuTjR1\[xw@Z($dtx 8x x P/00/@- 0UM 0H`0L10rp! 0H1@ᕆpP㕆0P`p  S 0*< ,0 0 L1 30Uߍɩ 1\YLXp@-`PP`@M& T, ^PЍp @bP /^P  *^P p0 0  P@0G0 $eT$HL0 $\X$v v O-@P(p,4^P ` V&S/Z V@0St000S @Z 9/P V@PV sP< i0SZ@P Vv G-`R p@P8/PPV @G-!1 0M@Q000`PR U: U30) p00P 00 S00 0嵅PP  0⪅PP ᡅ0PS !1 0 0 307Ѝ.00P0 pUp0T  ⊅PpPp Pp 0 P@0 00bPꤨUU/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R  B 1 // 0R  B  2/ // 0R  B 1  // 0R  B  2/ //0S :p@-@P0C0 L 00 0p/0p@-S@ :P0C0 : 00 0pp0 $000  / 00$0LE0Ep@-PP@ T -_P 0S Sp@"_}]Ppp@u]800 $TH0 $p p p@-PP@ T ^Pp >p@}_4Xh0T $0W0T $@p p p@-PP@" T( Pp ^P 0S S']P p@!]p0p@/80w0t $aTx0t $X`o @o p@-@PP U p@ ^80g0 $DUh0 $;n n 0@-PP@ M T \P Ѝ0{^P 0SX00 _<00 $T 0 $ XB$n n p@-PP@! T' 0 0S p\P D^P \P  \P p@\800 $T0 $@m m G-PP@H T  R! R `V" V  0LXqXp$, 0 R R2 0 00 0 `V000 0`V 0.0 F0R#  0 0I0,$y 0\K/ `r 00 00 0000 0Ll %k k  @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 0:0 j j C- MpPÍ`@PL TB A< [VP8 Y` 0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T Ꮗ p0S % 0p 0 D0 00  T h  RP . R0꒥I$Ij i i |i O-hIMdğ4M IM,J͍,@@P p`WP W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l ? J-  p y x#J T 0 ?s0 J- 0S GVU0  SU S RMJ= 000:02'0 0d$000H0 40QP @,VU  W3 0S^0S  0S0s S0S RJ= 0 J= 00WWG O<  EUP[ t0SF ig03?Q #< p0<0J8 0WJ= 000$ X\0Pq JJ- 0SJ=  0tS SyJ͍ 0 *&$ 00SdLP P P J= 00W0  TPJ͍ ^P mG8Gh g Dg O-,,ğ M@pQ `@#0 0CPS0 #3 0 0 30Ѝ#3 0 0 300 HD@pЍOWX`` 0? s0 pPT0S0SI ? /r "s0 D̅PT8VT00QWX00 R0SY 0Sf S4YP00SP"0 T ⠅T@@O 00QWX00VT<!  0T ᄅ UX: pYp  0PȠpY 0@D    aT00? ,!0  TpiT 1i #Y:pܐP 0PȐp   8P030#?pW 0@D D(P^T[pEL   xYCd BBtc c \b a a ,a ` D` G-p 0 FM& P@`Mp P  RW  5P Wr`ov` 0@Sp0 0 0 1 302Fߍ000 00?1 00  0bP Z /r RX 0S wP 0 ڢ>=A-@P`p 0 | 0P p@-MP`VP@@P@T 0S  R0S Pt@PЍpPlPЍpp@-@P ppPpPsp0@0 S] 0S/. AA0Cq.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@-F/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP0 P%D@0S0S 0S  Ѝ00n0 X @-pQM @Q`P Q Ѝ0SSp P*pV0S# S!  0`S Ѝ Ѝ00S SD<0 ?P 00@8R|W DW p@-@PP` U V 0pPp``D0P UDD`0P V((l0P V V V O-ŸM2 H 1 #C 01p $0p8 ` P0 0 000000 8 P [0 0$104030.؍<Ѝ  0?sQ , s0,0 0(0PU,(Q Z Z ZZ ``x0 eZ00Z00Z003V @@2S  @-00AM M@P čP`p1 U P P0 ∁ P,@  0 0 4 30#AލЍF0SP 0@ .Rd P @ bHHx0 q~Z00ꔟ1S 0pR PR @-t!t1 0$M0000S`@ S2  0 V& p,0< S:* @\ 0S PU S  S0S \Rp`Vp h0 0 0 30$Ѝ0@ 0 100 00 ,/.G-@P`p W"  YiPP   @ @ !<<D0 W 0 O O O-DM@ȟ4M M,&̍hQ,@`@$0 $0S 0S P0 <0]&<00!S- &<00S &<00S @'t7 0, 0 304ݍ4ЍS@70 0 0?s0Sp:0_>`C @80 0XP00  03/P 0@&<00&,SS00 40R0ST  X@`$`w R? p:00(,P Tp*0 C 0XPPf00  03/P] P3Y@0Y-Y[` M40S?&<00S !T? Y YY`5`z_0D0 ZX@P200   P@) =g`P% $)0 D0R4  4 Sw[ 4Sr 000`0 T &<00Sc 0D'TS@pW0(pY,PD Zu H0H0P08p`h@ 0 QiZ3 { 0{{ % %  0E {000000JP qP0qP R R 0   pR iZWy 80LE0S5 X00X00 30 0&<00S3@/}P@V 0 8(5$%0 5s (0SP #0S hUX00@ $0R TA TThT @|P@V_(0S <0`PC80D\K Y<0 C,0PB 0P,0(00(070@XOt00S000e@01z_0 0 JW@P"00  03/P Y 00`S @@80PRCPG.@&<00@$0@%/j8--p,ExtG F F F F $$0,$0SDDC?,0SddD0,80PRCPG.@%@0/jP0U0@ DVPp0000S 0R $ R[ $R 0`|O-@ğ SMDP0e`P epP $0  08X0`00pS0  PO 000 UPK @@PX 0  DPgg@|#t3 0 D1 30SߍY 00W00 Q0 0 .Q0Q RS% d! St*+ 0 Pogmg @S Rd! Sf*.[ 0 P< D Pdo 0 DDQ0000 0000 Pxʞ0=S V0S# S S Q 0 Pc0s70SQ0S V000000  Q000S0000 P=rV00 0 P3hV0.[0 0 0sx ]V00tx0/DI0 PKV000 DDQ@V00WWf9V00Td#<"A O-`@VpPM 3 0 S_ +`PL 0(H0L0P0T0X0\0`0(000 00000HSC S$ S0 0% 0#(,pLp0  0Phh0000 0000 d1S Ѝ 0,p#ᄀ=넀XU00UP P P 0,p#pP h08 H0`  D Z0 S㮟7 $10T0  0P  0 p P0{0(,0(0  {&0PfZ 0 Sd1SdXN  00S !> \> O-Ÿ @00@$0` pY i:92 I520Y0 0 S   S  R  R Q\  ^ \/oQ" S R0S  0PQ ,0 0S Q0S %0P 0 P>  0 B   (KP(FY 0( P p0`8P<p`P,@4Y 0S@TJ 0S] 0S S 00S Pk(0 0v;c RDP RA R>0S0S ;0S'\ ,;3< P 0 0PU `V  :00\ Q  P U V  R R  p Y ` P 0S   0?S C" 0c6#PY > ^h \S㔐Q^ @ pTp0S 0`@ p$p T d:42 D52H 0SE0 S > S PR  PL 0@P0 0`P`&0(0 e?0 @?/YP\(0@ S0 `P@T $PP@P &c$cT$PY@T@ pTt W 000`P 0 `pVPUS a0P$0M PH0:L0 0``H`pdPPP<$b0S4 0S b 0`@  ?3.:QRSP㔐  P  P \?oR20S c R㔐J HP\CR PMVp `$p(,PP00 00SrP@T0 5$p0(,PpP S 00 0 P@T 0S00S`<`:  0 yP pY 0sP-r 0P R 00S R00U  P3 0PW 00S#S㔐R0S @@ =6.~ 00q8P p<,@PbRSQ \`@ T P@P aaTS㔐e ` `a@ 0HP 0  0CP ` @P aaY@?/* ` `Sdb Pa` 00^_P  0 ``$cPPH [:PL_P HHH HL0[`0L* a20;>(0$0e0PpU 0@Yᠰ @|Ht대`pPUp`K|`0B l`v 0 4 0(TP`ph !rP lqPK0K D Dp,0rP`KA,:H|,20[ Sh S0 \`( $8 3 2 2 t1 *. f4- x4, |Ii R` 003 Q  R0R`U`7 qq$@0Pp0 00 a"0S0$0`H@P P0U 0P`P0U `0`$p(,P  Kb_.> f⓾ hCrP1x00x0 `r.`@H`0V00L0``P]`O-PTMb Zi @` 1q0=>p0=~  PP` 0PE `0S S S T@P `0S 0 0 0 0=P0 0 U  Y [ 00  [ YU,@TЍTDD?/Z((D0/w' ' & k h& l G-XMp@~P `P@ 00  0 ~P 40S0. XЍ UP _ 0 ~P _8 8<3P 4PP)O 0 % h% O-ŸM2M 0`Q<000 Z 0Sq p@ lr < p A.=~ *X8PPh 0#S( 0P$  =0P  @ PRP R R UPP sP4 @ R0 @PsP $K(0K$ K$ 5P0(X PPU 00   P 0@PvP0 x0 0< 0 30ݍЍTTD0/li<<x0/d_ꌓdd$ X$ " ,<"  "  0A-(M@ p`pPQv .P @PP $0S0(Ѝ! @-@ ]P t0  @0O-Ÿ 0 M* `@p1Mp! P :PX  3PPQ )P Q+p!1 0 2 30`ߍ0@SPX 0@SZp00 0P 00 0 J P ZY0 Y  0bP 0 Y:[ 0 0 X  R  XR EP 0 wꨒA-pP`P@ 0 I 0P 00 $\($ -0AL. R@O-0LMp  D@00`P840 <0T8 0 0'00# 0(<  .  " |b*. ,`Hǂ@# @!P(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 08 884  0$00 ꉫ#EgܺvT2 G-PPp`4 W* 0!ᣑ000? 0"@@i>V0: B0iS@I"p ` *90V@@p`F G{4\0P p00P i  p@- ! 1 0MPP0 00@( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t *T,00t "J, $  C-0"02 0 M0002"00 @00$ p P`0R   0XS 00 Q !. 0N `!P1 0 0 30 ЍQ  Aa 0s00C 80BS.R ^U* 00RP 0ES0 S S^*0W >y000@^0 8< 4^*0 8<h- MgP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0DS  A- rM`PpP: U@ @X0^00pAtAxW0OW$1 000TAΌ LIWP2  0 vpP# 0@XP 0 0 1 30rߍx0<0 U\=@0 P bY00 0P0B   0   M Ѝ -- M0 0 ЍЍ/--0 M0( 0 oЍ Ѝ/p@- MP@E0x x` 0 l0  `@P@X@0@T  Ѝp  @-HH1 0M` !000Yjp @P   wjp i@ 0 0 0 30'ЍhPpW @@T PU 0SVP@\TW00@:i, 0p@-P0@ 0 p0X(0PX(P,PXt` 0`0PP 0P 00 0poP 00 0pp 0@-@ 0 0 0 0 0 ; 0 00@- 0 MP @0QX 00P 0  @?o20c Ѝ01 00 0p@-@P 0U0 0pp@-@P(X0PP$X(0P!X(P,PpO-p0Pl `,HPd 0@00 S S0 S S x06PR 000PpUp 7 0P,"@P! 0P0,0S S S@ 0AS A @PQ% 0 PS0Q0000VP  VPP0@@PP d 8 G-@ 0`pM,0(Sy: (T] TppU 00SQ 0 RK@D@T0PF   RB 0@D@D0P0S+ T0V  0 1  @D@TPH 00S#0A S0偠0  Ɋ0S000  ⸊0S% 0p@*W0pp&W(0p#W(p,p@Ѝ=VP  (,@|(~  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ09p 0$  $ 0 1 Ѝ0O-PTMe pE,P@<@0 ppBXPb,oT`P^ 0 pp5XPS,PPU0 @\ \G \Q \A pp 0U00S ?TP, p0 0 0@ ` R  R2 R[ R 0 @U 0 `fV 0JX0L 0 TЍ @\L@ 0U  0⼰^  0 ` ` 1 0 00LЍ 00!00 0 0@-S@ 3/@Sp@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \0 \, \. P@^ ^ N@N P@\ \ \ \D@u4P@d\XTLHy7 8  @-@P @ I0/0 !` p@-1!00 P@0 00D@1011.T 0@\0 S@ P pp0  00C1000L  00t@ ʚ; 0  0@-lPP B1!1 M@@D0 $2 AD ( @h  Ѝ0̰ Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2S p 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`i O-``!P@@R@@hǟ IMMčLǟT ด`D407(O0P@0 0 4p 0A&6 0x PT < 0P00U0<06080H060`0X06 0` 8 x@,0, 04P<0, R00S D0`1  P0 R 0 0 0R P Th00S2x0S䕟 458 0/Hp岀0p 0W9 X%U80 P?Ⱀ-?2crlqqHT01NਂhL΅Re`\ X0PP QNDv~ @r~  00pp@ pp_p  /=_Pc$Ѝ C-@P@P p` MO0P?͍0,0= 0080=͍p000\ @P48@LpHDp 0 `PW )0@S2 P_P0⯭<0H0 0 0Ep 0(00H=`0= <<0Y@PV *0,. 0> 0;/0H=0`F$`` 0m x`d0 Z 0  p ( 0$p Y3 Y@ H= I0R#  P0⯭<0H0 0 0p  R 0S .S 0S 0S00S.S=L@0@=00Sༀ@tL 0@d/ @@SZ 0 p 0 D;S0f*2墏$0#8(08$0( 000@ C0 `CBZ 00P<0p0dd +ZU@ 80 pU Z8@P@0 Z}pI 0 0@pA 8;0 02,0#80B; B00a0.0 .0 V0$ V@ A80 Pp <0 0S 0D;:04H+B 0?R0S d d?/00<*: 0  0 30  ݍЍP0⯭<0H00 0 p@  0.p(ꠉ฀> P0⯭<0H0 0 0p0< 0@08 BP0H4 0R0IY0S ?/=00S2(@ 0dR/ pD{^YP 0 p < 0@8 BUPH=00S{20<pd^/D{ 6Y 0 pd =00`C 7? @P T T㐀 Pp` 0U0 0 FzpF 00e0T0PEo  0 lp7<0P@p8`@C 0PP( 0 Sp 0  P`=00S2@`20@DKx0df/ `X 0 'p 0P*=00CF@@LFd@R_ 0 X 0 p  0D;d 0 X 0 p 1 0d X 0 p `0pVD{ -8P8 zO d0 tX 0  p 0SD[ =8803Y t 0p p 0DK`VD @0TF1!PDQp  ` 0  PPr DD0p@D{ 0pe =00YU  0 PX=00@C+Y =00SCD`@R_d 0 Xp 0 mp9  d0 W 0 ap- 0PU0D[q* p`zOUD[h  d0 W 0  GpD@ Pe @0TDKV:UP 0 fP=+L0T 10"3d" 01;L0==1;L020 201;L000301;L0<=1;L0L10 1;L 0  p 0D 0 S @10k`V! P  @$`U 0S @` 0V4 b 0d lW 0 p @T +A0T 10"3  01;A0==1;A020 1;A0; , l X  < Y l P . * x < P \ ====== H @ ļ VUUU \ ̹ D 8 P t L P  \ =+L0T 10"3  01;L0==1;L020 201;L0L00 1 ;L>L CC+A0T !1 0014!;A>A C@1;3@ r 0 +p@ 0 < @8 BP0Dk 0PCU.ȁ@pQk@T# 1 W2  0d V 0 p=00S#/@/P/p"PP0p@ 2U/D{xV` 0 p < @0@8 BoPH=00S/@/S0p@P2S/D{DpNV` 0 p{  @ ` 0Pr Pp 0 DpD{pf 0 P_ 0D0D;P 0pS 0 0PL $0D; 0tp@ < 0@8 B P66/@3/ 0D  0 p6 0 Bcp/ 3-pP 0 DVp" =H{` 0o PPV *0,, 0< 09/=`F``pH{ 00 Qp } 0p E%p , P 0 D p =H`  02 PPV *0,- 0 08/=`F``H00 p ~ 0p p ,P 0 Dp =H`  0PPV *0,. 0 08/p`F=P`H0 0p n 0` Kpy },@DK@ 0 pm =H{P 0@PcU *0,/ 0 08/=PEP_`P0 0pNH{ypE 0 p= 0 OjpT5=00S /0 S00 =00S ?d0RO 0 RP 0 Fp `0 dD; 0R 0 7p  d0 R 0 +p > @0DKR  .d $0w/ R 0 p'`< 0@8` BPd^ 0P p pDK+ 0@++d0v/ R 0 p H 0 PM=@0@=00S  d0]/ aR 0 p PUpDD7 1R@0`` $0@@@@]=0Hp 0 Pl W` *, <0@@ 04/D0$ pG0- p UD0HD; 0D S\ @ 0 upA 0~- <!?C0 S 0 o_pt*=00SK 0D @C@=00S 0 < @8 BP 0DK 0SQ`+C1#00 SrD 0 o+p@0Hk=P0 0W P U@ *0,* 0: 08/0-`PE@ HkDKP 0 p0Hk=P0 0& P UU@ *0,) 0: 08/0-`PE@ HkDKPI=@0@9Y =00S.I=@0@=0@lI 0D @C@TI 0D @C@$P 0PU0D[:=0{` GpPWW @P` 0U0 0 FpN 00e0W0PE 0 tp?dh0`d/ Q 0 ep1 X $PzoXDK  d0 P 0  Np` @PT.TU wppP` 0U0 0 F0p 00e0T0PEV 0 "p0H=P0 0NP }U@ *60 ,P x 5/0H=P0 0/P ^U@*h60 0 p@ 0 p 0CF@@$F 0@ p  0DP uPP 0 p E0@ `@pT 0 Np "0 db/ O 0   p 0 p @RWT@ 0 p LT 2@$` 0`@T0DK: 0@ C` nPP@U3U qpp@` 0T0 0 Fps 00d0U0@D 0 pd 0 p] p_TUp 0p |pH pD@OmȀ=0@帀İ į \ @ VUUU  P Ȫ P   H ܦ , * P , Ȣ $ | h X , P +E T0T! ##,00 !+E T--!+E TT" !" !+E TT  # !+E T,-!+E TT! " !+E T 01 ;E 0p `VDK@H@- R  MAP  ,@0@(@@; Ĝ0P Ѝ MM$000 1 2Ѝ/A-PS`+p@ @W0 V :0?s00@PU &Pb(0@0T0T0@DT0S$0l0 (NP@p G-0PU!/:@0`?T0(p0 ?0 0@T0T?00S X0T0 "$ P0@(00A-QMxp$0PS@` 0! $, (0v(`Vg0Sc(0S0! , $P, (0V-ʀ100?&PT, 0 ^,0O /  , U/ ,T(0P0T(0 S0P$00Q (0, Ѝ 0F7P&, (` , \ :0,0?0s0\, :$( ,00(0 SPU$P 0"00(00A-QM|`$0PS@p 0! $, (0w(pWk0Sg(0S0! , $P, (0W0<0000)PV, 0\,0Q U/r ! , /r !,(0 Q0QQ(0 S0P$00Q (0, Ѝ 0GP', (p , Q!:0 ,0?s010Q, :!