'VniԵ0NetBSD/earmv5hf ramdisk 08i<  i=t ti@@<@T 08i<  i=t ti@@<@TU it`Aiii$h iiiAiiiA.iiiAiiiAiiiAiiiAiiiAiiiAiiimDn"iii (08@HPX`hpx@$Tiii`hpxN$ iiiK$/iii (08@M$,iiiHPX`hpxFAiiiCiiiAiiiAiii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii B!iii B!iii!iii"!iii"!iii"aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii:\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii2\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii*\!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii"\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii \!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii$!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iiiaiiiaiii!iii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiaiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii:\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii2\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii*\aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii"\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii \aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\ !iiii!iii!iii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiiiaiii!iii!iii!iii B!iii B!iii!iiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiiiibpf!iii $ iii$iii$>iii$iii$siii$iiiAiiim iii$iii $iiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiii&N;C~R|!lΙ=,:+=&2h}Z<iNuK\>.8OlNru-Z]>:?=k(zx=VHRa$/Gϗ|9dQuYw8 c.TJ4d U.l %$C9YNtG*TtE,6!fh=ºw)2IH*y'pLX,da7f GJzf_% Se[&&O@N ,Ϡ([I9_EEOGUWZOiXd`g۬q\8D/Y%$-:AjxOb1:5ŵ'try>=֑ѐXdfti~a`1*ڍ+M ts+N0Cҡ9U*8e4<<ޖmٰTb`-X)1K_ZkYw/s͢d\M(c^=t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4k"4 (!!!%%l( LL!%%NetBSDKwGPaX NetBSDearmv5hf3D0D 0p@-'HP&AH0`  BR` pR RX X/ᘟ&&@-e0 ǽH& 000/l&pC-P0-` M؀ @?!{ A (9!`P40 A00{{z ЍpY@l&% H&00@-@ M@  P  Ѝ0 t1A-`0Vz P0 @P@TV PC y W@@7e0S@ i@0;0zP W 0XpeV p}e0-S XdIHp 8@0SV  W %G=&Q5O-MpY xSp 4`P` Ѝ p` 0`$5XP0S 5%0 0 5X0S40S* D$尠D,00CS0 {@ Pp  @YT `0 @00CS0Xc0 X0 p00p  p@300 80: Sx h+mp@ p Qt  X0 0 03$0000x, 00 Q00S(> 0 0 `Jp2 p ` 000Z H 1(#  0P \\]P 4 `+X"J 0R 0p0ZZ3r0S P 3Y'  p00R0S ``0S  0 >(h P <`V k` 0R?o20S 0  0 0R0>P `P hh`0S L,` P0Rt00!P ꐬ&%]p&x&|&t&&H&`&o&l&&x&&&0@-MM@ P np  ;0U$C dP TTۍЍ08 P0 (0P X%&Q@-@ TP DDv,}P $ 0P@%&Q@-@ XP HHW",P $ 0P@%&@-Mc0 ttH&0$/p'0$/'@-M`@-Hv@-C@->v^@-1  0 0 Ѝh'@-1  0 0 Ѝ'@-1  0 0 Ѝp'@-1  0 0 Ѝ'@-0  0 0 Ѝ'@-0  000 Ѝ'p'<00/@-0  00 Ѝ''<00/@-0  00 Ѝ' p' 0@- 00 $0P@IЍ1%,0A-MA!q`!X0 p! R0B=0B  P0H 8 R8B 4!010,!0ЍePP l=R0P   0S  0 pP0P      0 3/R ! 7000<040L7D0''4p'#=\'<i|0p@-|@PtP00 R 0p800 p0  B0Sqs Ľ'p''0 0 0 /p'' @-@- @-@-80@-M0@@(3/P $ H08 : S( 0h 3/ 0P  0 0Ѝ000  1/qpa0S 00m8@@-@FPЍ@ PЍp@-(`Vp80@ 0 3/PP8003/(Pp@-@P`P 80 (0(3/@a P}aPЍp谼'3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A]G 000+ xpt| E  ЍO0 P % Hpp 81/qp4   ?P p 4  a0S4 tp0 0 0 0 "E0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0004 8pX  FЍ谼'9'R/ R 0 0/\\CC B 0R0012/P/ A A A A  A A  A A A A A A A A PPA AC-MhB0 0  T0 0 8  @ ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !)4Y4 " BXX P!d44Y4 " B   !d44Y4 w# B  d44Y4 d/0eY8p<0@! eD` @d44Y4 GЍh'Mb''@SjU@-@RC- A `00P4 82#&PP0 (1/qp$ 밀pU Ѝ0S0C080$0( 3/P 0 `V`PEDq0  Y $ E p''%@-MPA P04 00#!8 0 (1/qp$ MP9 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p0h( p3/p #U0* ,0P`/RP `'mXSP @- M0@ @  ^ЍȽ'O-Mxx M0@S. 8S+ #=P(P0|0S( 0| 0(0>" ! !7x00# #0|0 +& %%ݍ Ѝ'|I 0 X0 S 0F0WS07  S  S $0S1 \7000000S<70 0,70 00 0@R4C*ܽ'pJK 0OKTn\u@-p< PP@`D WP Ѝ`3MU@p@-XP8@T`@D p WP<opQ<PpȽ'A-AP 0$ P0 0 SQ ( $0剧P g\h dl`P, R2DaDqU`0``000PJ\ O00CS000 Q   0,`0CS0000 (00/U R \8 4 D 0$00 0$ 'H& ''T0 S 0SP/P/S/@- 'p@-XAXT0040S+@! PP P0P`04 PV R@40 0PPU4 ^*00" 0PE`PP 0P4  P U 4P0C SR40P 0P p ' '%''p@-@8P0 00@0@00000p褿''G-PP0 n[&0 ,s(%p 0 R`Gv@0S ( nPL[ Q(x ?$00 0(0 K0V0? 0"0[8 45@Ђ`ƟH& ' 0p@-?0 `0:@ PPPPT 0P 00S/S`r8P|p*pP XP(@88 p脿'' 'X'!;>Ap@-@(P 8PP Z\ 0TP}p`U(` 8E8` 0"p 'WH&_@-P4@(P 8P 8-080 'DD @-kyP $000<0 P'& '@@-<pPG0`F [stlV000IPXXK4 0,J00C0Cf 00CS010:0PUP1 ` 00CS00 P U Rt0V00PNX  S00C0S"10 U00CS000 U0P 0@ &X |+ V 0  00 0 @00S 0S YI'|' 'H&''O-M` R0000200010S uܱ@q0`0#0P 00)<T0J?o20ST SRP 0S  RZ  @T  Z     0010S@@  0 10P00CS000 Ѝ S 0P  BR l  @0S Z0 0$|''''' 'H&'A-P0`!SP@XW 0\lLpP0!S P @10`! S:`Fp00  1S pHa0S ʼ1`0 BRpE`  S`l  ǾP 0a0CS00   ꐿ'. H&FZX'( Q 0@30/@-I됿'`01S @-@0!S @JP /?P /萿'n.7@-A0 R!RUUʐ0\00oP@Nq |xp00CS00+ 0 @ R,\ R P Ѝ00!S KP Tf0 Sڰ 0R0CS0000 0 Q  vP   ꐿ'T& H&q?A-O 0 P,0p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pq PPPೀ0S!S < 80S 1Sm `P0PPPbL ,0100,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S ( X8 e0PP1S PP"G@oG`GoobPVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1Sn P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1ST1S0!S  60S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B RNK@ `@@p>DK0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P {冻0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S" P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SN^P0PP RPӮ nQ pQ lQ 0 S:8P0 PPT&'Z%%' H& ض-L3p'X'f'%x}QP000P0P@u Z`P 00 00 P0 nR, pR% lR& 00 S1S0!S  50S1Sz aWWv 0 =P0S0P0PP1S 2SqXP R! l B R0"0 S07PP0010CSI bP寱@p I0"S4mPP00 nR pR lR 00 Sy|2 00S <PPPP0  nQ pQ lQ 0 S[0S dPP0S0PPX0 nR pR lR 00 S<P +aw2SA P0PP P0 -@-0 0) ЍЍ/''-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-`ጁP@0 SS&tPD(!RGdadqU`0``0,0堸P,H墻( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a GP0  0@S  0G'' '^H&b'.G'!p@-0 P= P@01SE0p0 SS t`P@0P 00S 0PP0 0_0P h0T 00Q㛶P0WH0 ,\('p'|'''^H&bO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00峷P? 0A0CS0l10G0 P \QH 0 SP 010S mP/ 000S S)00 S [ U 000t PGu t00CS0L00 0`00 p<P P'' ''$'('&H&A-0P0 0p@ W 0 `@P 0 R00R00 1BQsG@X @d@phG0"S,"@gR000''O-ScpгM@00 0GS TcsT`0``00P6G` \;X00C0+0&SK BR D R: Y J@p RP G 00C0S @Ѝh20   K  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WpBp@| \  g P FgD @<f00C0 AQ 0 T0 Tpppp  5Pu p BR   @W0 `0CS0(00oq0  b' ''H&O-M 0@P0P0s <40S  0 0000 (0 pP ߍ0`CԳ0#2P 00 S pSN(0Y01ڐ Y   $ ȵ$PFɸT PL  BR +430 # W  BR 200S 00 c D 0 0(PP.000YX Y   $ z$P  BR 200S 0 - D P0 (0 P'0 p1pG Y;xxZ @D1PE@0 ,(?00CS0uX   R   P> 00CS000^`W 004 00S |xP00S 0  FD8 ADX ꨿'' 'H&'O-㴡A0QM0Cp` 01 00C S00`NlЍ' 0 P5 P!` 00000`P00CS000  E[  0S00CS0x00` P  P꘿'' ''''O-M R B000bsp 0shЍؑ؁0S1  0000 P@  0#੟ɐ Y Fp10S Q0000000p0CS0C01;  \" \    " L\ B   @      0C LN ꠿'%'' ','$''A- `P 0 0Cs 0x 0t0 l  C A^  00@pT ᕴ@ 0''%'G-p@P0 `R0  P(S%0  d nP 0 ,(_'H&@-C0 7H&O-GMeM0PS@p$Q403/P w0: SC00W +. P8:C?0P0: S 0SP0: S 0S 0S 0/S&qP7v00po>P- ᬍPP #0vO PvO+U.0P ]H#P;]9P /-B/P'BP Q>0P+I [(H Z% U8..0 0PT9..0 0P @DP ^ PT1RP  oR00S$ 0SS 0: SO5PN 6  0AG=00 04K AG=00J0SP. Tq4XGH X00CS0 p Pp  pYW kX0 X p00CS00 0S WP0SGݍЍ0?o25c 00Y 08'h&FH&S&a\\=0\\=X X0p@-@P@@DDT ` U H H0Rp@\\v=ppX 0Xp@-@P@@DDT ` U HH Q\p@\[=ppX X0p@-0P0@44T ` U 8 80Rp@\\A=ppX 0Xp@-0P0@44T ` U 88 Q\p@\&=ppX X0p@-PPP@TTT ` U X X0Rp@\\ =ppX 0Xp@-PPP@TTT ` U XX Q\p@\<ppX0X @-ppt t0\@ ^0@\\<X 0X@-pptt \@ ^ \@\<5S %R R S R SSh -^L^S R 0/0/0000'O-QMTh u@ 0 `0 0L0 @@@@@ @@D@H@,@0@<@@@4@8@5 SS$\ 卋0 !00`V0S9 0 00L0刐St 40D0800$0S00( ,00B?:$pp:,0S d @?C0000D00H04$0pp:0$Cpp:$0S00<00@00#pp:,0S  @?CZ㸰张 0|#ppz: 0`#ppr:0 \ 0C0CQ0B003/040 0S :YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0! XVX0$0Q: 0x! dLd0(0$9[(9 R 0  P 4P0@90S00P00P00jPP \0.S0S 0!{ 0P$0 0P(0 $԰ (ϰ R P0ưጰP000Ѝ'VUUUG-@a!80S S'PP )rpW G)(<0SB|r(@P ?@(?@?0S5!0CS0\$ g  00L0S \0.S0S )@0S40S t)#Y<0?o20S X (040' G-`rK3DP0L0  P0S$00D0H0r먔pPP00$Fp[|4T H0 `F0P 0 \<4P ]84X0 s0X00 00dt |  P PRPS WO( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30VP 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@P/> WW00@`0S0\0S00S S S0 /0`0St0\0Sh0h0'ht@%VH&z8'ؕx̴%H&$P̕d80p@-P@T @@\p'80p@-P@T @@\p'L0-SMM\0 + rp=呰 0ލЍ 00 >04@p$l0l 0 0  L00S   H&x'|'T'$0\ 0S  '0L0S/0 0 0/0@-M0S   4 @  ;$@pkЍX0T0P@ CH0@ B ?! 0Ѝ@' '4'<'8'P `00CS`0p S00 P0S X0X /Xꘟ&: S@-  S  S/ I* S  S%|@=1A-`@XPTM !\t@T10S H10S. 004q 00p'p *X@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?K6 0(H00S ' '4'x'|'t''<'8'T's@- @P@P `SU00S @JT FЍp0t  Q \0 \@0U +P@'U''p@-P@Tp0 0C0  $D @C-@4M6$3 30S`sV4Ѝ0 0C0{ 0XPS !$0S 20Sm 4 㠒;$p|  *h0( P{D20S 00s  o20S  g0 : SK( "0 08"$4T10S10S61!0 0H 10Sx10S : S0: S x`x41萟 0IR 1 B?;5 0 'Q ㌐,p| , *LN\,|00S 'P'' '4'h' 0'p'l'x'|'t''<'8'T'1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQ 0P  00`S2p.,QPPU% Ѝ  B 1`0    0S[  L0  $R,   V ' '4't''%%'410G-S$0@010S 10S,0000 0 0PG0`VGc렠pPUG s0 0C0 W jp0$S,  `YpP Z`' '4't''%0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG 30 0C0 W ,*p0 00 S !p0$S,  Lp` ' '4't'%@- M @ wp ЍT P 0@  QQ 80 *T ޫP S  &0p@-P0S``3@P 4PX Aa@P8 Pxᤪp|'$96C-CM@3 萟P`8 8`T *F0 pPPCߍw ? @P8w0S ?@ῪP?oP@&@-9 ϿHH& 000/'@-90 㾿H&@- M<P<1 [ NzP G0 ˯S , !00  A (! 0  A{{zctp|!00@0 5P 8p l2P 680S X0;X0X&P !P 80-S ͼPXpPl0S  <iRpY@'XbH&&V1>s@-@ `PrP 0P U (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPXW剼凼ЍpU MJ\@{y0 3P496@%G-~MAM0SP `E0p 0E~彽P7d!&0`~܍Ѝ~,P 7 !0 0E~坽Pt7 ~,`Pk7 ~,PE0p 0E~PYp  OQ `/04 0EjPA7>( /%m+T00CS0 0 /G-`XDHMp ԻDTD$0@t000000 00 $0S0V"4`0p Q 30Sa3PZPZ60#/塻000 0K#ျP6h#0n/V 00D30p Q  #cP0 06"0O/V0020"LP6"0:/2000HЍp(0: S T. S+@ ⮼P00S`0:0 03V-V)Vq 1X  ?/ 3 0~\P F ;0L S0 00 0,qpS60S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U / XPV P 0%''P&%p('%!%m8@x't'0%}D00S/@-~M0@0S~, ်P~܍'%@-0p@$0l00S Ѝ00 0+0Q 5, ].NP%'IL0@- R<-P 0 0 -'iq(x'A-pP@` 3P@DTP`VA-pP@` P@DTP`Vp@-P@Tڬ` 0Q@Pڄ0  Q @;;S p@P00T@ W5(0, -( -%'x's@-R@T` Va0@$00 ?00S 0CS3P3+50 S9f-00@ЍpPڀ;;S" 00 0*0Q P?P00@00" 50S @@40ES TT 0$040S40S 40S 40S $0STڄ00Q Qd-T( L -4(04 W-$%'EDr(z`1 RS@-MLQ R @!  BR0,ЍQ   RR  RQ     ⫺P000S,@  00T0pSp 0L0*Qo 0-p T0%*Q/'%P&m4dG-PP`0  ,p@P"ڰAQ"*Q 0P P 0)Q(4@ ,ЍP P%'@-`xAMPh1P0S2 S VPLDB,00ЍV0Ap0p )0Q3 , P0S(0S 0)Q#3 ) Pڐ0V 0?K- l0 ` 0P3 0@ N,00%'$Ix'TmjO-M 4M S0`RX0E@FPy0 0S ̢000 Sr '0S    G⁻00 0,0  t0" #nT~4"#> Dp܍4ЍT 2 R - U1[ 0#`N#,# ·0S1圁  0,p 0  4 0 #.T>4!D #>,1$a0 00$0010p(0 C0尐  0,0( ,0$ ,$ 0   00 0# p#,# aTP&H&'Dr('q('''%C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S 1 彻$ 0S ͸pP (0: S0 0垸 p10S10S P5EP g0 0 0S q4[ 1 Z$00 0S00p0000 S(00(000 P@0S '000S x0-P 0+P0p0+ 0XM $%''q(r(q(q(q(>'P&,r(nDr(u''zC-M M` 㨶P!2H#*G 㜶P2#*SC$0`SH 0`E0S2*p,-Pu '-Pp 0 m S( 1**2r0t0CS G)|)p)5)])\)PL,P0000$2)2 `ލ Ѝ)&0S  R  sS SS YSP )yS)Dq儁)3)P)P@,P00000S,)( )0S0 ,P +0P)@PP EP0000)P0Wf)q(%'|r(q(%%P& Eq(5UtG h00@-@DpOp`T&O-L|q| \0S(P1`XX@P"@U(,L0 R1V10S :)@DT  A0d#0UPTP#)PV0S t)`@`ꓢ"H 2/L0P ! 咣#, 05D&8&'P&'Dr(G-@ㄑ0p`FP@cU PppWP<(PЍPT10S (Pp@ 0$03/0 PP" R T  A@P 80 3/PtPPTT00S\ X(R <003/P 202Dr(' P&2U''{@-AMMP/?/@P+ p`p P/00P Up0p (AލЍT0_"B+/0P0 0, 00`(''00CS0 ㎹0 /O-0S$M00`Y P$ЍP0,03/P00彖T30S ,@C@s2PPPP 0030SY PV :20S Q P P x4 CSR qP8 ," -P/7"( H0/S6P+) AX m 10S  P0S !S 0l!202;/P K , 81  0S a0S 11004 `]0D0 3/`( 0S 0S 0VP0x0CP0%P!P0403/ODr(8r('q((r(q(q('H''q(q('q(`'@-<@P.( '('b@-陴p @@. o'@-@Yp. 0a'@p@-MPʹp@.0S  0C0. `ᷴp 0: S@S NS Ѝp.`C-M~pЍa0H03/P0 03/PjtA]pP@ 0AS0 @0a3/PE0 0P)3P/P 9P0/SP( Ag00 006@ H.t &0(03/\ g\0 PDr('''&&q(O-MpЍe0H03/P0 03/PsPD50S 05P .%&50SuJGBP 0(03/ s P 0AS0 @0a3/P|4C003cP H4 CP(40S  ɳP T 0 0  ⾳P 0R S = $ `0Sd003p0St00PhP pS`3`0Sd00/S7P,', A S0 0  }P0SW 0S = $ `0Sd002p0St000S "SD p 0 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P |1 H^ X RP$PP ,1P0 P Ez @ ;/0S0S P0S 000[\000*4S 0S 0Dr(q(T&8r('q(`'4r('(r( r(''''r(r(q(q(q(X&q(G- R@p T T 0 $@H03/P0 03/P0SB0 X Pqa0 09p1MP \P: 0 P0(03/P@!!P0 0 @0S 0 00OP@& ɰoP0 0Dt0 0S T0P \0 CX TPDr((r(q(r('q(q(,q(q(`'T0@-0S^PP 00H03/P@(r(Dr(O-M MT崐0$ 0 P`Dp( r(&q(0A-M`P@pᩪP5(10S Ѝ 0RP  0RP 0: SP ƩPp$ 0hPW CP \$ P W$ 0@4r(A_p:(40@-: SM@=0P - \ 00[ P0 ;p 0: S0 cЍ000 t:P/  0 fA-`QFZDT@P#H!081P @$<s1P0SP+(0 0 0 =  "4S `ᨨP#` 0]ũTt 040Ѝ(tS|(tHPߨ ݨ00 0q(q(d&`&p(O-Z#3(tQJM0 M`p @ 4#0CS0t3tP d30S ፩P0: S X P p#Z Z30S "0 q"pSZ#"0 X 2P @$<댂P RPn( 4`S42TgP ỨPu<Pa*#" 00 + ~0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 CVzҧD 0Jލ Ѝ  ⳧r p G@$<pm ?4S(40R(4 \ \0Q0]0S0(4 00P 00q(r(r(0q(q(d&UZ`&//O-Mp@ 0W0DN 00S8 00<0 WPP0C080pG0S `0S * 0R 8 00 x x.  P8 i"@0 X2@ ?@$Q*Z"@0 0嘠P P` lЍXX { E  ` `@rr(r(r(r(Rs@-Ѝp@ 0@`PQ"< 0$ ᇦP " 0p(0@-@MPPᲦ00<00S =  J"Ѝ0q(G-`QM MJP Y@ #p oP p 00PP=! SR J(ݍ ЍܧPJ!8 F= $HL0Q\ J(L00 0dQJ!8 PTA-QP 000p@T+`00CS0pT0 0S0T@ 0S@ 0  h P 0S@ @@T S P p(&& p(0 0 S@-0@0R00000S0@000S `hP Pcp 40Pr(r(p( r( +q(p@-PP 0SEp `?@P` @P0/S000000f PR @@@pZup(h0 RX R  H R/< R/ $R/Q/ p(,r(r('"qS+0  @jq(ml@-=XM"@r:(⒐0 ZXЍ7@-@Pp lP Q Ѝ00 X DH Ѝ0@>H0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  ~//$r(A-@,,PQ U?-QQpW E`:WP 0?`S AXA0:S@0 R   0`ض-p(H&H&/ s@- `0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0Sk`P⸀p 㼋0P T  @R p00T0p0S , =@P00 PPp(,Us@-@n`P0l C300PЍp@00S S@@yPP$0  @D 200p(@-AF2H&l0 Rr @-/P&@-<@<.F0b+F 'F#FH&G-pt 3h@F\P*p`4 0Z/00 `8:O-lM/_oPa@P= /000?`GPp` PP@t?t/  @p\?X?A0sR  S  R4/4?0, CR 0K?zP<N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/8> 0> > 0S>   .00.0-0==P}===|=-=   H-  g= 0@T pЋPP\Zy,  0!-1  @L< -=@=<P? <;<,<,<,t<,h<,\<,||&nq&@r(0r( \&hq((r('x' r('r(r( G 0.q(4%0K {pdmPW0000 SX0 0P  /p(d0P/X0X0 @-P808P'  Z3p(Dr(q(WH&A-` @?\, \PA *\.  Q R( [\SPQU  !\@@]^.!Lo \0QS8 /0S 0R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U _ Y P:4Co S Q  S  FP  !   <0C<V0(0 X&q(8r( q(#p@-0@P` pp:40CS  0 p`pp@-@TPPLL @0P Jt0S ᅧMq(bp(1A-@` P0SᔗUp  P0P00C0PE S%P p1@@ P .SUP 00 B00C 2#@DSd00 00A 1#@10C0 00A00C 1#@ 0 00A00C 1#@0 00 B 00C2#0qp 00 B 00C2#d @v>C 0C0T T0A0 B!"00T&GA-@QpW :0 01  5  d } (l| <tw @|qp  i=/ 0$  4 =C@2Q! 1Q) ($5Q/^)0)40($84K ARKQ  $ q++   @04(4 :(40/S0004084(49)($ q++@k$r( r(C-Z4$#0CEM@S$030S`` EߍJ(\J(J(J(D ; 00$0$0<0 0 0ݍЍp$ xr(p@-@ PP hp@D@-p0-S0S( P7@P#z 0M0` Sh0 BPPP00T Ѝ@`.&-@-0@P   哥Ѝ@Ѝ/r(p@-@ATp@0 R P'RP ` `P`pr(-P@-000  x0x 0 0 h@0S \ R00L0L <子 ,S$ R Ѝ@ Ѝ/q(r(q(q(H&q(Op@-x+@Pl岾hPP \᫾P p呿/000S   pT]r(_8r( -P7@-000  0 0 @0 P0S | 7R00l0l hW XTyD 8K0 !R Ѝ0@Ѝ/q(r(q(q(&q(OH&}@-  55H&0@-MM#@P@Mߍ00/S/LPx*LP p T p  0RP 0RP  000/r(@- H&C-`q$M@T pphAPD00CS0>.@ Pp< @Y@DOoB0S@$Ѝ0P: S =P 0S w pW P0圀 SH@  0 G@AT圏0 @00CS0,0 r(H&&O-PQAM t2@ l2 00pD54< 0@ Ѝ/R#RR@ :BQ&@ B&Q@0=S 0 "?R|R& ~RR ^R X!000P00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R0'  -R0( )%#$0 s(E,s(As(|s(0 @-xs(0s@-P0`0W0`0S@ P 0R@P@  P@0S00S 0ST P000 R  Ѝpxs((@&E,@-AL ^`X sr^0 \ 1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP ! ) : O-p`p됰0%SP@y0V0&S T4m! i000 @ P@P@xs(G 0@-4M!@p PT` 0 P@4Ѝ0@P S=WP@V P@ 0 F?P@( P@ Uxs(U p@-@P0)Spxs(O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0`  H艉 BU! z!P 0 @@! 0 @PV`'T@@`4 @P @U xs( Z h U O-M8Pp`t! @p0 X@0DS '00^* PU@  0 c 0DS00Y Ѝ` pUU xs(C-pᐐ`  0BS0p0@SP&! "000 P@@P@@ Ѝxs(G-`d0SP@! p000 PP@xs(@-M@`P1PL0P  IR NRpp PpEp@@0SP@ $1Ѝxs( PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P11Sp0@0PH0@P 0,P@1 <&4&z(( @P/- 0/SSS00s(0@-@PMMMߍ00/S` #p p  0RP 0RP p@-`\0@P 0D0p@000"SP Vprzs( p@-T` RpH0@Q 8 PP a0pp@s(& G-pWR 0S)P PpB000000000CS020S @T  bSt ^S\)$ЍP0(s(@&G-@,Pp0ESo᪢' 0S$ 1a12zHxHY.sHUoH00CS00 H 0 G|aU000 &PD U@q Cf 0$0  HC [DPF P00CS000S (pA900CS000S U0S0SH0H0R2HP H(0GGUp#$@&Ѐ(L&(%s(s(s()420@-IM000000 20S 00S 1Q12GG0@TG1[GPP& |1 1@>0S @T H1׏ B@G8G18G0S 1 $ Iߍ0A 0 000 0@P00CS0 0@ 0 00x0 Q>00CS0 0S {GlyGD0GX00S j@00S ds(@&Ѐ(L&(:s(As(s(Ks(0@-$M0000 00`^0oSP4P @'000p\x p%P 00S )q{)>8i{000 p0CS0(00S  '$Ѝ@&s(Ss(?C-@0mM00@H0?