( ,00(0 SPU$P 0"00(00G-PP@`pe V[ Th HH0H 4H 8<T0YY200 Y,2 < "Ì!? P P@D0  PT T00  #2<0 W 0"!:T@  H 0 = H0H 00 =00P*0PP00 h80 L00 TW P@4 L Й O-RPP@p Tv 0S7 t" `lRPHP [B T Wa@ Z 0 00@=ZB ᖲPM [ [T WE 0@0 0Z 0[9Y^ T W0 0@ 1 0Yp 7:P$T W 0@ 2 0Yp 7:P[0% [ S 0S 00@ 80 00 wT W 0S S0S @=S0,,0 Ͽ\ X 8 Ȗ ZP 00/\|X00P @/4/,/ //4  @-`MP@lTp@X ( L0 < 0,wLC7 $X h D A-lQ`PP@pO TE 00S>00XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQs 00000  0C Q700C20@?D0 $0>0 W (  A-Pp@GU`, T @ W0``W0 .pPEVp P7000 2000 S70Q00 V00gD0T ׾0x /vo/Ͽv///0x@-` @0 0DM p0<00 02J0 RP400000C0< 00 0 <0 30DЍhUē TO-d2drP0੒ 0 M #r @rgqC2(0,B刀B# C@$AR i!dP @`3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H{p# W0Y[0S    00000000SW 0 Xp@@ 0 DMp XW  0 M@p Y H_0$ 4 Ѝ @: %I$S  A-`pP៹0S-@ ߾T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@걿( 0 p@-M P@ ȍp k`\ p [Go4 (0 0 8 30ލpgPXPPRp@- `@POPEP0 ?p@\D3_00pPRp@- `@P-P#P0 ?p@=D=00pp@-@Q `P PP0 ?p@D00pp@-P@DP p@ p@ p@-@P 0PS <0S P 00p00pQP@- 0R R  ޾00p@-PP Q@ @Q Q Q ARt032 ƾ00pxP @pmP ~Qp@-@P P]P n U     0SPtЍ P EXH  0 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W  0pt pp 0@`> p PPD1?0 0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333d 00 0M0Ѝ  | 0 Q?0S @-[-- Mo ЍЍ/G-PP`P VV ၧ00 !PER !U6@  ၥPG0 _PU pWW@`u@-@P ܦ 0`00@ۦ060 ⽰d` - M ? Ѝp@-PP@ T 0 0 00 p8080 ➰T D0 ╰ ` M` NA-pP@`& T- V4 0S 0S 0P Q0 00 R` FQ`00`6P0\ ]T@@p0\ TV$$|0\ K _ ^ a^ bO-ß OM4`dPP `p@dh V Vt Z.` nP 30 00 [ .Q Q\.Q _ :!L!PX [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V ) P00 0 ` `别0 0C SA: ǰ0  `0  (+00嵱/00H!81 0 41 30EOߍ:[ 000$0( @,X0 0 0 `0P P00 ZZ00傱000 xE<4 ⭾PPK U.R}  :ᰡP qY4l[ [ BO-`PM@  0X0 X0_( 0"P? % 000 00 P @ p P 0 "00zP > R  R 0 @`V  pWI1:pG`W:\pG`S C0  ` Z`pGA R $ 0 0 00@ߍ R R0 S S  ⨜ P} ` Q PD P@ !T: p# P@D X0P@- #[0i0 hZ  ᩯ[` pG Ka  ᜯ pG  Va JXV P 0$P 䠊` `p R R R RR T * ;P  RPB(#P@D PT p@`V0  凫P% T ::`P vP !T014@1:q0 00 0#@ 0 @ 0 @0`pP`#, 0@ 0@ 0  PP P 0 `@Z Y W lV ^@-pp10LMpP0D00@I LP0`S. @.0 gP) V) QPP0 0叩 0  BP 0 _#  0 0 0 D0 30LЍAPpPPP O@ @#T88C?F/ ⚭W8T P8$TT T C-`P@M: pPU, Y @@NO006 0 AP0 #  0 Ѝ|@@JO @"T ЍAP P$$C?R/ H07S ,S R O-ʟ UMMLōpZ|ŝPPpxe刕( 0 (0S 0 S00 :0 0(i 0P,0 0p P?s0WS#@``O ,"0)09 0 L5 30VUލЍ5 00SP0  03/P PW: 0B?o2\0R0S<0e ᚨP0``P`0,t欠\ 00 H05 00 0T0R?@0 0 pDL48X U^*``0 C 0 @PS0  03/PK @ Z'P U$0P0S5<0S0 S  R0L6P0$ 0S!0S H0S0`-`$ 0`V`*X0L0Q*@ bH0``0L@H0X48HQ 0, d0L P0U\ Q  RO ZO[ p P p H `BP0 0 0PX ! R soQ \ V Spp0XP 50 0W  H0S B@Gq 0SPSPڰP^!P"@Tp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @ݬr!L0 C0 0CS`: Ϭ0S?0 @0 @Pe0 w $0S?@qY 00@TW @@0P`@(`L S  C'SRF0@t0`p0%P `a#2V?Z/ Ⅻ(0SX]?Z/ {P(0P04D0,0b?R0 0  PP0 ; $0ST D0,1Q<*,0`0P @ `@ 0` CR00V048,0@@PPp0`P@ CR00T@jP`@: 03/P `2,0D(@C 0T00Pw  , D00D0D  0(4PI0  WPP0 F $0S|H0S0` T D0,1Q=*,0`,0៦0SL@P`} 0% "y p  0 Nύ00N@1sKi 0`@0P``,0^0%P "V5PT T,0D(@C 0T0a0P , D04(P K K K I pH A-@PPMD 0 S`04 S/0p 0PP? P: 80 0P$P"  0 !0PቬU 00S S Ѝ0puЍ00C?. @ 0 F O-3BM0MPP040@ 0 00S00 S  0 "2 0 4 30BލЍ @pA~ `⍟ p0v#" 0 G5P@T*X "2P0!  /5,@PH `PC 8 0 0@ַPH` 0 00 00000 00@]T> 0 p pIP ᴪ00S 0  0pW-   0 ȫ 0 {1 0 tC?/ ⋩_#ᱫ 0 d᪫ 00S S[ YᠫSE @E C G-M0`py@P0P0 V 0   0 p PxЍ 0 PP 0/ :B A-M`pPG@P , 0 (   P0@KЍ0, 0ЍA-@P MPp@`P UX&0S8 0S0S8 P(1(!0800<0  P00? p` P 00 ЍU U* / 0 0 Ѝ0S ժ 0 00S000s S 04 P @,,?/ ⷨ0 xA T @ O-<<ğ DM<h@P 0 (PP `spp/0 `P ZP 0,0 P0ß RR RR 0 R R $0 S S 4 4@P  0p 00S S S@ 1U g*@ @P 0S0 0 0R 0@B PE @ Y8:I S@@3 $0 @ I@ Y#:  ! U@Iq E1P@GP `p   I  U>pᾣ` V `p 0  0`!L1 0 <0 30GDЍ(PPE pP *P@ P0 0 0 0 0Jp `pP0 00XV 0 J0 000娩00pQp` ? 4? ? p@-M`@P ),0,0   0kЍp@X@-M@ $$ 9 Ѝ@-MP`w @}pP0P0 ɠ@0@ 0   @0P|Ѝ0@-P MP@T 0t  P00 000J P 9 @ Ѝ0@T8 004C-a@P`PMT UZ !0 `   p 0S  >  0C ^0 .SDW 0  @Ѝ0 XR   9S '@ pG W0 QU 4 8<03?0T0m0 U8n<0 ⸦ @S D; $; O-ß3 0,MPQ0$00@` RM Pg PU0@:T000 0j Tl 0#P P` `@0H ȘP [ `VV @ ZpW` @$pTH氐0S T0D@ S0 s\b 0 rJp<0p IT TQ D/00!1 0 $0 30i ,Ѝ!1 0 $0 30],ЍO@:TP \p eP :Z:V0 0S 0$ S氐`PqIp0p V T T0| WU0| <0| H0S g@$pr @.T`@$pTPdOTq `: l9 ( D8 7 @- 1 0,M@P0$00P`' U- 0p0H 00000001P* ܒ 0 0 $0 30,Ѝ蒧 0 L0h0 ⇥U0i<0 ~O( |7 6 6 O-HHş tMQl@p 0 R P P* `/ 0 $4 0 l0 300tЍTIP`<0T ITu T 0S0` =x<0` 6 0$40(,04801@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<0000j:000@T `0> Zg 0Sg* 0CR00`:t"2 0 l0 30 tЍOP@PUF*0: T00S DX"H 0l 0[P3@T` 0Z00S RZ  @T0`zu YPr S 0 S P0@n Pa0SC:s 0 Y Y Y@,!0Q 0  HP x8 @R0PHP`0T JW Tt T0` ?uC0< P@0 j0~ : L0@

0[' + ᠗P#p 0;/qp 00P @ P h00 0 00 ؙЍp p*P 0 Q+ L WY pp 0*P 00 0 SM  00 0;/qp 00PPßQ <PU;<0 {p0 ;/qpP0 r 00 0PUßR <0PUß`X0p\ Ri00dX0P\NS  00Q[ <P800CPU0&Z   "  RNPL0i?  P;/qp@ 0P000P @ P 00 0 PZ 00 _P)0S&: I y ?J0C0;PPT 0S  0CPß01G0 APU0 Z 0CJ P&JPP @0P g0000 00ۘP0 ⻢0Θ괤 0 Ƙ480 ⦢0| , (, + O-P,MPp@P` T 000S000Z00员$0 0PP`W0 00@P $ 0R00SQR+X` P  "0P 0a0  VP`Pi [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pd z )P 0S   00S S0S S ^ S@@T000S00ti0\#00& ^@ [ @@ S@ U80h0 ♡0嬗-0D( p@-@PP` U 00F Gi p 00pt060 uUX7<0 l0 0@pc0TS_00' '  -M0 3/Ѝ/0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04P0 "00 & & 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04h0\ 00\ % % p@-@PP U 0S S S 0p@0/p0p@0/p40t ⽠00t ⶠ$% % p@-@PP U 0S S S 0p@0/p0p@0/p40 ⏠00 ∠l$ L$ 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 X00 Q# p# 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 00 " &" %0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 00 ߟ! F! E0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044>,⭟0Y0,⦟ e 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044K?G/u0a0G/n  0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04iS?O/=00O/6$  0@-PP@ M T 00P00 Ѝ08080.T q[?. t 0@-PP@ M T 00P00 Ѝ08080^/T [?^/  0@-@PP M, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/⶞00a/⯞  0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044j?g/}00g/v$  A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0t A0/Co<0<0m//(#[?m/'t (: * A-PPp@`M2 W8 T& P R P P P @ЍPX 00@R X ЍA|&w?q/00q/W>q/؝ :P` Y0@SP`$q{v  ^ _$ p@-@PP U  ;p@8080,⥝U ?,✝  A-PPp@`, X2 W9 T P  R 0 R 0\A/V 0A/|| =/dd0d0/]XLL?/TW0?/K   \ 0A-@PMP` 0J U@ 0pS S  P R`V V V ЍW ٘ 0SP00Ѝ W` 0SPVll>%.T0/0%. LPp %{   p@-@PP U p@@ <0<0/ƜU$ >/⽜(#D ?$ 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/|U ?/s W 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/3U ?/* { p@-@PP U p@cD00/U((?/ p@P d p@-@PP U p@D0D0/U,,?/p@y  p@-@PP U p@"D00/՛U((?/̛p@ ` p@-@PP U p@KD0D0/ⵛU,,?/⬛p@8  @-M@P0.S00Ѝ!@-M@Rp  B0?R0S Ѝ 00 0}0CЍ 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / H0 00/ 4p/0/ 40/0/O-p MR @ܳ Q5 0S Z0.000\* @\/  Z%@QAR0S<hsJp 0&PPX`VpX V}H 0z&P`FP(00@ ЍAS0S010! 0 Z@Q \p!SŸ" Cr <"I  Z 0@P& 0;S@S \S ! C]R6 Z"R#!! Cr  P "!!1Cs0#‹1 0 0@ RqQ^ T*000Q0@DT0St$0@ P#Z0@_SpV pV)!0  H%P|PXyUw @R90S`` p0 `f  H6 %P_PX[ p0 `f6"2d H %PLٛ00K Q@1.0304:Bt  Q , O-@pğp$M W0P Hd``XV @ppW \W* .W 0E0CH XF0 R S.R? pWP 0E0C 5 X3S0 X ń- PEU*0S0P(pW [W$ P @Qq ᵋP @Qp ᪋P @pWZ(00$Ѝ] ᛋPX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00   0]R' @R " XWQQ   Y I b"r RyA  PRA .R pW@Ne@@00Q    Y t " ^  @WX  P0R XW(@Qp59:fX0  0…1^S X ńY PEUV0SPUWX4 8  0G-LA Q@I*`0S$ R@ @RpP00- 0Y70  Ԡ 000 P00`S`00@NT00X0Spp$0]/P_AS 0SPQP!00P0YP(0@0蠼   RO-P3P#RP3 M0U 0p`\ @U @RF R R2 '(00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ a?.P  Y*@T*0P 0A\ R!ɑ" 40S04 0D - M ЍO-pSP$M Y p 0 pS 0S0^@w @^` \rS0  H Y B `@p p@TW @0S @S] pZM ቘTP @`T00 S Sn*p 0A>Sc B P_^p0Q ^ QC a(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 005(00@$ЍATw0S"@@A@pZ $@0Ġ?  0^q0A>Sp0pS000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/PϖȘ00@G0?Q0Shv?}/Pⶖ Vw*p/Y P LP m?.P⣖B D p@- M P0 `00Gp @ !p < 40 0 1 30ލp@@뜴 8 A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލw@ Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?R00C(00/C/A-@P`TP% UVT P @TP 0?Sp 00軗(00QSp@-`@P ܍P@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1APx(00s00o?00Q @-A?SSRB 0@S AT00O(00/-- M ЍЍ/@-M@ 5p TЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@ُP-TR +T} Y m?p ]`00D" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+꿖꺖0S \0J0 ЍY@0Te UGp Pa 0A0C0B QSlUPP\`?pa00Dꉖ0 0R0   ЍY @~0T+ U# Pp0a00D~0T00XS"@ 00DAAs PQ0Pp>cj p>cP0?0 QBPp>c00DZ00XS UPpb 0N00XS UpbPPp>c 0?U0@PP0@ p>cP433 00 0M0Ѝꬪ O-@SM \ YX` 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8 P 6   ۔ U 0C  pSPP0 0@pQ 0S  Ѝ躕T 0 @0000@0 ⭓꫕ 0 0| A-@`Pp㪉0 0@㪉$0$ 0 M Ѝd P`p@-0 000St@@@pdddPP@P@P 0000 0( p Sp@-P@S p@G-@`P(tpt0plp 2 T  l50 ⦅   G H  A-pP@`  F V{000@P p@-@P7Ppp@O-P 0S 3/0S Ĕ0PU@:W (0@@00_N Qx00p@@vЍTЍ0<0 0S  R| P QQ@-@!BM1M 0pPG040@@@ @@<aP`d ! R a@`@0 ! P0lA@ P; P1 0ୂ8!1 0 4 30>BލЍCP (B@P  4/P Q Q 0 00 00P &0 0 ! @ P 0S 3/ H000P <눣 L    PO0@-@PP$M U! 0 P% 0 0   0P $Ѝ0XX<0H X⪑U<<|0H X⡑@P\ ~ O-@PU  RM `100Xqp0S@ @@@ P ఀ $)A0PS,00a000S 000  000 000 000 OI@00044<0 X58 ,  p A-pP8  0S@P$ 0 @S 0`PP0S PU @P @U000 ?y 0P@@ P ((<0B/X0 O-(ğlMR  0 S X 3`000Sa# 0S00 #3  04 4 0P YP|3|s|0@p 0V^ p p @QS  QN `P0 Sh @p $ 3/0  0PY@r@RPt00SS" 00C0T@lЍxB0@@@d20\ 000SN  R0200(   @(,0 @p 0TTP 0S 0 @00D00@00qP 0 S PW @@(0XS,  , @0 R1 1S@X 1 0(   @(,0z6&>I/X0S XQ?I/X@lЍE?I/Xޏ@^(  (,0Qꠝ p|Jh@ITIH HlG b aC-LLŸ DMpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W@!1 0 0 30^ЍU00ì?dPER ?\00S T?*N>?#c!!"N .  "bQl.5:bQX. 1d.#c!!2N 0  ]0@ S 0!Yw0`0S00p S `l0 @ pE``0 S00C  B2=0Q/,0A!b0dP  @HYF0`0S00? S 0  B2<0Q/,0A!b0dP  @'Y%0`0S00 S0 p@`; 0Q,00dP  @Y0`0S00 S0 p@`H; 0Q,00dP  @Y0`0S00 S[0Q#/ b !S : 0,00dP @Y0`0S00 S;p: 0Q,00dP  @Y0`0S00 Y" 0 p @e``p0 |@`u9 0Q,00 dP  @gYe0`0S00^ S()Q1?0c01Q 009 00dP @0@GYE0`0S00> S8 Q00dP  @0@.Y,0`0S00% Sd8 Q00 dP  T0@Y0`0S00 SU3PU/P7 Q00dP  @0@Y0`0S00 Sx7 0Q,00dP  @Y0`0S00 S_0 <008@0 0@D00dPH00L0080 0X0&  Y0 `0S00 S8 0@90@ S0 Ř Y0`0S00 S!Y@0&  `0S00 S00(&@1?2c 1 R11Aãd0Sâ/c1S0c05dP0 0\YZ0`0S00S S 08  @8  p&80 S0R`05;4 0dP  0@0Y.0`0S00' S0 p@`0dPS00D4 0 0@ Y0`0S00 SY@0#  `0S00 S0 p@` 0@S 8 @ $qp  pqp 0@Sn R-Q Ry0c"Q312"0"b0A Yh0 ^ YP ` R  dP Y0`0S00 Y0 p|@W`r0@S 1Yj I` R  a S`]UPs 0@SUW P 0P  Y   R ` R  BP=0`p p@y`20@ S 1h Y)0`0S00" Y꜖ | L ԕ lP)\(\ ףm| X *$ T d   T h  nX $IQ T 0@S 1 Y0`0S00 Yj 8  0@ P  0$ (P, VR\ gR 0` p`! 810 0A! ~0L,, ?A1c$ (P0T?"dN2c 1 11N @0?2cQ  111@/ d0 S  á/c1S0c01dP0 0pYn0`0S00g S082Q0,00dP YYW0`0S00P S ` `o 0P i4 d76C-MP@`.p<0@000 08 @pT `ppFЍ"00Ѝ@-$$@M Ѝ\ O- M`p@Pm뀠P 0 X0X 0 0p0 @d Ѝۋ@ Ѝ O- M`p@P>|P 0 T000p 0~@6 Ѝ譋@ ЍH @-0N~ \0N~@ T \ڔT00\苋00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q BW@122e3cPBz :E.€Q_uk9"mnףp= ף Sc$IųQ\(\p  Q(\)\@  c 00 (: 600+$0+>! 0(a`  o`!!!0C0Xÿ0+" ?00 #2>`T[ c 0҂ (: 600+$0+>! 0!