_00?0,@0P@ h'0o000@@`pPdpTd0lo@0hP 0lP@T 00/Pl 00$0`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0F7S 'x0R8 @>0S900SE $.00000,(00 0p(0&p  =&0S(7S%00S 0 0S= 8 l= , {p@ P h=0 KT=8 ,=, R , ,( $P000<=0S @U0 0P@IV/P  @J$ 0 $ R 0Th$0SP007dGQhH 0'000 000|7 t'00l'00(0`7$ 10103/$60 E(7(' 6 ' DL0S /J68 6  @ R[ 4 0  V $C8p&00CS@0 fP60S ⱌP l60S%,0LzS5H6$58 h0 J5,,0( 50000*,( 0"`E0$0(0S,$P5 T50S U5,0S pxtP;%0 50S C0 @0 `@P$ET= 00<0$0 0C0 000lD000d48 \XO00CS0440S +P( T40S)T0SXOuI38 3 3 4\ 30)ß00:d3 0 0S '|0R#C#0 0 x3 Bph7J00S0T~N0"0C0000YO*I28 |2 x2 2\  H)Ÿ00\20 T0S8"00CS0 2 R   01D0S+$mߍP:10S x0(!SS}1 08 L0H@TIs10@0@0SP1  @0S1 01$ @0S 1 @0sD1 R#0S,1   B  @0S @0S7S@<,0 00S '9T@,0S0 f<,0Sh@3 D 0,000 H ((s(((@&}(s(S(s(s(Ѐ(L&d@0(h&|(|(ж-H&P&8&T&js(t(!|(s( |B E@T(0S p00t"w ,0 0v,sD)lPFG0/s(0 /s( 0/s(0/s( 0  /s(P@-@'P@<0 QP cR   s( 0S0/s(00@-/0M0@0OP xP 0: Sp  Sd PЍ0xP0 : S" PP(p@-Px@x`M$P*00S "0`000``0!`"$Ѝps(|(@-Pd@$0&0 RP   BQ   s(//C-LM)8}8 p(0@<P@ `D8G `0 BLЍ P&A-@P`(vvpWU bL(! 00'ap|(s(O-pWA R``%` P0S:S SEĐ@ @0S(W@  @<0T/S/00at00 R00P R:R:RPPP@DO!E"4&<&s(@@-PM/p >먐PK  0 @ T9vp0 @~0!0P 0pWZ0S 0 bT0S 0S 0 Svp @! h`P T T T0@@T >0DSs(( 1A-@MP`Rk01000  ;pf!XZU p!A@ Q X@T@QDA 08AS 00CS00 @ 0* 00CS00 x@ 0 ЍQ @@U P000yK 00CS0T00S D@@84(/GPYP&\s(s(flpp@-P@@Pp 0S%SpIP @2p@-P8@Pp 0R8Pp@1L0L-  R0S P P\ 0&t(G-`@嘀0唐0P0|Up00CS0h00SG@0S0 S 0S00X`PPps(t(&s(0A-p0@0`P Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S D^$P`0W:SP0R@('&A-`P倀000|Vp00CS0T00SA0Sp00|K_@T`s(t(s(0A-PSp R+G`a@T"W p0000 @0 0 _00CS0H00S `LP `@s(s(s(p@-P$@Pp0@P01@-L@000@00 _00CS000S@]s(s(s(O-PM/`@ 0P @@@k (tP00š0 0S 0S 000V#   P@ 3P @cPM R RA R 0S   0  003 0 03 Z0 R"00в0  *pP7Z { 2 @r 0>00Ѝ H" R," R8pP B0000S R pbQ  0X/R0XZp  #P pP t#P. R * R &($tP0 * R; R 60@@D\ P R  P@0000S R   BR 9D R5 M3 P(&s(L&s(<&s(O-`$MPp `x%t2@P, 0S*[ P0 00 P0p0Rp`#0`2|P& ZQ=01  >@$Ѝb@DT@ P  p R  U 01W VYXU' [10 0al 0aS v00@0S v P >W 00SY0 0 S0 P 0< S0X|(t(P&(& p@-P|`0000S S@ I000 00 00000CS0p00Spp@fs(s(0@-Mt@ 0P0000X0>00H 00CS0$00S Ѝ0@EЍ0s(@&s(@-yP 0SHO-`MpP@d$P0cS @@ <CpPp vPP VP@ 6 RNcS @ :*0S2UA ̲P0VPF UB< P9 <@ =T( 00S$ dB00CS00 < 0 U< 0RPU E<0@ T  Ѝ<@W P` 1000 `@`P1V>0/YPW1  [ZU|<qPUp<U~^<U Ut Uh UXU< |(TkP&o($O-M,B,Rp0 @Y0`V% VV:V  V /V   BR <` F R  Ѝx! R  \a[  #0000S(\@@PpHSP@ @Tp ~ [ /R0/S0SW 0 BR  R  BR    BR    <&t(z(@&VI.A-(A0S 0PS0 0aqP0S00 P000[00CS00S P 0SRh`hp0P RP000[000CS00S Zt(s(s(t(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `R@0S00S=STL00 <0 R0AD1U0 S 0S0&|(|(A-@Rdp@0`SP  R R00PH @t(O-Mr圲@0R00000 0$`4G0嘀C t4r0`SX@ 00 000CS0D0S00CS010S  Hn`P)0V00)PnP Z P &X10S 0DC}0@0CS0 10S {Ѝ 0S`F`H`Z' Z$ 0S@  @Q0 /PH  p @P P0C0~000@0C00C0t(<&s(z(s(s(I.2O-p0`SYp0 Ѝ1ܱ @100   Z :[X0S 9@ xQQP  PQ XIPD $Q DoP @800@P  QE Q@PQ @ T* R RPP P Y @ P@P@ Pt( (t(|&[A-XPX@X`P0p00Y0p0CS00S t(s(s(p@-P@Y0 @ pt(Q@-pP0` 0S*00E@`P*PP `R@ Ѝ `0P@@0`SP0S0O-0R00V00CS000S i0S @pWZ00萠j @0 ZqGꙂ! P00 R @x(s(s(@&A-@S`!1pP@! H@%Tp1@WV2 `1N0SN U 0S0P\P[V 1FpZI -@#=#060S$ 6#3#0#V3%0%U 0S \PP.[`[P L WT 0  Vz(s(y(x(@&&c08 N R S  0S  P )@&O-`RBM0p0 pP P Ѝ30S0S "0000@00 !P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р㒺* S :^ 0R Q0  r; R-z!  Z B/o" R" \    P 0 00CS000S )\  V@z   BZ/o"  "0 (s(x(z(@&L&s( G-pPK@P EP1N0St `E@[T @[Dpx0H 㠠`@0S0S 0S0S.`@Y 0 X 000 8@&&jcx(A-@e PPT0P 0S ;plP@ pP@ ZP@.pt06 R0S@@PX` p9 0 P m |($@&P&O-`s$M PPY30oV &P *P snU pUV `k`L3 R ZP$Ѝ3P\!ZpP'0?oQ20S P V P  Q6ZP@@=Y pW  42pP QY QuVP  <(160SG\  \@ /o"/ S [ (\@ Q 00pP#Pu@T R *  W R "0S  RP 0 S0C 0 !\ 0 R00YXcX `Z^ R[00V|(D|(H^'x(@&jp@-PX`a000@ R 0S 81_Cp F!t0S 0 00E1  S h00P0  D@ RQ D@@@Q00R00S 0S|00CS0000S ps(&cx(5rOs(<1p@-Q00@S$P`0SP00CS00 # 0 $0Bp j"F.!P#lP000V00CS0@800S px(p$P&&c,s(s(@-^ 0@0o|(@-@ S @op@-`@00  p 0Qp\ PU#00px(mG-b@P r 0 0UrP@Ѝ CR !)0PU0 R 0S\S0 S0S S S=S) " C< 'S: 8!0 S0B  0.Q,"00  }00 S$0,"0^ 0  :0 1 }SQ0 0 \0P $0H "0 U 0"  PE@x(&A-@s弃M`TL 0SIPU0S 0S t##RP 0 BRSD@4#":P;9@`1@P'%@PUV0S 0S |Pp `Ѝ@PDP$ 0S P wPlPcP`Q f `Q0 E`PV8 ? :0 S`A >vP 6P 3P 0P -P *P 'xusx(j0  %28p@-@PTpU0PU 0S F@p@-Px`x0PP6 R@N0S@2@@0S@D. 0    p0 px(@&A-0P@`Tp R@ 0N@T P 0S@@VVW\0HU 000000V0@ z(@&&A-P`p p P@ 0 ACu0 <G-PP- 0M00S _o1u q100 00R00 Sڰ \@PЍ0SF  0 Q S/R }CV P" Q 000S+  RA ``0S:SV@"00S"@A @00CS00  0 ( p0ST0@ ]00 y(P((y(d(5s(M4&z([L&<&C-M@$8T4App``P0S 60SP 0N( 0^0} P1U00S^0SP60S .0S PP PЍP ^Y8 0 P0C?o20x (@&L&T&$&ly(0S/p@-P000T@Pg00CS000S ATpP@T` `@V00`T0@0v0S V00T00p@s(s(@&p@-h@P000FTP ,00CS0 Sp@ (00S s(s(p@-P@]PU_)p@-=P @-*?Pp@-P @3@pA-P@P0`S~U0p~00 p0 000CS0h00S 0p000000C000CS000S 4&s(s(P0 @-S 00C00/4&00  000   /4&z(p@-@tPt`0000S0000H0 00CS0p,00Spp@^00?s(4&z(s(@-D@ 00040 00CS000S@Bs(z(s(G-qA0@0000V 0YP0kPSP) 00?0 000E000PS V 00CS0l00SG  E  P0) `0`00s(4&z(s(T 000@0A00CS0/00S/s(4&s(p@-$@P0 0C0C0p4&z(A-`0P0p@0@D00CS04&z(( A00C 00 0C0/4&z(-A-(M@@`DHpPpPVP u T(01 0P @ @p@DP`U(ЍAЍ/T (01 p@>0 P pL4O- DT00"3堣s PP$# @ #QRP ) 00DCpW  @  pU sPPK0 0[*0S  U! Q!P$<Ѝ# 0\X\S 0S#RP# X00S cS X ᢽP" ᝽PjT@ P' BP hTU   BR 0 äX U BPR 0 ä@ KyD b P BR 0@ ! ` `R   0 00   ?Ph :P00S`0KZt eT@ U8 L  B R 0ä/+t(|(|("d<&z(4&5A-P`Pk000QpQ00CS020S 3|20@T[UU  r0@000w @ C@00x @ C0 @0 0Dr000  w0B  x0B00  Cr0P 000w P C00x P C0P00E\ 0  LAt01 4`ЍP00 C R 00C\0 P #SR$ 000/hPP gp<00CS0H00S UP0> 4UQhs(s(|(jP&zO-PMf`@8pP0S 0S20YJ U0S SW@ aWP HW@` T @Pi Ÿ  00 C RS`   c P  j& :QpO> U0: a:#P¯T@3UQ `UQ 0 U<``qp\1V  d,V P 0SHA01 0pЍ U0 0aY   `PP q)>y` 0S㐬0qpl 0ޯ 0P|(  P&M#y(<G BR00/00S/@0S/ R /0@-@0000C S % RR R1\ *Ѝ000C S0S//p@-PP @P  ׽P l ѽP TP<P 000C S5Ppppp).2QX0 0@-^ @P U@R000/@&p@-`@`P6N0Spv@TpOOOsO@O 0 Cp@P@&xy(:G-`PR@]Q6 @pA(0S 0 - `V@A00CS00  0 x1@`CQ 0\!SX @TP<8a0 R 0R- @TP@00CS00 M 0 Q ]P @1@XT@Q@pQ JPGGpW, @-f@&M@P&Ioy8<0 \+P@--|@&80S/p@-@PPEPp@q:p:A-@1SS@D`pPU 0@P00` PO|(O-PPq00U`0SP  -R  RC -R0SD @0+R7 `;cP[ U00PoP0S P  ``U @-rP  R `DX @U@0PP ЍU0S ЍOy|(|(8@&A-PRB00і 0`00S 00S0S006X pWcP _P6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01QP00SQ 0S 0P   000S  00^0 PA( R   R0 0@&|(s(P0 d@-X@000D00S 00CS000S s(|(s(000C S/ @-0P 0  |(G-0p `R PU4\ 0S -R Q 0L@C10?P@! ,]PP P@U@b PPP-U0S 0@T0:SF 0R@1T0:Y " @P+@ P0 T 0:S  @P@?:\00|@Y00 X @0 0CC!08 2A@ Ѝ<?$ T&;P@-HD0P  Q 000CJ ЍF|(|( $0@-S Q*0S-QQ -Q^ R0 P :R0S0 ^ HPP02@:T  ($|(|iG-`R@ 0S P@ -R\@@$0P 0S 0-SM@T@F@D@0S 00?q 0@B00`FA!0S:0P:0`0#1@P0 0V:0 000CS0 10S 3,3"@0Sp` 0C  0XZO0a`F  R0 0CS0H00S o@0S 7|(s(s(p@-H@HP080Sp0u`0CS0` 800C80q$&z( 0R @-@T b7 0 B   B /@-@0S@p@-@P0S0ڈ500@2B ! ! !!  !!p@-@6    @$& 0S/xQS  00 S/00 0/0S/0/E,08 0/=P/P/0/E,0 0 0@-$&p@-`R`@PIP #t00P pd0 Pp0-S0S0 0pV ($00080@py(|y($&O-MRp00up R XT2T"Tb@P  0SRy RR00CS0`1``@r10`0@Ѝ\Y.R %A P&  BR 0004p 0 S B R  Y000!pX@U@  BO@ Y Y  YR  Q P Pp P  Q  R P000<00 K&<&4&z($&0@-@M P0` S @p0 Pl l "VT 0U@ Qx0C/  1x0 $&~@-M@P%0 00SPp@`T*vpPT @T4PLP @0 !P1Ѝ@4&<&|(t000S p@-`P@T T TH p<080@p$0 /p$&t(x(&(0@-@Wt(p@-d@dP7\Pp4 P 00008  P8 ! &p@&$&A-$R0@T @ : R 0 @q 聟8 0 00CS0!0`)V#V V v vZ A [`p! 0F S0 V0@000 @\V. |V ;V&P0 @ ;P0 @ @0 Pp&P0@ @0w|P0@ @00@0@p P  00P000S0  $&&t(t(M0G-pj00@ T T+P,0S)㰀" PP @Ľ loG@`P  0R0P `FFa@@T 0  $&p@-`0$P P l 0R$, (@R   RPDPw    Q  00000S@p 0 BRp@ b080@ p$& @-y0 000$&@-@oP"p@- @fP P @0 000p` P 0`@`$&O- 㸑`P0 b P@BPp0 CR00 S 0@@0XX U @P@W W. V. 0@PpGW PV VoP 0000 V wT001Sr 000h001S@ $&G-JM05P0@005 00 Pd400D0$[`P \ 0S ~3 #4 0  4 r[$0000 `SVT4 ` 84$ 4$00CS0! 0S$@PUV3 0RPPS p.0PS Px +30S x3|@|3|pX000 0S 0 `PPB P6 \P p(300p" PP0000 0 0 20 B#200#"U0S"P R \00\0@0 $P00CS0 P@0000 @("00CS0 0010DPt Jo@@k1000S \1 0 A0 SFp!倁V@0  0 0C0800020 000CS010S)0@0 0 0 0 02 P B1 0R w@z0PEu`0PUZJߍ2A00CS0`_R Y{00$&s(<&s(&s(4&z(qO-௟M"/0ϟ@/0 Q_  `00202280 00/20S@0S.@H" 2 pWdR00S /00CS0.0R00S 0@0C0D0000Pl210SxPTP"PF 2P%p~Dk@.U0@#S00 p6 p00@ S0p@ A0@S7p@a0@SaWp@ [\ P0000P,'P 0@Yi00@Sa p [`'P9Ypt= 0 0CS00C0~000p@L00@S0p@Bp W00C0t00j:`0@? @?o2;R0Sp z\P,\Ppx ?PpYW6;G S< 5:0 S [@0 W0C *0?0'3?pp000 S0 0C0~000@0C0p$W!*00'60'3?00 Q ~ B  ?pAp000 S0@0C0~0@0•3W5*00'90'6?00 Q ~ B  A0'3?00 Q~A• ?p Bp 000 S0@0C0@~0000C0w300'<0'9?00 Q ~ B  A0'6?00 Q~A•  B 0'3?00  R ~ B   W?p00'?0'Y/UP0>P0 |P!000P$@@0 Ѝ@PO0 ,  n0P(0 &P00 0_<P >P &P 00p0pm0 ((0 @0(0-P   p 00@0F$&&<&K/4&z(G-t(t( % @ y(|y(E,|(L <&M0I. 0{P B@ 80 <0p }  0D 00 B{[ #PA}P@ 0000@ P5 }P' @ 0  AQ'=0AQ@=0@Y0%[y :[4 #[5pt|0@ 0 p0K P AQLY 0@ Qp 0Ap85Dr IPp@<YA+ Q:p%pp02Q1S 0GS2@0  W y 0W0`2  !m!u@Q m@p[p$}[ IoQ 0#p0CS0p pO@'P023Q  w000`"0 !5  $00G-`Ѐ0@T@@0PU 0@S 0 0   B/o"X`0 0pS 0 $ 0 0 0$&K/@-.P20@-aM0$ 0 1< 001@001|0000TPI1| 1@Q  @@00F dt 0S $Q. 4QG Q 80 1,4  0<  ,0000 0 p0 0 0 S00aߍ0 t0 `0 WH0 D0 H00SqTS,0- 0s(@&s($&K/<&s(R G- Up0 000 P    x5P$00pI@*$rP 0 R 0-`     00S 0 00@< P0, RP 000@ 00 00 R, R~P3 00300 0000    BR   0`0 P 0   CR S0  P P`  ``t 00008 @0C 0 ^00]`0 Sl(P X0 R   L{000`0S0 R Ӻ0.0P 0 R000<0  P 0@S P 000z @`@`!00P0`e0 P.    00PU# T 0S 0@P000S0P0S@0S 000@Ѝ$00pp$&Lj  (&@&A-QQ@``p  @0p0 P 0W@ 0q R$@@`FR ( X% R"p0` 4 P U/S`P 08 000C0@04`Ѝ Q  0Sppp0 00 00 @p 0$&&  A- @0P P/ 000 `P n000p0g@`b`@@P 0`0 U000 OPPe``0SU OP$&@& p@-PP @0 @fP P 000 00Sp pp$&   P/0S/80 P/0S Q/0}(A-@Pp`00p` P@-` >P0@ pT@ PP  = Ѝ =@P=ĸᾸ㻸 㸸 R?!0& 0P/}(RQA-pP`%>VU``P``V@ =`0 R@~>P P+ 0=0 0&""A-`@|pPT@Q00C0U U a)@P 0Py=}(p@-T@T`0P0000C)00CS0p00Spp@s(}(s(P0p@-`@TpV@PU PG=P}(|0p@-P @R QP 6=0 bP w`+=,+ p0&7"p@-@pP0 S0C0 T  D =P 0S =,0O@dA0 T @@p@0&gfff}(p@-P`0 Sڜ S <@P t0 R@U <p+0S 0 S <@0S }(y(0&p@-P @0Pp 0  0p}(@0@-@ P  R (@<0}( 0 P/ R/}(C-M$P0 U00000p#0C@S0` o<@P 2@@ʷ徻  TV m< i<2 R@Ud2T /o"Rm U<h`0"0@<@P2V0S' `5<p@! =pP@<눷P1 僷w 0: S-<u00``!l`P!` `V'oPP * 0 V U0S00! 0 "1P @E) 0;00CS000S Ѝ@rT  0P#) 8Xs(!t(P"0&@& " c"s("Rp@-@`PP Vp ) x剺;pPV ;pV ) 0P0 p""pG-` PppW䀟@  NPA p0S T Y  <G8  x 20@ ,V L &T 0S @V@ PP&######p@- P@ 4;p R  +;p d0 Rp  ;p ;p ;p}(0&#p@-@PpD0 0RPPp03/;Pp}(O-0$M@@000`p@A 2 p @尲娒V 0S2" 0S2" $Ѝ@0Sp2 R@00CS 0SP P ( 啹:PsPP jT :0SX jPS:딡0000P Sm\1 0R  }:pP˵0C S ĵ|(  Q f:PP 0S( \:PP0 RPU P:0 600CS0p00S T0 00`Yꈵ0S}(y(P&h&L&|y(#s(#0&s(O-Px#xcxsM0@P P00T#e.p,`U8@D\T(Sh 0Ta000pW` *@p00S0SP0SV0SS0sS vS ¸UPp0+S -S T崸 Ю@ Q0 R: 2 P 1   G&PT 0 @0SA0MЍUF p p0      "TR δ00˴' Vr   %5S f9pm' 0X90pY0 M I0 H ж-H&ض-$#|y(y(L$#$#>$#P&p$$$A-PQT 00CSPDq12SK R@ 0`0CS00 `0120<S R 0q0S 0CS>S RS|l R 00CS0N0 - !$$$p@-@%0T PR R R& 1S#0 PpR!Q QT " "D0600S0T0S 00S0\}(s(s(@&@-@P @ %PNPW%@-@P NP 0 ; a%$(\%Qp@-@ 00CS00 P `d 5?U UL?Up!P0P0CS00 `d%g%A-@Pp0`00 T 0000CS0H00SA0S 00S $@s(}(s(L P0  /Q Q0 S//}(@-@bM0pS10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: p3 0S$ UEoឲp' W`RUM@D0>T000 0 00 v7TPx0N R T  DR 60SЍQ Q2 1 @$ }(z(@&|(PO-@`PP pP P0@DpSppTPA T٭P@DP:P5@<ϭP, (4  @P@sSa0S 000#T $00CS030S @@T00PpӪTW00 T\W! Hs@P 0E0`P 10STw@ T@@VPT @bP1 R 00STV@ Tx@P@UT X@Q0S 00S 447@@TppYW `ԡ̱PEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 ;`1 R 7"T` F00CS0400S i%q%t%l%\%P&o%}(s(s(w%%g%%%%L&*&%D&G-PPp0E` o@㨂 TUG0S 00S 0@0@000CS0 00S ´@}(}(s(s(p@-PD@`02S@20CSpѰV02p}(40T0P?o20S 0S//}(C-p@`1010r!Q0@S10C1 ЍqXPU X2岾P^!륾P 0S ᨾ}(s( 0?!!R/P/}(p@-8P\2Sp@\Bp}(0-MM01`"R !R X"R   1 1d"1!d2S ,HIPl1, ,?IP L!0,006I@P$1, u@T0d6`0P, U @T 0S &P00CS0 ! 5 00 0$0(00D>S p00 46 5"!031}(s(s(s(0@- `"dy}(p@-@H0'Pဠ0PPp0C/U00pH&p@-T@TP0 0P0 0 0000CS0p00Spp@萳s(8&s(A-@R`P`p 40PPEUp WD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000P00 00CS0h00S 0sDP`000=00C0 (s(s(p@-@P@0SH00Spp@00CS00  8&08&08&@-@*P Ѝ&-@-  Ѝ Ѝ/-$0@-  ЍЍ/8& -0@-Mh0, @P(0 00SZ0c1 @00DЍ0@Ѝ/G-@'`rP$ 0S! pအ0S00CS0?0 " v00CS000 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' &H&8&0Q8&@-0@8&@-0rS&&0p@-\P@-  Q%  0 ` Q R  @P@DR 000S=SA00@0p@ap<&4&z(0@- 4@ 00C000 076Ѝ('0P P PR00/0@-@HP^ ^  R0L00E,A-( 㴀 R (p`@pW p0S 0QPU  0S 0S   3/P@P00(0Shp@-@PၧUl 0Sp'SPVP@'PP,p@J  EF ''('+'.'3'A-P0@S`p    3/@P@PX 'W "p0@=S0U 00 00CS00  0 00CS00 | 0 T :'P&>'O-@00pS 00P㜠`V  X0 ᵛ@PU* ЍY   [ QʁaP`0p((T@0 S =SR/=S/A-`P0S=SPERPU@'.\0\pV!0@qpT 0S mPVpp@((1@-`0@S @ PPT 0 `W X `Q  `P Ѝ@Ip@-P @0S &%00Pp舁(Q+  0 BR @-$ M- 0 S^0@Q 80^  ? 0  / /:A((2Ap@-@dP`V P%%pp`HV4%0% %0ꈁ(=ADAGAJAO-M`pA P U d $TP L $XP < $PW ( $PU $ P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WU<P:TU $P`$bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU 4PU(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?0sP0SSUA ′t~<ST[ TZ TY TX TW TUx tThh BPUbЍ0i4"0d @d"T   Q ! V"0P녡t! P0 J" U P pBBBC CCCPBYBBOAWANAVA]A\AeAdAjAkAqArAxAyAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABB B BBBBB$B%B+B,B3B4B:B;BCBBBIBJBQBXB`B"C-C)C^BfBgB5CnBX71CvBBwB~BBBBBBBBBBB9C@CIC@-鶙 "UCH&40@- ,SA0 "똁(DH&s@-@`ṙ0 00#S@Pᮙ0S 8 P00S 0 PЍpDD0S/#Sp@-@,P(p0P 00p蘁(D屔@-PRP@ p`dp 0R" Ѝm0"S0SO 00SS  00@OT&@-TSPL0 7p@G0"Sd.Brp P !4SE 4`SB2 4`P=2a0C" 20< S :B0"SBx5`|%.BCpj P* x5< B B0qptB Y0x5< 0RDB 0BQ<0P Bx| iP 00 00S- pP0`(V& R s S 0|0 0 0`P TލЍRadaea&\M^bRbb/bbbbbt(&( c - BR0 R p@-Pa@ R! hr0 0 X0 |X0 hX0 T ( <, 0,a0 $8 4 < $#$,$<$KP ]T }⵵p 02Q0S*?X`\PQ TV@塵p@f~eHfTfafhfsfxffffffggO-pᔀ 2MSR R@`aK 8QH ,[E 0喇0 ᐇ  0d"@` O 8 倇,  y ކ0"@ 9 0 = !R!!'4 0S 0C R^!S[0    0A€8QI 娆P <0P+83Q* 8 0A0 @2<0P+8Q *ЍO0 0 0 0p `8 7 ЍOЍggeDheg\hhhh]hnhhA-@T`Pp(Ỵ`8SA|} 0`h 0`( "4`#/A-P @4"40 4"40 `p{ w(l(,,004488<$4"44$4"44<D$4"44$4"44$4"44$4"44DPPTTXXQl`pW(4"48(@4"48d0`PV@P ~ {0T0A0T0A T4"40A(@-@l40Pm08f/WEVT@-@P TP8#!00Q@WEV(80@-@0S B08f/ʉl( 0\ P0//@-锊DD@0 <44Ƴ R 0 Xj8&H&jjP7@-@ PTąP0 08P8 0p0 }A Ѝ0j(vdj0@?o2P0S@- p`P坅@P ᘅP ᓅP ᎅP@V@l充PH@T@T rp0 8@A@@ Ѝjjjjj(udjP0@-M zdPd@ Rp H!A 0 400+ +|Ѝ0訧(zd@jjjs@- P2p A0  `0 Z@0`D   _Q0   J0  C0  <0   4Ѝp訧(td@k"k9kQkkp@-( PM@`Pw p  ( kV V h PЍp (tH( p ,@0 ꨧ(}d(@?lQl~d(YlklP0@-M @  tP@ q@4P4 p0 l@Ѝ0yl({dЀjA-`!圁0@Pp0M00!Zp0SP\@BT up  <D@eP qP p`(,0Q 0$0S* @P "@QVW 0V0 w0( e_PR0cwt00(0S0Ѝ00* *  f`@ж-H&l(|dlllDtkP@-$M 9@P p t?릇  00S `P0"S U1r0%*V  00S p}wx00 "R00S pd>PdPd `尀p p0 <[>0Ѝnno1oKoeo}o(ydjoC-p@P` Q 7>qPd@ R;  b1p 4)>03/ ЍC 8&o(o 0 @->먧(jP7@- \P@X?P H09P400 ' p Ѝ0o(wdP7@- :4P@,  pH Ѝ0訧(d@o@-齆(0    pH&O-`,M @PpP}0T 0$0X,Ѝ q  p=$ P   p $0 S 0T@,0 0$0S $xtYV  RW 0 @Dqqqqp@-@P0P& 0P+ 8>0P  N=0P 0PtP0@p@p@ 0tu@`p@U@<Pptcidyaraqrbmngntsqqqq0D S/ 3C5C$1 4! 8<0/ᰫ(0@-,A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@갫( 213/P/ث(A-PT0p(,`@܀,0T@@DA?@?@@谫(@-?00@0 (20,200P!P30谫(> 0R//G-0`p(,BP ~ Eࣀ@PP W ,20CS(20CS G 0谫(ssp@-M@`42S%^  E 82<"@  0(2," Ѝp@  <"82Ex`p@ ,"(20| mX"\Ѝp@v 갫(&sst.t 0 S 0(00 ,00(  ,   00+ 0@PT0`  0W0S $8p@00W(0pS,0 @0m 000 W 0S7X\" 0up@@SR 00 RX00 04` p 0S 00 00 0p2P2 S2S/  3@ 0` S 6! R0Y0 @``!R (0 \ !A(0D!H!L@!$(,@l21S  "/0.0010T0 3`2044`5 8<0 T @`@ H2(0L2,00800 S- 1S* ( V000P,  00SV0!14!8!<!14!8!<V(`,)(,00L000D(p0 S( 21S$ / .0,40 81 <V ( S  PV 32 $45(, V\(00,0p@ `00 00 0pS0S00 00 0p ;P  \VU6 0pp y0S '0S 0s X2 0 RS 0 ePTo_P$$00D#$0 #(#< 0'4 0'80'< 0 0` p=0 @72S` BT0aPX k0 q 1<A 0G@@p,2 0C00@@T` d(2? 00@@Z0`Fa ?`1<A 0?``+@@D,2 0C00@@`;9(20? 0@@G/`Fa?`?``0S\ L02S@P@V @TTJ041ST(ӄx( @A-p@BM42fS,&P42S  0PHU42S 0S 1P0C0 42RSfvP:42S]1!$1(1,ЍA0S` SPy`兄d 0 4rW2S g`p` 0_PW"PR SM0SЍA賑@D 0ЍASP6 0Ѝ谫(ث('υ IblA-@T2 @PtP tP tP@ `p@T 00S p`V@tPD00S @@t@P謚(($&A-Pp`"@000 0@@@A-p@`T ssPP8( 0@V@@굚C-M M04((P@  ThT ntP'PLD(gt000,4P@(@P 0UL4 4sH` PF @44P4S@@044T0F@@!p0|"`P;$P$ $0 1  <30 <(00S#|0 `CLP60p0U9 rp@9 PB 4 R 4g\d<(00PS<(0 0@܍ Ѝ0HSʈP0S -Sq@`a=hP00@@4Ps4 R 4-$+A0!FNP s@800  0 R00S& @10HQ4A<0CCQW-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!rPp=0D@@rO~P0: S0RP00 0\"PP bP81: S P% S  R  rn"PPp(PPPU rPP$0@P(,(Ÿ@-l90P  44 0 Ѝ   ,(0@-4S 3/ 9(@-w00 @y 0 $vv@(@-v@Z~v{vv@@-p PL`@@0 7/0P S Ѝ Z00(O- MM0|6@  @  @ 0p$000 (0z(P=,@  ܍Ѝ 03/0P00  }Po @$0SP (0S W0SU SUtt 0000,; p` ,0 p p50@0Y0C @4 `V+` 0  0 000l4   ` `  Y!  00 0 ,0BqP,0 0S `CqP`k pW $`V|_p@P ZC Wp` Y4;0S5 #  @ 0 0 8%00Q00R00S  000 x 0 S   Z0% 000 0@@0 00R0C0r V B G SE SB `V` 0S 0S_i'@U 000 pG-0@  0P Q< 0 PP%  & 0P` 1 pЍ Q*l !URQ L l 'r0 p H0 0W40p P  0Q0   040 04! !$0 0 0( 1 0, X0`PX P< 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0ph00 QP    0P OP| yOpP1S1S1US1S 3S3S3US3S, { pP0p* 20212 1300p 0ph00 QP i NL2  0 0Pp00S1<01@040  0jh40  QP   0 0PA0O  A0OP 4 0R   eY   X`V P0E m 06#++R`HX< $0S,0,  RT0ClD0"#1P0P  0QL \0  0P 00P00h00dl0d@ʣأ6RtRRaArrAaUؤ,Ps̥@-p@[`P 00 P0Pg 00QP { Ѝ |0P< !@ !0 P0g 00QP 4 E0PVʣt@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |D0 | 0L 4  1 $P00?UG-`XpP @ P  Ѝ0!0呗 01gXY D X0 X0 P꘦O-@,M0p@$0l@`P Ppr$PP @,Ѝ o 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P  " @P@CL0!Sp sppP0 Sn j0 P p $`l  Ie 0L $ P 20 2 p(p," "  @ "  p@! P0 S@  2"!"0  0p@ʦ]P p p0@/ //neLO-`M@Pp0P0S Ѝ X 0H sA 0B { / 0 s qp6<P0p@P x q$`02&P 0 00 DP 0 0̀0` NPk { `0xP` P0 0D `P  Ǩs~MR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0HPO-0p` \PP0S Ѝ$P  qQ 0 @T 0Q\("Q@ PQ A BST" R t D r   0 TS000  R ꤐ0 0 mI 1P [P  I BPTR2 Q PEcߩO-X`0Mp@WPP\Ѝ m0Yl0L (2 R0 r00 PP" 0 STzR rH 0/UPi m a 0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX 09#! 0 Sd QP 00 P꘦PG-@`PpP0S00S <q/p@q9WP$0S! 0S 0S,0( $0  P0S 055P  PPpl Q #P l0p<0P0Q*l0S 2Sl  hXPP 0 RQ@0 P 0uld@-XP?`P@@\@#T@TpW @@T`L(O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0c Q P LP0 W:00 0nc Q P PLJ 0 P<0T 0qB(& O-M@L0S<`@DHp SgP PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:@dƫ(0 A-B?$@[`/p0S f0ES PC 5lp@@0T?  C0(0 PK` %/(O-`aM 1V( 0/ SP0 S@0P`,0@@D0$0 0<@D0& R# X0p1#r#88 (00b800 QP aߍ0P@<`,0@`D0$0 00 Cp`02# ꤽ( bPW00q2pG40HH04 SD00S    408 24000(00pb800 QP (100  RR R0(10D0@`PP\; K/T!ibPP05UP$, 50Ph00h00U U0@IP0U*0RPd0x1STx!0@P %4xQP0%8%\0 P0PEd0U03:T@Rt%P t!dx1PZb" : 00t12P0P0$00`P P014 ('40PI 020SP0 S0 $ U 0 0` 0J000 000 00 0(@ D00S8 0(00>_800 QP40(R(0 PI (&ͫ6(?WUzyr̬ƫ4խ2YG-@p r W pP{\aPP rPp( PK/gD08QP0Q:" 0PS00  Q pzxPhdP80 "8 R 00 05 !$w(Z1p@-@5%SQ%5 %SPQ %UUSQQQp  0 0Q0 Q 0(A-`hPp5@ @ 0% Ņs@ŕ\(O-OMPprP b5S5圢@TEOߍt cP@ ET TT 5d 50 ! S$5"R$%P0S4dP  RR @`0d B2" 0] JQP d d0P Eh0K/0h0 f0@! ,qrd (001 g j  f  f,10,1#40L0sK?000/1001001#40>000310 00 000T0 C](%,5QP Dd Qd0Pa깯(ï(ݯ@-@ P S0 5(0/(0/(0/(-@-  `  ㌲H&G-P`pg@0S  0S X| KU ?TY0S 0SVg@ }(5:HN-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  N@-M Mq@` @:PxPݍ Ѝ`!rPp=0D@@rO"P0: S0RP00 0PP P81: S P% S  R  rPPpzPPPU r PP$0@P(~ (װ@-)0P  44 0 Ѝ    (0@-4S 3/ (@-f00 @ 0 $/ff@ (@-f@J"fff@O-M$M`pP`"NPX1 b: S/se0P  rR mf00pPP W aUP 0C P"VVR V  VzaPN GP P W\1` 08`PIX1: S<V2"*5rpPUBPV9 PW00``2! 0$  $PPt )P5f0S3]`P S R Sp`P-p `P`!\1 S R U;Pk`x!|0#YPaY $ PtpUd( FPP FXND% ܍$ЍbJ=ESF F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0PF( $0 $(sd XXodddhhllppttp p@-4"4 04"4P0@ jFgFdFDD^F@@XFHHRFL`LPPTTX~X\{ \`dp` pd p@dp@-`"Q@Upf@p@-@P%F"FFFpA-P@M4Q->C F->?n}C@X=X\:\79>E9>:>CE:>CFE 0? AC>EC>mGEFEE~EnFEGE 0X J~pXV}m  $$((,S>,ES>GEFEHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,3JzTvT`XrX\n\`k`dhdhehplalp^pt[txXxE0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P b"9<Q08u@5ppL0p  0Sls` ]0 0S ]  000 St:0 02P0 @S$0 `0;9:  \08%@5  L0  0S_h DX,$P20SO DNv0 0 0 000(@$? x0t 60 P 0 BU 01S0 : 00(!( (}zh}{ h(w N  HD 0{0P000 R0T 1AN PKHPE8 @2x0 y1( @( 5 P2h5@3h (\(8((4&(t(O-M`@ ) P0H: 0 0@40P$? 0 62쒟2Q { B("( pqsἢQ0< ,#42 0JR uXQp 04  0R  @PЍ( 0C1  0 4 Y: 10S<000D0`1 0` (0oC 1 010S 10S 0V` `$110010S Zp1p1000 I E8C80](l(4&8(d&`(\(O-FM MP` X [딕p@&: 0 x5 RC@"0Sh L50S00  000S Fލ Ѝt00 _1000D0{4 H0T00X0400 4QpQ\t` #  5`Q"0S, D L000 0 HP" $0000S Yt0  0 3Yl.P3 d.P0! "0K 0 6 @ 8C80  0 0S ry  P1 !!2.P РL00 0O0 H f w 0I0 X0 l20G0  000B00S 2jp0!G0 h0G [0 Y0C0#  4 S 0040NpPA!)st1p 0pq@ 0m@0  kh000C0 0 S  ,q  0xs00 p   8C80>0000 0 O!0xs  p000S (ϱ\((4&J2(Qt(J\ (ѲC-@PM`HXpaY 10S t10S 00 0U P< ЍC(@D`T> 1 RP1H v0A  P PI H0S$00S T R 0S r0S G O@ ЍCeT-P H0 ЍT((()(4&ϱ/=Tjvt( 0`( "4`#/p@-@HP08 200@ 00 .00 @Yp(00S4  /l( 00S/l( 00S/;l(P000R0S<2O-@ pRMPhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0T\5t!S` 0 000 ?@U (  R8 R  00\ P `0/0/0 0 Ѝ  [ T R  P00 0080/((((TȳP0O-@P:1 R0* 0w됑吱0 `SxP p* 0 T C:\50 0>00,"1p R 0 0 !Ž p 0v>`0 C c00p0S   0 -0xp 0Z> T0  0R>400,00S Ѝ (&((T(\(#0O-p PQM P*T PW0k:8 `\5 0 0> 00O,"2@ R 0 0 !Ž  @x 0=`0 C c00 d0@C CLA c30B$ 0X8 Q,040(0PÏP08,10S 1 PpBU809 رPWE 80i,80<01|!0<S0<0<0Ѝ U9  P\E<:`EE8:f5:U .: R T` R <(ట/? 0WTFWV  P Q RF 0X:P`0FQ   R(F(TP(H(\(L((d( 1G- 0pP `D=   0 0@ 0S 0 0 80PS `P` 8UH0ZP000PS 4S`4SQ$,$ (,`(PP8(i(\(@-@8P 080(G-ܡP0S100 B?pQ PAP` 0@`8@Pp1 ?<\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ&d0SnP 1@0  XPP00Ϡ^P0d000 A\(((((|((P0p@-P @?p<800P( 02!SRp((Դp@-X`0SpL0LP0@1CA0STR000pL(|(( 0 0 /(O-H0MS MP` 003/ ލ Ѝ 40 pP00 +0H000 t /0 @ S 0V 0<0X0|3!0S' l3Q4Qd  0   0励0y80Z0 02+ 2R2 t R<ʨW;000 Q o ! ZH"$"$c+2P$" " Ry{!  {  t R1* Q5 1000S1H Q B/o" RK h!B0 \ +BL~D(P: 10SP, P n0 10S0Q 10S 03/ 000 0P  0p`V0Z((D(\(L(et( 0>p(0O-SRM0M 00#4@PU( , : SRލЍ|t \`(5R\<R P  RSU 0 0 ,OUq0 B?@`@P: 00S 03 00 XV8ő @5D0LT 031 a> QPp(@@-@_80< \PS0 80<  D ,Tp@-@@PU DNPP ;P 0 R0:pp (@0@-P@80\U< S0 80< 00p@- P0@RU0p81 R0p8P@C00S 0Sp라P0Sp-(00S t 0S 0T0S(p@, ] (\(f(nrv(@-@M`peWP !0B  P  1p`V( Ql 00S0H0S 0 0 P0L ,x00Sll, dS(00Ѝ@DE&P0S (0`Ѝ蝵((\(((t(0@-MP `"@ [(Q Q0 $0ASЍ000깵ȵh5O-,Mp0@P @P(0S @P,Ѝ` T0): SR 0Ḱ0 8$  !  刡 Q01:` V `3 V `! A P th(0`S @P0!90 0S:R 0W30  `J(`!\Ő\  ? 娣 ? |'0匳 R x3R0Z SZ d3 R #R L-<3 R '$3  R0\ 0㵯 80 20 00C 04$0S4L3 2$ 夂 B *v92)p20S `90 0 0: S S-  S5000000sS 1 00108'1 1Zp 9 6*K 00 0ˏ /0X0 70T @ 0`; ) $!000<00S 0C600) P( 0ˏ d ⻹ 0T0 C c;  뫴 h( ((x(ߵT(H(l(U @(h(\((`(O-lM2@ 0p`87P!\P  ? 堒 ? m&0 Qt"t2 0R S \0 S 3 S D)@X 4Q(20p`D2QpQ\tQ`Xd   X 1 R, WQ&00X0S 0 0 `0\ *L!00ST06 0 S0\ 0㵯 60 20 00 04$04L3 2$ @  *'80'h00S P8 Pt& PlЍSq l((T(H(l(U ,\((((@(h(O-`|2t2PU@Pp00U0 0 Z00 Ѝ0c ?˿R04G 0gC WV@QVg T0U A0 %00100 @ DL @T`T0p0T S @`B 0S @ ` T 09  0U2 0 |%P 0 J0 J`0@S 0 000T000 Z%[P000mi(\(NO-P,4Mp$DW`W0 Xa P0 c0 C003 X 4(!P  4Ѝh9+a p00p0S 4A 400 0? 083@430000!T  : @ @XT00T S @w0S @ & T 0 m 0t%0`00WCc 1 Pf (pP 20020SV 뉑  400 0? 0б 0 $J0 JY@ $0H  10J(Pj 00 400 0? 0 10S4 A0 0000 p0 @0S$0Yd0000o| W z R$p m0 ge00000 <$pWh@\((i@- P 55H&s@-@P `0S 0S 0 Ѝp获O-MlE M`PR0S 0S @Mp P 0Sލ Ѝ000S  7P I0S 0S s0S nw0SqQ 0Spkf 0S\e<0SH_0S 0S(Vl 08Sd s/2#' 00 " "B 0D@? !? 00? 0 I 0Id!! 0I0 pP\0SQ "04 0 R0  0"= 0 , R( 圠*,4ï0AN8?S% 78P0<P0Q R0" t0S dPUs U@0S @@PUn K$0SP@PPDPKH0S  `Cn* l'5xl$|0S ll0p00S00$P 0,0UA:000S 0S HD1 H0S 0S$0S 0P  $P   00(0%P 0Sm8 "P PP DP(ȷ߷7Z~>˹t(/Vv|ĹO-PH0pS`M W0R0: P 0"p`7 "0 S 10SQ :fЍԱԡ 0@ 0 000CSY?00 1> R. x!PP!0  S  @ eP   . 80< 0 @`80< `P0 P0  #0 S00@ ` R Q\Q\ꝻH((<(4(лԻ(t(ǻ(00S4  /l(00S0`( "4`#/l( 00S/.l(O-M,M \@M"[:$0: S`B[ ` p2*P" ,*P 0 0 00؍,Ѝ`0 (*P L X*P h0S  0  mP J0S, wL: z: [   054%00! ?0S S :00/0S 0 S :V00#03*  R00S D:0S7 8  02(:* 0S R #P0P4`Ɵ @U9U)9Q00f0 B?1pQP"x90S  | 0n 0l  0$ 0P080S, K:V  Z9Pp⨸ U0 00(p UxPP0X ZP (0000@PP8HYDP"$0 S7Q9 80S5  V0;R00*h0S- 7('d0 ( #0 [P d70S  0` O @(260S 0h0!60(%R/V+: <V3#\Q RnP   hPpQ^q U PE" #p#]:U PpXh RUPp%Q_'qP tPE! p 10S0AU 0  Z; 0S 1000S x50S 0S 0,  ht ?E 0S 1000S 40S 0S   J 10S0ꊡ 0000 04 $0 S 00  000 0R$000$0 #600S440S L4P P u@pt30Q00 0pQSLtQPXd00H00S1 0S \30S? \P  0JP2 #0 \00&&p2 0@S0:000S0840/<0a0#QP8`

hR=\NP 0H0HP0`0Ap`EP1PU 0\785  @5D0L 0T 32 b< RP1Q 00 V 80&03/ UV 0 H` P00S ,b0S@ H0S8  0 # P0L #-Pgh\( ((((#((t((H(()(8l(G(ǻd(P(l(_s(0(4(X((2Qy5O-pş|M@P,0S%40A}HDLdP T0AX  -I5 $00 dtP 0@, R<T5@|Ѝ 1o\%呆( R  `  0`oQ0P P0_ S /  !.0P?00 1> (@` 0 _%Ϡ<#\ ğ Q  0  D ?0  I#3 0R< S< 3ȓ0`S0x0@S ?0, dD 0t l`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S HV0 S\00T0  @T`0VT? @`1 0t20兑A0Y 1XS D 0- ͷ0P0  $ :H000Y 0;* 0 0VT0Q@`` @ T\@@R0@3T5Q`1:@Q`$ 0@0չ 00  P k00VT 1PS ۸  P 0R`* A G((T<(e((D((H(l(\(0(ڽH&((U x(1H(UO-`pܐܰ 0M @ 0 0  BRЍ PPU  RQ p @ p R RP Q @p`(4( 0`( "4`#/O-lMX iG0X0X10T1 LL1LPp 0,0SlЍ0S 0,`@d3C0 `00ట@ 0D RpT0#:J`P 00ASpQ 0 0S\tQ `0S @Pd{((`(0(H&l(\( 0000@/00S4  /l(00S0`( "4`#/l( 00S/T)l(T:O-M`@@V MP`0:0S 0P *S *`0080< 0/[ y 6CP X P ) ( P9`0S 0S `)P P00 <9 #R0p0,0S010002(0 0 4"400< 000800$l 0P @ a  \`* @00C0N LF0000S{ B0PuF0$S 0S '00dP7`} /00S01P,000r2H'0 0 4"40'0p 0pp00ppP*0S  .P_ 0 0M-`W"PS ` @  :- 3-80< 0 80< @00C0 0 00 0Q.*0SI  IP  0"pWWލ Ѝ0S 80< 080p5 0< S \^0 00$000 ,^IP 0S 80< 0804 0< S 4^0 00`S $`  B("( p , ᴠ,P@080< 0 80< (00C0 80R<.PSR$ .R $PPmP3P`080<4p3 R0* 000ZSP. 0 0p$Z P0SHp0AS0Ss 0p32G0S40000$P 2 @#R0؀R 000 E#R0uQ& d20SX20SL 0 (P    P000 0 0 #R0 R | 0 l~R> +v 410S& 5]#R0 š!ȡ0S  0R z؀0P 00 00lPd0`P00C0Z?#IP8[ \(d( (`(4t(8l(O[ɾ(ѿ'((3sO-WM M'0ASy0G PPl7 8gTG BP 07 00^@  6$-P 60S 60ԆF6 3X Cp0㨶`0q60Y0:6 R W8`PaVtPVzWލ Ѝ!  R1[ 10SJ0!T  0 S@1`0 ? `;00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 *Pp@((T(H(l(U h@(h(<(((00S0`( "4`#/l(O-lMX xx/@`p200,0SlЍ0S 0,P@d<0$ Pg000Pp1 0@1  0D R`T04:1AXpX\tX`Xdh  X  @RF X y%P 10S  0v@P7P 00S  0| 0S  Q\ {{00偱 N0X!  X  P  @00(0(H&x(\(b(0( O-M式M@PL!n00 q?0t0?0SX0S $5S\0SVPPWX0S $Yk S Y Rd?娀pW\ 0P%T਀X僀 H\ *W&L>@>0S A0 0ꔭ S0B$5111`R B- 10 0S8 $~0S%  0帐- 00$%BR㩑0`S<B11@%L0 ᣯPP  B PP 0S <P *堐%<<0S 0 02d0pA?P0;3A?`0 =<0T0.L0r>; 0WHQ RX0>F@ @0]>8 84<ϠQ bT{ S Q,0 SZ?^@ P< T;0S @ A>+@B@  CP; @@ h>000$:J*p%: :0S Z30 0؍ߍ0<00

 X9R0夈z Sz @90S 0(S 3S  0S  ]0 0H80S 8 0S8`0`x800D0Y h88o;\Ş&"\ `  0 0Ϣd h  pBnj `b"36+?H "D H D 08T<\TR\\0H7T `V=S(  H"T VpB$r,00C S=S|~S  +Ϡ\<#Q  0Ćh ?<04S  60S xnP%5u0Pfh ]$h60S K0 &\Q\u0D06P5D 0ST555o;\Ş&"\ `  0 0Ϣd h  pBnj `b"36D@8 !>A! "$5S88(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0<0 $ST0< T<$!0S\0P <V=SL5s35`!~? X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0$3!΍0 h0DH0lE 0#0AS0000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX㧁 X姁0 8PPK,2!~00<0S. d70 ST0Tpp101"P Rh"!>2 ԐXdN8pJ80 0 D87000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S0\04 0o((((PC\((U gJd(<(0(H&TH('((L((Gq(8 X(=(@((h(l(h(t((h()I$5S|2!h `0 ppWS $%S0! !42D0D  ,x  x |0  | ("H Hp L3t !n r! T0P3 L!T0 R H  20 0000D0 FP1  W"q1*Q"110S ;0 020S QL P 0< ST0T STTP hFUPt2 L "0< ST0T STT"l"0 020Sy0 S\0P S\nP BF'P 0P S\0 S\0!TD\#0 08 ppS $S00S`0" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8!!H &H Xp?!D0Y8 0 S\0D000S8!!H  H X`0A-0P`@0T:Ѝ8ppX @dA-A0 5 P0#R%(r`! 10" q0SR 10ai0 a*.!t1h10S 0 00SP03Q0S4 R@ 5*< 5 !000S 0 0@TP)UA$t0UC P`0 0S H P80 0S ((&@(h(l(t(=0/d(0/d(0/d(-@-  W  ヅH&G-P`p:@0S  0S X| BU 6TY0S 0SM:@ td(diw}-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  E@-M Mq@` @1PxPݍ Ѝ`!r᷾Pp=0D@@rOP0: S0RP00 0PP P81: S P% S  R  r PPpqPPPU rPP$0@Pd(t(#@-0P  44 0 Ѝ   t(&50@-4S 3/ Կd(@-900 @ 0 $&99@;d(@-9@999@P/00@-@0S  @ (pu1Q0@?o2P  R7 P0 P0S 0 0SS 000000/ PP  P R ` -X XQTTT 0  000  /TTT8 (l(@(D(H(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/X((T8 T 8(0p@-000 0 00@P22=000=000X0X0<0<0@0@0\0\0p H3H3L3L3P3P3T3T3u/ h p@D0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p H3H3L3L3P3P3T3T3u/ EEP  4444K4K4h  5 5d0d00000-P5BP5H5H5=Ch S>S>p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//\(4O-MX hDhhdhP@quP@D@:0 0 P\cpKЍ ?F10p  P\HP0S 30S30S tl3l#0Sd `#SX P L0S @90RS  c*0S @"\5S2 0\"0C ?o20Qh [ŚX2 0s#p0d p4 0T2 ? 0:010S=,A!Ϡ\<#P  0A ? 0Sd0S 40qh 90S (t!\5S\P h10S(\TA. H!0 00 0p 0<&0|&0P47p0p 60pwt>0 P0p$2S# * 1P *1P *.mVXZ hY 4[ 0SV?관X V. 04  L00 <\;P$V$ Q4C ?/|PeP 2S|3%8 S20#"20$#20PB 2SAt00000' @00a˽`02P$V20A\2@02 /2C`0 `Fb/ 0 |.H ? 0`P,Tt#0\`P`Q=S/0 5P` ( 2RV0 SSc 5*< 5h3 \30S 0 0`20S 0Nd3 0 S` V 10S0DS@ 0(y2= C0 ,0"t000 00C`r'? `0(" r0S10Sʸ10S0=S0S PB܁q000F ` 0L%000X30P%,<3da *- D10S {T0 0T(|(*(c<(p(v8(((l(p( 7ZT T 2(b n@`>0((:(]h( '`(!d(\((@(h(l(L(A((((<(x(( ((|((((7t(P(H(=S$0S, `0 <<00X3P%0* 0 00S 0 00S? 0 >0S a{&PDa 5*N> 0:#: 5h1 t10S 0 000S$b V1Pa00*1^ 10S 0 00<cQ6dPXb 0<0*l2> x20S e0 0r0S0L%r0L%r0H00q" T 000cH00STPP$c*p43 @30S Z3T#0 0 00L40q#  c400cL00S 'Pc*G330S 1 #0 0 0x4 R.0E q\ `PVR d0SPt4d*440S $0 0 0$d0Q,%R0%45 S R! t0040SPTu*d5p50S %0 0 00u(0S xQ$ ]0S0< x (%0Sv8Pv*6S$60S z8&0 0 08%<5HSR$ / H00850<SNiPv*6%60S sL&0 0 0v@%D5LSR$  L00@50DS%:P|w*Z770S D'0 0 07 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^1 `@R$@@B!!@H0 000L 00*880S  )0 0 0h P^x P8YQڨ0QTڠ r0 0S Pi*9k90S )0 0 00S/ 2( tI0S0QQ&d @0 0S }Ppj*:9:0S `*0 0 0 EI0S ?I0S EF9I0S-(Q\KQK RP+00S  E~0 ppVaF !` . R ` I0S72  I0Sb]<Q| I0S H0S H0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4*<<0S ,0 0 0(=0S 4=0S(@M*P=\=0S 0lmh = PA P<= 0S= @PL Y  [/p@TW.  @?00@1>0A@O@@ɣX.Pd7  9/,@؟>P* ^ P.0;00 0 S 1> >5 > 巟>p屟?WPppY$?  "008 @DT@H4L0d Lc B b"30`@P Y) ?0S  8 H4L0d @ B b"30D60S  6p00^Pt6@ 0X6PP 0Z0<& 5000,60S 1S  +P6  6@ Q U @ 0`P@@  04 8 <%c#!$c4"x%S X50S `C\P 0 0 o ``0  0 04 8 n(8(v(x((t(00S4!!: S *C   S D00S @-4僶 * R  S//l((x1p@-`0S d`7)@ %T D10S810S,Z$1p10ST00S Ip@C00CS08P U 00CS0. PPYU NU YU0 P0  0 0 S(,K(L(T((]&g&p@-PD0@0`S 㽵( 04Pp㞳(qKO-01 (1$100 P 1 峠P 0P  PPbPpp(㢛 @ 㝠PT`00 XT V ߝp WP @@ 00p((((( (O-P10$MϠ,"ˉH  pFP 0H w +0{`(@T 2 0W`P$Ѝ? 00 ?    P 0 0 0?QR0 0# Ϡ?a&0  8;`0@p 02p(l(O-pM0P8 0̀P0`Ϡ,"  ԚZ0 Ѝ 0x @Z ЍO ? 幚P  ? 0@`p(8(C-`P@U (1x U0P PP0 0T2p܀`*0 L@D0T@S   G8 H4Lđ0Ϭd @  Bp b"31 }0S   -0P00`0@T Ѝp('@((l(L( 0S/A-@p dQ A0\0 a2Pa0 SR P00@00 0` PЍ((L(P(@-0P@T@TGd pL `l0̠p `V W @ 0 0 00P@0@00 Ѝ ((Mp@-XM`P@X y* `P @&XЍp 0@-Q0H0@S \00S PuC00<F0P00(gds{p@-@8`8P0 *$00Sp p@((l(0 /0(\@-^* 0<80@400 01Q (x((&O-\M@pSR D00 00S` P [00CSX \ЍO@`T `)0XYH`o`00D0002 000D0@ p  00@pDP w $0F 0/ `@V @:@ p?00F`F@D0@0+ B\ЍO(JLJ\%2R/C-@=MS|QPG PVPV.10S B10S0 L5as0倀Sp  )0S  00 X0S  )0S  # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍT(H(l(0 \P/Q/ 0   Lq,PŒPŃ ,8TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S 0P 0ThSXSfTs`P`UU00Q AP 0S ?@?7#@>`P"hR0"00S8 lr003Pb0S* x?0S* 00RE>0X4* 2p610S ]0 00S?AYP10S 3A1 PQ`1*nX1` H10S W00 0H10S <A,1 P0*L0`00S 50t 000S 0dP` 0xQ 0ȭGŭd(t(L(P(@(T((("(p(\(h(l((( ([@((r(X((((O-PPMLp8 R<@B0S 0(3 ?P00@TaVa` 0 SQɑY\  \P  ?``  ? v0 ',",2 0Ri Si r0S 3S  '0? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*Y0`00S B` ` `Ѝ 0_S  $  B$ $ R$  B  (((<(T((H(l(U (@(h(t0A-P`p`ATR ;@P<M0S @ &1p0At(@<0 0 1S01/ 0S00/t(`0 5 /H0P 3S P 3S P///(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 ((x(Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐp0` RP/! 0 P  C1  1 @- \l0` xRo/ 10#/C!000P/ @-A`0` |R  /  /C! C!/! !/ @-,Ad0` |R  /  /C! C!/! !/ @-9A\hO-$5SX @ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ bPPl  P\` `jP P9 4 -p &0S  Ќߍ<0H(00,0 00004008004004 04$0D0(0P rW[  pUt p*h \幄 8 `$ <j 00k $,k (k $k 0,0k0 k `]$ ᥫp 0`?`a8SPb   00*P*00*  0* ,d@edACzd@[duA-@Mp`;@ @p@ݍ P0@0@ T00 ## O-M$M`pP`O"NPX1 b: S/5$0P  rR /%00pPP W #UP 0C P"VR V  V< PN  P P W\1` 0`PIX1: S<V2"rpPUPV9 ᒩPW00``2! 