Â!!!0C0(AX Oÿ@1+" ?00 #2>[?W'`FPGp1#1 :#0! a,V"! / 25:$" 0"4#2><"Q0 3 #L201d0U\`25? B4sppp0/S[0 is c 0h"(: 600+$0+.2(a1110BX2 o;#0(``T[`o@t c 0@0#$: 600*$0*.P3$1110B@Tl3 I:#$B0Nt3`0 `cR`@ V0#T Ba!kYC(1 ? c 000$$(: 600)$0!)>P$ 0Â!!!0C0p$Xxß)" ?00 #2>r/E B 2?A1c1c0R@ 0B 05P!@ 502c(%2c2A@" "b1C S/  0@ p0\X%X:#包  00u!ό#1 W?0}:5$  *4Ϡ! 5*111A T 1#0 0! C2 ! 02">"@T0@000|&  0@00U``PE0S0@P P$ 0Ѝ& t)1?c 0 0J0 '):60 0($0,'(>!!!0CD'0YL("1 #2>L<0`0@<' 0 @<0`0@ꌇT 0 O-`@PM 0S*  U 0%? [P>psŸ !" 0<0  0 S 0 P00_V00<0 S" 01P0 U 0< UPǀp1 !"3p ~0U 0  R!yh&0P l6m&NSp@0GSH0P0 0Z0b 0S0ƒ!100 0[;hhPx@2[ O\1X00 1@T$ <T=0 S0S >S@ <S*S0S -S0 C Rp@0G100H 0 b9@h&lFpFtF0N  0h!@1 0 0*T@T -T00D S0@0JSn0S,S  ;S  RiH .BL S` ,S;S\d00PU 0,SRx@PL 0SI  H L bh& lp&g.tl68$(,P0` ؠP`şDw6p%cR0#03 1d002c2c# b?0ppcW"Z  ^  R P`N |4|$cR*p$lpLP 0(,P0`p 04(p0,$p 00P#cR0#03 1d002c2c3?0  cRP c sP  RP0t#3>#!BcR*x3t3(p01c00,^00P00D#4p 8 00N  0h➃@0@ ◃ @t 004p80!/Z0S |Ϡl a^ZQ `S@ʟ@ < VP@@% z .X )  W.y 5:IP % ^, Ό3# qdO0 QS@dyWEVPP$ `@E`E`ȟ(ȟ K,(aoZ.h 11:h@h$ ^, Ό3# d S 0 @W `PLH@ 1S\` VPE_ 0(!:60 0 $0Ϡ! ' >0!!!0Cइ 0Q ?##. 0Ϡ 0,όក(~C1  ቂᢍ  Dǟ 0 Q0 pǟ0 ' ^, Όp3p#p q\ ` V PE    U&0 0cP:S8;Q$0(080` Pp@`PL40#XT YW W0#Qp? 00?0S 8@<W 80<8p< 0 5/P `0Z\ QX Q~T QzP QvL Qr p0`S P Q$% Q!S, Rl0S pWg 0 SdJ1F Pe,Px` BrIX 0S@`TJ#M @A 0S7 0N080+ 0+P0P0姾`@EOo [*[:[$4[4*[\4$*[B@#[1 "*[$![[$ ! *[[ *[ [$Č*[[ *[$[*[ *[$ [*[W Z2\T}QR [ *[$ [$ RI SG` VD  ` ,^6TF 0 FC:  0PS.`Z00æ0@T )9 F0 0 30\Fۍߍ0/S 90BQ 0R/S  5P ,DI@@H00`Z0@TR ZSZPQ J `@p 3N$ (,004U= 0\ 4 Q"<$1Vp+ ⁡ZF` R@!X0,`$ (004@T@M`^v  \`0\ \0$0\4 \$!?8:[ Sa0J08*S R\ R\P 8ZC7PO L| 0Wp@0P 0@E+.C E0a S`Nph@@W yP0W0 @0PY a0共`LVPyP  yP0/SR0/SOP&0/Sr F`Fh QPQP Q Q@Q@QDQ PR9 像AN h(0$ \}$ (0Nh   Q)`z@ P$ hp(0,P0 0^  4Q"<$ 1 VZ $ Q\  Zp@`$0^ ^04 ^$0^$!? $L\ Z Ao pd i0S PW"@0W_0 00S -@=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``0SZ0@?`cX0SPⅡQPZP }SPPA@QM0`0 RW@ 0# C !p|@pP(0,PF̉S n"1 R 0oS0" !0S  0H0B 0410S01 R  0S !0S RNh0B|00 000PW @0E a0`ᅱpl@1 \像B<02hC% p+tS p @ 0,P l l hhNA-pQ@X 0Sd! N,00 01h6l6h`P`P 0:S  DP `VpFPU N hg0PPT`VNLg@_ `S T 0:S*S+0Cs013ZS@Sa0CSR`P p@-4P4@P@ DPp p@p 0 00P/tD p,0, 000S  {/LD p P/ p @-\F p` |0| 00P p@-dPP P@P  0Tpp@z@p 0> p p@-PDP  @`PPp]zP`S@-@z0@Qz@0 (A-0 00P0S@@@A Bttt``0S@PPp@ P < p أ p@-`PHHH@MD@`0 aPN<h0(0Ѝp ,p@-PM`DDD@D@`0 EPN<h0(0Ѝpx @-p`Pddd@ MD@p0 *P UNLh@(@ Ѝ@@l@ P @-` MPp```@Dp@p0 P UNLh@(@ Ѝ@@l@x  p@-1!00`0S2 @P/0 00PU  0`PT p ppD'` `0 `P@y`@P: p  Xl T T0p@-@PP H p@0p44D$ $0p@ bt xp@-@Q0 0PP L 0p@O44D$ $0p@ A `P0 0np@-@P0P44 0D 0p@ % @-0@`4M000$0(00 0 000D00$`00P0` `0 0pS`4Ѝ8 t @-h BR\ ZR00cSyT 0 ̌ p@-818!00@0PS4  `P:1080So" 00P ʀ0h T 0S"ZV p<02@T_V ` 0X008P H00P`x0`p6 p  8 d\ G-P@UH\PRp^@DtPEp`Ϡ pcWV 0 0 \V |xT 0 T<0BT00 W0p@- 00S" P@ Z`P008Q x00P  0P@T Ep 0 `?xP`@3 p ܚ H p@-`@P`P U 0 D0Pp000\ Lp@0A0 vU$BT0  v2 $  D0@-00@S $000S 3/4AAp?p@-LP@TpP  0 3/P x{@TpA-d0`0pP@P UP xp?$ p `@ AG-Pp@  ?o2W0S Z #`v% :/P@D @p@TP0F0 uhPGP p` 80uZ p8HT0 u HT0{uꄂ h 4 A-PP`@! ppT P `L2 @0L€00#S €^"R000 (Ju?`? >p@-@R`P  p@L0X (/uP p@-@RP`  p@L0X (u O-PB@ Mp?0P2ܑܱ0 P2LB TH `SW !Q L 3/L2S"P2S`% @T2 W0 R S `@T& 0RS> ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2/P2SU PFU Ѝ\00P2S `@T 0400P2S >>===0==<`<4< A-`0P0Q0PP MS@P1 V7 T=p`0 80xq|q8OT@D @@`@p8P1TA`NPP%0@ 0 0 1 30ލd0P0 (>tVHQL0 (5t3vT 0 W0, `+ } } -(0( 00M 00Ѝ*  --8M$ 00  0 0 0~ЍЍ/l* 0--M0 pЍЍ/p@-0 0@PXi`00CS`0p S u P `X0 X PXipXI`u) \0\ 0 `00CS`0ppSr P X0X /X*`) --00 M (0 X ЍЍ/( --4 M0( 0 XЍ Ѝ/( G-@SpP] 0S:X( (S Y" WH i0` V V,* pt0p0J0S0PM``uT 0 @00 `pp`A0P,0`Vp C000 \i Ct0 0SJ 0 00MiQ40 ,sp0=0 %sIoPD@0 s0 0C*i Ioz y y --M  8Ѝ Ѝ/ -- M0 0H ЍЍ/@-Q`PP@M8  /pP& Eq@P#  0P S 0p@ 0$  0, 0 (0 0 Ѝt0000@Ѝ 0>jЍ00>0 r% 0lx @-@P h 0#C@h0;0 r0x RZ@-p@-@QPI 00!R ! 00! \ uP 0B RQ`' Q0AP R 0 U00SpfP FfP `@fP0 PW40 Ar 00B(0<0 7r5t 00(w v A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!pP  w0S< 0[1!pqP  w0S p w0SB 0[1!pS w0S, 0[1!pD[O[Mw0S 0[1!p3 P>   w0S pT 0[1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% [1 0!p0 *R# 0B Q@ 00B SP i  w0S  qp q  w0S `p  ;  w0SV 0[1!pw0S Cp  0[1!pwX0S 0[1!pw0S 0[1!p}wM0S 0[1!ppw0S  pw/0S 0[1!pWw0S 0[1!pJ pu pn pgs R  0p 0Z  [@ 1, pJ pC  w0S p6  0[1!p  w0S 0[1!p I w0S p J w0S 0[1!p npD gpp T  [p$ Tp MpI Fp)_ w0S 0[1!p] w0S 0[1!p , wt0S p 0[1!pnE w0S p$R_0@' p7 w10S py  0[1!p?w0Sj 0[1!p2w0S pXw[0S pL@ w>0S p?  0[1!p  w 0S p*  0[1!p p P  pC {p tpD mp P  0B Q^@ 0B 0B P$R8 w" R 0Kp0 [1@ P  P  P  P  P  P  P  P ~q0 S p  0[1@!r P d$R@00 P Y P T P O} Pz Jx Pu Es Pp @n Pk ;i Pf 6d Pa 1_ P\ ,Z PW 'U PR "P PM K PH F PC A P> < P9 7 P4 2 P/ -s &t  P( & P# !w0S p  0[1!p P  P  P  P  P O-@ϟM M0Pƍ0TH P@ H0S 0T00!R !000h00 Q 0SN   RT p H 0  0 L ,/찍 4 K/@(嘰d 00080l0`0$00@T$ `%T @T0PFU$0pJ!(0PQPw00$pT 0 @P `~0-1,0`4 0EZS00 P`P   R00s H0S P`p>+h1RRhOCh>TQ.`CHmˠ0MPQPDH T,TdD@|8HLI`P$`c`P`$`0@ 0@004p00EPqp00E S$U, ,pS2 U zUP ^0P00(00{0$080S 80匠0@0S$00$00ZZ ,< 0 6 30T$܍ЍUX 0D \l@U`X QP @n~@\X<D-$0\, Q00S@00儰0AXP\ 0,0\K0|@DT!L\0`P0Q ,pAW#S@0$000(000@T0Sv ^^raU` P X0$ D -1 00 S0 00 SP0100 P000p0 `P 0BL00?V0X{ r -!S 80S 0P80 0p0S-0~00s<0 PpGW0x*0 Pp0 S@0$0Xڼz堠pt@ @ᘐpHX   R ^ X P  HX( 0t@t0\0~Q-Q3BS(-0d0V~I 0 @\0U X0  <0D0S  XP @@U S(0^L0(0CP0)0A00QP  h00Q@TG L 8P~@\0`0S  XXP @@h0l0>00(S0  BX0P 00Q(0S0  1X0P 00@~0Sy 0~Q00t X0P*( - t QS t X0P(  t T800NS `U~#?0(`0 @P0\@X@<@D0S<0SP 0PS@@Z(p_`P(pP@FJZ   0RP0 S W0P00JZ0  0\0 < 0   SP00 P0Ϡ 0S-0q~0 0@S࠳   @o R 00P1s 0P0WX\  Ď@X  D@ 0sI L0 0-1S; 00,0QK0(S0&(0D 00 ER0 nn2!  00Bl00?R0S_ 0l S~P@@P8`/\@X@<@ oT 0P ( <0SPL0PS 0@`L0 0^(0TT0P009 c JT0P 00{ XR 0P ^ 0Sp~`[ @倀;> ^% 00~  0S Ϡ^-Pp  R  00PSH 0 0pp0\^[ 0Sp~`@SP001P$0 c^<  00 S~  %p S0P 00k  SD0P 00 00 0H00 `꼜 X@ 8@ 3@ x З < xd9 8 @8 4 ̠2 0 @/ DL. - + ,+ >@H  %L`Q0#"002(c`38# SD0P 00 S  P000 P000p 0 nS0P 00 |0-10l0XDpdP0pPE<S 1,0P`>p x0D RPPS 00C? 0@E S(0N0<0@8`\0X0/XP000 P0t@d}4R堀P(PpH@DT$   0RP0 S  S0P00 0S  R0P 00   0\@0g@mD? P6a T0p@E  $0@00P0PP0@9P 0p0P P0 00~RP0 00倀P000 0P P0P00P0sTP0 00~RP0 S0  R0P 00(0u0D \_00CL0B P0 R~ P0 ,,0A/\u_SW 0 0p1i^V 0R! ~0WpF^ 00~` 0S@ RN 0P1^N 0R! ~0/_^ 00~` 0S @l>00(OQ@d@P00ppP00P0 R ~P03P0 R ~P0)P0 R~pP0@bP0PP0pZP0 \^CP0PpP0P0 R~pP0@?  )S(@00D \^ B0?V0L 2@ SP00P0$00 00H 01p 0SP0 , P0P0 R~P0@ ;P0 R~pP0@P0 R~ ϠP0xP0 R~P0@'P00ppP00m @P0 R~pP0@P0PpP0{P0 R~ ϠP0Iy8 &P0PϠP0 @l< P0P( @ < f 0@000S0 P0pi0\0X0P`00E SOpqp00A S$Q0#S/ 1 0P`O O SP00P0$00 0_ 0 0$ 0H 0zp@S0P0`1 ` 000 P0$0H 0cp* 0SP0  P0 0pp6@-@`P MDpS@0p0 000@S Ѝ4 A-@P`pS0 x0@SO--@/ pj0H30P  (  O{(j3):0!**R7 0P000$0110@00S@(@P p0 0[0S0SS I00S Y Y R H0P0 4[4 0090 0pG04a^ pn0G040S  @(@9U Z$01P00P0 0009 0 00400A-@P`XUTp 0S*P @Xp@e@Xp$S XT@pX@:L #*460/Q /*460/P@-@00 R@P@Rp@-P`0@0R@*0Pp@ R 0 R Vp@ 0@!O-0@ MSX@DPa`101 0RYq`":0 6  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-`@0UM0@,P.0L10V{{{ {0.      WW4 @-K @- @-p@-`P@ TP P0F R @P  V00pP P 0?0 UP p@-@P WQ`PP  Vp0:0 U -M Ѝp@-@ P` !LNR !@Ap- M ЍP/D -0")2b3c1@2`M1 ЍC0@-@PPM {  0{ PZp`Ѝ0 0;0 4U    p@-0@Q r P p0 S P1 pj PP   ! V @0O-`MpD.@0D0QP0+5X! @0S Sj @ 0 1 bP  P T@@  0  WT`r ЍW Qz@0 Q AX0P @0   P 0`00QB@`VRTQ`p0 0"!` b  V0 XT@P@0Q=W 0000! @TQ- 0P0@20f  000VV" 0 @000 @O 0Se0T0 2aPPlv"! 0#000 @ 0 l`@Pr 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   TV X@@pp0 `f360@p1W@:b : PPO- -4M@0  O0l0x0 0&P t0p-P 000P0 0 00@ S040w ` 0@t`00@ SVV!Ђ0 @ 0SЍ 0S0 EP 0l0 00S $`,(@S\ ?o280$0Q0$0吊g{V VGڐ*5 f01k5UV(0 S (0SG( %0fSt(0| FY!0 S (%Y 1  @ pyPxL |0p0LY|0 ; |0pP0|0 A R< Q0 tCY x YpOyk0p000400 S|  <00S00<00 00 $003 (0,@S A,8$PQ۟䫟˟滟P?@0 0HPL0X@H@C 0P0  L ! Sx07 P x   !Sp@|4 0PDp0 W,0@0$ 0 @p`C0D,p@`@Q0C @D@`@T00S0S@D`FpG,0SDQO(0SVW 0P0 7 `P 0S0S @  @ PpPppW0 80  R P" ZN<00 S0l0 $@x T0 @DTQ [ Z0MNpT0 0p$ 0#[00S|0D0I hd @PZ dQrtWx  ! x PxI 0Sh p UbD0p |0Z0 0C?o20S )K{8Ik{_Zɋd 0S     &?@V瞯<?x  ?N00XS ptp0P P0 0<x Qt000Sl00l0R  x lЍ ,$t0t00+S -S( 0C ^0St t00S 1C\@Z $ R4iS* %IS' NS-dt` > P% 0l00 00t00(S6 000x P PB \ ,$ EQ0 0,0x tl0)2S$"8{PP*"* /B B*  *0CS'ʐ: # 0:II0H   {0 0tV0r0St00S n1CQ 0ESI 0 At@pH  i  h3Y01{ @ )2S#{*"* /B B*  *0CS'ʐ:# 0:II0H 7 {0 < PJ Z000t0PO p-000(00t00@ `t00C ^}^t,t00C ^^0 ,S0,0 V`∀V!Ђ PP`TV! 0Ct00C [dt00N0C [L\Xڼ@(Q@a@nS  x Px p0 0p0js% 6@08  ,  B1kl00{0 G GiPv|0 00*$&%&*&! IH I `xP  PZ/ 0IPT0 tPxG  B\ 0S< p $0 0R0p 0 0P01  P-  pa 0P0s"@ 0P0jxS Px <0| 0C B<0|  x>0P 0꧋{ ZNj Z{相80吪SI8! 80S0T00T0␪相T000cT0Pxa @P B\Z<00 Sp  Bp 0{j{I{7{l0T$P0X@l0 0S |0 0XVTHRP |0R! 00SA S; SP xB0x00 l0000 "aQ!*8P00  0c230 0x S 40S-l0Q000l0x @0l0dQ"00q @Bx Pxi |0p0C|0EYA??Nh0 00 l0x0 0080q_ pZW000 0tx0Pl 0x S 0t0,0a$`8(0@0}x<0| 0 <0|  U $PX@ppEW0 xs$ Px |00C|0&Z{相80吪SI8 80pS 0T0 {Nj0l0 0@,0AS$`( `400c8050 080H 0l000 P8 $@T s@DP.$PX@x <0pP0C|0|Pxctp`P t00Ct0Pt0 0t00000x l0~ !\ \ \ \Q'tp`0C0,0㈀ 0ES0$0,r0x000 0P 0l >P"0x 0K8^@0HPT0 0H PpT0P `t 0 `, $ P:S4( 01P:|6|0 0`$%0 85S(0Á!{'l 0 H P 0 `$,a$Z 508  f{({' A1kl00{'0 `$PX@0 B0T0 08pT0||0 050`R!00$PX@l00P00l00-Z$PX@h 0S~ xp0   ~\0v !00 00C lp |0Z$PX@^!0[l0 00 p<0SpW`P} P pAm 0 00lx j0S0S 0$PX@x 00000|0P0l0*$&%&*4<(! IH I:[! 7 0l  # U  RHx u Z[ 0l0l $PX@ 3 S 0l00` Px  pp1LpgpPp00p0!0l0J<00 lS |00CxpP|0a!0l0x0 R80S4004020l0|00CxpP|0Pxl0,0!@-00G-` 0Q`@PH PpPa0s z #8 *8"80 V# F0V B 3E  ^ pG0s#8)80ᴐ^#Y 0U 0 Q 0PP   ! wM"@P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   3L0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ{;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:iЋ O-M<0p HJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0SpP [ FU 0  UE\ PN Q UP   U 0CC10B1P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0L"00IZP0D^0[ @S0 QL 0S@00S P3 4^E *@C #`P `D21 2 Q\` U00 00S@0T@DUQV`Db  218 PE 9 @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E GP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq KP@"00ЍSn Sh S4 `Pb@00@0 00V@ !mJT 0 PeS5 0 0@0saF PeP\  0 S S HK@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@J0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S 0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P 긇  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPV 0 BP @` pT  0 BPp0U`98@-- M` p@KU0  B00C2S*ސ* Q6cZKE A Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ H0"S1 1  !2R / 3RS/0 00 c Ra `` 0 ` RA 880 ` R/HPA-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q @ЍA-(a(1`pP0MS3 U10AT !0S 000 ̺@T  0S0 00Ѝ  @00D1S@000ٺ0S 000кx pDp& 0p@-@P0p R pPQ`00App@ԼD `ᱺ80 0QApp@襺Xw p@D0  +0#10/sQ#8sQ#4  00/sQ #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P$pP   ! Gl`hP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  &G  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1⍹ @P4 P1 p@T `P@T10SfP@$ 000S 0c0^@T 0C  pP@h0KiV0S <0@ ,0R0i s pqD`@G-`0b@TP塢ڃ0TP$ Zp  SF p0   a!  \2)R0L`0C\0030 `.pG \ `$-0P!1^$23\ *G-0@`@DTP  !1QF*32\ H*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@ H 00P0S 3 # Q0 A B  02NS cP 0!0P` A-P@Q`pE: 0` P0T @ *\ l10E T56 501 P56 +C0T `6<#511<?@--` M@P@P : #z:S W 0  C.G B 50c 0 Ѝ v0P c2# RW C>C0C01` Ѝ0S0/0 R /@-Xap`@PMA @1P4PP2  pP,0S  Q3 p 0: S,BP 0uPP0@ 0$  0,  0( 0 0Ѝ4F00Ѝ\PL0E0 %D#F00FO00k 0p@-@P :00CS00 P:pP0=0 C$@-@P 00CS00 @0I04 Cp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SE 0 p`0>0 Cp@-@P8 0S< 9 P00P! !' 0S 3/PP೼000P @ P 00 00`00aar9\0`` 0p7P,080 GCEE 0P0@-@P 00!R !#P 0C 0;0 'C@-@P 0 0 S @60;0 Cp@-Q@PPR 100S4 0 US 5000S: 0#$0 3/0P:s004p00P @ P x00< R 800pA0PȶHö6P00s07`0J08 B  0@000 pD 0 @00df p-Ѝ/@-^@S S S  `0@  D0@ c~D 0  0@ 6@00 00 0000/<P@- 0At @ZD41S O- P`c`EM  A 4/p17/9? !0(l (|  p;o7@p:/ `;o$ 7:/(p,$`;o0(, 7:/4p80`;o<48 7:/<`@D L;HL@̀FGpE`JK t (`DI | HpŐp$ ǰĐp@`Xư`0`pA/`;pd APpMOĀmX@Q 0piPSQ 0piPHQ 0piP> Q 0piP4Q 0piP*Q 0piP Q 0pxiP@Q 0pmiP YEߍCO~C,Eߍ/aQ@-P @41S  P  P0]CA-4!@ pPP/1S 0L1 @P!ڶPPPUQPMoP ʶPQp W  Cp_oRCpCpp@-@P 0@᧶@A-@`hP] VapP[PQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V B0@BB@SSO-P M1 Sw$aVp$(q SSp A`TO X`A (0Pʀ R `(q^ 0P@  Ѝ Co$B/0S (xp \ Q @pT`xP0TC G(VJ ( 1$! AT$$(0 [ `(0 A^% S :0  @PB@@,A \$O(!r5 V(* T$1$$H0 ?([$:((~ Q  0 $? $ @(!$AY 0 $?0(S 0 6oPb ,0^0{$Xꌷ,O-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 mPPu2  $`mP$`  0 `P% 0@SP㲀0C  P\ \1 \"  eP  0 hP@0`00,Ѝ 0 hP0 0 †Ằ[ PಐU I  eP(A0DS V(Qp  0pmP 0 @-@ ! \ @$@,@00,1S@-@0@ @00,1R@-@1  @0@,@ ,!O-`ᰙ0S ]M= pPw@P Uq  @| @P 0 Up3 < pɟ00 8p4  D#?@ ?p PXP }V P0pS40X W!3^ TH ^^@4:P3] uD H 0$ fP 02 KA<,0(5 = Q PV\^ P  0p pt 0} V( 0S% A/ 1++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^Բ  9/@P OPt>P]ߍ|Ÿ 0( P p1DN90  !NVq QU0 aPP$4Q$Pc @Aq!弡Q0 0 ` 0! `]ߍ> >Qt~> R2 < p 800p4  D=@ =^>{ Z S>P>@PqL>PnG>PD>Pd0a<>p7>p]T Ta`hO-(P`P10p5fS@(Pp5 RؑzP- () ,0[ D D S 1"1 Ofꂡ ?P ر 0$ J< ჱؑ@-@ 13/, (Q0@-@Q -00 2= 0 O-fMS` $ [pW  "0!0 B& %@P< Vi V1 Ve (0aV@ +&TA  %@P# 10CS`*0Fs @崒 0S 0S 0M@T  @崒(0QaVU @b,  1% j%@P 0VSa V0F %@ % % @ ⴒ[ @Iy洒 U(01ḑ0CS㣠y'*z0YV) ` %V +%@P 긑0(0 @崒 /`FvVv @: 0 b3 @1b0 $3 @崒, 1% %@P 1ᴐV0CSy`!*v0Ya V0F1ᴐቐ  10@! j% $@Pc ` ` A0b0 $D30Cs 0 4 0Fs/0!10@崐 >% $@P8 10CS`:D0b0 $3,0b0 $3ČhLp@-@`PP 0 00(0`00Q(0pO-@ ƟP LMQDp` $00 2[V  400%5 0 D0 30\LЍ0w R*R* p 0$00 <000S0 P8080 0Vk 1S6 .$P䑄/  00 0!0{Ⱐ0 BR张:1S 0ZS000 P 0 00000S !$  P 0崐V` S0! 1 BR,*0 G P 20 2r(k i0w Qx #`P_ 0 p A$R0CS㣰*{0Y* C00C ^1! 0Cs0 ! 11 0 K0F(0  0RK 1S RQ  RYF  $ 20 2A0Q0i*10CZh PbJ0V㰐`0 2 i Sf # p 0,00 4000S0(p0000(01 S0"1!{/010CSP*u00C S {?尐!0b0 $1c0y漐`尐0300D0b0 $z1,0b0 $s1% % 4O-(0pM I @aP0`f0PP P FP1uP0y1JZqa@0 R 0 1Q@@10CS㣰N* 0Ks0S0Cs00 VqS10C1(0  0R/ Ѝ@ Q! R b0 `(0p) 0  PQ  p 0 0 p1 S0C1ȁ3b0 $0T> Y3 0I 1pP(00(0U QPEUP*0EY*0 p1Ps YQEQPEUP|*uP0EY Vp崑 (00(0D10CS0I*S ```@0 `p崑`P Q "PP @ PAPV(00 (0"0!0!0 !PPo 1P0CS㣠7*0J 1P(00  l"0b0 $Q00 1pP(00(00b0 $>0u00C StQPEUP:P0b0 $/0{80b0 $(0 7"s}zzPz4zp@-@PQQp !P 0 0"Q !P 0 0"ppO-P,a V0Fh  1t!@P! `Vp0ഀ0 0 po 10CS0s0*S0SS PP 1b0 $/  H 1zp0FV㴠q1p 0 R 0 1Spp10CS㣰4*0Ks0S  Cr 0 S00s060W10C1 ! R bP  0! 0 ZP! {!0b0 $`/xwO-Pp@Q$M f!00 2uT T H100$Ѝ(  @f T0 0$00 ~ `PN  R Lt@Y* dP 0PeA 2@D @dT㴐: 0 bt@ /Y:Aᴐ@DT@* 0t@ @DOoS0CB0  0p= 0S0C@0  )P 10CS0N*s0SQP@ ] pP 10CS0*s0SC 1 X1@0CS0*s0S!P  m  hTp*t@TsP^ 20 2$Ѝ4b0 $.T  4b0 $. T`  0 0 P1  RA @44`0 0R7 `V v q, W@ t@@DXE g q Wl 0G 1P AᴀW@DT@: b$=.d3b0 $6. F A pP]+P{ 2b0 $.02b0 $.G@W1 @t@ @01p 1 0@1@p01  P@ Iy0   qP v@T 7T1/00`   P~ ,` 0R @T 뼁VpB 뼁0V" p0H 10P] XR  B1r W 崠0pG1 #!0IpGsw0崠1 加1 0  P5 10CS㣐:\0b0 $q-   Plvss@slrqqXo@-@PM 0 0 P Ѝ050 H-nO-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ jP /00H"<2 0 4 30Jލ Ѝ >@0X0 0UXS 00; Is0, T:)[' P0K/S  00P00: S .000S0I S.?00 1X0 ,QP@PV# 4- mp!.0SY  \0 RK Y P.00W ᭳p z⬳P .@oo8 G Dn@m(mR Q0P:Q0Q:z-@-@-@@ $ @\ 긺 p@-@P#)P$ I p@cໟ4 ǟ$ 0@-@T M 000 @QP 0S  Ѝk 0O-TM Pp`0H0 @D8  $(4PD 0,0`< @@pLp PP  좟쒟肟 `p  @$ "dXb`%0#  `!,l(a `& `zcna'b(*abf` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah猈b,)` &`dL(bdl+`|.plXp`<%cjgpl& ```ga*aldH(d` &b()`b`j+g .pl\c:%pWpl̠ 000 0p. R+. X ( - h   0 0  < 40 0 0 30Ѝ\ pf @-pQpP`MDf0S7 @P PEUЍ Ѝf0S"  p #'p 0 00  0p@  {p 壞Tp@@ePU ӝ @ P唞]卞$ *@l d 0O-llŸdM \000 00A0PEZ!0 B"3+S+s`@? W: Re:0GZ0#Z(WG @`p @ `@`@P W0@P[ Z]!|1 0 \0 30VdЍ\\0 <)@  *W; @ A S@ 0 ` *@ [ 0`@h0 <) T:0GZ0Z tt0 <)0GZ0ZW[`0@ ( `baha O-$Ÿ$2 M0p@`000 刀 <* P!0  S P Z  @ 㔑?P N^艐     @PF F*Z3 Z0  D 0F P  xP 00e @@(P0 f0`00d X (0 0 0 30Ѝ3t `<`_\l p L x 0@- 04M 0P0,00M @T d 0T T H0 0 ,0 304Ѝ0$ O A-$!$1 0HM Q0D00@P ` @qT( 0T-  ` aV p 0V  ] h X0 0 D0 30 HЍ$ |$ wT ȫ C- 0 04MP`0,00%`@ pW:T p 0T %T H0 0 ,0 304Ѝ$ :›n l 0@- 0 ,M0 0$00 @ P-T ` 0T P D0 0 $0 30,Ѝ0$  ꔛ@ @- 0 0,MPQ0$00` a p@ T 0T p d0 0 $0 30,ЍHV?Z/<'$ [h  *vP P00 000 0 O^Vv`4*V 0 rPP:Vv` *V 0 0sPP:1bL0d p$'|bL0d p'1\bL0d p'@bL0d p '$0$0 $'$YYXXXO-4M 01X0CSPᰐ0*10C 1R00r0 0*0S! @p`40 $ ,P(0Y P P0ES00 01P0P0PYi00CV 0@p P`Uv`d*0Pu@S0SZ 000pVwp:@@T,P*t@1@A(0  0R 1 S0"s0&1!V 0 0C01ő YX0X 0Ӂ 0C00 䒟V*R 0P0@Pr V @Bt@Q 01Y00!00Sd*00CV` YPU:( $0$?&01 P0P P P r01P0 P0P h\P   r` @pX0v`@Vt@@TB*t0  Y !0s00 s014Ѝ   r   rpGwp@@T,PL:0 $%D00 $%hbL0d p%L0 $%`@p'&WW|WUTSSSC-Mp`@P%  PP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍO-M@ p8lPPN 01 0 0 0رR 0ⲱ 0 1ᰰ0CS`G*v0[: ر 㾙`PF 01 00 00Q00岱000 P 0 0Q<0 007!p4&Vpǚ@PЍpЍ 0p!0@P,bL0d p% PO-\M`0儀pS>D0@ P(0$  t@T X&*1#0Cs0 11 " r S 0 0 0@SD@ a,^p  $8 008,000F 1BPR `V 0`0 v`0CcS00 p㰑1 0CS*0S 00p"@ `V@ 00 0 00CS00 1!R p0p  0  00 0VS00 IY㩐*y扐1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 0#S1 0Cs01 1   00000 v 0@00DpS, 0S 2  0  0 ,a0S @ R3@p00 ,G 0 S@Dp     \Ѝ3@S00 01040封HX㨀*004 1xpC0wp0qqᰁpHX㨀*0x03@S00 01040封H⨀Xx*X 0 0 sP:400 H x0 岁ᴁqpGpWwp*W 0 0 sP:0 0]  IY㩐`*y0V* C``F  001`01pL  } y@ s oe`V@Dp  0 00Q00 0 P} 0 0 0M각HX㨀b*x戀1040F각HX㨀O*x戀1040`bL0d p# 2  0+ A]@ \ 0 0,bL0d p#/bL0d p"=bL0d p"SbL0d p" pbL0d p" 0!jbL0d p"hbL0d p"Lq0 $"DpQ(TXOhOIHtHTH4HHGGGO-@`şM ,p00 q p *PG A@D@Tt@7*T/ p @Ѥ@spT PuP P 뤰P@D0t@ "  !P0 @ 0W 0GsP 0k P b$["0  0Ѝ 2P  pUQZP10CS@*t0UQ 0 0PЍ P  ᴡi @P 60㼡 W0  {00CR $뼡@ W 0J 1P 0ZK[0嫰:2b0 $! 2 p P uP 10CS@c*0D@ 1 PPE 0㼡 W0 D@ZTj 뼡0 W P0J 1EP `1b0 $!1@DPEt@ up@! @10p  %P 10CS@: E(1b0 $!D  A0b0 $y!0p@Dt0' 1 01p01z P0 1 @Dt@ @U0PE10Z!0s00 !HPE8DCXCR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ል @-@P L  0 0@ (! 0"AO-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00ЍXAh@ 0G-1?p@P` @g(XS H! 0@0 0$0@`F0($0`Gp& ?V:@F?@( 0@  @T 0 , 0< 0$00T$0?`@p?V @?V@F?@ 0$ <@@ T 0$ ?@@@?`V ( 0$ a0 0$ A-@PP! $ap:?`V7 ) `0(0 0`0$0d0W 03?R0Ah w  08R(@R )@ bj (`8 b )8 b\ (`R @-I/ @-@-@P P Ό 0 0@ (9 0";R @-"/ @-p@-@P X00m]\`  0 P 0$$pL;O-$6LM0^_~?800@( ,0  0 ( 48pH`D  ,$@0G-1p@P` gPX? y@0D 0 #@0D  H00H0L00L0`FP`P6VFppp@0D ;  SP@0D *H0L 0 H0L UPP`V P:@0D a0 #@0D H0L 0 H0L VF Pp @0D ;  SP@0D *H0L 0 H0L U`‐V PR @-t/A-@P` -PF8pEU@ p@-@P X00k]\`  0 P 0$$p1R @-:/jA-@P` PF(p U@ `03?0/00@-<PM0 P97@0;P4 zP DP6E@05P' 6P %ڼ6P 0P0Ġ@ 03 P0H yp Hߍ0Y00ߍ0?CPt 0P@  @0H Np HP ߍ0P0Ġ@ EDCB4P@ P0H A 4pH0<,+*)(&%{ {@ 0Ġ@ 0P^xd`GjFf|0Ġ@ L.`0Ġ@ <D0Ġ@ <840,(2.H∢P H~P h0Ġ@ ,D0Ġ@ |(0Ġ@ d     dtF{0H {&p h@ P0H Ap D ? 0=@0S,p0Ġ@ bR84|44@31\1<11<00/ iP.,.- 0Ġ@ Bѡ{G-p8M(`P {{ @W@V@U@T4 0S !Q4 0S3 Q!-VL W`0b U p p P\K  0 020  @ڍ Ž8Ѝ0SZ  Qp 0{ 0h2{`"P 0w ! r R  #m:VW$ Upm P`10    0 0UU0  P R & U  Pp\ P0 0VwW0 UpN 1 P0  `  } z00 R y000 P0SQ q0Sy Yb @aU^ PTd0P0  T s (Hs s r r q q q 0q q +hp o 0 P0  7p@-0@T 03/@T@PP <00@T 03/@T\p-H00@T 03/@T$Ռpo o o Lo Po o @-@M@P Ѝ{  0{ fp P(0A0 A (H-M< 0ЍO-p@R M ഁУP  `B80 S! 0SK: Z 0 Z 0"80S8  0Q@0 E 0 0 Ѝ 2  Z  00  00 0 P 00  P00 2  ኍP   ꃍP  000@-0 P R@MP Q( ! 0  0 Q   0 13/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! { I PU p @PpP pPO-Mq0 P0 pG 0  PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@g P 0 a`F [ P@D pT P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-Ÿ2 0|M@R0t00`P] 00S80S ph"`2 0 t0 30|Ѝ4P  喉P8 01\ $`0P  8 0 0L pX; P&8Z? 1` 81! 004 4^ 0P8  R8P84P@PXP`0:A@8型0 801248 Q :0 S 08P刋P82P 8 ` 0pP 80008PiP8k00pf 4a O-ɟ M@@D,\($ 0} pWw 0H"4SnSl90Wo 4000hh00c0P.  e00d S  S h`I dPP& EX 0 0h0r000 @h0S000 R @P :SY 0S c/ d[ c/W0 U 0 X@  0 S   0S$ R0200H2S708 R400W 4p0p\ r400p4`400刀]` 0  $pA 0PW:: w` 57's0_UPP6048 W00S  0 \' YPPU PEWY0– 2\8 Q(( Q 8PS 0 SR7@T v00$0S  00@8Q 4Y  [` TpJ 0S8 0 5 P 0到SqT2 c/00< SG 0 SR@T 700$0S ,0S !s$0(0S (0@Tp 9 0到S c/ dh R   P 0 SRPU 00$0S  @?00 0 SR@T 00$ R 00,"00#3 0 2 30ߍc/ d' p 8Qc 0 SR@T 00$0S  00@Jc/d@0h@ +rX *㈀2 `0 R(S Uᅀ00*PFY`l2 08`0p4phTrp/cp0 S ((Wࠓࠃ\^` `0\L\440 0 8 \R8 \P0` @ eP 0 SR@TF hF00A@ @ h3`†(0PP ` s8@P@@ ` W x@  0 SR @T  00$0S  @ l  ` L<^ p] Ȫ X X A-P`pX@M@`@ᦆ00 0,00(000a0@ᗆЍHV @- A0@ @ €1p@-P@Q 0P ! "0 2pp@dp@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R00x B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@-$!$1 0MQ020# 0S0* /!PR*  R @ 1@r0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@/ ܢ  /O-p?o2P00#R00,MSP JW@  0R0 000$00 0000SU 0SS0哨(g 0 00(S@C0 $P#  7/P 7/P` 0S 0 0P`0`cV0= F B R Q @E"PBPEUP!U Y*0SF* Sc:P 0C0 0000S0  RR㢀@(@ 0 P   `7/ 0P 0B  P @V, 7/PX X  00R0X 0 00 @`0#!0 R0 0X   S X 0 0 00  "! R0 0 S*S:  X  QX F ^ @E"PBPEUP!U @  B*7/P  7/Px 0 S 0SN 0#10S0S0壀S0哨( 0 0 X BuPS 0 1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 C  7/P P0P0Sy,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 'P 0 C07/PK 7/PPC7/P 7/P7/Pm  7/P e@S@8 ) 7/Pg  7/PP0 0 0@哢)YP `c⃰Z~* P  Uu@P 7/PmY Y   0 T0 0#0Q0 4mL0 (0l0 (|-0 M0 ЍPR Q0P:Q0Q:ل@-鐹A- 4PS@M  $3/0dp  QP00 囂4P4S  $3/000Ѝ200A- 4dpV:@T@T 0P0 S  00 S  0p@P0`0dp@A A-`M p@P0: StKPP ˅P@ P 0 a tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0?$  0@-SN 00AS 0O-4 MS|@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0     Ѝ P@ 0 QP300 倁$R P1)00@000dS0  pq0Vp 0  $6/ Ѝ 00 Ѝ00O000Q 000A/0@-S@  R   0 r0Smp@-@PT @T 0 `pp@TvP`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//@-P0Sp@M:Q !SV@Ѝ0A 0`~ P F @{Ѝ_T 0 @00O-PP X 0SL K 0SH p@ap-[0T B,B R`  0S7*V5* 1000P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D0(PQQ  /  D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:J0P 00``F0``G  0Y0C00 00dP  n 0 0C0 ` d 000NP nX0G0 R X<H<0 I G00]C 00Yp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0Z0  0p@-PP0 @`v p@ 0@0, P @pP pR0 q R/ S/p@-Q@PP: 100S 0  R 0   p,  0R0y0  0 0c0 0 P @P ;0 0 $0s0 $0<0  pt D@- aPP`p@M) W/ T6 p p棒P0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0d00 P WH<0 G T(L0 > @ pA-"2 R0hM@PP0d00< 0 C 00  X"L2 0 d0 30hЍ 0`0S# pS~0PO ! WP00\0pS pp6PP0001|0`  0St$p@l ƖPA L10F L<10/R  0 p6{ {5{ 00{ 0SP ` 000p p00` ppl0`  xXP껴  p@-@0MP}00Ta~V(  0T1S OG~0T1S~0`~ 00UTX!\!R Ѝp@}\!~00Ѝp@}00UX\! X\!0 000S/0 pp@-0 00PUp@0}00TQ~U0` TQUP }pX1P0X1~0T0`X1 ph0h 000S/@-@0}0X10CSX1 @v}T1O}0@o}` p0 000S/g p0 000S/p@-P@0V}U0 \AQ\ X10CSX1 p@F}`_~0T1O}0p@;} p-X X0 04M 0,008 00 0 ,0 304Ѝγ p@-@QP  p@Ȑ090  t,@TO-M8@0 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W  0pt pp 0@`> p PPD1?0 $60p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 433333300 0M0Ѝu 0@-PPM @0  QP 8 ,0 0 0 30Ѝ0 8u ,,u H0 S8 0 / 00 @-t 0 S 0,/00(@-0H0 S8 0 / 004@-@t 0 S 0,/00<@-H0 S8 0  / 00H@-os 80 S 0, /00P@-[H0 S8 0 / 00\@-Fr 0 S 0,/00d@-2DH0 S8 0 / 00p@-Tr 0 S 0,/00x@- H0 S8 0 / 00@-q L0 S 0,/00@-H0 S8 0 / 00@- q 0 S 0,/00@-XH0 S8 0  / 00@-hp 0 S 0, /00@-H0 S8 0 / 00@-yo `0 S 0, /00@-eH0 S8 0 @/ 00@-P o 0 S 0,@/00@-<lH0 S8 0 / 00@-'|n 0 S 0,/00@-H0 S8 0  / 00@-m t0 S 0, /00B@-$D0 S4 0 / 00E@-4m 0 S 0,/00G@-D0 S4 0 / 00J@-l 80 S 0,/00@- @/ /H-M 0ЍA-`@pP@8#pW0PpP@-M/"O R ?#0!PO$P P!Ѝ  0S RP/0?c0 3??oP/p@- MP 0 0000`@`0@PP  7P< (0 0 0 30 Ѝp(j j Lj A-QPp@` S V '"RSQ P_ 0Cj ?o/o0CS 00cÎ10VS& /o?o BR Z 0b0Î01pϠT\ ^ R0V0 BV  T$ 0d0?oc008/ooAq!  R! b0r8·V pV000e0?o0c80@b>08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000H / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@R`P R U  V  R 0 p00 (LQRp@-`P@ 0S0 0 0R0  0pP0l (R S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00||00v x4 ,0 0 0 30Ѝ[|[ [ - BMMRč d X @ P   P㛅y1   Z 0@- @-||Ÿxr M Mp$ȍP|`@M TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p0\ @p ] E0 xQBnP`.d0a/wH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00p0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@b@b0 00/R -$0$0 0M 0WЍR -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ R p@-@p@-0@ ,ppPb0Ppon////// //1O-0pPW`,M 02 00000"00  ( 05/,Ѝ!@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+ 00 0 0 00hT0 0S0H00 0Kˋ@hp0dU00`0d?* 000D@D 0P 0 `prpo@pl  0  `, P ,@ 0q *XH 00H S V ! 00H S /L|H P@T R ^0P  0CR P0bP 0`BC p-x $0p RPRP` p@ 0 0P00Q0= Z"* 00[ʅ Q00CS0C0 [ʄ0S* 0G @   0lX pp| 0000 Rp&\{0S P`@0 0P00Q0 Z0504py< 0 0Rz @0000d0SP0LS0B 0? T0SPA`B 0Sd 0000  +00hpe0S 00_{\<} 0 ) ' R ǣp @#2>!d00_< 0 a 0R00 0000S P   pDP`  @00CS0C0S(0S- Z 04 0D Tu00CS0C  [ʄ0S*0S[ [0S000SS0S j  0000 x00CS0C8` P @ 0 Z0J0#2 0 0 30Ѝ    000D0@A0 3  0     [000{ 00 Sx*< P B C 0 @~ 0    0 @ s0  0 !@ s0pp-DA@ 0000 h 0 @s0}|0D T)(0D T!-@+  * $ 0 0/ p$ T0 0 Hp\+N ̠E DA-|@P@ `l0pP@PU J0S 8/`PEuX@pW0:0 A t0 0SS S  0R @-zo/ 0R0@o/O-((@CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 0p `0pAP ?qx0 h 0pdL+  n 0n/ꊣ@ @ @ G-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  P# `VP@ Q@0 R!R  "R0 R R QO- BM 紀ḏxMXčH1 0!p P` X' 0  pB]P@P U]]0 ZP(;PH <0 0 4 30BލЍ@> p= O-LLAM P MU@čO2 0Y-:0px0(S`4 0t@?s0T!T/ 0 0PU ]]  0 P @T t   0\PP D0 0 4 30Aލ Ѝ0x0(S꒢= < O-M Mtϟ0 p X0T [ !R & R# ` 0  0 ?p@X@0  0p t8  0 H   R: R20P တuo@ pR EP p ᰐ_P R!Rs 0P PZ@ 0Sz 00 0[ p@`u_``0S 0@Sʰ00 9 S 0S%< d 8, [g0 @0040Xv?D0\4 0` S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@ (P w@u0 P oP @0 40@ 040D00D0 0S \0S H0S!80S P<00p  R  H RY *0ㄋ00ppt`0|@ 0 @5/P |4+$; 0 6 30Sݍ Ѝ00S0 Q 4@PD0Px ! ~D0P0 y  0 : X0p jD0q4000SB0T0C@0`S\0c  `@V  0p`G0?`&0 0$P 9`0>P090Z?L0/ 00 ,   F  S|PP. U<(0 0R0K `1  0 l90 X0L80 Z   800803$ 00 0 SL@0b0!0t刀?A9c!|P l0S h@f0 P #n0`ȟ-  ,80P80I Q"  (<  0 0P _R`1  0 70PX0 800 00}   1 01 080<`0 @({P& I 0 P[ `1 p 0 60X0 ^80]0 M 00 TX6PL0&08@ 0 X҂@1Q 00U0pI} M 0W 0@`vQ@  ˆ20W000QP M  0 0vp1000P w 0 H5@X0 M0HP80 K{P 0D }@{0 P 8m|0ğR/0  (0d0080%m00lğK/0d @K0W 0ʤL0 +S .0CSDCPA0 @^;@5@30Pa.P AQPRi `1SC 0    R 0H080n |P8R6`!!! Q2   30 @| X0X  0H R; 9 qW *`pR|@P 0p t@7/P 0 80k`V~ q0 <2@X0 ~=0`!02 @XUⰁP S0 \01S@ 3`0`00S S````P1, '`0 {P00 `QzP101@PDYhP p0< (00 y<00PK00 P 㸠D,; ; 6 4$Cdpвd DX,`|H TP Br R D yP00d0-P+0@&@ d06SV `v 8YXpT0H0x D0 P TP Br R D yP0d0@0P kp0L 0S\(0 0RS 0`1 x 0 10XP 0HX0   ek0 0d @ⵀ PD 0 (2 X@`0r#Z0   2H0Sn=00fak00  d⇀j0|p 0 Gr 0R0 D P T Br R D  R,##yPʊuX Aa0@ 0zP`P 1011S1 T000 30 X030 3@X@" 0cZ0   =<0d01d000 \4 X0 "00`u0d0@0P j0 08 (0d0`0d0 ` `0 xH 0+S .0CS&@0P j0X j%00 d05 @XP0 @ ~j&00$X dr/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@;yP$Ѝ0 FyP͡0ıġ0"c110$Ѝ00@-$MP@yP$Ѝ0 &yP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/MbO-@$$ß CMM,čßS1 PXd ,p0$P0000 0  &~ 0p r P<QP0p\400[ PJ0D0= !8 S000 $0<\40 ;  P0 0000 ; PPP P00 V t\10,430NCލЍS# V 0?s0S0Q1 Q+ Q% uV     `  f0?s0 00|/?r s0}OVKVHVY " ܨ$@ @D xDC-XXPAM M č@`p04$ R6 V}!0 @` | P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @H |D }U dP O-AM⨑ M  čRwpPLpA@nPF }PPB t @+0?P7 0S4 `  0S+ 00@ p2P00@S 0S0S 00@ @K @ e @ܬ ج@ ,0 0 4 30AލЍ~0   O-ß CMM`,čPp@X\<@OU0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P 0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00 0 00P00S !  @D DR0$0 0s<  T80 tP0 1 00S|z0000   Rl@00S}0000 u 0s0S0S ~TvyTꊙX  O-p0Ÿ\M P@`dT V p"!3 0!100UϿ@ 0U 0 P 0FSX0 0 0 FSP0swp?TV$0QV@0\!R p Âp QVp "@p O-@@;_MM04+ 0,; 0P050P0XU 0 _01'`, 05p d!  d!. 0`1q1110`PP  Lʟ ~0ʏ Wό d10 d1u YUP& `P a`0DPS_H [ p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000009axP >000{o0p+09P 1#S;S 0(S$ 0(So 0(S@ 0(S 0|(S p8 R00sS1 S SD(0 n/,(8 R1 S S0S00 S S SS@@ `0 u`_A_0P@00Q"0A'A+S}? |7R1 S S00R00S 0P0 S S00 $ e@h@0S S| 0p @ @@@@@800sOg/0050v 0G@Pd,P R`P 0,P 0R@z@L0d!S 0 0 2d1p% QIp|1|qp @ όp0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0(UPP /]0%004 0 5 30 _ލЍ4 Rq W W Zʨ$  k?00$` `ᄴ k V V` VV00;V0SJ`V @4 @0p ;V  00@`V  IPP  P 0 Qh!9P ``V;V # 0 00@`V;V  P 0 Zl` $`|3 R1 S S0Sq00 S S SS@@f `P &_ _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ000004'{_)P.P `a_0!x3!|3paDP` DQ }ouQ\z`,1P 0 Qh!h!2/R1!RiP;h1QbQ]` P@+pL 2 5NP~E ȑt, domasearnamesortoptioninerhp#h@ list؋ch| p@-!1 P@hlHM QP T 000HЍpp Qx#r c pV p 0 xT00~nPT $000HЍpXLt@-@ RP0` PU ` 0P\\PpP pP sP pP O-0PSMp0  dd40Hu0P0 `[0P0 0@0$ (    ?P rPX" RN M 0!#X㼠`Fd 0PP P qP R X@ PU& 0  0" `F@YP) (,$@  Q PX `F #Z Yr 0 ]00`Sߍ @,(0P PEQ*(20 $^  L  `0  S : 0C S : P CI⼰ R0 P XPJ( e X   TPPJ, 0p  0 H Q T P pHZp  X   0 ]v 0 {0 0 ]tܣ 0 m, Ą@-@0@ 0@P @6$$00HXt  @-$0$ 0@P00@ 00/ᬨ @-@P @Y600H1tt @-@P00p@-@PP  P  0 p|L0X $dp@-@PPM1  0`   00HsPP0 P 0>PR  0 ЍpJЍp  0 Ѝp L0h $ d@-dA`P@ MI T!T1 PQ0 Pp 0 RpGS( `Tp; ЍA@D@fpP 0`pP 0S@ R RpP@0 DL s^ Ѝp0 L `h^ ЍH00 i00  @d@h0A-0PU" 0U"0PUP!q@@ ``F[P  (ZP 0!E`1(,`P$02~P''0O-F帖@ MR 00408 6P0( ,0xfxvx`{np`S8 X&Q !GT@ d,!@ ,&0C S00  60@ ,  A0dP@A <8 @P, 8@0 P,0P{ PQE@80Sf0S h 8 0Sm87S H% 8 0S4E@40S S508 RT 8 0000040S4ğ0 @, 4TA4*02P10S P1p1 S^ h40, \40$0Sp @4@$0 T ,< 1P,6VqP0880^ 30,P PЍpAR $0Q*# 0T@!6# 84,P< @@P,4&1pRv4"0# @*Ȝ1\ \0X $0T:p @, 2@0 1P6,P_8*20,  20@ ,  l20@ ,  X20@ , D20@ , 0204 , 20<  , 0 0,0 ,  10 , ̡ ,0, 10, 0Q0001刡0 0 0 0p10uSp , 8PЍ>p M9p  u p\TmpP/ 0. S 00KL `l\   ~~~}}P<}|dH8|x{Pz4Tz   z l T < $      | X @ @xwO-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝ  @-(0 $0 pm ~A-@@`V 0 CQPqXP pG P(XP 0`0 P }@-@00 R \\  $0!0D0 0@ ($ TH@-@PL  0S  T0S@YY@ YP/0-` 00 0Q,000 P0($0 xp@-@PL0`D P 0(S  1T  0"006`pp@-`0PyV@P PtVP 00p C*x{ A- 0@S  P p00  ( $ 8PP(p`P08+O- ,0弻S 4Ms 0 +夫   / +~` P @h+0\{p^/  H[@P^_@@ T@ } @Q0 :Q , @T  :R^@Z :0 Z:P00<0 0Pt` `@ 00H4S   !d$R; PSt0 0,0Q090( RC 900 RB ) 0S  Q )0 0($kIk@(p` 0X90 4 R B8ɟ  B QR90  P`0N( ( ( X 0 80P ` I Z4Ѝ8 0``P P @d8p0 00  D( 00D0DS: 8B0`800H@004  P`F0 0 0H0C 0 1 ,Pp$p$p(,(\x*ppQp(pW pA$pW P G@Y@`A$ppW0@  ^(0 1,P0 @P(@ @(`P, P  *VP P  BR \`A Ng0@(`P,  P1#0S0 0 PPp`@(( (p( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000%4000C?00s( $0U$00( P A ,P$ppT (0$0 1000@`p $P1(P$@ mP@` p$0 V$000\JW 30$1,k, 0, 02B0@ (mP v R-rP( 01 (0lPP$ 0 1(P$@<0 (P$@$10$*QPSKKG 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `|@ @0`0V |zxz(zzDTy@ylX, |44w \dL`lt$pooooLon@-@P  0Q ^  00$0000 0@ ($ lp@-l@@`VpPPp0U1pPE1PSp ( 0$ 0p4QA-pA@PT`QV0R@P  0P"P` pp``@ YbXlA-p`@RPP T  H000P    E _Akk@-@@0/h 00(/h000/T004/@00/,00/ 00(/000/008/008/A-``PU 0AP p_pO0AP|T404 0 ,(0P< RSfT/-@@ <0 Mb00a.V ЍjȆ @-@P 0`00@050 o@-@Q 00 2  0 G-psPp@M 0Np T 0S0{00 0  0 0$ -0{PP 0` 2$ "Z &= " 29 Q 0 0 0qp} X X @00=0@ cj <R 2"/00,@Z 2: 2 (OeP0 0] 2< 210 010010 010 0100100100P 0 R00   0T 0 2 13/p ЍTg0-00PP 0`2 2x00@Z@P0S}X 2: 2p DPx 2 @0 2D001800 < 48,xlC-@`pQP M 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH aP (0 $( p 2 P7 ЍP ЍO00P("- $X000X "R0#03(0 $X "X002S13/p 0 ЍR k@-@`pQP M 00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00PO-1PSM3:00 X'*q`I`[ 奘p@ p W i0 PtZ 2< 2ЍЍЍSQP O-MXr=*`00A̱PkpP W [K D/Q@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 p Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0 9 PpXB Ѝ 2< 2 ЍPP ЍG-pZ RbM* U0U @ RD0  P XЍ@ 2< 2ЍЍG-P഑p 0@E `` I`\1Q1v`01 @Q=zQAq @0 R 0 1Q@10CS㣐/*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pT00 (v<00 (o$bP0h tg|c`cDcp@- @VP P 0@P dp ^@p@-P`@Q R00T T 700p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-P`@Q4M 00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  Y`0P 4Ѝp$  0qp 0 塖P 2: 24Ѝ?p`(0 0,9/P 0 KpF YP`!P1 0  0 30I؍ЍU90`J8 C8000S   "4<Ġ"< ̌Q0 Z "Q Cx⊡pp껟@0ⵟ@0O00굁댺  UO- P `J@P H1嫲p0q1 * J&08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ Q Q  0@0 SW!B! 0PQ|   R 0S  "  0!2#$ S C$ U @ UU SROS5sPnUi 0 WPa 000@@℠0ᄐ000ಀXa0HPIᲀ0@ ЍX D $ U D Y RP1 PD D00CD0 0 10CRR  B Q"y0慅0sPP!