0$Ϭ $iPPt P5$0St3]`P S R SNp`P-Fp `P`!\1 S R UNPk`x!|0#PaY $pPtᩪpUd( FᣪPP XND% ܍$Ѝ$J'5F F F@00S0`( "4`#/l(G-pX10P0@ʟ 0  X 3#15`05aà121 R0` 0Ppp!0R00S! ;% 0%# 0!ZXl000Z T00!ǁ8P,0((v(G(t(]t( 00S/l(O-,Mp0댡`P@0V000,Ѝ00 ?U0$p$0 0000 P$0S l??00P0  0 T0SpP8Pp(^F(  R/G-P `$ 0pr@V` 0k@`` V`@&!D`( G-P`0 4J{ Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@p0P2#U 1A Q ` R J` U9# c! SV Q V3  P! I` P09# c SV!Q V3  P 0  P$ ` U 0 Ѝ6J 0A-1àQ`P x0xo Q0Sp@@ P` pFQL @$ @PQ0࠱@6} p@-@P40S:a80Sh0h 1C0C800S   0900PP80Sp0 C[C, 2 ,0S/`0@-@0  L[6,0,0080S 0 0 [CL0@ ( ,0@-S ,0, C<@TP @% O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D50  00 0P垦 U0#03?`[[U\p@D `0P$0H5Q @傦O0$0 ᬎD 0 XR @m"<p!8pL0(0$0 0H(0 0 `,0`4  0 4 KB@$HP$0 mP\40  (00\ 0P@,05S00SUSP3S` $ 0 B@`UQ `F0{00<040@00 38p4` <`00HpL`<0@ RS80 0 ,H0 PpT`k@P ,P`3Ql 0Q 0CQ <O@ $@$\Ѝ0,03p(0?D00T P  HpL`%VW D50, `S24040S@p( D0 0 P  X Z (2( mBV(H ]`ニ400 0Q 800800p?(00T 0`RZ@p(0  0 P 80S$1$f/1C:0C800S   0咍` 0SP THpPL`P@ T@Pl P0)T`V@ !qP` !T@00P0T0$0B(PLBAW NBAWb,  G-0,0S 0 BP@`40S*:Ѝ00qW! 0 ^@P   i@PpF A-0`c,0@St0+ CMPpvQ H0H CB@ 0$P@DT@a C-0`c,0(PS0W C"p@JQ |0| 'B@@PEU  0P !  0 P P Ѝq s X0sC-@0Ђ D`P 004 0{P 0IЍp(L( X0sC-@0Ђ D`P 004 0`P 0Ѝp(P(=0p@-PQ `@0P Rp   T0`! =@P 8o4P١3((m(@-,@P,0S "A00(@-,P ,\  E Ѝ(p@-@Pnp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp\(l((27@-0S S2+, R0 ELh `Q tpSPCoaQ* Q( H<FP 4,B 5*< 50d30a3]210S G 0 00@ 7.Bp#x3@ Ŝ & 0P xXPA 5*< 50d3(01$10S 0 0@ d3S+ CQ+aQ# 0AS"P @0a3d3*|0p00S 0 0@S Ѝ08(((.@(h(l((Jl @-Co| O-M`p0@  @bcc 0$0c# ᠓pPc0S@P7# 00" $qp3$AtUhUaU bU X^P4i0E S00p$ @ 80 (P 0 @ 0S ,00#!( ` P P0V ЍVp FpxP`8  pi P`P0V:P0V ZP p0[0T$$0 ! Pp  @0 00$ 0S Z(0,  $ 8 Ep  @p0 00$ 0S Z(0,  $ 8 (|p @0Po |  P0 Pq 0 ! P4| H& (<zG- 0pP@P` V  _ 00000G S`00000O-mM0@` P0@004080 0bW, AW- LW% H84cW iW0 p `$QppH40S 0+mߍ8 4i0H4: S@ @0(00,0000408`0P gP 0 0! Tp :p 0Q=  0! $刡匱@P4 0V$0 0/S پ<<Y7`y`"0 <0P0<0$`P tP< ly ႝw <XV<Hp n/B  < n?n/ I0Pp < !$2$0 @#0P!S 0pSp`Vxp 0S `0S  R  R 0S( m0H $8HP`$pF0pM $ 0pF >p>  T 0S  (, PQ S RPQvH&0zd@Nsc/EbO-P-,M@p`$P("p($0S0$020S'$3pO P V 00E 0P0Ne 0O fP AP PP `pP$p,Ѝ`P 0`P , ?o  0x0 00 ` p 0Pqp Lp UQp`H& UG-@pP\!აp`:D10S:  p o09 6X $$ Ap+ P%W00S $$ 1p YPPU `fV rV GT!P$$  p$`H&cL @-o| A-@P`pP 4\ XT DD 8 ὴU  A A aH&0 P/00#01 0"$#O-@PU \  p U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G-8a8q@ @ 0P^ \ ^0᳀ 0S@ 0S@ 0S@@00\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-`$0Pᅄ@P 0z'0 0 Q P dž@ Ѝ ǚP-0@-  Ѝ Ѝ/4A-0 P $@ᒁ`p'0 0 QP Ѝ  {P404A- R0Ѝ耟P@ $`P0`p 0S 0SS0S$$7# BS 0S $ N ` P eP`$0 : ` ض-#-@-00@e 0 Ѝ@ Ѝ/-@-P 4( W 㴝Ѝ Ѝ/O-MPp`7@PЍ P yP 4S \ 0T0P$Q$ P 0S 4S $OX 4P S $ υSGڔ!0  p`000  0 0  0 @3P 000 00 0 0 "P 2 T`嘖&P%(0,p 0p$S4pS ڠ 0 p" x0 J0 `0p"P` 00P0SWclHO-$MХ@pxPP? 2R 4S  0B$Ѝ0m Q Q0   RSRQ"  "S 0 0c000 00  0 PP4S 0S,  0B0 000 0 Ps0P0 <00SS PẐX  , 00`S4S 0$R V P0 RS  0 0001P\ H0H 0000 0   H;pFWU7UhO-P$M`pHLpQ@PPz@P0$4%Cdt(, 0840; pd`0 S; `p 4044s p +pp g?Ιp@ H4* R9 : S$$4SB. ⾙p $4Sc(d,T0 B. ⫙p (d,T0 $$0  P0p% 0l?$tW(d,T0|4$t0dT 0  (d,T  0p"4S    0 0p4 $  | JEp J`mk 0P PFp  0Pp P LP' 0" RpP5:$Ѝ0 S0gp 0$000. 0S*+hi/ဗ ")5Ad@\sd@ 3@e @-@P 4B BRP p <4(  Ѝ@bЍd@@-@Pp P Pi4PS 4 1VA-p P@P0T `{00 Xu4 Fp( @pp$$ @-#$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /G-`Pp @P1P ?  PP A0` `A0000 U:Ѝ 1000H0H `P10(0 PUH&C$$0A@-X P@-@ t`RdЍpP eP 4 R 0 ض--O-p!PR0_otM`@R(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 T m0 $8P  i P P  P =A-@pP`P 5/p 4 5/p 4 lMC-(00pS4P Ѝ$d@ 0 x   l 0` 0j 0 ( 0`WP WkO- 0 0pP딐@T`  P `VP <  0 @ض-pp@-P `@0 @TpO-`P,M p@FE0     R  0V R 0 pl PU0 (P pg0 SE; 7,ЍpO-PQ04p@ 00` ЍP P0S*  E 0`P      04 p p#p p04pp  c0s@-S`@ PX0 KRP: pЍp%   iQ000 BR00P0S ض-s@-`V@P `d`X0 ?o2R0S 0S00 Ѝpض-@- iR sR aR p` !p@-P@^P (`Pp Opض-Jp@-@T 40`PUPppض-eiR@-- 0 aR bR LR( sR% tR@#P 0gP0S`00ap`(a0 /ض-wp@-M `@P`ᝯ P00͵00s0S m )ЍpQG-@M` QP  ЍAP $G~pPt 2B0 00  0 p`P _O-$MH@`P ,`$ЍPP 0 0 0 $ Y># P0* Q P0 0?Y S0STP pY0 P pE00 PU 0ppp $ }P 0000 0 pqP ~4  W $\ `  0V,S( 0$84 0p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 0 PM 4$$   $ 0$$@p7 Gbc00S 0@-C^M E@$<$$E0V 0%P%Ѝ0 @x("(!!"`#XT 80 ` @P8H&,7HZo0$ 8O-LMP`p4  G 1D0J00 ᄆp  0S& ! R"!LЍLRR a0BSS0D1 0S 4 P $ ဖ@P  8 }@ {䰟P  } T Y0 ŕ0@   T G 0@ @ `P@ pH&hض-*,.x&>PA-p`(P@c|P 0p`P @00! 0$0@-@P$0S }@}O-@`;0S؀@ `@` 0@ `'  0 T0YX@`" R    0R 0 0  0 00 0S 00 000Sp0Ѝ   @ ` 0@T` T'U@ ` Q  R0P MUpP0 0S 00 0 0 RU Q T0Px n P0 @  T 000Sp@ `=W{P/0S//P/0P/C-@ P Pp ` R Q @Y R0Up@-(M@`PiP<(Ѝp, `PlP0  4@-@ TTP@L0 @P6S8`00l3(@0TWH&\R R R D@-R R///// Rp@-0@P S  \ ppB \"St t@ h0d pppppp, !$0pp;(O- 0`@P+P Ѝ0!S R `z0P(Pp0\4SP 00$$8,0PJK8 S =z R RP304S ڠ0"S1$0 @㖑0  40 3/p 8 H06 0($  P P 0$ 0 0S (0, PpWEV;D;(FO-0,MP`p$0 #Vp@20S$`pP 0 0!  pT AT fT @,ЍsT00$[p0 0 00 0@Oqp 4 `00p x0804S 0 Q1!1 X R- R02U1 0S.d RL!L@@1R R8 H0  pp0pW$00(p,0` 0S0 00` 0`Z]p ep{ 0oo`@ a 0Z p@iDe|H&hDX8];\(HvvyA-@ĔQM PP ကAn`` p pHPP ?ЍEp,   0 hrzG-@PNp% U4 d$! A~ p $$ D0 P ! `" $`9p L 8 B~` H00 yhrQ tO-M@/PpKPDEA =9$R 4SЍ4 R $ RQ  S P $ 4RS  0I  U08pP  0S5 P; 0  0T`P ,U ?o  0J0 00 `gp \ 0&p0$;nU p@-@M@P`4 t0<000 Xp L00S @ 0p'@ЍpLH&\T  @->| O-0TMp #$$0@`40#&pP>20SK@0SD00e@ DP 0SD0SA \^<40$ 400#qpp, 804<0QP$ 0I,0, tP bU@ qU H04 8P0pPTЍ$$0 H$(`Vt0Y`0X0 0000 WX0 0 0S$ (0! [ Pk$00(0 00qpp 0 QP Р 0 Z!p , C$p p ,  H&| "CO-C` ILM$@P0$0d%NpP50S D)LЍqP sP @0p0$  0!qpp PP`0$0$$I0P00P 0 00 00h 0K0P(0  0 0(0 040;P 4P 4  0,0$000' # 4PS,00 VU$0SxP0T ᒃ!088 X : U S   0 <07<0P (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S$ 4pW4 4` P 4\ "$`0 0S 004 b8 $ 0$ R40H Lp 401ST> 0S 0` 0T 00S!Q `S$NP$ a@ P PT{pT T 0$ЍP`H&O-P$4TM⓲xp哅(@0  @"`B |@c0P|`TЍ X  0`ꀠ @ 000 0R010| 0¤P @P0| 0C`l1  00B00 @@0P$ 00S+0"+ /0YQ Y 0 $ 0 0P|  V# `F0,0( t,0 Z ( 000S$EK%U /0r@P0@YT Y PbLC-\MP0  Rx`|p )X% 0CP00͵@ @    0 08@P 04  0S  ‹\Ѝbkt@-0@ n 00 0 0:ЍzP `00CS`0p S00 P0S X0X /Xꘟ&3S @-xMm0 $8|@Hu @T >uxЍ/}t2C-Mq`PP0HЍC訋0 0壋(堋p XV p啋N呋I !80pp0 0 zw P  @08 0@XWF QX9Tb 3S   PPs8m0 $ PJ 0p UU Ѝ0 0 ppP21S1S)tЍC#2XQ' @ i(z p@-MM@`P  4S x0S h  . 00CS 0,!80% ؊܍Ѝp A!0̊0 0 D ⿊P ⷊ 0|P t⪊# BP塊@P 8嚊r1<HSazkhO-YM MpPm @`  H}  y Y?H 0C[?H@0剐 000 `00T c  _ p n Q T   _ g J0.J0 BFF P <#0b10Sq3#Fs#F?f#"袟jF?n $0 0!  <#*Pq $ĕ 0S,T UV:#@[ 0000p P  m0( $8u/J(0 B׉0z/C҉#$ f7@^  @TYލ ЍP!F?fⶉ@!0F孉  [ 000080 P 0 0 P3 RC2A0 A0A003#0#₉ 0S 0CS 0L 800, jn j0b(z,48C-MMPpA@Tt ݍЍ0S@ `  ;$> Pp  0$$ Pp 0$$J/H0 Bq/H0 B kP H@,#.D0 B W D@ m0 $8D#PD  dtO-`((lM0 p@`"`%  {ypPZhvPI46( sX%XᐆPOJxU`U HU& WU( AU |;lЍaPEUP@@|p o@@@@ @`@LdP V`ҧ#000 0  t0SP Vx0 V0 VP0=0 @ @<30 SEP4  0S$008 $P 0S0S \^0PU  { 40>S1># r  SP P @(`VL?XP?#?U`1?`#!XY3V`3!V tYPWU 0(0  P |00  P P Q: ,   P  P X1  P UP1`P00 ᳇   PUMH奇(1&ht@( H&#3'7p@-PM@P`4   %1L0$00 xp T  P 00S  0WiR TR LR a0BST plRs0BHPЍpTRp| xH& @-0$M\q` 0 0@P!!붣  B⾣@A40sS 0lS#$q` 8 1P< 6#Q  *p%0p 8,0,0P" 0'"QG0$0F0 0E00D00C00B00h (0 LЍ ppW0`Vpl C-`P`C$P X PXЍPP X00 PZ0PS 0 tNYP$$0NP+ b Pp5 o  >P 5  >P 5 >P 5  #>P p5  C>P P5  2>P 05q ;>P 5  F}>P q/  {>P r t>P 01S [r/s?p'(Ѳ Ѱ  _>P s/l X>Pu$$c}$4P~,:`P (480C$0 |b`P  |b$$0` qp\& p0t< ?P\3C<pP 43< 5C$< ?P <P2 >P 2 >P   >P 2< Sx?P <$ 8 =P# 8 Z* 0NY$ Bp u$ |P$4`  0'qp($ |Y$  N800(0 000K(040P08\ p$,` 0$00P00T0  3X/0`$$qp@y$$|$4P0H00L0p`$4'#`qp[$$x|$4P`"#H&"ض- #"#"f#####,$$|  $$$X$~$p$$$$U.%$$%% %${%G%W%%%%%0@-M@ P |  /p@ ⯮4 }p$㧮0Ѝ0&'i2&@-SM@P, O0H0P0X0`0h0p0x0000 *T  \ $ 6d l 4 pB0`@pt  0 DL`|`p% !D Sߍi@&i!i@-@    X0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01SP A!BAxP 0`0?oS c` 06P ``,|0 0A. 00P0&P A Adv]0 0A. 00Pl0P AX XA\E000H 0℠4:ލЍp/(p(f&g&p&t&{&&&&s@-1PP  ⼭P 㵭 @`TPЍpP  00SUV  ~@&&0 R !O-M@ Ptpp" `P"w  \UP? XUUPLPUpP XppIUP X T7;P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, #  ;P_ 0S\hQY @ F|pNl laXZ T X (t0W 0k0S, @ h#|P@ `|pd HQ L 40R !01Sp0S 3/p\ |] 8 X{p \ [ 6@ `{p Ѝ&'&'3';'*''0'T't''A-p!T@P@hTPP'TK_`P UT P TP*^@<_T @- |<P Ѝ'A-MP p:@P00p`ЍpP ) š4 {p !0 8<'i@-@p @A-P`:TpPL00WP@C?0W > FA-P`TpP.00eWP@:%?0hW   F@- $L:P00 Ѝ'p@-8M@ P;:P1 SP   V4 PT`O]V8Ѝp''(i@-BMM@ g p 0S 7  /  (0F(@0S700$0/ (d 08(@0S BލЍ<|4@ |,@i$(Z(o(p@-Mt`ZSPP VP@ T0V" C4V  a, pPЍp((i(@-M@   pЍi@-M @q9P0C x p  1Q0r R08C80 1p`Ѝ))iis@-`P p@@@<9P0\ -@PdU PL ! D.SP, CߪsdЍp*)***V*7@- P@GpX ɪLR P<0<( CC,0 S@ Ѝ0z***V*7@- P@#pl #B⥪0T㘪LR P808 30C) BB@gR@ Ѝ0***@-M`prRPP00ЍUP@U a@PmT0 7p7\0 P@ PPNc**i@-$Mp?RPQ00$ЍU`a@Px0 l0  pP0-DP P`@ p06&c7+i@-(B |{ Ѝx+}+@-000 0  P0yp `Da@P| ` @ypl 0 PR00bS {zcxU {C{Pxi ++++s@-@`?PP  Bp$ ĩx0x+p@-` MP@QP T ЍpX    T  PQ@([D+vi 0@-,M@ P7P0 - V p,Ѝ0 0R0s0S 0 $0NTPP ( Q@ZD+)f+p@-P?lp@@@;QPL0L. CTQv P8bp ,***7@- T@Pi7P-00 Ѝ0  p ;DX,@- 4,@-M\ @I7PH0H+. 04 0o pXЍk,)i~,@-M\ @)7PH0H-. 04 0O pXЍ,)i,-M0( 00; P ĨЍi*+@-@4P P(0(, CP@**V*00@ P/a CRWC/A CR=C/@-00@- M@ M0, 0 pㅨ Ѝim+P0@-M lP@ @]k {<G   yЍ0@A?x+,,@->@OPP Qm`LR?0P`0.C BP000 Kzt0@`Vm`ol0lR/C B@ @@@@P0< 6zY4w03/`,H&z+,,H&,-//// 0L0L0/H& 0T0T0/H& 0\0\0/H& 0D0D0/H& 0d00d0/H&p@-@pP 00p00D S 0A0CS0$P|>P 0@pH&@-p0( 0`P/ R/H&O-0 4M@@ !T 20( Dyvďp㕧 P(0$`!pSp D@T PoS@ڐAP`@ ptpP`[T000 [  uv R  P Q R. 0S $P\(P  1/ P t@0S vp "SR(0 SP$\ 2/P W0(/ɚ;6e /+/O-M Mp@p U pP< ( I`P  0Y000 r⛙r/Px >  v[>J0pV / up Q h2x w@ p 0 Q (!x%_X[ `00@0 0uPx: 0I 0 48I0S;X`PU 0 3/P:㸢 "rr000S:0 r0r0S Xw  w 03/q {I0.FuNpI0SQP" E%J` 1 `E PIE @P0 l1 LAp 1 LJA@!1 ,Pw ``#%J_!1 IA @@ |1 A!1 MA@ vPPU_ 03/P0 3/ݍ ЍH/h/i~i00H&i0i011(5/81(0300i8/Q1b1m11X11O-@PpP  p ㉥T L@LPT! uL`P \rPPU @1O0S vVV qtW P.Z  P'  N5P! K0S 0 L0S 0M0S 0 N0SO0`S PPV Hv>+1 /(1&@-,MP@pP L`P(  up0S hP 2P00@ 0( ,Ѝ>>t(8i(>>?@-P@ᮏ0P ͤ+?G-@LPP0 `@ Y㌀ PpO|PP  ppH  H@@@;^@C?M?2t(?s@-@~L@P00ЍpOPOJ@P <`  P^u ?t(?s@-@TZL@P0{ 8OPO!@P L` P]u kЍp?M?t(?A-@'-LPP0  |`@OppOPP ᮏp< BFJN@?M?t(?@-@d J2PP0P CD 0 S8800 >00Ѝ??t( H&@0@-M@KPKP KPtKP d0P P P P< P6p$㿣Ѝ0???C?t(7iN@7@-@塎du ÎP HuDPю P! (u Ѝ0u @E]@`@h@n@i@A-M`@PK upp"P  (  9  ґ rp' (+( pt"d<@T d8Pt\2PLt RU T#Ѝ0 P6[@P< $@brp Qt t 0R t k)Ft DtPp `H`t` Q$R@vt 2tmLP:ЍA\P\ 0P R   1 Xt 0 RS᷍HtFt $ s0` R P U 0pD`L P>TA8i(i}A|@AAA>AAA@i@@AAAPp@-P`@IP V  J`P 8T`5T 00pITp'TA-@T 00`PpO 0p @-MPPw00Ѝ`0 000p@ 0 P GM0P_ 0 p 0 `P0G-@(PK00`( N P1r0Pp*0X!U0"R0 ."0+0"SЍ&<0P 0,  \p 0 @0@-@P S @O-`,@pP(0V0S 84YP$P$P 40S 04S 0S(0p(`8P0$0S(P^[O-Mq00W $000Ѝ`QB QE 00 / PP0PXbU =0ነP ,,2,p4@[T /@P00 DD0800X5T (ER( R R[D"00ZP 000 cPs0"CQn BQj Qf4!<5^ Xpp[XPPX Ჰ  $P KpZWF  0 Ep? 0STt -PPX!0 8!100#R0S 0m8\@pG 0 YP@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S @00@D@ T030ZK@)ZTl +  HPRU< E゠0 0 0`0CCCCCA-X Pp@` Pl00!70Pc 0 p 0 `P0O-$M`@ HpPX) P W0  P}p` 0p0   0K@)0#30 Sd0 00#00M/H0pp'P41S (0Y CM/ZdmXFip(SFp@-`M@jp 0+SЍpP    5 R #D jp 01S 0/S KF iF 00S/@-@m/(FA-P@`TpP @ 0SP  H&FA-P@p J`PW`}X PH0 000 0 p` GGT&:i@- M @ph ]\ )P[00 Ѝ0, 1pE,G@G9iHG@-(M @p  5 !+P300(Ѝ :00S H [)P02 , pTGjG@G9iHG@- pp 0QSЍS   ^lqGxG/ 04 8 <` S $S HH @S/8 S $, @$/ //PHPPPHHH 04 8 h-hKHp@- M@P` KQ4P aPp@@WG ЍpiL@- 8@\%P(0/D Ѝ LH@- <@H%P,03. / Ѝ LH0@-MMP "Gf@PۍЍ0@G P P+dP@ GۍЍ0@d0S0S1iS5LOL@- T@P%PD0D/  Izp Ѝ^LHAmL@- T@3%PD0M/  ]pЍLHLO-MM`@ <P04< lP7EgEJP̖7U(0'S`@0$00 `F@( 0R |'P~$0S0'V$0ʨ).0030070 0;00@00E000$ h(@!0! X ig0 /C BRY  0  00=C$0Cȟ"!0``F ^u ȈE0080IcCP S@BA`p$ D80X04p` g!0@"0,0,0SD qg0( P0B'S(0؍Ѝ 0$0'S   BS>C0C'S Q:ǟ "!! CR  ##9C0C"!% X'S8ǟ"!2.B$ǟ>C"" ǟ"!/B Q 0*Sz S &S  2S% S`r 0S R )Sx&0C'S000S 0 |Dd|0 Bg0, 0 B@, R ,vSG1g` X>f 0R 0!g`0S g0S e0   g00C!&⩐p`YP0  @fp f0S VE 04 8 <$S9tG@f0S 0 fu f 0 G0cGApG00Y#q0p`FT`[! i a`V1ׇ!}fxV-0S]  }X 4=4I 0f    #P# $P# #ß P zf|3Kl#S0S XcF @jf0S$  cfS s[f0S Uf뭏 `p0VVČ  " 0`?f V/A@8f0S 0|H/f H(f 0pHt~0H≏HAH00Z0 `F[ p0g&V 1 !^ 44J 0f    !PT! $PH! D!l P 8e41KD  @S0 ,Sx0 i}MM̼(M $((PHXHNLKNI$N(NUNPXNLvNNLLHPqNLPxNKLNNLiMLLM MM M(M0M8MBMGMPMYM`MtM0@-MX Pp@@CЍ01$@iNO0 / &/-@- M,00@(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  OO ЍЍ/@-@ObS 0S/@-(-@-  OO ЍЍ/-@-  yOuO ЍЍ/@-\00S 0  0000 0NpЍ(S@-@VaH aap0b'~pSSSp@-pMPڬ2P0 PS 0P@ 0 0 00 0X]Np HlP@@ ((@,P0P4P8PS00!0310@- Mx 0 M@P \{ ILPP @ , 0@@MP 020Ѝ0&5V (BV@-D8P @,jd$PvA bdba5VH&P@-d0 !X !T@0 60\ (0000/dXyXXPh0@-d`  !TD0 60\ ,00 00/dXyXXP-P040#^4<\$0000/dXyXXPD0 40#\00Q 00/00dXyXXP-H 0:# ^4 0Q$0000/dXyXXP-H 09# ^4 0Q$0000/dXyXXP 4 <# \,4Q00/00dXyXXP@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00dXyXXXX$0@- 00`P Ѝ 2&A-PɈ@p`WЍ _P Y3M@P p7@-0P@U , 8J Ѝ0LYA-@0nS0oS@p pP`\EKPJ0nS0oSKPPKPP'RY@-0 b_TYH&O-M M~ PS J Q"t1 # YYYYYZ%ZY(Z/ZY3ZRY(ZZ?ZDZLZUZXZ^ZbZuZzZ&ZZZ&ZZO-}MMȐ⨀p@ 0, -`R`Oh-EV 2U[ZrC0F!!0`P0S Z`q?P1`Q0SR aZ'|_0SK \_&\ %_&L %_0S;0!0 P0   P00@P  0S  P@_ލЍO4 0 0S 00S 00h0Zo  _0 0` PZX T,ލЍO_Z [\ZZ\Z\\(\\\Y]]ZZp@-PQ@@pQ(0opQP0p(PA- 0nS0oS0  |@P0Dt=P,WpW=EPP`8=Gp@,&@P@(``@- _\`H&O-@M pP"P0PD0@"` P0,"Op/2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z \pHh ㎍rPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00 0 yPVy 00 0< 0ft[,0t0Z00x0V 0;;0|0Ѝж-ض-H&bb``b-BMMI^@0 P@M00d  0[pL0 0 0/  0\bbb7@-P @=0Lo SϜ 0  Ѝ0c@-@<0P @c@-@=0P @c@- @=0S 00S0?  Ѝcp@-@PᙡP0 㻌0/Sp  p@ cdd@- ^[0dH&O-`@ Pp(,夐U렰0 0000 Np0@DTq oPX0 xP@yx8 O3H&ض-ж-eXde@-M@A> 0@0D00 l0Zp[0S SD T H ,0@ 0R[LfeSfffp@-@PP0 10/Sp p@~gg1g@- .^.[HgH&O-`@ Pp(,夐렰0 0000 Np0@DTq oPX0 YxP@Jx8 O3H&ض-ж-[ipgPi@-M@A> 0@0D00 l0-Zp0S SD G ,0㶋 0Zi^iiioip@-@PᅠP0 㧋0/Sp p@jjj@-ZH&jG-` $p嬐0@P0 Mp00@DT oPl0 wPTqw  |ZA+zGض-#lH&kl@-M0A~L` @ 0P 0@Yp EUZ$lp@-@PP0 80/Sp p@lll@-  5]5ZlH&O-PM@ P0dr`T"Mp)@20 R. +x   &  x `!p0 *00)0 &0_ YpM uPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x 0wP㝊vPZ,0p0Y00t0V 0;;0x0Ug:V$00|00|000Ѝض-nH&nl`mn-MMJNP0 @PG00 0Xpl0 [0 0N/0 4 |000@0[VYnnn9o7@-P @6;0Lo SϜ 0 % Ѝ0o@-@=90P @p@-@:0P @ p@- @;0S 00S0?  Ѝpp@-@PўP0 0/SpD p@@&p;pTp@-ۉp@-8l0 0}0000000R [XpH&7@-P @:00PS\ 0 㲉 Ѝ0qp@-@ \0P i0(pxPP,㢉PXp@/C(rO-@H `p0HXH LLL%Kp850`FVQ8 52@FP50S 4 40S4 0<0074a0:8$0000000d4Dt09@0;84giP04P 04I_08(0@0080 uPP0       +  @   ' B D# R8#  $# R# , @ ( "  )            t20  t000$0 tt000 0 Pt080$0 ,t0:0<0 t0:080 t090@0 tt000,0 t000000t0909 1R@11r00$000 00t00,0w00 0x~00007000+ Q4 ~ Ѝ&u&uH&hp,($(ض-0($rtt((tttttt&A-RMMIN@XPpD`00EL p`y눁H00p$L0gVp 0KS 04  RuBuKuv@v0vp@-@PyP0 㛇0/Sp p@www R R @-~/w@-@M0P`p 03U000 mVPPЍ0P0 0 07V0 U0P nvs@-`000/@P TP0 MЍp 0`( "4`#/s@-`P@600!  Pd00SPPP @@  0uXЍp(x(002P0/0@-@CMP( P41010 0000000 0P B< DXH00Cߍ0Cߍ0@o꠆9xG-`0@8Ppp6 8Ġ#̌ Ƞ,Ƞ Dt4$03 00p4408< j0g,d<0pE0< D(0|0040<0pp PH00ЍpJPF PG  W(<]l^LxO-$M0 R6@0` @PpT .V0f<00$Ѝ 03/ Z0p .6P P @0 ` bu0P":@ 0 `  p00P LH0@3/p0P 6 0 P 0T@Pp0 0 }W꠆exC-MM`p/ P  P@1L#d8$#4d4# N@41@D0 0@000 @pߍPHڀ@Td8$#Td%4(C-[ 4MP@ڹ@0P` :0P`P Y l 00l 0 P t H0< 000``S0 V0S0`000 pp  iPPQ8#0!D0D00V 000 0  P0b"!4b4#P0P4Ѝ 000<0(xxx(-0-M 00H 0@cP ,: zg Ѝxx@- 9W9TyH&O-PM$  0 @00@"0"p0@@"  Gp20a0CS |2g@xbP00p00@␇p ! 0?qPՄ0q P 0S R  㶄  㯄@zPz f!!L1 _ P ᛸ0S R  d  /z @z'  1p0 p+司|Sp h 0[4S08pS @p @Ѝ?Bж-H&{xض-yyzz{y{{0@-M MCN@80P 0@ 0E#(00 0Rp < 0 @U U U(40P( 0U,d30P , HU0@Uލ Ѝ0@U{U{{{B|`|R|7@-P @50Lo SϜ 0  Ѝ0|@-@ 30P @}@-@40P @}@- @40S 00S0?  ŃЍ }p@-@P᝘P0 㿃0/Sp p@ #}8}Q} 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0P῭( $0 $( XXddhhllppttp p@-4"4 04"4P0@ ~{xDDr@@lHHfL`LPPTTX~X\{ \`1p` p- p@(p@-`"Q@Upf@p@-@P9630pA-P@M4Q->C!->?n}C@X=X\:\79>9>:>C :>CF 0? AC>C>mGFE~EnFG 0X J~pXV}m  $$((,S>,ǬS>GìFHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,GzTvT`XrX\n\`k`dhdhehplalp^pt[txXx00[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P#` 1R  0  ?