@ 0C 0$ 10C0S  0"h Q 0S 0aLPP Ѝ1  \~000,s@0B YPUڜ0S 0Pⅅ!D PDp0PU PHD充AD$PdP POOO-@P`Up M0^000Xg*0Qዞ P @PU \000U00SP ^o PЍ`0SP0@ 00S"@P 0S00 000S` 0 P00080080ЍO訙 80008(8ڝ40PЍ0@0 00^00` 0300Cs000 0S7:00Cs000۽0  PP X0:0 H0ಀ0 0 ` ```I/>s DD>I/j,,I/D0b dLq@L} Lu 0A-s %!@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!ApPQ?U/)p 000 p$  ` 0 {p [$0b0 $?gy뜙 H 6A-@pPQ`M A00 2   Q Y:1Q|_0" B1"0001 0 VA0 0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " vЍ00Ѝ0PU Q:(0 $P0PU`PAP  ^ _CP 21 z3D45@-0 -M Tl lP 0PS @P000S 3/O TFUt< 8 80 $0Q/ $0S/pE H03<<0 0R/$ 0S/ E l P2A-@T 0Snp`/XP0P@QD 0 <[YP 0A/Pꠟ\&O-@$MpnDT|$Lpp4pD0q$4SO 0! 0  0SpC(BP b0@S3S10 393 3$$ 3$ $ 3  3$$ 3$ x3($ h3$,$`M D3$D @Z$Ѝ $40$0($0,$0$0 S3000`V" P  2RCZPP2&C>80 p00ShP\R0 p0 00CS0z +p`  RF(4S VZ  4S8 0V0$R0S  ?Z6@) 0@ 7000`006@FU0`00 ᩉ 4S ! DZ6@ 4S $Tnp ` V V ,4S ^Fnp IBnp4S VM8np -4np `000 ^*np V?@0`mjI&&-&&H&ϣ&գO-@PMp`PlHC @@00,3,#5Hp: RPGP P n f0@3 hP>  2H@ P PxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  sPPXPPqT! Om`P "  PP* >PR0SQ tOYPdqPPSp`@ 8>%,1 B R  0S kV X l 0S X  R 7/P  R 6$ C $ C \yYUD%_-&T,WjЙFjg`O-yMPkB0`Hx00 00 (Ip8`K[( 0RI Sp 0 0 X㻇vPePRPGPʡof0@S (H0@ S aP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SQ0QK4Q q '⥸ P M6pP/W  0 10S gRpK0S &0S0@0@P0P/S AR 0: S00! [s@Ro0: S 00000#/W00S %0S0(00S00JpW   ᷷0P0K d50 0"0P @/P05$%0CS0 $ `B V R `p忸PP0S І0Sq 00   B R\ L` V `,Q% /0 V!P@`<0 !P` J/R  S/R/  # C  R:   ` `5 3 0S S/R$ 0hSR& Q0sX/ HL!R\0X\!R\ 0X00: S 坹 C C `bQ0: S P1: S  : S!  Sp  Sh :l Sa S L0S !mPN,0SL ! $mVG0(尥 0Z Z80 S800 Q xQPP1: S 00Z0S 80`!0CS!80 TT0 @{kPR X0O M0S !m0S !vm_S[ (0S0S 0 0 Pp!|峅뢥&}&d%)l%0>T[xX&66f?z;O-@Pi\u@H&Gp@<6umXP\`0O ( (0, PU`00 XP\`> ;Q& `'p% '8dp'd`'k'T X p'TxO-MMg>O\Gw 'Ep 0 Q 0  xH0(0h7G@-Pn 0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S XiPU R8nR oR0P<0,㣹`P  ;P8P`P,㏹PPP{  1T2QRN , 05 PzPpla4 1SzH0S?80S<@0S9 P0SP zP4PD0S 0$, +Bp P44X(D`尠XV 0PU 0040D0S QoލЍS ,0SX sP 娠=`0@0S0H0S 0  FqP P 3R㓵( F P3m W` ᥡ0Z oP t3  dI;P \T 0D40`FP MPP 3qPPT0SF10: S$qPPP4 01!nP4L  0R p 0P0 T0S|H R 0 T0SP pqP4T0S 04YX 8SU # WpVJ    !   !  $ ! ( , ! 0 4   8<  @ D  H L  3]P   InP40SP8`꟮x'-qSx&.& 2[βѲ߲@-04e~P000U00SOr0C?ou21@ Cp0 1000C00S9 000-S40 2R)0pP EP SP ol hROsP xPqD84 4" 4" 4" 3!00000C0x㨻P&b@P |S!VTXcQL*vPN<32S L#L02R@q 3 0S 000S 0}P 0uPbPH000!S 0 O0S XRd~000S DPDEQ@#A1S bVqQ^"&P2S 1"Q:Ua`0:EzqlQ100S S т!0`00~01x@P} Po wPj @'Pg 2S 0"r r r2S`A "♂ҺPG2Sl p0"PƺP, H0"`(pQ0 0kQx@'&T&-dT8cԥ'D'|L'&ŸH&@-@MP`/P@P@PH"3 0@B@r0 ^Bp= 2Q=0 q E - PW RZ R\ R3 0!BSQX FKPS0: SO&00 # .Bpd10 ER!JpDwPePLP PP0 FP f0@ S0 0000 0 0 0 0  Q |fM J@P0: SpGP P@'չ&-O-`M@c:IqpP!Ap 10a1S 000`F0PmP pP Q|dP x`dP!9[A Lp@,0Z 0JPk0 0sJPc 00.0 * R W0Z /0 0 U:gIp @T;MZQJP U:QIp9&-=?O-JM M@/c  :`R!,Ap1 @DTS0 aS T  LiP fP hP vP00`0` 0QDIpP0: S ! PP ~P 0Y/S / J>00$CP@T }0p/SX/ZPm0 S:L!p` ቐpT' &A-`P@MbD4 0 IP  H IP  H IP  H IP  HPh"d3P0\3P P$P@3( 05P+( /P3( )P7( #P;( P?P ( PP( P P8$@Ѝ(P (PP"(0S (P(0S (P(0S (P(0S (Pq0S GP|!0S0S p T啻`PLa @1R`ᅽPU 0E /R  5P(=PU  00,0/00m,;0 0CS0 㴚P0$0v00S t})0s00嶜͜#`W(&YPtW(pMa%S8'<'p@-@P|aZ8`LP PP x`t s?ph00SVPT}lP $> 0@0"S P 06owpg*0z05000001 00 00g0e0c ^D ^  ^ QS00 00055UU / DY5S50`FV%R" 2) 0%0;ipPx%5S 0AP80: S055@%0IS00 YV05,V/r܄$0P0 HFFpV%P $vPP`  @d$iB4%d6w500000 0@@P#2  @@X@@@F4@PCS0 E 0SE   upP.1W0#S  ?F%VA㌣ 5X0D?o2?  ? PU AG@P$f/J,PvU /PP*AgBgF 00CS0 vP Pp PNU0 P00CS0<v0 V)/0S:00S:020V51/1S'1S o)*PdPh!iB4%l|P5V`FP 4e+P :/P0V0 .Pu0`FVzP@uP  f/塺 RT   /x)PXg(;;l:,;R<p<<<-,,;<<7<H%&$i(@,<<;1g(;==H&&mdJ:/=g(P@-5 0P @`P@pE p)9`00CS`0 PF@T ЍX0 X @9X(VH&V&O-dM@` $ P 0t䄟4 $057p0+$p@DTlUU!Z %rUdU t0>pd$0 y dUQ 'RU2 SU> QU040,   ttPcPSP PP09d @" nP tP0 aPP pU] [1lUT  !9  $h$ ?pX dЍ $4$ ?p3!t 88 ?p2/( 8W 8ץY  HѥT@D+PP`p tU`TE`8 ?pPAP?<"X0B!v  0!s&X 0  1 P Q !At0P0?tTK  0@SdD\D-G&p08b08 p0PU 8 & P P P0ZS 8-`V  % ttD0P`\\Q-X&XZ~DXD{DY|D(#Y0Y}DYYYXYY&yaratcidO--0`pOaM␯吏22242222322$ X/5pjL?"42`FS 20000b2_S R2SVV10 dbV% ``L0.p L*pP  ``L0.ppd2S P>PX0: S0d2232d2o``Sn}0 =zfPpnY0S f  zPRP3P/Pʂ9S@'P x=1@P A@PT=P 00j0000] ,21,00SP s<P0d2M042J02G02D02A02>@\ @ECTaߍ02.202*02(o{opȓ(pH&_o}57P ⋟팃``00"lb6,00!`0,"X6? 0,! 0 `0("-L6(U5EW7P s0$    0<2S3 bV02@t4@2S:7P# ?| 0 0 0?\6@H%7P D2!` V!0Tp2<<23Sa 72AS``b2S ?8$)0 6PO 99F:I ֮0g2  `V' 0`EV ``    RV 0 S@0  f<0s r @Tm *?T $?"20"09P`A9PL; $p!p%p qDq9q((gqqrpJqCrbr-0O- EM MP 00P00`PPP@ 0 $0pԄ0040pV4$B ލ ЍyPcP PP! TP' V\4 STf?g04P(`CQښ. . a0C2,S!R. !$RU>"0`mغ(Ղp&ȸb&X(-(-R%}(sv(zd@(edA&DjG-p@`㠁Q!L/p$V】 0S 0S h``10pWA 㸲P 8峲0S  孲pW$ZЍyPmPPP fP B n0@ S0  0 0000000000`PV 0HQPP@CPZP{U 0Pf%`IF|^fZ 5VfZ(@(&\(-]`͡(% (;KO-@Mp@@Ov,ʬP5WpG101ʠvPlP+HP1 TPH 6p0` 0&y D D0`Z n  Rqp` c0S Xk5m@ P   $a-p R 0S00!S0  4 00Q40 iP000S \ 0, PHPH.O00-S 0`0@0( 0P@ጡ`PЍ@} 0 0<d(P@000 R0Sk3<0 @ p#  hG B R-  0<0 @Q0<T #40 R   jQ Q@v0DKT$0p R" 1:E%KU0<0 iR BR0<0 BR0<00SU  R\" :J%FZ R  :O%A_$U@*DP Q@:IP1/-@p $0S% T0@ [ 2 00S0UA$0Sd0S (00(0@`4P@ `$`(`$0S (,4TUT[D$$ DR @Ph 0 4#(,4 03/p V `p P͡X;4V&bv&&H&??-|k%@-44:,@$0$006 ЍH%(DO-@p8M -P`,@埮hF8 0⚮\`^ PpH Dp 8i,6 R, 0P T4p80P0\80mpH X7EUIH吅d5|uuBhH%+p0)\5O005SO 15. , 0(0,00(00 0  EPDPP$VBAvi}zS `SNS7 AS( CSt 0p0RLtaC Q WS84$  1$ 4RD +K L J sO 05N W W3pM H $0%0!0 0 xs $0@S \ iI (3Wpph zS dkSLS`#m0C S[00 rTrRXmPH0SI0SO005SO LoPK ( tp (0S  0C#P [@PD L@#p``p/<jP 24AP!< 0S!0L BB@k3/ 0L@ [Pp PP a{6PPD1D+ CL HR #u0 -p0 0 P 0" B @100 0S0 pu%(%%(%X%&%%P-%j%  P*pjiiui m@-P  hY@s(0(`@-HHI@O<<H,0400DV Ѝ[$%8(@(@-HH/@5<<.,0400*< ЍA%T( \(@-t@t h0(, (0H 8@@04008Ѝ@l(%L G-`M2Pl_PfE2P1 p* P52X62@PH42@PR0 0 K0@O@╄ 2 H⯏p HQ :2P 1 @  p1a 00 @ p0 p@ `~080<0@0D00P0 0 080$@P  80 HL@P@T@X@\@HP H000 0400,0@@,0( 00P7"pPPUPT0PP 0/`Ѝ<<<';<j<<<(%T'('d&x&(O-`pPH6MDF(` 0 0&(p$6U K V0Sq`@@0VoP 0SЍuPfPFP RPZ 5g@P P0P 0 hf0#S P` $$0`0S  $x$0`0S~KP f0#S (yP $]$0(0S x $Q$0(0S|00y0P ᛧP6q 6q 6 ]6` @s0KSq00P0 C@Q 0cR pR bRJ 2fJK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX J@A00S_ /P|0 0C?oR20SV X_00 0$,0$00S 0U00S 0 ֫0S0P000010SX1 0S 0P0 0  Q00s  h1000T,0 0 080P0S& SR 0@0@0 #  R S /P(0s  /p+z00S Y/ 0/--x>&(<>1>H>b>>>>>>?&>?O-@`'M M⨆V$@@@ &Q'p㌦/6p0PKlU00S 0C0 1U0 U!qQPPy YDP㬀H= .p`*0S   eAP* a@P5P 00@50S $@Y ddXu@000@0000p  P P P4 P/  P*pP P( d}p qhQPXq/d00 000#0 00$00 0PP^`P'ݍ Ѝ( tP(@TPY Xy1 PKP(!hDP( ]^`PP p8ᑥ0PP 0(`p` qQP 00 00$0 00PP^P ^P^P ^P PdaP P\P DWP!@jP0OPZ P( ]Pp` P( +< /➫Pm``ᱣV":r0 0-p` d!d/P-0SH00 000$0 00 0P0@(p .p--z0Pa0SJ(S'- 29S!S1X/0S (;[`P@\pc@(D@&D?-C@@DCJD(DsD(zd@(edA p@-P@Gep@-P@G#p@-P@~G@-#p@-P@tGp@-P@lGQpp@-P@bGp0O-NMM@00LN`4P%`~P 0(~0 P oPE 0~S$0Gp=(0$  8%p@4=10>0S=D$R$r R  $X}t $I<$9n0A2 x0@ <$04(0Ib-p0 b`PEB@D4T@@ 0$0<@P < $ P  E \<  L<$$r $TLd P <$0 00 0 0 <0(00 K0, ;0@r b; |;$i0 00 0  D;[0!00 H0 ` ; M0(00 0*, :$?0!00 0  s:(10!00 0  ed:,#0(00 h0  W,:0D:@:0S YP T: 000 < !00  0 3:0!00 0  %t:0!00 h0  ,940c 00 00 p : 0!00 0 < 888嬘@0S C.0 NPa NP0@4 P@ 0 =a<8夘@PD40 PD40D4  G 0P(0t ,@00 1 1 8Cc|7@4P00[7 000  KN(7G: P廗P/ ᶗP pda0S` 0T460 03000<4 4"8$1I/PEU UYv  ~0(V 0 `R 4S<4Y0 H4L$0 =,pBm?HL4`@0帥S $E~G?᪠GHtLW09> $?ᜠpX5WLHt4SH$L4R0̕ %*p`  ,p  4S@`; S`Pd%d,p h19: S@ 6 $R|*@P <]XP  t P 00,0000XZ3$R  $~?0H0@p!|$Ts = 040šP40, r0 4ɡP ,ġP$,03}pTs 40S0X44S9>@#R$ !SR- >C0 # 埡Pr 0T40S唡P 3P# 0ST4ST31℡P <3 50 >C0p/"R 2H$L4P**`pp 0 L4H$2#!0 `p02 C  `$0- ~pvHz N0P0 $  㵤tL$H4#"w $R 060_W P0$$4RT SQ  W  _)pp pWS  S!0$Q[ +S0$0 Q$ Qf*.b(f:ggJd&ii-?gBg&Egggggggggh&h&4hEhWhthhh%hhhhhi&i8(7iGiwii7kij(j0jUjhjtjj}jjjjk\kkkkk1ll%lm?lmm6g(m0m>mHL$ P,} P+P *+0$PvS0[ 4S$dkP 44pS04144 0S @4S 0 @ 50@4,4S $4R#1ѣ1,40 0(0Vv (t (0S 0yp@$ P& 0d!.m^`E}M}P9X/ Q :$46041$4+gT4S/ *d0,".*)(((Pp)\4$X1H4d\1x0<$0@ 05)ptȤrP Z PPa  D؆p  TD Q i0/ ,4O-0pMIMi44 ) pP_8`4pGs04WZ pB4  0Ya 4S<44S $$4R0tp((p ` p)p H 4 SP40S (x0$؝ $tZ0 0S 0$̝ P$ 1SJ  $$4PC*`%^ZU CU7DPEUPP bPEUUPP 7 0 $'p000 R0C0s0So p ]044s04d0 00 0 >6V0(00 PV0,x00@G `0 00  0870*00 +0 +0*00 +00!00  00c 00 0 \50!00 d 0400 1 81 40(40Sr]00-; p$P0P0X$e]p(p 4S $'PP$,T`P#h dt  qT4P C00 0 0`V Z 80p%#4,p =  $00TP$0 r004 VP QP$#0]3}p,p4S@0S4l 1S !10"H 0S 8c-P "0b11   $$!0#\pX2   \$ v{p -P l^ $ t$4嗂s'4S 0<-?X  J $tR $4'S  4%GX0; 4 $$ X  0&p0\X+X0:S Q4S  0  h4&0S Z ,&Y*!X0⫱X+(x-}&}}(~~x%||||}}}'}7}D}U}f}}}}}(~~6~M~h~ (<VO-GM MP`h ՠ@t@4$(p(4PEPEUq0@@5P 3D04030033(3 &p0,0p0d3000T3080DL3L#$ 03 @ 3D 2H2"20L02"t2|"T|2\"{4d2 p0V0  82Wi$2 p0X01!W 1`Op0x0p0t1 n&p㸐%\  BqpP0 S L D 0Z $:[0S:0SPT0 m @PA/mP 0$ 0 0@ x+xuI@P[ iGލ Ѝ&-ƈֈ.=N_zO-` -@Mp L`K@%\UPZ %P$ph %%pX `@>< 4$pI( 0{@{0{SH{{S $P{{Z$P<;S$P Q _ $<^ A׻G8 ({:< (;S[ht `30X2pGS1<+0X2#030S" C@4P 09 0,3 PB P P  Q R2 SZ 0;8;08; 00t2H2Pq8"2 P R  0z{ l+S*Z<2 P P $2 R / < X 0< 0: 0 Z@0 010@;F 0@0 00 008;0|1 P P @ \1 R / $ 1P& 00z 00w 09t1 PP ` 0PR x0 P P 0 R @R hK?{Gz?eA`RMb@A/D]w0*)&dښ-?D*TW`*-ZR**S&(*֜* *x**/H*P`*d&* 0; 000  0 0 000 0P 0 P R  Xp<00 ,<d P 0: 0 d>!.t8@|1Z 1@2TȌp Tpp̌ ňppqPt  "Y 0@ @ 1 0@T`Pb 0C S_0400000,00(00$00 0000000000 0000000 0#f0p R= @@.)ĂW> (s8;p 00 L0#p8; 00 L0#pDw8; 00 ,L0#pi8; 00 dL0#p[ 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;p+,,@ℝp L0^#PX;"0#10@00 0`K`QHD  `   ` 09#PqK0S `` K0,#Pd 0  00 45#P@Wd x+0 TT|(``\5d%\#P`|5|%|#㳝!2`(10kkkk,a0a4aU 0P````㚝~<;SU">@˟ N\z{ A k:L:۟S"@ =\Vz{ A k9I:`"2Rgd@' { d30S 0 ' L N@^IN2 X0弅L!pV00 堏@+P@0W0 00Dh'@X2 ppW T p (2l"PL0"0:CS0Lc"`>pjL1堋{8 {'NjCAZAG|@8țINT{({*X!PU7 Q0S3 <i0xT0T000p+t pP <0S &"t;<000[ W0 0 |`* e'd2"SS% 0 " $@-C6?8~A@@P**؝&k(*H*u0*&*P&< `G1 PS& 2R`嶐@p/YTT0R?L0 d0 0 d20 !  s  `00hl0 ?ph{{7{{{|3{{ {  M@ )*3h2 00h232@0d@Wp |)<0 0H 0@02 0BS= (SE; ? 0;&p@0S<h2!0@0Css0S0 0 0@ s04r & 0 @O 2币  0h 0S h;    0;& 0W |s)x<0 0H 0@0hp0V 01 JxP<0[9W 0 0RZW |A)F<0 0H 0@06 0 0D lH6&p0WpH-&@*&p *P&&Q|(*&*֞ JZ0Mn$ 0CS0 0 P \0Q.0 p% x|%0䋟p@0|xtplhd`\0 tPb <0 kPY 3Q0 %%0 MP;  %0 =P* %0 3Pd 0 *P Q Q ,(x$v 0 P x0 P 0 P 0 P 0 P 0 Pd 0 P @0 P )% 09 50Sj CS^ S W | (<0 0H 0@0p%Hğܟ%<L]vǠjՠR;gɡ'1AUg|Ǣ*¢SIZ0KWI7L$DD=D0J0ZD0 0I) 0K J0KX  QJY0KWD01ʸ+Y wP WD0 $D0J C <帛GWT$pDDD0I0YD0  0J#1 KJs$ Wk$O-M`P@0-S@FP- @3 pȣ#p*30SP a`F0P[:< PQ9 JK P9 H S8P@ 3 C d0@S  Lp@20SAK@HGG 0q 0  X dSY'K`PsP`8b2 R l 0 S ` [U+ 0 q!0!00W  p4 ,pJ0S㇀Wむ` p80S.P p00@@ 0xS VhZ`<+ܢJ&UASX!_l~Σ O-PAM Mʈ@`Ḑ6P&0P0V00-S' @/ P ᜒ) 0P0R@0p0I\[00c `F0S0`@DDA@Du%p ,0S@bLpP53 Q  \ P -00  `@[-00  D0B5S0  Z00S pRPkR0 0꼄 4P dR0000x4 |4 0S dJR L4 00 8K#P   300S Pm0$0h0(0e0,0bt0C?o#2p R0S0$0P㢗t㟗P㚗X cy0Hr! C @DT43a00@`FrS= RS iS1 tS xSf㨢в+ ~j0p 0@00@00S  0Ye_0S :|8< Q (0 B b/S CD$(0S  0`m'4.0S (0S |1 00VXS @h(0S ( 0`>XU#JPp+ 0 pPUU2!,+-E>-`x0;+p& &&TB|&8 &p.ΧO-PLM'P0N0n(.'p>F,# PER a0:  @@0SCQvPcPSP TP LP d0@S0 0D003030800H00 30$30(30,30<00",00@)0,0p w qW3S())P @ P< P /P LЍO,3S %00p,04 8<@ 0RWS[Z0DSPQp! 100gS @8{D EY0`,  aR @L0Z S 8P0-S0 @ 3R:  "0 0: ` P0 0|:0 0h:43043{0830<3@30@3ppzzyyx||{U ,0U ,0U ,0U ,0U ,0 g0 0U ,0ZL00L0U ,dU S S0X0X(0CS0 0 PD#8 D#<#  P Q0P0083 00b0,X0$X 0X@0X0 X0X0,0   ,0 =1P咐PdH0S7 009@PH0SX'B0- ,0SSX p43 S20P-/aUF cU2 gU0BP03S_0Sa 00gS# H0S |&Z` 0  dS0Sa PMpWpUpWX 0S008"> ,048<@D~ULЍ0000H3P0P xH30娐PԓD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R  B   0z< Q $0Q P0 00 R  B   0z< Q $0Q P0 40 R  B   0z< Q $0Q P0 80 R  B   0z< Q $0Qp P0 @0 R  B   0wz< Q $0Q^ P0  <0 R  B   0_z< Q $0QL P<0PESZ $3S0S (D0S] @p907S  i00&c;sr<  R  d  v      Ul5P껓0S 0S 0S  Q 0   ypqPU 8 30(#0<  ] L+&G[Qb0&L &L+M+&L+L+L+M+M+L+yx M+8L+M+>KYgxG-PXMpg1PHh   LMDP b0@SS0 t80 6d(QpX80U 0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06lShqQaDPA07=CP P W0S  fP 0000卌P6T&0 XDPP061 (VUwpX0+Sp@(86 000o<00 0/15T& P 0p00 :XCP00G00X]p0 h5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0-qp(4 0P 0PQT3LՋJZp=V Qx`2o`F#P0 0SU030#:U 5%$Pe+P p:=5 XP&T6K/r0J43PvTS0 0 S6# G@y SPEX!EK/r03P y 0 0<6Sr46Sr 06rS 0GpT2R01 x6S 4P W0`W  0#P |x,6S m/X7`P bH`Q0Q b"fxD߫<6S46S^E`^E`@6D&SH1 0 00R8!P H& R$!$Q $&R! 8&R0&@PR  Q   @D 5 @ '/@R+-&Y+2S+S+4V&1H&Hex Y+TWZ`~]~A-P`pI䁟HM! p10PEU HP h0@ S S HHIIp1媱h1X1 T1 pa 8P (1`   aoPP J L`$@@Ԁ`(` `C UP P0S PxW MP XJ0 0000 &-` &qY+yt Ct 0G-pHM`0x.BR"x p 2B1 pGS 1S 0$  !RS@# P+PTP<$FJxP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0"HЍP PP  I0S  %0 B`PRJPW a W %pGW R $Sw ,0< sW pY+&Rh &- Y+&C-Mp`ጏPPEUy% p5U@U`F V/@T xȊP hÊP *aP tP,5 R )0%  PV 0S A@D V*Pc`VD W StP@PA@3P zP0S<0S000S00S00S00S00S 000#: pPU 3 `V= V30SU7 0S4000000S@0000000 0 3ɯ 0Sr<0Sm00Sh2P0$0:]0S 0SW`V UUQpP `P dPB UB U UR<2PEUNPP UH Q PA H U2 @U U60000  +- U+BPJ 0000 0 +P  f) )$0S P+ D) p#qpը*nf@T ˨ 0r"600"$0$P @zP tuPdh^+\&f-& w#=P`OLC-@PpMa M!' p10S QฑPE R ލ ЍRP fP74p-4P` GWOJ\P1 JP/0: S2  S)J -P0 JN@n` 04S00`dč0S vphlJ -PJ -@PJ0@^+& O-4MGMM rw0P+0 <[@P /P ;T(Xx[@V0P\+TX8T ۄH;P  0S,;0+, Kh8S <PU {hXJ„P@ /OoB:pp4*:(8pp,P `ZT`h^Pdhkd:xJ 0pP0 `*p`W0 J T,* 0 W0C 00܌10 l>  \p8P`T0>0 XP90P- S)i0 _P\9Tr P 49h(iP 9T(X(_ZⴇP 8h(^40FDS00  8( 8X(T( |8,8 :8P 00S| h8l LF(8, ,, ,o 8,k 7H(g7l 8k k^ 7L(Zg+kw PS:?@ 0 x7P(H7hgjpPP78=l7 87<(8 (7T( X(2@7 7P 00S% 7$  6t(6 6P 00S 6 6p l`E w68`j`F080 P 0S46E: `V 8x:p l[+M 5, 5L(5j0P0 p5`(d( \5efH5P ? |5?Qt(?[GލЍP5T H+0D4<<90P 0S Mj V=P@@PD8SQ  [ ` [U ZV Z   ZW Z rq/Z= ۂ ZYԂZ Z ftK^hH^`E^TB^H?^ 0S0SA  J@288S2@Px |b<S P 0S i iD2 kN @+ v P:B?l |<081<Sa\+Tu P*]㋊0:zP 0gP 6J@P.&] ][#&@P] ]0@`zPP0@P`_p@+u0(@0@000pUp,`40U0 (P<P8j,(PR00S ,R  \0,0S >i,8S=? q,8S d+UH&&.&UG-X&s+&-kpL D zr+T A-P`'(LEEhKEP03jtp2S l PCUw9~PO p 9P/P00@˜7' s\]vP3038$p,40pEWQU 4 000`ᅃP C,tPE0S3 4# 3PFC@=wuPpC`p\ TP[PH304{<y4S ,S{xP  Cl P 4SsRixPn l 1 PpR},p`bG1/΅<01 1> 110101$1iw   ׈#2R CzCmp`a P^ Q1s0S rpm`|q wp  lQ00S dxp P *`3P?o20S R=?o20 P P l*x1s0S 0 S lS 0Rvp  \gw=`S 0 0000 lx1s0S v`yd0F,n3 4q333&&3I,3A 33&3&"3&34G,G, `3&2@-@`ᓈPP p1 lqd!pX10SAH81P@ y 1*$qɃP  ăP 0 nPbP 9P0P p  c0@ S0 VP ab 00@0 P0  @0  00 ~0S;TM,[7<&;;&;&A-`4C0P@00$ 0P0 0lP00s|Q벃ȋ렲U&-pYP0r0C0"SBҞP U 0+0C0SPP \p84PPE ԝ尞P 0S娞ÞP10塞弞P1 0Q 2U 0S멢P㞢!PEh10S \10L$DQ0S(1(P#PmP,qp 000000S _N܄랖]PP`0S ҩPPp00Sw8hM,&<1<,!<6<9<@<G<J<S<b<M,l,y<<,?&<<0,,<d,$,O-`pPLBc%DA@`4"`p(2 0 qQ pPpGe#fuP`P GP IP EP 0 a0@S 0000 Jꨴ-9&@{yR~10O-@㜕M05%@5P@5b 5p@t5b/dEdeX0T%`5L%LE5H%H50`0v|P`%((" P P  @omPD DP4 fPğ5 CP6 pP8 rP$p:H( P00: S0S00'P|tPP( pyP 00SW p4 3 CK3`3p rW pP  mJS0d1d0@ KjtP4h ~P =~h^@ <㶃0㳃(㰃 U4x) 0@00]P@ZPU@`Q d,V ((P,@44`(PV,@0,@B( (P404`V(P,@((P,@4`7V(BP# 0  0S0 0 0 0 0 p  OW6KI?@P  TI002@1".41Z(1S00s>n}PZ #0Q -uq4G 0 Ѝpk--2 ----,0 V-,----2 &2 -2 14 <4 R4 $ --2 -e4 |-,-v4 [ ^ Z -4 p] 4 -( -Zi,O-poMN!0 @U 8@0 @$Dp`S4 W[Y~ pP 0  IP(0: S) 0T0[0Sf Y XhP$@PD  P z  z%PPLg@Pq t4pVaVb`FV` zV" ӓ!0 l 0` 00 0<3 1 $ 0y300u@s pT 0!0 02QX 000Ḑss` pP0; 0P* %Pt%f`Ph!!C A@ qY !0t<1/"0;P `<$ 㠓  P"   PH0S ㌓ x?0S ビ\0 0/X0 Pp0 0  Q   S  R#4sp V`P 0S T N 㖁 U @pxx- @ &K N Y [ z -) 5 &ht@Ή  %  0O-PMp00@}P? }P ?M / A3ߍ(@).s>X?PX1P?/01012 211R"T122bp[pTp^&[0n0d10 .0>pZ90|n0C 0 0R080 h%0 l10 B1!1pq奸0 ?PPZg0Z m 0R- = 00+4 0 80 0YSVPMP 6P@ ?P7 4Ptp=N@P fP j@PD=P 0=0X1h=x)hVP0V30 [0000z00u nPo㔼l㌼i 0p״P 0PH U0$Qa8 N0 RA0 籵PP  0p岴벼 484'000`1Zᥖp @ >1SP ;<:I6ᗦI:0P ,0@ @ Tp 0 )pA@ť( P0Q819:d!*`1 xjp ⩥PL 5   8:8@埣p, D&`11`V zPp)YGB Y9+  0 d1 រmp*8)pl?冣pP \X 0S` ( 6PQ 0S Zo F0080x8"/0      2s<8"/0   2sc!"# p B 0< P$*ڤ F 00 7@团p 138ؤt2 7@冢冣P@ z@ w t7 @ p0S Ԥ0HX0SҤ~0S z0 Q  8 0 +zpj0S &BA⩤rp\0S t&OBA⛤8P q HS@␤c 4嗤_,h㤗0 T S 0ap) cp% P ;0$A>0 0T1 5T@婠ptDAcp$0 T1_p mtcp\Q$POp "p,k@T 5@}pA X000-!0@00 P  {@ p0 30 ᑔpt@ F#\ XP$# H43៤pI  ኖ+⿿p 3@-pTA!R`14`111P0@!箥P0!t֣00!R00SRd18I(`1Z  R! Q01Y<(p ⚥`1 Ɨ1Y4180; X >< 4900ᩗᖲ1PU| 0S 1PP 0S  n 0S • G R080SX  R   L1pϠ0 S   0忣`Va7 8 n& M &l  - # I \ @   : \  |  Ι ܙ  0 \ 4; < g |    ̚ ( B i , &â0@0@ #kh/8o+0   Q/0p@-x@0Ppp@ P T0w<p@ 0 0$010P'HH t'&/O-1bM!0Mb  [ !1 b0  0 30_bݍЍ  0  "\ ,{`  $;(0(0 +Pp0G  80G( G:pn x8_S  000 00 0 PЀ @G 0  >xP x8##[`@* 3xP0 l8 40G PU P0l8  40GP %@G TG ?C?0ƒ S$*0@- R P@ 0\ R^ H00"@ 800 0^ 00"@0/>x>`>@-M A .  ЍHTh  0S/ -PM00 0I p 0 S 0 0 ЍV(V /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/~*/{*/cx*/2u*/r*/o*/9l*/i*/f*/8c*/`*/]*/Z*/W*/ T*/Q*/N*/0K*/QH*/E*/)B*/{?*/|<*/#9*/)6*/=3*/0*/-*/"**/'*/$*/!*/*/////^*/*/*/< */ */*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/0 */*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: ItN8R[bj Pp rr8uww! |%|(.D1D5:h?EKU<[bh mмx`â$Т,ܢLthL p!'p!,%4%=\-C\<LEUH\Kd`QkSo`as`avg{gghhhlothv|d\  %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %sd(L@@ @@!% (.t@@48=t@@B%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdinԘq,afiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1sETw#Fm%c9wNcinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.BD69`hn<|AJ.O? [SV"ekqty2'%s: %s%u-%lld%llu%d%s: directory causes a cycle %s: %s: fts_readusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS/%s%s/%s ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s!4&4,4411Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"eVeee/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+PPP=PPusage: %s [-f|-i] [-dPRrvWx] file ... %s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sexamine files inremovefts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression8A3>DN#+T QIarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %s  +8N+8NXg{EZ# _^F<>*?=Perror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQ?>TTTT7goujjW-EHOME :]./%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier%lldnull or %s %.*s: parameter %snot set%d%zunot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused$4ad;AD:ZZP'/]}64/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes%ld [%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d %ld[%d] %ld /dev/nullCan't open %slpZ%smore than one -p unsupportednp:invalid name: -p '%s'%s readonly%dYou have stopped jobs. ${#${"(()(...)$(...)">>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error -2t:?fFKdRKsX?caKmhKlv}r pnKv b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:/\ (8nYShjrltEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpected $(,16:FKPW^ejrz%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)  @         @%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error         %d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATIONf(0of(1wf(1}lf(8f(0f(0f(0Xf(0(|@f(0PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad numberD       !!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unset#,%D*/`44;4DK{OlUD[`<b$commandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp(t=XȜ Ȝ4Q R"~*/'2':>@IEJLPlW,[f`gLlLn<sxXnTkJH&#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260506131259Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failed         (  . 5  :  ? D option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOPg"`%k"8'r"%w"%"%"$"%"%" &"&"'"$"'"&"'"$("'"%"%"'"'"'illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedttyo's'w'{''#'3'#'3'2'3'3'#'''' '@'@''''&''''$'+'1' 8'@>'D'J'O'T'Z'a'g' 8&C$<&CA&C$H&CP&Y&c&h&n&w&}&&&&&&&@&@& & &&&&@&& &%%& &&&&$&+& 1&@litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %s???@>@?@?@@@@@@@@@@@"@@*@@+? @/@@5@@>@@F@@??M@R@X@_@g@m@?s@z@@@@@@@@@@@@@@@@@@@?@@A AAA#A)A/A3A:ABAIAPA>?XA%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:orE=V=f======>>,>H>[>f>>>%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=7WB[B`BhBmBrBxB~BBBABBABABABBBB%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:_AfAkAuAAAAAAA7AAAAAAAAAAAAABBBBBB(B7BCBSBt%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO>>>>>>>>>>>>?? ???%?+?/?6?@?F?O?V?_?h?q?z?????????????