<#΋ 0 `x 0%`0 C c00 d0`c Ca c0b0 0  0x  \41P0p$Ss $$TGQT`P@Ul 00 ЍO TSt hhȀi XȐPbUP,6(D(U TTt0p@-`0S[\ @L00S000000B0E0p(&|0P000/000/B10B1/101/ OX9H&O-pPUM  dϠ 0@Ì `0 150S  C0 R0S@`Ѝ 0 R` ` 42 b< RV1QV RQQ R  $%R /  l!. 000 0P0C030S30 0C0 0003#0 3#00030SQd  0@ `?40 ST0T00  B 0Pu SX0000W0,d00? 0 0@ `4?᾿ 0广댠 ,1#  0娿! ?ᠿ0 00C000 rS! 4A 8 0 B0 080$ 0C  $$ 0$080Ϧ0C40040 08 ROʌ10S  a dϠ 0@Ì `0 1%ÀQ,  "C^C C!( "^ !N 080@o0T0@` !  R` _P/  1> ( (D(U W\&}H&O-MMO⾟D`, /%5_Q0uPSi`50K,Kx%?D0Shh,/nD ?0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#809Kp0 0` 40S7{ 3 0 000p0  8`  Z X &0Z``a 0,oF Ϡ\ß ^/F022292?"""0Pa 2@őD L 00 /4;2JfJ 0"d00 0 o 0p,2 0r 0` 0W8 KJp`xSi`10J>J0/`&22220OD05? 0 04s0hl 0@DE0 L04;d00 0@ `4 <02$2,242( 0 092?  0@ 0@Dő L0 0/4;$0 BJI 0lh d 0@Ì `01m&<((AH&X&o|(D(TO--)MM00=0?0,8(0ID0D`0S> 80pW:,0 0 0 I<(P(H(((6\4 P@P`Pթ P@ 4 ˩pI3 E復p@ `3T@  6SP@ *S 6P (J`0S0,5 Sx0<0(5002 0,%S0022Q04KT 0QKLtrt" 0 04 0A TK> 040A 4K5 0 4QK, 00 Q*K# 00Q(K 004 QK1 @00T00D-\3SB1\CpWXpX1X0SHtK X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001FK @4pׇ0 R\0 a $((&&nj\(h(!Jvύ`(@(5M(Tp( (&Tl(&X(d(x( Q2! dS,QS18$Q<4R:|K @0\5 ?>C0P4p3x00084$0%<0D0t@~000匐XL5P5|G   ?8`F ?   ?_ p^h8 PEpG0!/0 p!"0 p4%p8$``05<4Rp`J!11 8400$0$ 0<pS_Px8S @ɼ`@0 ?@`0婦PP* ?ᕻ@P`(6#R0:㪼`@0- 00 0$50SQ 0PӘ&"P0 ?00 1>00S`0 c2#, SZ QZ3 ?00 1>!00   B^B0NPp0/2"0$ 0$ ?:Wp1Wp#T0p10G 0"K ?  0PPB@TP`P 嘀 00B1  B1 R ` U"B !!0 R0CQE0E ?P0 p똀 0 1 B0S0`0US0  B110S I/e @P`x1 0G<Ĕ84CP0Sp84<Ą-0$5BPSQɑ,pRB@L0 0 000060S|0p ?4HL4P0@0 6@p9' FK@00 Q<wD7\5?>C0P奁%4tx0]p7(T0#2! a, A3 31  0H@`0 04 p s 0H$4  $ ( B, @%LV.  R*h ((E < 4(r X @( \ H( ?.@Xt@+@B@A.@B,-8 Hup  @40 pK} ,p8d A YZQ  bZ0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423倂r0S.U{됺 ~z000d0S CQ c6Rc,`P 'z'z {'+SmH @<0 z0犸 00z8'(Ȋ (+S,YH 00 SP0\h!P !0@ 1@0 pQ0&ㄾ0S`@ R%H PP0 뀠@t7 -J0jF 0e`K!00S>|(^F((ԏ(&ht@&(hTU ČT@(H(<((&D(L(8 P( `00S<  0 (#0 g(0+ V.g|00S  R 0=S, 0S10$0 1H@(p  lEPP04SP0 0R0 S00C0> S< 0,0Ϲ0P0lA 0,0S9 p开8嘥ȿ+" < Q \%`R 0  ᐡ, @400(0 0 @DU@, 4A<2, R40@ `0```0T0(tb 0 国p ` I20 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R`# R0C00h0$l`0 R#00B1d0 R*t%됃U` p 0 0 0 (0 0C0 (0(0 S 4`R` { $%R l 0! `04 p  R2d  4RT T  4P%QXԐ R, d0 0凹 儹  ~,   8 @ 4d`Q ,H0+9H, eP+Hܼ H00S ,00C."\ ^  00 0?d 2 B< b10 P&E$01=S,00CU c010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST0C0@ ph`l48 QT* B!44 T: $5Sl0h @0 pp^:S $%S0! !H`$p$p(0W0x0S ,4 H d,04  0,4 $ 00`  VjX0S   0帀0 Xx0#`0y X\H># P 0?d @ `0 <j 9\%R 90SP Q``ƌ` $$S :`R` $%Rl 0! ` p   R2dᆷ :RT T  :P%QXԐ R( d0 0   ( [  8 @  p;R` /  `@$  $ ppS $S00S@0P뀐 HF 00@z8p`0x(1pYU0I@X!@@000T: 5@$\ Q 0@08(0  (0d0O@N 0NC n 0p 10SD=0S0 000S.LD08C0S= %>#\Ő\   0d ?0 @> `2<N  $ gD0000P4>0S4> 0,00C0S0 \>0S OD0S D>0S 0؀ C00@P:*0ELP>0SN`E C>`?0S303040404 0#pCVW*HrV.寺P`oV.GV^0S ?0 PS?\5=S,J??^ E? 0 0S 04 [ dLĒH 0@Ì `04 1,$0S0S 04 C d ,04 0bA 04]A)ݍЍSmfG-`RMXr@ rPPl 4rP\` `P P9 4 VAp -0S  !ߍ<0H(00,0 00004008004004 04$0D0(0P #W[  ,ApUt &Ap*h q\ 8 `᪹ <' 0Y $U Q M 0,0G0 C `↹ @p 0`?`a8SfPb   00*P*00Sa ⾥ 0* Đd@edAېzd@v +?RgA-@Mp`;@ @dp@ݍ P0@0@5?T00 ## p@-@PCP0 eq0/Sp p@귑̑R/}G-P `$ 0p؞@V` 0ў@`` V`@&!D`( G-P`0 4J Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@O-4MX00\0p0`P`᡹0 ,0, 0S P 0 pmS2aSMS ASB0Cd0b0CX S0SSU0@0T 0DS d9R$ 0 l"P T 8 0U$UQUDT P 0 sS@ @ @U00 @@@ X 0x0  P2p0S00 000 040 P4Ѝ`Ò@-,@ $)B5A2#?`H&@-0 @     0G-@vP| 㴷lPE`0 00000BoH0UB?E ᴀ)L)P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p)0P  C @-o co`/s@-PL@` 008&V  @oЍp)) s@-PX00SL0@`ă5#000<&V @boЍp)))-h10 PS/C-@PQM@MP`6`@f$a 1 P0p9 0 T:@6S0O@ kD6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PTᬲ 0+ۍЍ)))))TG-@B`p 6&PP$"n 0F04( 0 s06# R 0 !)n0 80 0 !Rn0006&0?06 0  B 00C0( 6V0:!`p`Vp 020$&? *0(0 6 C c0&0 $&?x0`L0SV&% ၶ0: S &0 d ЍG(< ((n)h&A-Xa00S FT:p%PP  0 0 A1S0S' P @D A01 S $n0S @2106&0'0& 00C00&101 00C 00)<O-CM`(HP<?O8fK  Df0?o2U+u5&0#/6` c2HĬ H0 HD!8CߍXAG-`RMXr@ QiPPl hP\` `P P9 4 8p 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P aW[  7pUt 7p*h h\ 8 `p < 0 $   0,0 0   `L 7p 0`?`a8S\Pb   00*P*00X ℜ 0* d@edA4zd@ϟLUfrA-@Mp`;@ @[p@ݍ P0@0@5T00 ## @-`p6  k@P.00S0?0\ 0S 0 hS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 ꌠ@-аHH@P @9880 , P9U@6밠H&۠A-p`P@ҰP V 0 g댠G-`RMXr@ gPPl gP\` `UP P9 4 6p 0S  jߍ<0H(00,0 00004008004004 04$0D0(0P W[  6pUt 6p*h fg\S 8 ` < 0 $   0,00  ` ?6p 0`?`a8Sځ[Pb   00*P*00V / 0* ꩤd@edAzd@[ؤ$7LA-@Mp`;@ @,Zp@ݍ P0@0@4T00 ## -0<\   RS  0 SL&0 /L*Q@-$ Q:蜥O-@-MMh V⵮0d00h00\00|00p000 0L0$0l0(0t02000040<080H030<004P04040F00G00H0040P0050<0p 0S00|0000000S00\?00H R00S <t0S Pt|0p 0l0- Sd0h 0>0i/3pD |0@ Sp0@0D 3P pD 0@/q]@P\#3pD B5P (Tl0S 1 : S  R 5   *`P`0z W`r`Foobr PV   P  @DPH 03}pTrd0h 0 0d 0Dh0唤d0h QP  h0@ Fv0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100{ S0T00RS 00R0 R0S0T0z /傭a+a`0P00 pR  W 000\SW 0`S`SV Z T @0S X0S2|0p 0/>0D0 p| 萝쀝pcT* ppv @@0S ?X01?0#*@0bph X0S*Yp_ XpZdh 0㝧[J U  U* >05[R[:L0Sd `!0SV 6PX` VU L0 0` V I`JDP04!$ 8!0 l02M.p`P al|0&>C- 0< S0|0| 0$02#|l0 U00l 00 00H0 30R8 00R000L0L0S0 U@ $ 0004Q t R t L0 p 0H0( S P0S (0dHݤH00 (0@300\0S# U0( R030"S Rd h0$80 S  .p P P .( (0S U0( R00S $4 0$00000,00#40*40`00 01@01X01T00 U0 @  0 <0$00(0x0,040303)00000 0$42?@1c4 04v 08#$0 #(#< 0 0 1 =Q p0Q\0S0000to00 0 R  P pT ㍨,'? D -pc P^ ( \`74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CQ`000S  0! UQ0R0( lR00S LM(0 00 25 010 0P B24 01(00(0S PP 0`( "4`#/   k B* {S@--Gd A 8 /eAD00@- 44@4P\P 0B"" P*-@=B'x*@-鸨 1.똯H&G-@P ` !>0P V0 0  PP G迓,pP`0%X 0_0S < _0 ᚧV P*ܶ-=Vs@-@lP 0  2X X0T0LЍp P `2$ 0q0P*p`*s@- 04$#$04IQ   0 Ѝ{A- M`  L P@1 P00 !0 00))01 (0X2pQ`:0P2A0F@UWPE: Ѝz0ꇰİp@-0M4AP`   0 0 010R  4   "!0Ѝp@R0R  $   "!R ߦ0S1$#$ 0("( 18#! 0Ѝp@(00ЍpP*0Qf  @-=,p^x*wP@- 0 R * 0 #  @0p*P `00CS`0p S00 P0S X0X /X1ꘟ&p@-`ၧ@8!RP#<10<10 .810CS81V <1S 0<1p0 hCdA`0ZPp <10C<1(0 810S81P*&&H&*0@-@-4MT /AQ`/d/hQ 1/`"R d2RK/ C/d2SA t= hk0:P{PSH1A k> * +['Hk;[E{7  (+S PPP Z/ 0 @@zj{ k[@  k[+S@/4Ѝ00B:tk{{'*k[+S2/@@?-C6?Y@*P*&$ * *\q@-Ek0d2S÷,P*@0@-0S0@d2S/`2"R2&P*@-@ 081 T 0+tD t4 t$0#-S<888xS`S)?S DS .  <(8(Ky*0C @*K+ C 0BK+ ⚍00CS00KD*a0CS00 '  ╝PK 0@P< 0@09  90S90 0K +K  hI  nPK 0  PK.  K   (  TPK P 0K. ,+80  ʛ  8@Pjkk 80SL8  ⲛl  PR_?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?-0I?V* v  `PK PP H70SD'0 0C!0R3 $70S0Sy K  @PPPh VIpFt0@Pp n p<thP@@0X"T  0T\  XpW LpS  0QSL0Q0P@\f0D` X\ X0D S@0S( @DU2 PP PP<YK 0P@0 K. <*K>< 0/ +) @@jpP @v XI 0S$0 0C!0R3 40S0S 0P`0-P `0z'P c=0 ,C0 0 S;.000 )+ ⻋0  d0d0@3 CFS p 1 01 Q 1 \R \>?p@1cDD0X(H`D# R  D)  Z   Y   \0T0Sp pD00D0, L0 SH00H0H P0S  &A  ⒛P0S>$ =    }PcݍЍ   Ta?  hPP|A80S  0 RP  h  RP י8  EPwy ˙`B   7PPi@t0SC !000+ Kt@@ +++r+H&BJ+&!fm #T++h+gfff.J[`@0@-0iS03S !x8=P%X++@-@hh` 00 P @4 0   +"*3+@-`0@Px0 B0PU1 S2P T0p0S 0@ SB80( 0p( Ѝ&+h+A&FC-PD1`0B8! Y!tMR!p@  10S b( tЍ000iS00S 00S  d `PA'W @ 0 i P _P000 p 0p3 W@000&+T+P&X+h+&e`0@- B@T0@T0@1 S2 0P   0S &+G-lQ0S ``  @P 0S 484a4qP0 0@0C!R! 1S1 #Y TpЀؐP` U0(@P 0E!0R30S u | X'0S2 @TP`00 $ @h+&k+++T++O-0B$0 pQ0US P`P PP"% @P0 D  0S= 0S: P05"  UE  (; V S 0S00V0C?o20SP@Yb PP`30S  8'x#0ES0000D30S ЍY9 0 X@00020S ?P"0 'rX0000  000SH 0@& 0 0@0010S P0 YQA 00 0X@I0000S X0000000S~ @0 0 n RT 0@s0S @ 0 $ @ 0r@WH00S \0 ,}L (\&4+T+&H&'D+f`1A-0S PPR@`D1 T0 :414a PU @T*$PXP@`0S 0D !0R3 Pp U 0S 0S  |&'P0S0S `0S < %s@h+&++T++0A-0S |P @`pT V @TL$@ 0S$p$00E`@h+&+/!G- 1RR0堑S @Pxqx! 0P0:ЍS @L`P$ 0/C %000j PP@:SR  0r%v Q ]y`P0td0 r000 i000X+h++&H++kH&2O-0S Gb00 @_1P+p P@ 0P0p0Z: P0-:p R02:70 R S U+:SR00W 030"S P 0000 S' @@   W0:0 SPhn \ X$000P@ Ѝh+&+++H&C-MM$Q@P0S  @p T0:ۍЍ0S 0 CL000@T`PP@p0 - 0 Y %  *000PU h+&+0p@-0S `P`t0 U0p(p@TP` 0Q0F00S <@h+&)+BA-p`P@P #$pFpDorPT 00 0CR?o20S $P XH&rp@-/0@Py 0Pp SRp<+@-8ޚ0S$$ B0A A# @+H&A-P0`0pO0000 Sڤ/0>+b P0 P<P@O 0 ྀ0O0?<+4?+&0@- @00a0@0Ѝs@-@P`P @TZXX #?0 00?F+"+R  + Ѝp0H&$0L<S/ @-͊P4?+&2O-@`CMV{ qP@ `0DUCߍ貀TX B/0 S4((~ j@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S !0 0S 0 000R*Q p`"0S L `X0S  ` L+9+F+h+&ThD@-op @, P~0@0& l3O-p0]MS TTPcPC L H0D#!00RS  #05 B !Gip2"!CPPRPP "2"W  0"!00RSZ  x0x"u!hip\"d HPPD"L  Hp. @B@@@r0SPY : SVH`P؀/0 }10L<aS$ @ ( D {`  8<P  8H\  T Ђ X ` {ᇉP <>"0!00hH/0>+b P< oP P <^0?0H @P QP%PD   !L P QPDPt]ߍh+&+@+X+& 4?+&+9N+ P<+pU55.+H&#&@-$@0 00: S+G-@ q `0S+ FP 00S P0 S00P R HRڄ00S t!  Y`ⳓP 0 Y00:$00S ( ~!+T+H&NG-AM`P@m0pP004 0AލG/00 08/P1 00C 0  R+ d T!0  0 D h4?+"L$H&OxA-MMp00 0/R @`GPP 0S P@ۍЍ D 8|`D @P 0S P`4?+Np@-0@ @P  P@p@-@\@33O-tM0 S 댣00RS|3|  p3p#0hC4#S\C0TtЍODc  8PL u-  z +v )F0`00Aoܲ@`L<` L\0@ $iXK= hpWW#X@P WL<0@(e0xSiSPfP 0)0@& 000 L<0@ Q+( A\dXDL OtЍ0 0C0H10S 0Sp&0` S\Xh0SS  /8/0d0S X00\ `0H0P!xm`p 08h+&X++&@++&H&4?+\+#=[+`+A-MMp`@PPx 0p=h!h+@PX TLf냖; < 0ۍЍ aD D< rPpU! U`k p0P aU  xZZ0S p T0TP 4 H<8 [E.H&34?+\++Kv@-2P@-H@4#S 0 7 0#S 0.@ &0A-@P` 0 P0:t 0hp ?z0@$a@00S$`V SR+2+T+ 0S 0 0/ R  /0S0 `0p@-@ PP0*D` ?Hz0Pp UTp$/p+2+0p@-P@ 0 P0: 0Lx` ?$z01S 0Hp@< $ P\@P@ p$0+2+@-MMP@T 0``p/VVP   ᔐP @T@ۍЍVP @p@-/PQ@P@p00/00@P 0S  h0A-P@oC/p 0TD@D={ZU pD@DP6+#G-pPȎ`04PSpM@P`0PP0C0 T`4 $D@:2+p+DG-ᜡ FPTpA$`Pt0&(0C0@V$Q@$0( 6刓00v`PPEPP lk @$@@(`/᫓X` 00 @ `P`F0P p0@0 P $6 2+p+_@-@-00$ D2+0@-S@ 0S 0S v 0S p0 Pgd T` R 8dD0&$ FЀP 0S00#2+p@-@`PP50S ? 0P0 @/Pj:0P 0 00p22O-p0lMS |20SHpPP T PL0@`000@Q 0*` R 0@*b@0Sg@01 $10 8%1 0`008<0@ An p ZKlЍ 00`V@ 0 /0` 0 @T`$ y000 0 0$00(S0,00S0(0 0S000$0S0400˃@0 1S0 0 0ῃ@h+&C\+^`H&k+2+x++H+3C-0MS \Yr 0wP000 ;000Ѝ  PP d `%\ 87P 4 $( @0@D^`P P   1RQ rQS! $0SP P0h0 mP`1 D1L1D10S0" 0 AD@(CD(P@\ (00(( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t> R" h+&+2+ H&5?aX+x+++D+ 0`( "4`#//)#~*$x"Y"00@-@MT[0Q@X0T L0LP  @  UЍ0@Q@9+I+$H&0P @-@@+JH&0@-Q 0@T0 R ||:+0AS@ }ЍH0H 5P ( &+9+H&q#&mA-p@@P 0 0S( ` `w `9+L0@-  Q4 0P (( Ѝ9++H&@-0xP 00S@%*S` RP@` 40P  $ 0 Ѝp9++H&0@-@0S 0$P B5/x00SdPP XqpH0`P@劑B4 0@$ ЍP+9+\++<H&p@-hPh@4S 0SPP *D D0P0$000R0p4 *9++p+=+0s@-@0PS  40B3/p00S\0 pH0@P`74 0`$99ЍpP+9+\++H&p@-P,@P@pP @\0p@-XP0SpH`@P EP   @pH+#&9+H&01A-Pa0510qS :p@P 00P@P)P!P͐ B@ 0Pu 0000@$AvH+9+D++&WY[>+G-la! R` \ 000 D! R 4q4$83(S$1$A?@" 0 Q I!Z/ , R, z 000 `2 D R l83S@t00"0A`p !\-h00@ JBGЍ(+&+`+H&`++L+O-pPEM08aSP  ,,2(3po0C @ 0T*0 ?o2W03S 20S " T  0S  Eߍ0S3 00"0 0S 0t"! 0dDV V V-   B B B0 0 C"p+ 10S 0@  B B B0 0 !   B B B0 0 X![ HӊP 8ΊP# 0S 尸 V    VI p0S    V     V ,l p T D h+&T+d#&r -A 0P/00S L#&9+P 6 O-M M)$ PR P  50S@ލ Ѝ90嬕e@T *500RSQ 50SM\5pE9S)0D0e000E0H0D# 80@$ۀB Q00 (4 S BG@P%DB9S; B. 0 4B [T U@ 40T9 49 dj #ʷ3NY0 0刀3B 300 00zBwƉp`Pg(4 S BS90305 3 R p 0#p   ~"00K b(@62B0 05030Ƞs3303Ƞs0P 20S )UTxa0040 S X(HL#R Q0cÝ\V I $ oPB .hP (1 )a#090)S )0(PU @10S1$10Sh 0 X `y 0W090C/W pC0S 1W 0 pWJB:B6`FVU 4S 04s&0 ZBJ9+T+tX++TH&+{[#&H+T+!&BY+x+f+=+O-dCd5)SW0pW_R44y`u0SW  0PS9 S00P0S 0S 剶09 R V?o20SJUMU5D R4 pGW`pVp``l\2 RD R: R; 4<a820S>,P:J %+ Ks909909 Ѝ0 +"+R ! R | &EUY0+5p`PlP d< T(`e 㶋0S O P 00 ?ᮂqp V00S |0S 906;#;S X%uO\+r9+H+#&T+&H&]+tl+h+8+B+'0 O-RBM M@xWtPP 'P P Bލ ЍDW0S870S ,,墵00 P 70Si ] "4"42hmhm004488<<HHLLjmgmdmxx||Lm9^EHmEEm:^EAmE"4"42"4"42T%0A++T9+(++K+H&+#7HTO-MEMM <$ B0P$@S@@<hD 4 4R 4S{ #404P |DQyD$` B D 吃夠EN┓P{D0S[h 043`#4 "SQ A 0P3/04$P!0+s00@ @3"͡( 0A E6/0@0 GR00 Q G00'G2P004SQ 0P3/04P0@ CE 6/0@0 4S; 40?0;D$`C0 4P'x "P~ ׍EލЍ `4SQ 0P3/G+p0 G#͡0 0A6/04G+p0 G4+ $  BRPEN0SP @0S1P@0S( 0 $00S  B20SP D$R00S5 00S \0l 9P tlx3  PPeP0SQ+T9+K+#&+:T+&0 +U@-@0SS+O-M0< 0 0 4   b@P0 80 0b @0 0H0@0LP0D p:PPP S  S  S;  S h0 `p SK  S"  S<60S 00 (60S 6f0S -) P> 050S  Ѝ50S P 0 L50S @@ h 00 000%0`,:0S40S  N40S < P 0 0 8$!!!   Z00 0`40S T 0  30S  30S30S   j?O P 0>   Z 0 0 8  P30S` P V0A 0 ,#00 020S  20S620S   P[ 0   Z 0 0 8~ { 20S , 0 m "`e00 0;| 10S 403/ Z Z  !TCZ00  0T10S00S 0 0 82 / 00S  0  4\ 0 3/Z 4   0,$ +]H&h+&d+\+9+Sx&lVdWW9+`+XU!2NP+ =+XZ}oA-1(   0 !S@ 1 1R 4S8 !4q04n0`@P1 TP0S  R-* SR/ AP/ $!0 010000 QP 0PU0 $N 5P Ѝ0PB0P;C0d0P70S050 0000 @ 0@0 0++T9+$+@-Mc0S tt|pCpS0S YLPT 8#804XX  R0 3 r 0500L rP5"0C590C990C9000rtPp 30S d2l"h2Q09\09 <0S <20C90S(20tSV2"CbC 2 P5  0R0%S P م Lh ;#;S h;004t0@%S ) 40+C? R 0 0B  0S îZP 00S )XG0STP=S 000Ѝh+&9+#&>+H&+H+D++L+_xkTB+IX+8+x++HT+!++-@-  # ЍЍ/H&x07@-@0PS ( P MH0 <P Ѝ0000S 0  Ѝ0@C\+HH&h+m&|0p@-@PU 0 P %D 0<)p000SP \+~H&h+&p@-@T`P T0:p1P 0S 0@P+p@-@PT0*pP 0S 0@TP@-@ 000 0  xl0 dT0 P<0 <$0@ (  F+F+p@-P@P @0 4 0D !0R3 p+H&p@-P` bv00CS0<@ T 00CS0< P yTnTyDop0 @00  p0 0 S+H&-@- T "L00S @P@0PH Ѝ@Ѝ/H&l+Rs@-`P@00S#P %0 ( ЍpR00SP h0 XL00S8T A0 `|  \+-H&^h+(&p@- Q@   P *  P  P  p $P d P 0T S0BP ,   %p@TH&)0@-@MPPPP<  (0P Ѝ0PpJ+0@- M@ \0 008 ;N}+ ۍp@-@0S mt00SPd[ P 0@00L <p@04O 000Sp p@F \+H&h+&A-/`es@P@Dp/Ѝ/SpPP +0 00(P0000S@-@0S  0S 0 000h00S@ IP <@04 000S @ \+H&h+&@-@0S 0 000d00S@ PĂ| 8@00 ,00S @ *\+H&h+A&@-@0S 0 000bd00S@ bPN 8@00 ,00S @ Q\+iH&h+&C-0M.S4`DAPp0/SS  冫0 Q0l V ! ,u  4o  Z   T   N   H   lB   X<  00@ 4"9Ѝ`+@- 9+A-`Axp@P` P P800 S00ЍU00N++Ktp@-BMP` 0 @E CR V uفP30FS`0  BލpAS z{P0P S00@$Z8N++A-P@``{<0 %pX{W 8AN++@-'AP8 # 0S4 P  KPr80b'PP `@qPL 00p1 F0S6 0 00@10<0`V105 S:; S0*P 0P0  0P 0 P 0 Ѝp_S-S pz3`00P D0P0;CN+T&N+H+0@-CM@P0,   0   DCߍ0N+@- @ R800N+%@-$M0h ` X '@PHpP$ЍPU Dh0P7.3N++@-$M``0C/P@   jz8p  / +$Ѝ+N+@-XM,@0F/P XЍ+Q@-BM4@0   Bߍ/O 0`( "4`#/A-pPמ0`V  @  0!Sp h \7 0 `0T  d00 DoN+`p@-@PU U t 0<j  $p@rz &P 7P P / //-M M? )-ۍ Ѝ&4`00CS`0X X0 X /ᘟ&C-pQDMDЍCq@pV`hP !W200 u0002@0PS0C000@ Rp@T3 W+X( U U    x~  ~ 0 .   h~  ~\ .0>HHp8(p W&N+1N+4@30@-P<0TMS @Q TЍ0@0!Qy0"0CS0"PFTЍ0@a !0S SL03  `X"d0AS!0@ 0S(TЍ0@    00P1P2P3P4P5P~0hP1 20345PfP# TЍ0@,j@P=(<$; :9876 P0PW1jS$ $OPPJFQ Q ?<P4/(*  x\TЍ0N+`IOX8e k%2?MRX`gxD$O-@R<@D@HZ0R0 `G U+h4Z+4@@-t4Z+0@-6S U+p@-PEyBy?yxT 1!0!sr 00 0-04 0*00 0"[+O-`bM0弐SP@ |pTp= ,pu,0 pYЍ  [ I0S  ^u0S@0 poLpT 1S!1T p 0  T 1!0 00 0     !00 0d,, 0  000!008 0d,u , 0 [+0@-,M8p0P R/ !!eP\,Ѝ@}`@ @Nt(0`0$$0FpmP%&[+[+]+G-XM`n@PQ% 0rS P @0 D 0,0000x0 0P    RQ  XЍS @0 " 0P@]+A-8Q夁X@`!1  0 0AQ!pRS4V0 51SV AVS 0A eVpTPDP@XU HA 0 V[+%&&r0@-P$M@0000 PPp$Ѝ0 R p s+d0 0 1S40000 0[+r(O-XqM 080@ D @CT Ѝ0ZЍOR`" 1!0 0 @@Kp Y tPP 0 @@ :p R Z dd 0T 0CS0<0( [+[+dD 0@-P,M@0 08 0 PPp,Ѝ0 P  *!! 0Q P0P6 08/Q(* %[+%&-4:p@-`M@0 0( 0 ``p=Ѝp R  *|P10 01SL0L 1S*HP V![+%&GG-@M`Yp2 0S 0 00 (0_P (P(0 %"`P(` P@P@Ѝ`(Pv$PP ( $0 PPXp@ЍG(` 0v ( 0C$ S  '*v%Ppv00Y0S Y 0I0t!0,,pH1! < 0( (`(Pv ( q( V((0$ 000  00 0 000  00 0P$ 0 0$1SH6"<!!!! +[+O%&Wr^C-M⬀`` (pqW0P0 000 0^PPQ ЍP@P/ PP 0  PPp!ЍC 0R $ v)0W400(00 (P 0SQP v 0Ppb0!00(lP0Slp1S\`D0S hU 0 $PO[+W%&r0@-P,M@0080 PP7p,Ѝ0 R  )0 01SPm zZj{e[fk0KZe[KK[K+S][+rO-MtrM00`S@ iPTO 0P H(J@ p Y:@0@0E p.oPٍЍq  ᠺp  Y  ( q "QPR0% !*1 21 0T 1S1!T0 0*T 1!0 0*P!k 0 D~ @k  0 Dm[+O-JM{ M`P@j03~<0j0`400pc?c8000S0P0S@pTlK+!W 0X+ 04@pW8pr4S U08pA/ <0:0 Ur> r.0 014@:@#TRT 1S- U IR:1t MY00 ! d D\z@@403p0wG, A[,[|pG y, [ ,[뀀pG  y, [  ,[pG  y, [| ,[pG  `y,T w[ H ,s[pG  0y, j[ ,f[pG  x,][,Y[pG  x,P[,L[pG  x,C[x,?[pG  hx,P6[D,2[pG 4x,)[,%[pGX (0 A,[,[ 'HwQ (  JY\'0Q00S? 0YS; XQ;X PED0n4H01L001Hp`00 D0ppMpXL010@sXp&4 0#Q0X00Cs 1SPdIX0@sYG4 0BpYPE pW.- 0;/ &4"pSu ,Z,갠Z 0 R(0 R pP n 0 0 03AP7/%00D0 Jލ ЍY@ 脟 RH 1H0 pH0S# 0 0 @3SH  V8p$W"RZ 0 000@P0@3A4/d4IpY 0 0 @3S$1R 0) 403001rP 0 9p 0400 [*Y o0 S P40Sr 000   $ $ 0 `p8`0㛣#0S P   B ( P R0X0,( 0P$0 ,( m$0H0 ppp0p?   H0 ppp0p.;㨀H0 H0ppn0 Sp HpP H0 pW 00H0 pH0 ppHp0pH@P0P ppH0 pplp H 0b[+&&%&[+r +Dd_+t6(_+L%&-O-qM쿟`=P``^@P U#*0T?SD00Y딟pP0.0809p R  `1`STyP`  l00 14Pl0 ,@P 0S qߍUmm 8ᆶ80U  0Sm0SplhPY yL- hP.U hP hP040 hP040 hP h베P040 <hP}  vh PU  @m 8 '80U40<  0S.m0S Wh P!U~  !m 8 V80Up; 0Sm0S1!R00:qx0hP#UW L 080 Rk aBQ@IKKLGJ 2  p  Q)PHFDBpl 8 8 Wl   Rl R0!P  : <0<00140KS0J  X01S 4PU U0H?o20SU0H?o20SU0H?o20X0S l |l 8 ᱶ8 W@   Rjl R0S*  %00140KS% 0400qf4PU4KU* eAl 8 8 WX  R0l R `0  0140KS0 }{S01wXu40Sq  Kv 0H0lX7' ZX` 0sXp0;p0087Ww0@QP900.@D @8Aj 4@P8BV8 0V80 R@00@0Y-1 ,`040 0@pk|  @c40$ 0@ 6@JV808 p@C1!0  p' 04 @1@S 0 Gj 0H0c?DpD0H 5pVHPp0 SX Z+j-0E1 d! n`0D00 0``qp^k 1!0`1 00CS$$1t' = z[@P qߍOtor4S 04x4(0 0,0c?0040(00p`000, l4 Up8Xu,q RT=00D3` 3f@P0=S 8 R`  &fP 0=Sc 8 R @`  fP 0=S 8 R  `qߍOY( T W04@00, 0@WD@)0S M1S ^Y   pP PU-u ) 0 0(00,00 03A5/00P9T"YNd(,p@\PW0,S(P  T'&j XqpF {j0"S wj/ 0 SX0T R l00SX S SY FP00CsL " 0P LpT00 T0pWpHXA0 &p000&00' T0[+\%&fXBGT4bhQoN#Y{&&Q(_+-[+0.hpT00j0SS@@T T TK0P 0h00L @=@0' @00& 00.0000h 0 P:\0 p XN qߍOHi0S\0 pP000 0000( , 0I0s@-qi@ 0 P= ^p }` P @ 0~  zC uuH&t0p@-P@T`d P  p@4#p@+i `+   @-M @  P( 1  P=ۍ' p@-IMM @` PIލЍp P0 b0 p\hP 0S 0S0 0S  #P' * O `+@-M @ PDۍ00 R  P' `+H-3MM pPPYW@DcP 03cP@  P{ 04cP00 S 5P 寭P00 S ) 奭P2  _x 园`Pa `2P XcP ,XPP00 XU,00P`\0S嵲X QJ0 PWJ rP ⠲1J @GPp10S h 0mc 0dgcPPPUX$ P hU  0 V, )PmP`ZZE_oR 0PPgU  d4S J P tHp* \L0Pt ' w z `+        ! H&F  f O-M Mp`;j/p p P@@p p p0W1p0Z?:D0S eލ Ѝ00WV@P @Pxq(0IT*20Sa00 00D1Z7 0V98 Z RP \g1Z.  @bPZ 0 pjV㧉 0Z 3P =gZ.  pZeP /gZ. _KZZP $g 0Z. _C|d edA`+ p@-0M` 00OSPPj0 P@XBSP Ѝp@8P _ 0 0P : VЍp 0 S C/p@-@P`P``V pp@$bpO-P-Md `\0`HV<,~Ѝ`JN0PH0 H 0PD0 D0S 4DH 4UU U U;x0@e`|6〴x01tx00Sx|UP@0\ 0S0R0SX0 0P809 H0PDp` 080Xp*0SPx ?`3S00 P 3S00 P3S0P P|0S|P 0000000% @08|0@P P0‹H0` @T0,4PD00CsD0;\0S 00T0[S40Dt,0僄 b  0`p ,0 ;@p H@l0@x0c_80J~S01804Pod0S 0` S_ 0@04L0@0p?h0?l0L0?p0X0S8 z@0竸z0相SGx ?l_|08 tHx?ɏ 0]_ {00@0 C0t{'{N_L< 0PF_t 0"P0, 0P0@00,04 h00400 l0@000L0T 0p00T0JnU0 00 pDY@D _ f ( 3 "   Tɚ;      + o? 4 ;$p L<L   p @0x C?4; $p 08 0|0 {0000000 P{'{x,ʟ 0^ 0`^ 0 P 0ST40T,0[Ⴤ0S00僔( a p 0p`pz $;pr ,00 @S4004$;pd I0 x 0r^ 0`l^,00 @S40 0P_^0 :P0S40Tt,0叛{ჴ0S<0O 0 b 0 0`Ap 0 p4$;@ 5p <<0*?ᚃ# 0@'p ,00 S40嘰04$; @p 0n A,40 F0`|0P P A8{ {'{S0x`Ɵ A,4,00 S40 A{ 0 {'{]<0 ?ᚃ(<0P 0]00  0 P] 0P ] |08%Y@ @-d ??H&A-p@4`S  PT0DPEE$UX  A_PV008_P V0-08 P (3MDPE@D`+ p@-P@Q0 0 p _P@ R 0S Ly#Pp 8N4 00, 0p$k#`&&H+T<,gT4,P4,L4,r@-2800S ,0,0 p $7h+H+zd+G-MTM0S0 DpW,Q44Q`@`$0 kU0A+x<P 0  0ۍЍ0 000nS ?S aS ppS qS|0 | h0h 0a0L0j@0 Uꌐ+p+|H+&+P&A-X`0S L00S @P@@0p0pP00脫+h++p+T0@-@@X2@00Sy&,0, 0S00q&x+L+l+<,e+RC-PtM` <ş< @ !Q RP ğE R`S \t`F0Q ğ ;   T-P ׇ Ä CR ` 0S $ Lpa@4 \ P00 4ß@Qk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\0H P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+AM`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =T&P&t<,<,t8,t4,H+PA-@@P@T +- @P`p0Sd姊`0 @ FP ,04 0 0@A`&&H+<,T4,A-@Pp@0S0P0`x0 Rh O R0T @ 0S 4 P@` L4,++`&&3,grP@-,0 F<, P@-,0 :<,'P@-,0 .<,-P@- , 0 0 <,H+3,3P@- , 0 0 <,H+4,TP@- , 0 0 <,H+,4,wp@-PAM C0 0@00 0S0! :P7 0S40=PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0Q0 00S0&.AލpP*,L0 P @0  9P<,<,<,<,O-1M MP ,t4 1ݍ ЍPX$9P D4@@@/ ,P_ 40S d_P 4pPV /3 sP㞏0S30S 3Y30S7 0a@P0 |300p3 0 #X30S0 %Q03@OoB0B&Q 30S 2 ` 0dP0002`P0 0R " Rd2 T" R E@P L2\"00@2 0H,20S %W 2@OoB0A% Qo10Sk 1pP0001p^, k^0 AP0S0,`V 咟Q 10S 00S2 0@P- 0! 0000 |00S % Q0@OoB0`@v%Qx00S d0 0P00080`<,+t d+L+Tl++<,<,<,+h+<,G-JMMPp 70 0@00 0S! p8P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1d%P*L1 @JލЍP @ ! 18PJW#Pʡ0 ^0S @$00 R000S0 0&'t0P0]4qp P0ST00@K<,<,<,3,H+<,<,+ 0 0 0 0Y<,0 0 0 0 0 O<,05C-KM MP"*2 Kލ ЍP"7P l2@@d200PR0/YP 82 0S@(2₇- P0 Qo` 0S 10S1 1 2@P -p1@d10S x4PT1 =0pP 818!0001 00S P- 0 0 0.>?0T por [&t@t0Q00S x0p0OP0 00P0pL<,7+<,T3,H+t d+l+L+/,<,<,<,+h+PA-AM b)0 $P`P0 0ꌀp @G Hx @0 0\0@@H;@C0+6PAލ0S 0 pP<,pH+<,P0@/P@-)0$ 00 0<,H+Pp@-o@P P `hiP XdP (pU ,0Q0  C0 dpH+0 @- 0t+<,P@-((0 00S/0S<,+H+0 @- 0+<,Pp@-0o @PP0B %0S 0 )0S P (0 0pP@tP@P d4P(00 ,<,H++H^+<,0 @-[ 0a+<,0 @-Q 0n$+<,@-(@(0 F 00S0  褐+<,<,0 @-6 0+<,P00P0SA- 8(0 !0ЍPAaq0S000+0S 0S1妅000PPzP00rP ,G\7`0H 0QD084i <,++H+f++0 @- 0+<,0 @- 0 +<,P00P0Sp@- '0 0pP`P@ P# 0P 30P x#l00?o2`SP@8 8 <00S000<,H+(++BP00P0S@- ~'0 ЍP 5P 0Pd00}S`00S T0T0HqP80 0 00( 0<,\m+H+t3,+,+,p@-0PP0000m8@Pp,p hsp@/P p@,'1@0@ 0S 000奄<,,+H+/,P00P0S@- 'P0 ЍP8 4P 0 P0 <,3,0@-M P&H1 Ѝ0P0! 4P 1@@*P0 /@P*0@0 S 0 00S P |h@Pl0  Q\00S P0 P 0gP000$0P<,7+t d+3,h++@-P&0 ЍP 0Sx  4P 0S0TP0@P00 ( 4P<,3,G-@pQp`HoobpUP>10S|1ЍGƃT`pE89&T1 Ѝ@5V@ 000 1"T9pX C(`P 0S 6TPS5|0 @0E `T AUPppTT TV@T %7@P @P 0 ЍG$3,H+<,d5sA- MP%$2 ЍPR0S"q3P 0 1CAYUP 00|S 6P xP 0|EUt1@p@\) XP#LQ@o`010S 00CS 10S C)0 0 S } !3P0 T.>00R   ]tp!'"Ql00S `0 00P0040@<,d+t d+Tl+7h++@-PPM M:%@p1@ۍ Ѝ(`=@PC@@NT( Na/@P@FX+PD00S p喂00CS0 U000 0a- 9p0  o0 O-AP(t@<,+H+\+0@-M0P 0$d1 Ѝ0PL! h200CS0,P@/0S0PPP P@R WT0S0 @ʴ0n@P @PR WU x0xT0S 0H @R W,0 O,<,H+l+p@-0p@P0 p@_$\0\`0XPS 0S#/0S0p@ց $00p<,+,+,H+Cp@-0`@P0 p@9$L`LP0S.0Sp@(崁 00p<,/,H+YP00P0S@- $0 ЍP 1P 0hPL00}SH00S <0<~00P 0 <,n}+H+3,P00P0S@- #0 ЍP w1P 0l@PL00}SH00S <0 B0,P0 <,n+H+3,p@-MP`+ C@T` P;+ B0ES(+ B@0 ۍp3,@-P|#@0 ЍP( 1P  <,@-Pa#@0 ЍP( 0P  <,"@-PF#t0 ЍP 0SP 0P 0S0,E 0P<,-(Pp@-#@0 p4@0PP0 )Pp$<,+>I0@Sp@-#D0 p8@0PP,0 Pp <,+TPp@-"D0 p8@0PP,0 Pp<,+dQoP@- "(0 00S@&+<,l+{QoP@- "H0 <@0S }0S <,l+@-0P@-000P0S "P0 ЍP@ 4Z@P@$P U<,p@- M Pn"1 ЍpP! 0P 0"p`1`0S@1D0 0S 1( @P%P0 0S 0@T 0%`H@P AP d@ <0@ A0 @ 0@3/H0T 00S00%<,H+e+ l++<,0 @- 0<,<,0 @- 0 +<,PA-PPPPU㈀ !00Ppp@h0hPT00P0` 00?AT,0PA 5A<,<,H+ <,t<,P7@-A P000,00 Ѝ0P!0P%0SʰP 0 002F00S@ 0 S  @&F@00\+@0 S +<@4 /P<,<,H+\+L+t8,t4,$P@-00?o2 P W!0 0@0P 0P tP 0H@XR0 L< B S00Y0 ꔐ+<,++H+000 0@-S0 0 0 蠐+`Ԑ+<,ܐ+000 0@-S0 0 0 蠐+rؐ+<,+p@-@Pp@0 @- 0<,<,0 @- 0<,<,PG-uR@`p]P\T- ,PPgT`( ,@P`_$$V; W P10S- D1D!@1B0S 0(%`PKV1P1@W 00S 0 0B0S  D$ A$t0Pp0@PPlP \P LP j Ѝ蠐+H+̐+А+Đ+Ȑ+ @-s0<,P@-P |0 p`P \00}ST00S H0H}@PP40 , 00$ 0<, +H+%P3,+,+,P00P0Ss@-  0 Ѝp0` 0S P@P ⱞ0Q R   Lw 0Ѝp@}}$Ѝp@j<,3,H+<,UsPp@-(0 p@0P0Pp<,+A-P0 "0Ѝr0S2K}P70S10S 1=}a0@ ` +?0封S Cc!!b"  A   c# P0U0C00CS0<\b  P?00CS0@8Y  P7,! ,-PS0K p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 S<,8+H++D+D+D+&9[P00P00@-SM  ,0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$U@00<,H+P00P00@-SM 0 0Ѝ0P ,P 0(qp L0@0Pp)4 0Q0S 0000<,H+P@-(0 P<,@- (0@P0 @&5H+P00P0SA-쀟 00ЍP <,P 0/`P PPP 0S0PL@L@@- p= H= =00hf<,m.P00P0O-SM  U0 ЍP  +P k @P@ 0S0@\Lp`z-|0 `@P0=0Р00000 @0 C<,m.<,<,+0Pp@- 0 0p`@PjP |@dP _P@)p @ @000 (^0@<,++H+A-p`P@Pd0 `AGP 00#-4 RU0 A2H+++@- PP   R Ѝ@P   HR  @0S00 Ѝ@`p<,B&&H+A-0p`P0 APPp@P @AP s00 00<,H+KPp@-cL0 p@00S40p@,z(@0P 0fPp<,3,H+\+0@Sp@-Ch0 p\00SP0p@HzD@0PP80CPp ><,3,H++ @Rp@-p0 pd RX0p@PzL@ PP0< Pp <,3,H++O-MMPPQ 3 ٍЍPʴ#EE*P 3cp@Y 3 J ^L`P@T)B<0㓄(p @0S (30@ @c0S0,00&p`J2(z2`0S@$S \S00@# 0!|"  0 #" @00B   BR 0 F )b;0 J`0S@iR0@S 0 F)b;0{J`P1yh1 0S x10SL1h`10S ,0y00CS0. - E ;0 03/00S 0S 000CS0 S0  )t;00000h0 Y 0pS7 <,8+D+H++T&`+l++d+t+@-@P 00P 00P00p0- lM xX00S PH d00 P000p x+h+)H+g+-lMXT00S OD d0 P,00p h+CH+g+A-@P p0 0C0S13I `BP@ 0 B RQ@  0 0C0S13p@-@`P:?P , 0S!PR |,pp@,*`(P %?P008 ,0S!0R]qufp@-@P 00PU 7I :NPp00p@-@0`PP<p0 $.0St  h0 S Ѝ00S 0C @P2+xP/0S/0@-@Q0%Q#0S P   R   07W0C2007W  BT&G-pP(P SR@ APP0   APN0 0010S / ?Pe )`@?P 0PS(2  `P):`?P P)P :>PP000S`UK ᤗ0S 00S1 @RđRp0 \ AP0 0 U ))) 0 011 ژ.Ѝ @PP) `9 0S000a) 0S S St0 0S 0`S@O)H0PU F),P++|+ - BR0 R  P R O-M M@x PE$@AP0DHLP0($0,8D (00,0DHL` 0p 0S 0S X 0SR@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;L@P dۿP XֿP HѿP8&0 !000S V PU@ /LV@0S 8P @0U0C?o20S b4pWp 00C00p0Tp pW LO9pPpUP 0S D90P00 $ 0R 0900XME+ 8Z0048<03 0 )3 x30S7tZ  A(@=0P0 $3@@6(:x=@0P 0 @*(00 @`h `00PPx P00@sPS (P Y0@ 0'T00SPeU 0S} W +X8+X7+X7XP+ 8!0 0p4P80L YA+ P07E>0000HP1@@DcT@@/ =0P  00P+ 07 08 04@ 0R 0S00}Su0S @0S 0S@0P/KP0Y80<0 @    & . [ +{ l+++3,!++!!<, H& +O-kMMPd|UZύLHD`\X1 !0PX0C|6Q0B? (p8 DA#'XH 'La\'PQV?ⰡT㰡0E?o20SdQ` 0S PVV 0S#UU?0SxP|0s0s0s0s0S0s &X?0S0 /JP&&?0S 00SU n 0 0 /x=0S !~P' Uu8MD-6>O00)0SO !N)P$/>N0 0 (00 RAQ 4t=0S2=@ PR( @@-0 Rg@lFP@<0^ 00|SZ >T00S;0JT0#QK\ T< < $:Gk,F6p;`0S00X  UL k ;/ 0S 00S 0P 0S} &o`аD(pPp 0S :J0PUDY :I=pPX ၻp0SU 0S_ d+0 00 P#P %;P i 0x!C_/0t1p1l10[/E? p x10l1S 0S tAT# 0S iEP h [T  K d0厓d00S 00S P p$%tQ8[Qύ00D!0 H!4 P!0R iPP0000/I84010100i/\V`P VhJ 04 0@峔PP0S4 0 媔X VU@`PTv  p 0q_0pP7/\KPX80S 0PPq/@|'<5t 8500S @Pq?/(70 S00?o2#PP0 P60S P 1S$ P 1S$6vF VE@P3 )d4\60T6qP e00@T ~C HP V00@T oC rHP G00PP UN`UEP< ('(P<50S2P@T4dL! t&QQ m&R i&Snp `40 WE:e0 0- 4Dpur R&U l@05 e4@T Q?1/N0 00U@ L!1&Vv40SlS`V :> PY= 0 &0!&p0S0A &W&1p<00S`a\ST0EP<0S 30S 30 @< %V P30S 3 @ %T ,BL%O&paⵯ 20S $3q|R`0P0`0#@ 0DPIP> 8pPP`@PPi 姰0 R8 1000@ #@b>0P`@@`0p|! P0P A@P p `@@0S P@pPP-ࠝZ  0`0rPc ⥒h1Q00S g+)&"L"+<,"&h+3,"" #,#l#+####+8+#D++`+d+^ +#+ $+!!$$%%7%-&T&t%%B&&&Z&('&1&& '+^'l''"I' X^ +'''R((<,Đ+@Bg+()++H+_(<,+<,+cP> PG 0*S0 1Q<0-S8 %QP00P0,0 /R( *R0 0Q@0000S!0 016gP 0, y\0rF\yP 020SynP "` P `P t2m Pnܑ000P }P P  c"qoP80S S WO @80K/CR032 V 0S|"0 0 ڷW5V6ZD Z4 0p#2Sm#83Q0SQ?0!<03$ +SQX3P `Hᠷ᝷0SH40A {u00P 00S0xsl4 r|00 P 00S& 50S004 o0st4 @ 0QP `th0S050o 52S| % R 5 P ;5P P P Eq! 55`0Əs 00@T@ @V  $P|Ґ~F0 0 o 2 R@ qF0"0C?o2? jF ""0A05c0 S ;S0 VLAP 0 R RT L0SD0S(0?d'"( ,0< R /$ $ T á @"͡<἗<P r"@RD á 0#PPx#Pp0S0S}H80Si#@P pҬT(X000 R0HL0$ 0 p wx'xl h[hl pt pEpt P #P U 8 z RP90S H90SL9DyP $70S @DTʨ90S Y~ 0 0S$8 (PZ0S= S E#J : :`00S0T0S= rpq\J  #Px |Z L@P  W` b:0Sb: Q ]* Q0: R:# 27 ;R/sr  3/ 0A3/@cpl;@X| :; R0 ;Q;:+0 0 S |] YUQ"0S,D< 0R.QVB^E\0S |000S u000S n000S g00kލЍ0S 03/0S U00@-P @7P  7P0P : Ѝp ⿉`P G A7P 0 FUhLP  Ѝ@^ 0S S0S ( l70PPy("0@-M0h 00P P10S 0S00 0 Ѝ0   @T0 S 00S 0s 0 :v4P 0B0P R  0 o@T hZ?P 0|S ᴴ00 0S00 00004+l+ l g+++G'A- M@`p /00000@P=0P/S:S X=@ဴ P.D .p$0 ./@B@P/:BpP "@^P Z Ѝ@/000p0 @@PWp@00l0@@DcT@@00@0CcS1S@(( <,PP00/@-C,0 @  000|C@x+j+@-vCx0 @ d00S X0X0 p <0000S XC@x+h+H+(j+@-OC@`00S T0T0 p 8 10 10S 4C@h+H+(j+l0 @- gX00S L0L0 p 00 101000x+h+H+(j++`0- lM@ BDd .800 p q8x+(H+k+0-@lM@% 00 00 0rS sS phd -\d -P00 p A0T(d x++j+<,(()H+k+(@-`PP@ 0@s8#80@U 0s8#8000@(B(2b!! P VU 0A0T0Ѝp00CS0 S0 S 0 /O-TMxp|W0ʿ0? p00p 0O`B0`P0V0W B@@0 @040SD H 8PZ0S= S D\0 S00 @P(2B0S .B0#S *B|0Sp `1 R R 0Ha# 3Btp uTЍ ? 000 $@0 uPPA0S A0#S@DT|0S ld@"\3$0V 0 `{#M"00 "@B+H+O-BM MhEPdP$P Q L?0a>0 PPP0p5(`p 5 P<$ P@+40S5V $ 0D  r30XD S00H00S+(, 0S 0 S     R  T!$PP$p 0 j?3@P$p ij0tp9# ap0tSS 00   00Bލ ЍL3@@s 30S VW@@cA *22 0f cW T 20S 5V  R x" R " R W WSh2h <202eW @2000 !00D 1#0U10S CdPRPU [ 1000P T)T 00P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V0     0QR\@\0 RZ P :/ 10 YS P 9/0F3j+x  <,+@++ +H+D+<+>)+(<,3,t)T&+-A-` @T 堊0 ЍAЍ/p00$  PxQi2l0 h _;oa0S@ P 5/m<+x)<,j+x )+)O-FMs M`@ ( @> > >0$0h30(0$ 0H,@K0P S?婲0 $<3 Fލ ЍK0 @,Q(*2@@в@aGT  2  K 0 PD0P2d @P h"hd*\ *0S 00S 44 0d  PP  dl@0S00?o 2PA >06XK6D01@ @Wp  pD<1  $D0(66S0d000 d01Aa0PS 0⟉P `P \00S x0 0|0DlP@0H| @00`,@0=p++)<,3,+))H+))(p+*J*@+L*<+O-JMGMsn0p0얟VXv600S00p 9 P忥X6   t60 9PL孥JލЍ860 00$0 97S 60SZ6g50S# 䵟0S5 Q U 5R "P 0S 500CS\5|g00l=0S P97S( 5D 58%80SX0$000(00000 PL 4 0000Z40܀C XSX P4`0(  $   dT CvP 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 408'0P30S@97S00000 0S  0 p廤008'PP2 0 0080I 0  < pd 087"PD卤 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S0,< 00 00,x1 >P!1 R  D 0 0ZP 0S 0097S|0 k0S [[}X  S[00000IQj+++$+(p+t*++H+*Ԑ+l+ܐ+++*<,***D+*+ l+++<+N++ p+++,4,T,k, 2@-`pBWLM LЍ@C pP=  p7 00011 0S<0 |q?!((00 Q 00SZ=9Q ='/@#b?!"/Qp <0S <0#S 嬣P'00+0(60 8pp <0S <0#S p pbp 90S0 000 0yLЍ蔐+++Mb{,,j+,A-0H`D0 82V p R R B`R RB`b2 Q  ,'00EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 'V 9'V 4'0 l!l! ++'+''+W#'+W'Z 0S000A/j+4 L+Pq+z+3,l+p+@+<,<+P4,L4,+<,<,<,<,t<,<,t8,t4,A-/`:@P V00hT/00PPᨢ贀]~H+&.01`@5H@dUXt0td9V`P``0`>PP<0V0T.S10000D,,,+H+,0+0@-MTQM0S D@11S41  ۍЍ0@ ,@ P  0 P N X-0 PP  >01S0  T  +p  PP000SۍЍ0<+-j+<,;-T-@+p@-0T MKN`00 0c6P`|40SJ> 000d4@T X40S@ H40S@@840STPv40S4O!dk3 3K d Ѝp30SCP PupPHd+ \3 4LS {P@02000 3 )bQ gP@$R000 0R0 0|IP  AP P"@P  0 2$@520P S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S0  0S PU P 0S 0S T01S\l(0 (<,P4,3,3,L4,l+H+<,j+- <,--k+, g-L++@+--A-M  0 8 4 |(@P@p(@P@d(d $ \(\ RS D8Q  Ѝ 00-S0S 8 7 770SN0<00@0D07 08PPGEGWn@ 4PZx7,047P3DPPL7`@0 0wK4P [4P6Qx AQ ,0 p,00002/Qq 8 0S6 @0szD0s{xFP00<0Su40Sy5$ 0 0  n 00|S  0fpD,,0Sx5P5<0f @,,0S    5<0,0Pp,02PX0: S 5 L4 i00, 0D4Q PU>0 00S,  P4 440S!@%`4@0@@Sh4@s `TP@40S 4040 4 (a 41S $ R 4P <3P P P CrD0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c48 pcU|,00@ h800 05400@ ^880030CS,0"p,040q402P001!P X<0S <0,3/0,0@4K4@f1 R0P&80 SB\1#)0 ? 0!$$P400@0 0 0 48 p 400@0 0 0 o$P0 ^w0#Y尞@(D $,0S <0,3/4++<,+.+<,L+H+.P4,L4,k+L*+ (&<,e.<,+I.-3,.++<,.̐+.@-GM ,$ @_̟_. 0 0+(0,00040E@PL0;@@P@;K00;00 2oDD0S>;0SV 080< @ t+ RD00S0\ H0PLKNH@41S<$$2P $00|S $׼P$/I6@G70SR C70 SN $ ): 01RS 41S $00-S0S |: x2d:$ d,D0S $ GߍJ0S : <0s^@0s_JP0080SY00S]9 9 p9T00$0S  T$ nT/00Ph90S 60 S$P$60 S$ֻP$ 90SD8Q0SPDPP?D0S!0S' S+80S 2(P  8d(880sS<8  01Pw00S  &PlGfQ000SP 7 H7 R0WCT41SWn$1P_x7(074! 6 (0p(0pp 0: S &00&071S ' R 6P Ʀ6P P P F60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p(+Q*$Μ$00|S Bg@$((0S$ @54! 85 580$ ((0S5$姜_00\%p00(0q(0P5P001!KPL50 SE480S 80(3/0(000L0S04 SDQ  40S 8 4R* qp~ `y%$'`0x0孺pr3X@$P  0Ⴞf FP$@D0S s0 0 @( 0@RP`\ (T000 0EPP sZ,pJ P @`@# '0 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ 540050 SE1(00@N 5,00(00@T!000t 04\p@ TL0Da0L0 TUA @(, rp%P1 G1#BX噛@PbL ʽf]00S 0 =<@ (0S 80(3/0+(<,+<,++L+ +k++ $.,+H+. .<,+,,<,.L4,.P4,<,--&++<,e.9.Đ+=/.., /0]H+h/QoP@-X@ P0  P !0 @ @+<,u/@-@"40 HЍ0Q p@-P,@P@p$P @&&p@-T@P HPP   0R  p@+T2P2D+p@-T@P HPP  0R  p@+|2}2H+0P |@- P@T Wp`W VL\ P  R/'&G-@pM`t.T oTP ЍGFT8,,a,1  CQ Q@尼Pw ЍGz 8S 0S vP pP  0 叼@DTЍPp 0 X0    03/ $ p2@+2'&2338 $R!R(R3 R (8 0 Q Q QG (-R ( R (8 "^'  ^ ,QQ(88S08 S08 ( ( 0!R/\^^00^ "^0 00Q8/8S08 S08/@+-&p@-H@H0 (8@08080$8P  Up$80@+++@-A(8S [0 S ϻ$0) P p p $8S 80pP\ UP 0S ,8S0[ (8S 00CS0 ~0 `0 08 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝp@+&3+&*3J3_3r34 l P/@-@P(6P /W6~6@-@@0s ,00p 0Co-&H+0 0 O-0-KM0/ Ѐ0 P 0 0SZP=9 =:k{J0`Y0 A8( P@ : Ak QPP@0I000$0.A++<,<,6Q6666+<,<,767"7.7H+40P@0X (p `l 0{吚 Y`    0Z C00 0f⩹`  Z f  0ᙹ`< <f 0@!  ቹ0` U  S  RS!01D0 0;f#;Z0S;#;0 d ,!?;#;0#5 ;0?;#;0@#5;DEW0(PS@Y $2@V0TQ@2QML"0 P EP A  Ak{H{7{j('"d%Z` f" 0`< <Lfp  # 0 0 0S@ P0S S dh#@p#d0S 30p aKߍ%U[0DEW@-0X0 R0@D00S 8080 p D0@踐+h+H+.7-?$M0 0 $Ѝ-4M0 00 0000P4ЍO-p-MM0EUჶ " pz4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S 0sd0S $P <0440S` $$1N`$S 06 "{0 A(# A0f{{zdWdp0033Q-A`P )AQڑh#d#A0 2f `4ß 0 R#3SPSr01D0000 m/f0 $` P(0 0SZP=9 =:k{+H2 AP09ڳ A k Q 5 P;!%#3[QP q D d 0@!0f !嵷1`P0F|1p fR P 1*!3^2?^01w/d!P00⓷P100 p 0S"%+0!gU8 i`0Sf a`0 0p ѳMߍY@.A<,+++<,t f7<,h7<,k7<,Q6q8807H+4+8.7<,@~6880P Pv0  ApL0 A k{I{7{ZU{0P  pgP<<`0  `  @-.@S.@p@-Bd00` pd00CS00Cp ,P P00 @R0S"P7Qd`d00CS0*-p "P \Pd00CS0 p000S8A PA p0 0 `Vxp0 Pc`d00CS0p 0@S P,P \Pd00CS0p `V0 0 )Pp@=,-&8=,A-@lp`YP@ .PP O@P PE 9!P@OoB@=,O-$UmM0S pZEPd 4.0S mߍ_0.1dPP0͵U4P(0P/S SUpF Pd4P PP P4$0CS0p- P P P0 PsdL)P P  )P d0p P 0? lxhxdp P 0S d0p ԳP0? wp P 0S0S dg0 P P d00CS0p`2`V P Q82<0 0 dAQ 00 p1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\00 p P`, ^0!S^0C0 hPwP\\ +8=,8D+83,889-9_9H+999T&D+D+*::L+8+0@- @0SОP  P 0  00@|0  pḞPX0 PᯞP40  0ᦞP0  T&::3,:::00CS0 S0 S 0 /1A-0aS0P0-P3U P 00.S Pl`1h{`L VT1@P H, NP0T0!0!00(1   fU 0!ZA0p000 00000P0 0p0S0000PTl0l0  @U x4 I'P$0`9U++::H+D+H+::L+:3,3,P4,:T4,:3,+]; ;;p@-@P | 00t 00l lP0h @Q0T0 L0P@D0@ y80@0S, 0p<+l+3,3,+,++ܐ++L+8+P0 @- <00S 0000 p >Qx+h+H+b;4+A-@+Qp0S `0S p v00`PlR00000S t`0S p W0000<0uT $ kv+pl+<++<,d;O-`"BM |2MR0pB  h" R S4 P o04 SP 4SPP004BލЍ$Rg1+ NB>4P/S + +  P ꔡޯpV0刑p00g00000000 0S P1ov@19 ^70@ R 100CcSppW00 0S 0oW0000 00  $RV.uD5uPPT{ P00ꄫ++h=,l++;;;+<,+L+~;<,D+;;A-@Q0qS0`00S Q`Ѝ0SEP P t0 R 0000@ Pl00}S0s00T 0S$@,S ++3,H+;<D+T&<,O-4Ma0AS000qSP Q 1kS4ЍPH y.P00tsP00`#P$TL V%P@1( @ S'*000GS0P#0!l+=3,+,=+,+,/A-p`P @_qP0  T  `00T   0@ R   `FVp`00CS0 X> PpTD000`000 T00==&=G-PȀ`o 0帠@TOp ⺯ 00)a@x0@P 0⩯D0D 0 P 0 Ѝ+?H+>1>&d+`+O-M M@ P"<` 00\ @3  P`'P # \~ z30S)  PQ PUP )pV&0F.@00002e'P |"|FUD&F@lލ Ѝ pp<0\  ٪p \020(PS @ (0, 0/(0, ªpQ &0$S,F␡0I00S 0h$Q000SZ=9Q =*/@#b?!"/E オp5%0S %0#S [%0AS  \0 0 PE0 0P囫p 0S %0% 0 dpsP0\ {A|P%<00S>(+U>h>>+Mb>>p@-@P<p@^/p@-@`00CS0pP0 @ %0S0`00x%0#S V r%00p0 PA-p@`pP0 @ Y%0S0`00Q%0#S V K%00A-@XP`po P j P0S >@-@iP ?@-lP??@-@-lp  h?P@-P??A-0hMPQ@00 00 T  40S P y00 P p0 0 0 PtCcXY 3c0S w@t@@ p  P @pRP@ 0S  @P@ L O# < P@A D#T0S @P@p/ 2#0SIHn0S 9 ,w00 0P YP12 qCAh1 PP 00 @T  # P ה0 0@T  "P ȔhЍT=[8P@ "T 11@T0 0P`V<PP)000T 00 0P@T{Q DP+??0+H++ @"@*@4@?&@<,?A@+,L+l+8+D+I@N@+`+d++,+,7@-P[1 Ѝ0Q0S 1 1ŬPʔ! 0 CRxA R Sh10R P1P 0S8S,1 0{P 0S 10S 0 0厬@@P 0 @0@0 @~0 $@x0 )@r0 00S 0 S<,l+3,T@H+@+++@|++@@T4,P4,L4,4,4,3,3,,4,(4,3,3,+00S%@-0M@, !0 +P0S8tmv@0Ѝ0@lꈐ+@-A-1 dy团AލЍP0 SS  S0 0< ȠLȠ\ ,p 0圠0CZ :Z <50 @dK,H,`N,@M,BPM,M,M,B, B0&BJ,HM,B0@-EM,P (P@Pd5Eߍ0 ,PU ? = (8 x0 <  aTP"a 55pBBCC 0&5C3O-PM 〣@pt̡`l``#P3P ۡUPE!,cP00CS0'p 00R0S kP18C8S9 P%cP22l18C8S  ⨡Ԍ0 PP 1 P8C8S  P < P^S,18C8S / P 0 S 18C8S <18C8S 8l18C8S 00 l1 _ \1/ R L4 U 118C8S WpG(㉃P`8<18C8S0  ЍS R   RMP0 UA 0QDD@M,dN,B M,PM,M,0&dK,B\N,H,CCHM,J,WCBp@-BMd,@P4P1 HҠ,! 1  rPP4`1{pP@uDN8e0S+ ,5 $5 @5 5 5 R- 5+ 400000@T ,P004@Ѝ0400/S@ҜP w w w LTaHa@ 0S{Qt0S Z|p=0#S|sp#;00S: 'y`P`|` R  V \3Q 30Sx l: y$c\3P0S 2Q P o2: @xP2  : xP2 l!: xP2  : xP2  : xPx2 !: xtPX2 ,!: xXP82 <r> 04Ѝ0H,0&@-`0S@ "P0S 0000q20\@f{H,6LDL0s@-l000Ph@` R R l  R  R@4Ԝ03/ЍpQ P0&H,4.&LA-` q QAT 0SP :@}P0000s0P lP0 eP0 x^P hh 3\0L@L  "  \ 0&H,JLOLSLXL\LaLH&/&iK,00@-18C8S 0P  0&pN,(0( @-q0@ 剘PM,M,HM,p@-BM` P@0 S`0018C8ST01y0 0Pn00x0 ABߍpB/ BR 0T00P y0001HM,0&VMpN,PM, 0?o2 0/0&H-AM M0-0r0)$&0P0000000@00 Pڶ0 ȑ P0SS WS BS 0 +P  TcpZ0S  1 0S0Y` 㾗18C8S ؠ0S Q     |P Y 0@^S00CS00 S00 P0S@M,(O dK,M,H,0&pN,p@-PH@P@p*P P #P @0& 0/@-o/A-@PP p 00CS0 `V  PPTᨸP0 P00XA* 0S P0000 !0S0R 00 hMXMwMA-`AP0E!Sq pG 0!00CPPSJ0`00CS`0p S X0 X 0P"SP, 0SP`0P0CS`0p SX0 X ! šX!ẚ0 0P0 P 000P pP妚0"S00PA *<ᛚ0 0P0 tN,&`M&MMMM@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 MA-@t P0 =`P`PP2 00pPF 0P .0V @P  @0S@0Sؼ)00@ PP?P PPP P 0!SPMtN,M0&MMp@-M@PP\1  { ᘚ@P`u00u0ۍp0 lP 0@ 0000S X Ῑ  YP00 f0 [Pc0&MML,Mp@-`@;PP 0 /Up(b P\@pM7@-@P 圕$ A R : 6@T|o Ѝ0(R( d坕0P6P @O1P ,K,P dK,WOf@xt yt [OxN,0@-M@@v0(@,0 0 t@P jЍ00,x0 e PPPv P0S P00@SP\ xN,0&dK,@-(,W~OxN,@- @Ɩ ;mP 3 0P3P xth 墖\ { 啖$ЍdK,xt yt OOOOf@Op@-0M`5PPT 1<18C8S |巘xAx3 0 9 0@ 廔4R,P( 㳔0F, R  娔 夔;P 71P` 0(0S q=Ru 00FS0xlhjP0Ѝp\XTP DZ0&OdK,&PPPPxN,PQOP!P&P1P@PMP0@- Z@6dK,P-@-x-@-x0 R   ЍЍ/O,-@-Z0 R   ЍЍ/O,A-ARp`P@1T pPx?`@DO-dM @P$}0P 0}0P0 0 >880 0(P40P0p`,@@0,@ T R3 U&T ( y0 (d(0p ` Z0 000,@ @0_oR,@ 0T ZPPU <v 04 JR (0 R 0S0b 0S  dЍT3 ` 0@D(0,@5H00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q p >W : "80(,PP (J- R 8 %Q  R P`(3c8@Ht  G  $P T0`000S(3 0(408 TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@TPPPlPPPO,QQ9Q?Q{PUQgQyQQQQQQR9RO-lM($P|`M|PVPP*8@ 0 |   0<0hh2 @0`2 @0P 00D@P 8%@P  GPp@0S$("P @ _~]~[ lЍH<`@40S(( T Px  , F, 0P¯4 p0?P00?P<  B,$( ( ,0pRQ @(S<`@ 0`DP%<0%800%4000 0'<0'800'40` 00k$ P$@PMR3&9QWRkRqRvRRRC-pᔑM00PS@ x%`0` 00qp@  ґ?sp$_@`0 P菕00: pppppW0@ @ Q@Op`6t0` }>?@l@ 00 S @.  C8 ЍCQ03&RRRS&A-MpP`ЍAh}0@: SPPT@ {`P00S 00 0iQTP1 Op P PU0DsLS<(    SSO,#S+S 0S; %OP2 @@?T/   `00 @ C @ @ F00 *S 0 000?0`?-XP10EE>P  `ЍpLV 0@-$M8P0S 0@ő@$Ѝ0@3&0 0/P,0 RP,A-@0QS`0@S` p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@@],|,@-P X00S S9 (,0 @ T @],p0@-@TI0 qp0@ @}01p@],|,p0@-^ 9 @ 0@&)60 P@ ^@T@],0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/@],P0001S0 0/L3&7@-P R I0 00# Ѝ00R 0@!"0@@fqp Ѝ0@R?@],X0@- 00Vqp Ѝ80098<@ q|/ 00\ /@],A-`px PP"@ 9 @0@  P09   S 09 r`AP,@],@@A-p`VY@  @ @ 0 qP0 0y0 څT  00q0@A @],P,0P /@],\ -P0S0@  / P2:1S0BS /C-@4QM`@|@0S1UA:ЍbS9 .S8 00C S 0  ? OP ~>cS@U:s>0@0CS000 000C/  0?NP @@@L],L^,XXp@-@P 0SP`pPQ P@dPQVP4>|P0S  p PT3&4&XA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o21@0@ 0C^S0S`P@u0C?o2L],@-TMrL@DM@M<M8MTr,3,!4!!!8!!n_)a,8,h,+a, .a,,E&EaOa]`eaaO,aaaa`N`a,abP,c``bb,bO,8bE&e`@bg,d,xP,8i,,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,YP& 0e`0,0[0@0S 0! \,P 0Sl-P *a0ES000 *P *0 /E: 0*U @U !U<30S 97R0 <430S07S ;07S 00l##z.10@S @0007S9 P 0S S30S PP d0S7 40S{i 0#0CSPwd ;P $0FcS000 e`!0 S $0!R0)?040S  /0 S 4%0!R0)?0 ]!R00 !ı50S!R0 !R0 0!ı{ x5 r5 !R00 !ıf(60S!R0!R0 0!ıT !R0)?0H60S 60S >`@0 S 0/70S y0 S 0  6!(gR00 !00Q 0R eSd0C0<0S d 0!0<0<pP0tiP0b(`Q 0!(8 SXPt3IcG\80S0S]=B X8@ 8D 8H  pP- I,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ır ` `<0P 0P0 0!ıP *P n P !p R0p;p;0!>P }0P0 0!ıPs ! R0;;0i0P0 0!ı=`P \ PPXZ=qpT 4< bP0P0 0!ı=`Ph A0P0 0!ıP 5 391<`P.)P #!0`0,`LPN(P 00,004 =0=0S:8-T V _@10 |q)PP U U ?Vi!P0 >^PP U U {!@0 NPP U U G!8>0S H%:PP U U.P0!0P. %(P0 0S .00S>0գ?00 ϠR0  B ? 0 S /00S0?0գ?0/0 H 00\? p?x?0S080k>00S/L^,@-@0 S!0O-S`MPp``@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0A80 0 @S/o" R 0CS0 Q  S P R 0T@180 0P R* 00P x  80 `P ` [0J0CL^,O-pZ鰐X& RP ` P`Px` [ ``F 0R@ 0R U *0@S0S  PpMbp@-`R P@ ^0P @@@ 0ppM-@Mp @00PC  RT0Ѝ `? `<P ?0? `P<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P#0 <,0P,g,p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#n0 DPp@{T ^gP 0S0^  PA0dP fP pip<,0P,g,@- @ @|g, @-p@+|g,Ob @-p@v+g,ob2G-pWPrPP{ P0`^rpЍ\@P 0paqp&^ )rDr?SZ ^0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*pO,g,bp@-`l@PP ;O,;0XV@` `;D Op*p|g,b 0 |g, 0 |g,7@-`P@ PP 0S  P Ѝ0|g,Po/@- * ЍbA-`QpP P P@P%U0P 0 P l @>]T @P 6/P-]bbb@-~x 0pl l0P X H0 H <0 P0 @0E&G&bt c $c@cScT1C-M0SL @10SH 410SF pP` JPUi0@?o20S@ _P[ZYe@ЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P jPE%U@@|0t00SЍ0 CoPP0 00dqpOo00@M(O,c5d(3&ydO-M40S 0S j0S@ T y P 4X ЍP @n Pp 00r pPPP`h`P$ |P  pPPP(do0S P``40SWPTePQ ((@'#PP3`00FNP0`0 FP0`0 +P X ' Z 0dnP% 20SP `DP  @' YP nY |2 d`2 p KH2p<20WF,b(2P 0S P (oP11P %0S (.1 \ P P l1 PZP10S Z 410 (0 qp 000Sp 0 s.P 5 R0  [ R 0l 0P: p X ,P,P,ddd,dg,cO,P,,,O,O,d P,8i,dE& ,|,H&eP0@-@P,00@-IP &@g,edA-`pP`VUPU@JTVgP0|, 0 P,@-xP@0 @ P, 0 P, 0  P,p@-P@@P Pp@2pp@-@`P%PpVU p@ Pp PpA-@Qp`P \YYUG-@䠟@P`  @PUЍppPX7AP X8p0ShЍGP,@-T00S@ @yP,0 R/%R %R0 sR0/p@-(PPp@P@pg,_eG-`dBd@p00CS0fPu U   0DIS  )XXp@P0 P00@-@,P*_eA-@0 0Rp@`0S00 R0R@@0`gP0S U  P@00E&E&O-MpG@ PJ!`Q[ Z@>P[@P) 0 000p0}oЍPP P K X P VPAP 'XP00pWpE&E&eA-@MphPPPЍAl@@@j0 HP`1oW H@WЍeeeA-PPЍ0S `p@@@hVPP D 0 B`oW kPWke@-@ @eA-p@`P@0S 耟P@0S0# CV* UR@ R %S0P u@# CV* WR   R %S8 P0sWY@P,P,C-EMP PEߍ@ 0@\qp `,&kPڬ嬐P ` P:T0S EP @  h0Sp `P  LP@L^,,C-MjX10S@GpDQ0SP? HcP ppp``k00000 0 0p-nV+00`@PU B`VV P0SVЍ +V@O,eE&E&e0A-0S@`@#0P Pm@ p`PqV@nVlVO,e@-@<P 0P oeff@-M@P ዱPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` hP TP D@#@ Ѝ-P * PP 0pm U ` UV @T P uX%XiP ,@T@P@T 0l000@`<P-@0SU\,O,/fe8ff0A-`V8@P&pP0 PЍA"vPs`@@@@=0 `mUU@UT ЍAɄЍO,gfqf-M jP  @oЍ0@-P@M0SP @UU jPS @Ѝ0@T@0: S i*@{Uꈌ,H&H&@-M@jP͡00 0fЍ0@-M0P@ jPh0  R\P0  R\ tu p0St00Ѝ0P,g,g,/e@-@P P0@/R@-@ (0@0Tb#@,@-40 R\00S@+@g,Ԍ,h00S /pp@-qp :#qpP@ QPppD],@-P&#P3#0 R/  g,O-$Mq0S@P`0S\0SOs@HP`@100CS sDP`@ 0S"P`0vu0 @ 0尠00Rᤐ000  00 0h 0 00000000 0000P`HP$Ѝ,,xP,0P,X,8i,O-M<`8@p@PV t30Sh30S`o`V D3``F`V`utV-$0S 300CS QP ""]s"QP ""0S6 N` +20"`Pt0X 0SJY/Y @ Pi"V<"0 40 ut  20S1"0 000 a0 0 10S*P10S q+*qp@PZ "P~"P41Aw"P  "qp ,10S L"P ЍO0G00 ЍO,V utS 00St001 ?Q*)@P9ut`d0P,,Ȍ,`,I&O,g,,,H3&f,D],,h,H00S <0P/000S $0@///g,,Ȍ,0P,'G-pP(,`@qP"V 410S(1`V``ut 10S100T T00 05*`%*00oᨂY J) qp00S@P W ЍGx!Vq V '0P,,,h,`,O-M`iP P @0P! ЍO !qp@PV00SЍO0Az!P00 0@YЍ!pP@PX p 0Z qp0 @PD],0P,|,A-p` qpP@VЍAw   0@2Ѝp@-8P@0SPpUqp @0P,0P  P/I&0P  P/I&@-P@p@-@PptP0S T0 0S @ 00C0RRp@R  B 0P,I&h,0/h,G-`$qP@U P9 Y* QQU&8w@y|0 "0XPP00040000( @0@000S < 0P00QP   0I&h,P/P // / /00//000////0/0/p@-@4PPP zQ4Pp4/O-M cD\ {rPX 0000 0 (HP 0000 0 (XQXQ> 00  0 'P*Ѝ=ЍO" <O-4M(0PX0@ ,0utA @P4Ѝ40SU400 ?QQ('@PP@dp00 0lp P7sc  ` V0,? cp` P P@㴣Pv V}, `?V@P,0S1 h3Z1 @P'L30pW05 0$ `P" R $0 S S`! P P  `VʏZ: P `@T_ @P[ |20S  P0 X (0 S  $PO 20S @0  1 R00 SA> P Pe p 4ЍO V  P0# 0PB R \A0 Pp``@1`@P!Z 0 0@P_ V V@P P P P P@Put 0~ 0@P_|l00S V V0 0 0S j@Pw`0 ,h,D],|,8i,`,x,h,,,7@-P@P ,0 R  000 Ѝ08i,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = Z* P+R( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP U PP 0S 0P 깢XI&h,Y&¢&ĢƢѢڢߢq$0 RP  / h,0 14/ h,$ 0Q/P/L&@-w04 ,    00X,X,X,X,G-P匐剀I@IPT`ppP Ti,,EA-`ApP V P = CP  V10S ! 00|QS 00 0S$8QQ 0XP< R0$1a 0S0S Q00S$1R0$aʈZx`P F F)00x$<0s0$10P0 0S $ h,,,`k,L^,0606Ѝ訄,P,G-6@PP`j>T6k.sq 00P6 >06PU p>P0ЁPP  G P 訄,P,,@-P ,0 0R  P,%l0l 0@- ^ @^TSa04S '005S #P,,,00@- @P QA6R 00訄,G-X@pP P`PL>`I>p6W @訄,00S/A- M`V@pqpp6W @ Ѝ 0 PUP8P P 0 V4,>,BD@-  0mS Ѝ 00 Q @@P 0 S# > PP0P`0 S  Q0 R pV`PPp =p000P,17@-PU0P( P@ Pd0 Ѝ000S@PP =P7=7 Ѝ0@tH00S@ Ѝ0@ 0,0 0 O,O,Ψ(3& 0 O,<07@- R ,0,@P?@0 Ѝ0Y&0P,@B,@-P M# @0.S 00S Ѝ 0S0 0 00S000` @h TNP0@ 0R 000@(@Y&/,Cel<07@- R ,0,@P?@,0 Ѝ0Y&xP,@Bd,@-P M# @0.S y00S Ѝ 0S0 0 00S000 @h 8TP0@ 0R 000@(@꒩Y&d,©eީ@-@P]P  @ Ѝ@-@PP  @ Ѝ0Sp@- Sp00S p@t 'l0p`tP p@$qpP@ 0 p@O,C,,P07@- S Sl0 Ѝ0XPX0@PP J<Z@ Ѝ0@A<00 0e Y&Y&aP/L0@-@0S 00(0 $ @, P,,pP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P; Ѝ04@P,0, 0 10 Y&Y&,Y&Č,r0/0{ꐌ,P/WP @P/Ap@-@PN=  !P0UxSJ}{0@0xv6tkrp@tY&P@--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @dP @S$,C^&jO-`-@MLP00P@*0 S  ?  000C/  0?ppT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ Ti,@M&DM&@-PM MP 0@ݍ Ѝ@` @;0Sp0 e| @ݍ ЍU \`; HPR0S(:@M&Ti,DM&rP@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000E&E&ӬP@-M 0   0x0s @ph P 0S>000H ;0Ѝ004@P w߬ݬH,D,ܬP @P/i 0 /O,P/00S<,0/@-@0SE8,0/@-,@0S0 0C00Ѝ0, 0/@-,@0S0 0100Ѝ,,90/400S/(00S/@-qp@ ,P,P@- 00@ ^S00S00 Ѝ0 Y&h@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S` 4Ѝ80D@00$0P0  QP,,|P0@-MO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  ꂨ,ޭ800S ,00S 0P//|,,,$0P/0 0 0C/ᄌ,0P,,A-PU  @Ѝ`p@㈀}P`V 00S0\V0S 0S@`W jP @`$V00L,@-0S08 04*P( Ѝ * P7,<@-Q00P 0R C Ѝ`@- |,P/0S/P 0  //ီoP@-/Ⴎ 0LP/ᐋ, 0@-L   Ѝ䐋,A-`@Pᢼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @@@Pp 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 7⍼79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PlX   00 p @ =RP    B  Xp00aK[0(!00CpS0 0U ?o200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0 fP.00S ꐋ,, P, @-@PM @PU`p0@ uUЍU  j  B U R{  0L"00CS0U0S U3/U@`y 0 LV00SYS_U 0 1  U# U U 0?o20 0?o2P0U U U W0 0S00P0S000 P W 0  0S00S000ESU U U I 0S0mPS000 00SH000V S(7Sg,np@-P`@000C S0 ` 0 B ^ ST00p pS 00 000S/P/Ḍ,,@-XP@PL0  0S0S  0  03/$@ٯHM&, 80S/S/ 0CS/$HM&O-@DQMp0S [; 0S 00 Ѝ`V$P  I 0P  AAQ-P $YQY0 0 p@@OoB0 0S `0 0S 0WppHM& @-%PP0tY&/@-0M@20S4凋P 2      I2 0S@ 10@@0Ѝ! 0R0< $0"1 S 10S 10S|1 \11S(  uI2 P!2 R@ z$10P!@0000 R  RJI 0000S@ T0 0S T`0 !PL 1 10S 1㗹0Ss 0#So @،,܌,,|,k,T,Y&D],Y&,@-܌,@- R+ Ѝ@-Po'7`@@@ᕹ 0`p]L Ѝ@-@7P t,G-` @$pP 0Ψ(S%0 è P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 HЍMb@B404@-@@T oHP0  Y&,g,@-@0@Y&0$R/ $嬾,p@-@8P 00R:0 @0 $pY&,,p0s@-@@d`D \0 Ѝp坾0U4@5PP<|,,g,@-@@PC- `?@P!M0`p0PƟ0 0 0 eT-00EPNH4ЍA-PX 0`p@ @ 0mi0 P dU-  D@C,4ЍO-0M` p! 00@C QaCQW@CACQ7@C@tT?0! `?0 !@P0PX ZЍO-PMpP 00@C QaCQW@CACQ7@C@tT ?0? pM ?0 ?@``PZ UЍO-PM`P 00@C QaCQW@CACQ7@C@tT? 0 0 `?0 0 @ppPY UЍA-0MP@PЍ%P p@0pnP$ cP& dP %PsP xP   ?@`0P`D@0 0 M`0P 0A-P@`p5<[ 0 $,@- R$00S20 P00S@Po p@-@ 4P0 4孻P}p@ V00S뼼h׼d0`l`P{밼H0@뤻80@0@S(0 p@ ,P,X,Y&X,xP,g,@- 00 Ѝ7@-@PP Ѝ0@(0  B0~ Ѝ0Y&p@-@PVP %@MP _800S00 QTӶp xP,g,@-@1P0pSQ l4000 @=U'Qٶ0 0 R 0?o2 `=P '2W Ѝ@IP 2`2꜌,(,O,@-@P 200o/O-|MpP `@< 1 Y0 \0ACX 00^YP P0@     0 W" !Q0S|Ѝ@0/0S00 0 0L P00CQS XH 0 R 1 @0^AA ꜌,/p p p D00/40@$0@0@ ,0P,800@- ,00^ʎ1C0@ @0P, ,@0@ 0 C\1/0@-LAC\@c00P, ,000@- $0@0P0CQ0 @0P, ,`0 0 P0H0@-0^@P C0/ ,0P,<001P/0 R2:/ , 0A0P,0Q@-@ q1!0sr X0L1!0sr $0A Q  ,0P,A-pP 0RX@` P0c00yvt 02C!A`Ѝ0P, , 0P0PP@/0P,0 :Q Q .Q 0?Q  \QQR/ R//A-`᥹@p0P; R0C @1@C" $00000,p@-@XPqp00T00S 00CSp@n@qpp0P,@- 0 A Ѝ@- : Ѝp@-@0PS b0C0Spt 23p0PjS BS bSp0mS tSpp0000kD,p@-h彴d0dP0`@S;Eⱴ ⮴4@N⩴b⥴p,,Y&C-$MU0`S@p`d$Ѝ:S/ %S .S 0 pU@0S0S ?S \S0S 00@ 0X 00~xX@KXBX] DX. @4LH,X؀PP6qp@40S(4 4P40S N30S qps P p P{i P3 qp }P' uP02~mM P3Xq 003BH@6Xg Q0R 0 Yqp 0 O|2MP0t2t"0 \ P B B? 8(qp20 PP01P 1011T1P1Kf. P \1C0  0R0:P0P P[ڹxy 0RQ x0 Ĺ 0R0:0P 극lSA Pb ] PPP$0[P,i,8i,P,j,P,",0P,O,lp0Y&H0@-@@00SOoBҼ(0(01x0 Č,,,Y&P,0lY& p@-PPp P$R@ @Tp `$@R@p\ @R @T @R \ p @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P -00@p@-P@T `0S` 0 p`ㆲ0@Ⴒ0000`S @@0@A-@QP` @$ @p0W0 S 0 R 0 0 ]PЍ .P 0`0T X0 @P -0T0 ᷶6-`꜌,(,A-p`@V  ` R P ( ^QPR(;P" ^ U!R ( ^ P0 0 Q P$^U $C 0SP` 0 00`Q!PQP "Q P \U!0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-oP/(,A-M8@0C0p`pGP4 ϦA XЍ0 H/o"^ R  ? 0Q 0( XϦ@@,O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C <P$Ѝ@(,0    /(,0A-@0S xPT(`V0(0l00Sdp@ i(`qp &Qt@00CSjg,(,\,0P,$1O-`wvB 1!0РS ЍO>00S 9PА@00CSD& ЍOѴU 0qp  L 0ZqpV Q "aP@ Ѝ83&\,03&g,0P,p@-P@T <0@@@ @p `++@(,@,p@-PH@U p@\Qp@(0?o2(0(,uh,p@-P@ӹ p0$ 0P !U@ph,O-M,0`70( @40ptD70<0<78 @$ 70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00$0 `000|60(0, rs  T0000S (0S0 00000S0S$Ѝ0H 0C000L0 " 00 000zy+  0Sqpqp0S`000 00S0 @ y40S PIUPe U 0A 2Pm40S 4L HE0|4Px4U 'VPR `400PP40S <400S0R0S P 4L0SPk`kL0PH p3PPU7  T  qp R#T0'L0`     h ` D0ND0P T 0P@TX\PA* ?* P ` @ PUaP 0 0`0hP0p`PL0 $P  000 00 L0`$00CS$0P20S r000 00 L0`p408 CPPI h0S8 Z5  `J!` 0C pQ0_00 p0S0' 0 aP0o 00 0S0<1YPPYPUp1) )0S0$0`P0S 0S < @B X0C  BS pa oZ0Yp0Pp0xP,0P,, ,,|,,,(,,,,,h,,8i,g,p@-P@з < 0 P !U0p P$@h,p@-P@ḷ T 0P 0 Up PS @P@h,p@-@`PV0000S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp p`,83&03&@,,(,p@-P`uU 0S0P@T0 P@|0 pP(@~0 00000@pp@(0P00(,g,@- 0PP(,O-P34Mأ@0 40`p 0P 0 X0S`p$$P4Ѝ0 $ $X0X8< rq ut00T00S04\0`ut 200@_$0ut  sy00 $0Y0$P @ut00V 0S 0$0(00X00$00 0 P#srJ RD R 0E0P 00@PP; 0  Aqp@PN ` p%ut \0@P$100@_V `p000/V0V`p ` p @ P0X0  8< Z000rq0S Z0 YP 0 *qp`p000 040*(,h,0@-MP @tu 10 }Ѝ0@-0 ( 00S@(,,h0p@-@mP HP0 pp000S(0SppE&(,,@-$@$0S000r @(,,,,O-0,M "0Qp 0SGyP pC 00#  `PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(00P2 X`@PE?qp@P[Y8@PutTXPJ1\R0 0#@p HBHb0 0 0(0m0S 0S >20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@P@P 0S 00SL YJhG qp QP 0S 00S3 (,u,`,̌,0P,,0@-w$ 00000S@\ |,،,0@-f$ 00000S@K |,،,ɪ@-鬯8R0 000O00S@4H |,،,@-@P <x0x0S5d2/P@+(%"H O, @ 1A-@TPP0  F뿮w;:۫0 @ P`p 0RW 0` ?00b<0 ,00SAE|, g,xP,0P,O,X,G-pl0P`  @ OP 0S 0S S耚,A-` pPD@΅>%0Up0P ᰮ/%p@-HP@T<0   p 0 x%v%t%Y&,O-AM,b M=pd%W A0 0{  PP l0S0000Aލ Ѝ0!S  ѯPA>004S S S ჩ0PS  00 QP4 p0S  HH P? 0 ^R0 P\ S$R0C 0M00`000 \P0C R  C0Y&,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c PU Y< 3T S9PA rPppĭ@ ᾭ @@; 0 $p'W $l R@ $T<"0S000✭P ;04P S@ w0 Pp 0S 1T SP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U00`0002ꀚ,Y&&|,T&0@-@ኮPხP ~P pyP `tP 7P7Y& @-@PDP P @|1O-M0S" @`0 ЍOh8Pp00 0 Ppxy@`Ѝ00S 000S  0P @`IN 0 00O0 K# I# 0Sꀚ,|,8,,\0@-PP R^0S @T 0 Bꀚ,Y&\0@-PP R^0S @T L0 Bꀚ,Y&0/ယ,0/ယ,00S H/ယ,@-3LP 7P6PK@-0茚,//@-L@M +0p PFS0PЍ茚,\ QR0* /QS QQ*/0000/@-@P "000000/0S 0C0//0@-  0#3@PP @0@0@-@ 0PSR? P  Q`  Ӱ_"` PЍpA-`pP@T@  G-P`"(F$,@p 2QP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00 a0C@`S0 PЍp  000@@0 0 0 0 0 0TA-^\^ ^Q[\9[^V ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00p0p@- P0@S S R 4!@D@QV p@蹖0 @ T&1C-Qp`p?Vh0@`P0Y 0 ,PA \Y R T R 0 0P@0   [R .0B0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@$0 R Ѝ蠬, ,0@-0M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00@4O-@T0tS bS rS aS @{S000pW G`p 0S0QU 0VP 0 0 PUP,b`PG ꐚ,X,MO-M n >4Mp0 PIW ܍4Ѝ000Q 00  R Q  R  R  R @    0S 00@0p00pS 0S @P#S ;S T00 P00@ w0P TP  0S @,SP0S 00@TP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q T ,M P <,0 \\^ 0 ^0\ APP00T0I S TP0S 00@ :0S00*13p e 0S 00@0S 00@00P0S 00@X0S  @P0S( X S 1@( RP0U0 pP  P\XX $S I0Px $^P I0~0 , 8 SR0 (  S듎700H00 PP R00C0 0C S000SW,, X`0PpL\RC [D Qx␸0S <,00S ,, E 7P00A S 0( [0^ 0   0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00AR0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y; E"40"S YK  0S 00@<,0 [  RR, S 8x R30S # 1p p  U@P IW[ 0SD @;S> BR0110P\SSpE ND  PP< , @P 0S 00@00 Hpc0 Hp Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 02 .p000 XH 0S p UJc  pYP9 )0     囱!$R1 ! 0>0$ (69 09909 00T&,,blY&Ew, ,,,w 1K1p&A-D`@@PU@Tp00S QX0T0QD0 0pS0(FaPꐚ,X, , ,,p@-P @kQ000P @pL[&@-@]Q   0@0L[&0p@-PPUph4@P 00CS0cp !cp0 c꘬,8A-lBp` R3 RQ R P$0SV0(  R R C4$0 P,ZbP0 P0!W3QP$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0Bc( T0R #R nR   RpG QT000(0V0(00P R R0   $Q T0P $w (0V0(0 00  T0(0V0(0꘬,8&)̬,.@-|@X0  0S 0S00CS0.cp XV0  蘬,G-`DMX0pS00S 0S a#3X 00X 90C\ `00d0弃XP 00CS0 bp X!X %pP0 W0 XPލP3 bp0S $w00X/P 0G/P =p4S f0q00p0p4S \2PP pbP '00\0'/P|p0`0d0S0000d00S 0@S0k F00P  +a0   0@ @a00S +/+ P0  a0+!0+JUcP50Jd0t!PQH1 P*/\ PP b83P\a ( p$ .\0p !. 0`PS(002PX1000*0\`0P l000S SP@  0 l C(00(01꘬,4&X,,^,&g&8--AMM@A> 0$ 010 @0 `Ȭ,,--M MA>$00q1( (  0ۍ ЍЍ/Ȭ,,@-@P`PP  0&p O0 & Ѝ,@-M Q qM`0S000@03 0@G0S B 0/` 0 0S S ` 0厙lH2@P *0 1 P3a0 z00ڍЍ ,,,TR@-P@  Px_ \0 P`p `P 40P S x _ Ѝ ,[uG-pA嘁0 0`PU , R:(,N00( &U# \U   0 R`Z &R\R`P , R:(,N00(P    "pr P qu PE ,  R:(,aN00(     0 ,T&A-@P p0R`*ANW0 0 n 0P P O-0x/xOM00lPЍ080L?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0 P0 R p>0R*ST>0@oP0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0S@=0@oP 0 -=0C>S00L0 R: L M` 0pK00c0800400S<x<8 00 `\4 00<0S  ^ +H0SP80S4PU 0`  ErP0800A E4 o0T P !0  004 0| 0ll  0L;W 8{40 08;0R0 <0p -0P 0S P 0( C-P2S 0 H˥:`0C0 0S0`V: $ 00@ \:@0S 8 0] H0 $P y0 H$0啥$ [0`V: $ ` 0 0C 0 P ^0`V:T  `0  [ p ޖ0P `V::00`(CE /0 aV : ` 0 0/0 SH88 00 0h4 00ז<0S  RPs,0800 0 P%80S!g4 00㱖<0S  ,80S04p  GJ`P <000F pp40<  0ᑖ<0S  V 0400<068 00 V4 00y<0S  L0 R: L K` 0p]00p[  R  Q 58 H4000  P 04`Z Z Z000 G 0X0 00 V~ Z0 0RP  d0 >0   PQC p0V `XOdH0p0<H<p(0000S \t4 00<0S  ]p P[ 80SX0sFD$D *p@0 ,_\Q0 0  0p V0`0  `=0P  0 RS0 0 p0V R`0 0 PP04 0)4 0P )P"0 000S 00P80S0s")p 4 0u)40P, n)P P RH0t0`<pL0p<80S4X ! 0`Rl0004 0V*0000p(pW10 (W0 \90H ! R 0( 0P pW*0$ ( 1 0X`xpH0`h0<H<h`x0h0E0| 0}->, ,<,,,,\,&T[&ht@,TR$, &t,<0 0R,,0Q 0{Q  ꐜ,\,p@-@P`Tp0wS {S sS 0p (P 0 H#[0`@p (P `G-`pIPNPU00[01 R  @᳏PVAGWp8!p!Q <0A\S00 0  Z0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: pP 000BS ,0p@-P@`T P P, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@ꌵ, -0@- MMP'@P X JZ 'p8BZ+ ' P'ۍЍ0H0  BR R R, /ᘟ&H&@00CS0 S0 / ,ꘟ&@-(A[0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@eꔶ,0-01S ^00So^ P0\ S0S Q0S R P0S0S0 00Q R   -,0@-  `Ğ\ @ T\    %R    蔶, -p@-TA0 5S <0S -0,!0<叡aP0U&!0! R8  (P |0  ,P s0  4PP p@$00\P P D W04 0QP$$"Sp -t ,,H&p@-@0`  (T  *t͓h pDdPPT p P000ST @ꘟ&H&,4@-@P ƖP;@P @0?SP@ yp Ѝ/㩠P@MP 0S SH8ꓡ0S00XLDQn@-c *'H&0@-@<TQ T0B0 v*0001S R0Sd0d@tTPT T@0$D@ ,Y*T ,  $@P*ꔶ,H& -/9@- B*B'H&7@-@P/  >0S 0@T !00 Ѝ00"S sr@-@ P  p WЍFA-<0``@c# ^p "RG ^<0c#N 2 Rh[&0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,0P01p--01//00/00/00/00/00/ 0  /(-B 0  /(-H00/L00/T00/]00/f00/l00/{@-@XT -00/@-@J|- 0  /T-L 0  /T-T 0  /T-]/00/00/00/~00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/H00/sO/gb@-0  0Ѝ@- @+@--r0$%@-R  +@--k @-0y-|- @-|-(0(%@-R |-  @-  @-0Q -T - M@-S- @-R - (0(%@-R yT - < @-p4-< @-g1- < C@-^T-< @-V3-  @-M3-  q@-D\- e@-<- e@-4- e@-,- @-$4-  @-z-  @-2- @- 0-- @-4- @-1-  C@-T- @-- 0$S00 @-- @-@DℙP d 048 0@- 0|1-p@- @-L@-Z@-$0 @- -@-2@-R@-G@-@-cp@- PXAN @4DPSEJHp E_ _r@- TTP0P@4SD/- D~_  z_-|-r@- TTP0P@4SD Da_  ]_n -T -r@- TTP0P@4SD   DD_  @_--r@@@-CP0 d 0 4y--8@@@-,P0 dm 0 4Q -o -8@@@-P0 dV 0j 4--8@-$@P ~-A-\`)qW Lv5@P |Aj0 "-N00/00/00//A-`0P00 #1@S02 1(Sp0%0fqu10#1Ux  Ua wRbGW80S  3/1SAu0@q( S,F`N p~1O-0Q@MJPPPP%Pp 2 0  0a 0 p`V F  9qV 0S01 p\w! 0S`@`F|R@!ġ0C!\5\6\00 Q0S3 10 \(0` 00L1 S1S 0 p! J10 C৕ЍO S B/(B(!  20 S 20 0 p@-@` P  0p@FF0@-@Q10%R   @  M 峕P \03S l{ d` \ \ T0 T - R - S-Q -4 o -n - 0@-@Q50%R   @  oP x03S 7 xt p pl lh00S  0 |- |-y-4 --2--0@-@ Q80 S00 @L  C   P `03S  xt p pl lh00S  - - T-1- 4--4 --2--0p@-PQ+0%R   p@  x/ @h̔P 3S/ @< ,A. p -r4 T0Q@ @8 84 C, ,( (/z- 4- T-1- 4-\0QH H@0 4 4000S  /-(-2--H0Q4 4, C$ $ /-T-1- 4-`0QL LhD D@ @< C4 40 0/-\-3- T-1- 4-H0Q4 4B, C$ $ /3- T-1- 4-Q Q Q/ &  z- 4- -iQ Q Q/   -\--r///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ 0@-@@茽,0@-@@茽,0S00/ C@-T- C@-T- C@-T- @-z1-  @-q1-  @-h1-  @-_4- @-V4- @-M4- @-D2- @-;2-@-|.0-@-t.0- @-"z-  @-4-  e@-- q@-\-+@--rA-T`)qW D61@P |A*0 -NA-@PP 0S a`W/P .`1S0rOP D/P 0p RB .`@-@PF P y j0 0]~i000A-@`\@*T<0p " RG\<0c#N 2 Rh[& @-@Q@-@R@-@S@-H&p@-@0S*TDP) ]_.P ] ю#MNk|P s sD@ P < 0@ S< 00ppp,-h[&O-,M@0P0 T; R0AT 011!0 S01  R 0 1AP5_P ~,0S  R3/00S 3/[1P PP Q0P 0 0S^:` p` 00 1`@S0` $0kp$0P$0P``Pp1U00$0PeUP0S$008C80ᨹ B@S SBڰDP@_@8C80$S@ Sc_ 1  p$P  `0p B BR V` Z `1Z0Z>_ 00000 0 "P P qV`y 0CÐ   S CUPPEPE_P 0 wP  _ 0 0 0P@BP Kj1  0 w } Q l7w3XXW`-YPP000;Nᾅ!?@  S0010 S4SQ 1S b !ġ1S 0C" !8C8R11$PUegqphq0 RwP u)}~wlb `P 0PSY 2D p5j0 j ɏD<X P ,500xP0 qP- >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`^|k1SR !0C B/?!1TD]1NSAPN0 P ^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0PWvP tpP1aC P vU{1S'ʰ1 C P vF{P 00P1 RE40S 3/f PPP f P,ЍPR0v X] 0SpW 0j 3/pd P 0`C P Av f `{f00x00AJ!0 b02P J00P000azf ,H&e-T&-SP&R 001/,P0 R0//,O-PP$p`*@ [ ! % 0P@ Ѝ000 1\$<0P0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @,P/D0 R/0@-A1 P e< @Ց,O-0dBp W`H5h0 00p0Z Ѝ0P@P 0S 00@ ['0 0 &oP  ?X0S  9X000 00 `[0S  oP  %X000 [0S nP  X X0 00U P0IS0SPPn0 00n0S nt ?C S WPU  Kk0Y!0C0S( 23PP PEW ,T&VUUU @O-$MH0[S0P 0L`Dp? F0Y0 0S 0g e}g뤣`Pnn n 0@@0@0000. 0ESET0D0T00Ө?0S0 CR C0D S0  06hknX 2 g 0  BbU P0{ P>  PN P P!VUA`E D x@DP`4g g g@`"PD P AP;  KR !   ` D0w0@0!P1 `V0p00@  d`[y`F`FV0p00@  DPEw@DU`E¨` Y @ |B@T`— R   BV00000S 000 0 0|$ЍO0Y S  ,14,/T&H&A-`PlPp `m@m@0T `P@ P P0000 ,@-@Pp 090T0* p@Ѝp0 00t` 0 0 @&w@t 4<P b r& ,6h0p@-P@XP0Ps H` R :KP 0S@@Q@pur& ,@-@@0000 ,0 k ,0!k ,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@>@-@>@-pMP@`,0 0( 00 0`Ѝ@- ЍAO-M P`@pl@lUjT0 0`P0 JD0SPY 0SV L00SRDPPL00PT^y@DO@W ;p nPSWpV`KЦo`0 S`K0 q@PE0@ ;PT0 0PS00L00D H0T ?Z  tr b5wbbЍD 00R00S 0S ᝉL0X3#PpwqP 0 Dr똰8FEdd ?0 EGOq``PFE`dd ,B-@-,, ($ *ЍA@-`$0P@ 0  00 0`Ѝp@- ЍA@-pMP@`,0 0x( 00 0`Ѝ@- ЍA-@-00a  >Ѝ Ѝ/Ap@-Pk@kp ,@-T7@- !@BA$XPU % >FG00h@PU %T .6G00000S$$0 Ѝ0,-LH QH -cH 0,H&zH O-CMP@(`0P@0@ R&  @ҥ"PP BPFCߍPpW ኈ @ [kpPY Z  ` 婥 @ =R@<ᠥ8@ p yJ J J H&J H K 1@-lC-0MM 0p@e{`P0 {PP* P kP 0S0 0 T   FPP᫉P 0 Q00#0PxۍЍ00P 0 D40 0>4K K ,00S/ 0P I@-S--X@-BP P <y@(!Pq@LH K C-@M S@،00y$P,  ̌0S#{P  d0Sl Y0] #)PeA@PaCR'C=*A^&'ЍP@R=v~P'P'20S @`P'.@p0 $!P]=L~ $ X{$P 0)AT P[P @P pPP 0A+Q !S0p 7'SpT+ApW38pp0W3:X# @PQ  R@4Q p0Q  R@~@P`Vp003/P,00  h0S  R l 410!8jp--t-O @-MM+@(4x+(wB+(+xB+w(?PލЍB?P `0 @@@@@ @@@@,&B(}>O O O -MM+ wP+ w+ w+0w k?P  _>ۍЍO O 0@-M ⁋1@@@ #P @  P A0$*!PRU)QXb&Ѝ0RL00S 3/P 0$003/0$)*L<@P3P/[P+W@P'.@P# 0P| O,<|  0S 0_ Z'P @P4o0m%(*00--bO O --@-M 0@@@>#P* :@  ;P 00*!R00$Q )k@P  }0S 0` <'Pp%]()Ѝ--O-`M  0 0X#*0S ` 0 SS 0塅p0 S00C `@ᒅ0S :PP @B pQ %S0S iSc %S, dS 0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@ j T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^0  3/PW Ѝ 0 7vT&7@- @PU  3 |*C00 Ѝ0l,P X! H  |$ 0[%-O P "P -P FP p@-@Q`T80800P0S0S   0p@z6-,-WP 7@- @PU  |B00 Ѝ0PP x |`00S `H EB0[ꟊW( $,-^P pP P |-P P H&s@-`4Q@A:jW{ K`dz`dv @`d6d`6zf 0Ak@Pxxrc5벀P @f@B_E_ zЍp謭-P P H&P O--}Mp@` ~~0 p  V5 <0S  5P R )0S  뀵P {pP {npPU Pg 4cHS0B? 0L+P  APP  A00PP: @  \: :0S :P :$4 j3 %z4$"0}ߍ3r]U33 420"!03140`040&2ɋ 0ɋ 4T0 T  (0 P,00  ಟ>"!!0@#   PN  XT $ t8l2P t:t @*0S$@0  U0 @"QS   1P z2 U0W$2s1@T  @>0XCe 0@0S@ @  0R0SQ z0S  2 0 P[^ yt0  PS $2{&-ptbtQ f@,--Q #Q 2Q 6Q 9Q 2-P Q NQ -Q XQ |Q Q Q 0@-0,M 000000 00P0 00h0 PPP@P DD儱@0Q ,~o,Ѝ0@)s {&H&Q ,- -O-iMs?!0=ZJP 00iߍOЍ/\AxZ`PD1P 0 :A&`P z[p `P@' [PpT00Z&$@U0P 0 " 0GSW 010#S 00PpP@ P'Q ,--O-0MT@pX   p$p{ `V   @Q'U` wPPtPp@P >븤H E0mPU m0'SP0U*S / ឆP00 _tX/0 0P A0@ 0 0H0 jyPX1Z  q`p`PUQhS(  2S022SP0220C2  S xS`` 5w$00 0( 0 0`,VPMUSSS PPV  H  0%S @S B B* 0.S 0 0JP1Zp@P] 0A0 D 0Ϟ R68gdTw00 (o@0 0 (gP+cq+c0S  \V0A X0E?o20S `o\`$l\aqcewV @ x 60S. c@sU\Qw00CS0000?R0S Y$0S  `_6Tf4wWU `0\`X L*\%wjG0ЍO Ѝ/Q R !R 2R ht@-&+R 4R 0@-CMl,PP 0S .Qv@P8 |qCߍ0 Puq 4,3,G-p 堀PB`A@T:00Y W ,/Y 000 uvP EQ 04@T&8R A-`Pp  p@ ؄4 p+q = P @2,A-Po@t pq0S DQ0Q.SP @$ $p p4,?R 3,p@-M8 8PLP   p 8PLP  p  p@ ( u p  Pi U 't@tP ` p 00 '@PЍp vp rpP!i2,%iP,2,8i(d,AR O-MNQ >M␮||卮~ ێ,Pz`0尪S  W:-8 4e0w=C $ C/w ]H00w=0pQ>e0 NpP400~0 W40P  U Ur0YR?; 0/3qp @*<: R0 :P'P P 0X60,0:WP<GI.̟ 0  0/P `h< 0 B0u`````V4Pp0ۮ0tl= -D0+lq0U,ݍ<Ѝ>0a Xo `P  P; `{ 1sS1lS@+2 0P%QPL NZP<;`Pp},o*0x*0wnP\8 0\8VW*0yU *0z*0}\8t*0|y\:U :L*P0Q8 8* Q9ʟP \ʟW^9    +9 @H- A)( 0p HA0@pp p=Sr9<)a0hh FP 0H0H0A (pp , AHY`P( 0Vi uPSUp`jvF ᝂ! J♂H p0n`0<X(0~Gd@~P T,~P @~P ~P }JA~P ~P ~Pg0:4LP '0\6S '0* `P 4|| ph,'[7S0 ';x& P`6 A` Ay0\8eP P &6 jP `(b:4S (6 YP 0: APڴ  VF\8&08\8n襟`Pڀ ,n  Ms%8P00Pڀ( n  ;st%8P0040S\80\8Pڀ n 0S %8Pڀ| m r dsP000S\80\8 )P0S\80\8`:%4S4Pp 0@?S` @PL 3m 0{C:$P0R#R#t$ßRp#lW%R2L# M % 0S2  P 2@T |ᔫxP HMHK* G00S |"d~0S p"wt8tk:3S6 U] "R?0⸂0N?C0C `. `0  0F0`_fxP:A?FWێ80I,0`I7>E00x 0,?P"H pV0S {WW5S '!#korXvsX60S`0 <IpW4 ߍX X X X A-BM`x@^|pPP3Sp (pE < X8000 0 ` 2PBߍX X 0-4- |-@-@ @-@-0  0W P @0@ 18 0/P  Ѝ0-( 2-- Y @-@0XPK0  0@0 P |0| x0x`E1p@P/Q  0 P 1 /R@ @0(Ѝp4,0-8 -Y 2-0-t-@-M@DVVP{P  k k0 D 00Sލ`0` `PP0  0@ w00 rT-$S 0-1-t-4-z-Y X-DY C-CMbX6S P \8BPBvt2tB0S 1\6S T1P2P"@ 18PP 61,B0  NK:4S / "C@\@gU 10 5:4!SU *00 0 B*'qgGA1@@P+ 1 aGAcGaGA0S $!(!0S   7 ?P\6S @#U 7qCߍ 0t Bd@ 4,HY -XW CS 2,cY 0,hY S tY D,Y Y 3,2,Y ,Z 8Z Y Z @- @T^ S C @TR 0\0S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-PhM`p 0S%hЍ0 L03/@P 0 @P  Q 1/P @ @@08℠0:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T x pzP00 0S 0S0S$ЍP P00 S yS, R ,0S R : 8 80R:P3#///A-@MM`Jp" *0P pV Xd5\\ SS=S 8 d3R 40 $0 ڍЍTT@[ T[ A-`QM p@ 3P PP PЍyPTP t0u@$PU@@T @D oTH0 @c Pb[ p[ t[ [ 0G-Pp0 '"M@poPP +А`0 R PЍ 0L03/P  0w놁0 wD @(T$0S P @h @h`-[ p@-P`o00S@ 0p@)[ 0A-!qP0ML0` 3/P< 0t@T 4/@00 Dw 0@P>w 0$0S  h$0 hT ` h }hPw0S0C,a$ 8)Ѝ-[ [ [ [ [ 0S/p@-@PI 0000p@AO-p|M@P Y0P,0+`,P|Ѝ ` 0S0 !X V 0S0H L03/P X0p``P , 10000U00 0P100 0<0008 0pP ,0<<0@Dx@0S P 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0 0 0ا  @-Y P 0P 0Pp PQ` QXPQH "P <0P/(/$/ /@[ [ [ [ p@-Q4@P0@@DPp 0Pp@|&p@-P@P  g bg00pp\\ @- T|&@-x `|&G-@MPP N/{ qg0 0 0S1 0S XP a,P ލC|0S ?|0S1S P awP @l0 1h0$1d0(1`0,1>1S nP >H%0>`@$Ԡp+ <ep9     +: $0{Y 4p < 0S 3Sj jdt z z008?` `p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`0F'Sn`0pF'S``Vn`0F(P~ 0C QY > 00B,0 c!4 㐀@<#0 p^IZP\TP fOP ,04!k`~ <#``uL2P  @000@A$"0p?0N?P0S J`  y yKR y00`K?(081l1$1~0 1\00 @a+K "`P tP% ptP tP tP tP ~tP V`0C !d  d` (exP] #] %] (] - -8] <] [ >] 00A-p$0p@` P"AP0 >@ p C 01/@P00pЍpP@00003/003/$AmU] O-UM M`Mx.0Pew.w QiX@,:FniD#U[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7\4 04@0Pύ✗֯N#` 54, Q~W <S T7h4F>D0C247\41 [ V?h4F>D0C26A\4 040 000000000 00p@ }0 p0< 5 5s 1yt0 00 0000 0 0p@ 0< 5 5s qଔT1 @t00, n.E "9c5@0\qW 42XL1`⺀0Nόpjppr຀q ph \ $t00? 000/0,0S00Ӥ?'N?,$"@p0 ,0mS` Ed40S N?,$"h4@PUX4LT0}10  A b "b b,1,1 101$10!4141(8H!L1 1$!0L1H!,@6|$ 1(1)\,, 1010$1441>(8A $$ŸP   ^{Xy! H#0$100$4;P x2P >{\ {]$10M0$10GP0 0 0:^0H55S Pf $003/$pVrPM pQE! >,!  5$H0@;S 1 HPhP> W;<S: $10>C418<100S. @_ 0bWQ!!10'b/u0,1014181>C0(1}1S0}1$1S p E@--&< Z[ h|&- -P--\ ,-] _PP$030/0@o//BO- MPM@AT0*!Rp0)A`T0 $0   P V Pp ,3*'0x$0 |`$]?(pP H4\,' ܍Ѝ4p d0Spp0 P0 4p0SW00l , Ri  000;x8,9/PV0  ,x8;;/0  ,x8;9/T0S8S "0CS0S "S S/ Pp  R <$pWP00P0)|2YP0 T P' 'pP 0s W&P }d0S "88 ┍O@d0S !8\0 @S !8`0S !8X0St! p!S0 80` DhL0@ O@\0S ` R !8A8 QD@D~K@x@DD@Dq@=D@DjX0S0A3@`^pQWppc  ^-l^ p[ fv^ #] ^  $[ 3_ -^ ^ ^ ^ ^ ] ] ^ ^ ^ ^ 0^ _ _ ] \^ O-MuM0*QU$e Uh&&p@5& O Z -&060 4T Q :ލЍ2 )qW nP7 FP' P  @ hP' @H0 pX p40"p40 P] P yU Z@D`@ 5 p PkU   c0SIS  : 0S #S 0P00P F0`P14s10d#5:`#`S /%5%;%0@`S D% % ,tfspp`0 0 ,0S T0 S00 P0p0SS40 0  0.xP;85/>P0400S8RT0RP S@" SA00 80zo80PP QL ,0@8aa<th\<0 !L! 080$ 0t40 ( ` 3 S/  S" _ I_ N_ V_ ]_ f_ m_ y_ _ ` @_ $^ p[ A_ p` ` ` ` >^ O-BM@MT) Pp ` I@PpTp$;IPpppPP@BލЍ  oD@M0j@0 cM>0 $04@(8 YM>0@0P@0T@D0< IP t I@\ 0A00@30! 8@4qI( A.003000S0ؒ; [I{P RI^ 2] =b 0b m۶`b -_ -[ ^ p[ \ b_ @-0`M2 pR !,^RЍ04P0 @ PP@4 xp8;7/P  yPB,,(0@- @"!P(@,@-$@2S ^02,O- S@P@J^`P@   FPP@ k0Ec#ะ@pPU* ЍI NP  NP JI@    R0S pT&2] @-@00 AP Q P 0 ?`Ѝ O-JMM ؒPp`up GqpP)NU\baG8PgPXa EGIXK  lP 0000 !200P T"XT1P T2X"TPZNT"R0 0XPY 0G,0;1 010100 0A000P00 xPPPP,P0S9 0S)XJݍЍQUP0 X$1QQP SU T"P 0 003/PT2X"S 0S(0S 0SX(0S003/PT2X"SP - ( }& 0S/p@-@P`!a(0S  R 0Q003/@Qp@z@-@4M`pP0S4Ѝ0 0L03/P 00@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0A. PPxP;5/P A> ob 0@o/b 0!!/,10/kp@-@4P0 `[1111p,O-P䐟䠟䰟@p`0/ C !  !0  Po00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 Ѝ, 0@-MP@/.n1, 00 0d000 0X0@@@@@10 00@0 ,Pcߍ0 ,O-P4Mp@` 0SpLP `Ppp 0S00V0#S 4Ѝ0L0 3/`P0 L03/P)  0Q R  Z0 0P  P  H  , R  T  X $ \ ( ` `, 4@8pTd pA- 0R0 DQHa@ 1QRpB   !LAPAP0` A#0Q     TTAU @@, d d O-pLBMXQU<2PX\1S2\U \QUЍ0C`1`1S \`h001PS \1 X5X1! 0`1Vle.X`00 T1] "X m\P6 \ ! m000: S.X1 2 \1`00X1``P 0 S 0.S Yhp ` XXPUY SX1, 2 $ eY, ~& L ` X d p@-MM`cPHoۍЍpP@P+Y P*p+Y P*+Y P*'P+ ⴶP"d d $d p@-&M@(G,01K<0P@T 6Y Ѝ,Lg ~&@-@<#@-0 0 Ѝ@-0 0 Ѝ0@-@M&0"0 000 00vЍp@-P<@0/SpQ 8dPp@$~&@-0 P 0-4-C-$M@`pPG0 ( @P) 0 PP0P00Px0 @`PP0L`ySa00ͅ0݅000͕0ͅ$Ѝ[g Yg d g (--X-2-|g Vg O-`-,MSb$u@uX[ pPe $XePd@T10S@ L2bPPEUN TT0 (Gf$0P0  @@$0VSS00Y00S b P E H $X0 0$0   0 $ VRR   P # 2R @D @g0@Qa `P$ fX@,Ѝg  G-p`w@PPU  hPP 7/G11PpO-@ M$7X`P Ѝp0P 0`0VSS TP$X-@-0 0Ѝ Ѝ/\ -@-0 0Ѝ Ѝ/\ C-`PM M@d'P @@ELCp@ F=43V0 V]DADVci & 0So 0CS+PCS0 ) 0 0S8 0S r0S 0S QN@xAP$ `0 =P0 @o