/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd %s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:xK%L)L.L6L;L@LFLLLRLYLK`LdLKjLKKKmLsLvL|LDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>%K,K1K;KEKNKUKdKkKqKxKKKKKKKKKKKKKKKKKKKKKLL!LFilesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdD[D[[V[D[[M[[[[D# %s: PPPPPPPPPPPSPPPNPQWPPePQ QQQtype: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u OOOOOOOOP PPPP'P,P1P5P>PIPNPSPWP[PePkPoPwP{PPPPPPP%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. VVV%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:'@*TMP-1  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootablecrrrrrs8s_s s s t t AtQtht}tttttu'u}Y}{}{}{}}}}}} ~)~A~_~z~~~~~:puu6uIyuЀB%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype "+2AHNU]bjotxąȅӅvfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY3:CCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:08%@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:J5@%No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec];D%AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]=H%@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),@Ir|Unrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to function dL%Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:T`eP%@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored#bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGF+++!+=++V++Ogpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: @0h PT Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*pw|  (,26AP\lPartition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sQ(vX%@Afp:sNo MBR in disk to convertpy@     "2I^c3Kg !#$&123456899:; <)=A@PAdBCDE FGHJ4LQMbNiOyPQRSTUVW \a2c<dwefghipqstuvwx$Nmz -Ebz,<Xrx #2EPZr0RRRk6QmuGr  PqMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sL{\%@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremoved<}`%@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]+~h%@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]`(l%@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] p% a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l.!(*,Iy %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)en_GB.UTF-8 (active)UnusedExtended MBR%d - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s Could not find index %dDetails for index %d: StartSizeunknownType: %s (%s) Attributes: None()start %*ssize index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ],|%gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed s%@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l <% a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eC쬿SFU0eCHah!IdontNeedEFI(s*K>;|nQn- q+ |nQn- q+&|nQn- q+3<|nQn- q+MX|nQn- q+fj=rGy=iG}ny;Mt?mWC 3KOOyD<#*=(YbBRuoqr3Dh&\ M}-@Mjy֬0-чHAE-чHZ^ZIчHx|IчHIчH2IчHL6 %?aS'@ )Ѹ*1@ )Ѹ1x )ѸST.qBHo6֯i.9%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL%@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]- %o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin `%@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeee[%+-/EXXXXXXXXifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s  linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroy'zi`%.yialiasdeletetrailers-linkstrdescription-descr-description%L%%3(%T%p%p%%%|%%0%0%%%broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6BMXdp |@ 0@arpdebugunnumberedlink0link1link2### ## #@getifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %dP*G[*P*f*m*t*({*, [*t* P*t*`**@**[*t*f*m*media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaopt((&&%((&&%&(&(%&(&(%((u&&%p&(p&%no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %dH, <tunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnel),%",P%bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif-%2..%V.2. ^.VLAN tag(ELGnpTVnnnnnnnnnXnnnnnnnnnnnnnnnZ\^`bdfhjlNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %s $rhw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'6c=cGcRcUcXc]cfcjcoctc{c cc ccc@ccgetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}@)KYn%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).SmzmmmnRnnnn o(oOocooooop 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s: %s/+-$ '5GIUamz%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @ĉBՉCFI LN OLSWahbxcefhikmn'o6rEsVug -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jd@@@h pp pp ŕ` ʕϕ@ ԕ $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880%s: %sbj #'@PSVgmp] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uB*O$command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c )+S QJNunallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s 8Q4Q0Q,Q(Q$Q QQQCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood  %Nx,^&%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +8/& Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/!'P6`D\\kuD,,l%8tD%Qck;C;k;;pp `00<GNSregcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): "'+27>CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%ch421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiB@[Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYLm Lm pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4\VValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS!%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s5}}}}}}=}}Zf}}}}}K}g}}}}}}}}}}}}}}}}J}}Tam}}r}/}W}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     #3( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.6 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.6 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.6 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.6 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.6 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59) Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. 4 4 4 4 P-4 4 -4 4 -4 4 $ -5 5 -5 %5 -65 >5 -[5 f5 -5 5 -5 5 -5 4 -5 4 -5 4 *-5 5 -5 V-5 5 8-5 4 -5 6 - 6 4 -6 '6 -36 @6 -E6 @6 -V6 _6 -n6 |6 -6 6  -6 6 -6 5  -6 4  -6 4  -6 _6 ,-6 |6 +-7 4 *-7 7 , -07 5 )-<7 4 G-H7 4 F-r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.6machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula9 EB 9 qB %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5h@ :B ?B ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalidJ G J J J J J J J J J J J K K K K K 'K ,K 1K 5K 9K CK IK MK UK YK _K cK nK }K K K a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF E E E J E /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasedtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugxdebug!,YY `Y eY oY yY Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Z Z Z Z Z Z *Z 9Z EZ UZ   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s ) 4Q W $  8 & ' > 0> 1LP e u %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES "/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%a, %d %b %Y %X%Y%m%d%H%M%-30s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errore e "e ,e 6e ?e Fe Ue \e be ie qe ve ~e e e e e e e e e e e e e e e e e e e f f /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijz4y ؅ @ 4 @ ` | ~ | |   h  8x ~ 0x (x } } (} } disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSd v %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhai9258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new| nxnxxty8wwmDfgml(zada|h@aa ~H|tqchb]dcb| A| D| I| N| Q| U| [| _| e| j| q| v| {| | | | | | | | | | | | | | | | | | | %s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eC쬥 SFU0eC쬵 Hah!IdontNeedEFIɀ ΀ (s*K>;؀ ܀ |nQn- q+ |nQn- q+ |nQn- q+ " |nQn- q+3 > |nQn- q+L P =rGy=iG}T _ ;Mt?j u mWC 3KOO yD<#*=( YbBRuoqr 3Dh&ȁ Ё \ M}- @Mjy֬  -чH' + -чH@ D ZIчH^ b IчHu y IчH 2IчH L6 %?a S'@ )Ѹǂ ΂ *1@ )Ѹ 1x )Ѹ  ST.qBHo6֯i  %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/Ї ׇ     & 1 A AF P X b r  %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_newd   ؜8أ@0З\ ԸtXD< 4L %s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s ^ ċ ȋ ̋ %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init QW\{22*\222.4jn22v282=Iy2/E3rw|2? t-27<Qf{splitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument b' c. d4 e8 f? gK hc iT j\ kd ln mu n o| p qޢ r s  tߟ u  & v w x zˮ yҮ Aخ B C D E F G HĠ I J K% L. M6 N< OE PR QZ Sa Tf Up Vz W X Z 1 4 6  |ү ~ޯ }    % * 1 6 = E J P V \ k o u |         Ű ʰ Ѱ װ ߰       $ N - 9 C O b o }  option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLff@d@d(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deletedeert_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_delete d dsa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULLc m v } - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%sA F K R U [ protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)  ! % * . 5 ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %sU ` l { %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s       W BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- 55 6 6: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc55VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory .t Xz X Y 8Y XY xY Y Y Y Y Z 8Zalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ & , 4 , <          @ $ Y"|W"xU"ASCIIcs_path X  bc_base_maxh  bc_dim_maxh  bc_scale_maxh  bc_string_maxh  coll_weights_maxh  expr_nest_max h  line_maxh   re_dup_maxh   posix2_version h   posix2_c_bindh   posix2_c_devh   posix2_char_termh  posix2_fort_devh  posix2_fort_runh  posix2_localedefh  posix2_sw_devh  posix2_upeh  stream_maxh  tzname_maxh  atexit_maxh /usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[. g4 g: dh@ iF iL PjR jX k^ :]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d pi  S7gb8"u lt$$ januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDҵ;15MS7) q:e%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n20QKGC?:64*(++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQvQvQQQ,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K6Dzg Tr_I" 6A.o\vI16Dzg Tr_I" 6A.o\vI1" acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C029N.0xco<q Vunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`K #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.2 Copyright 1995-2026 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.2need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger/852array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist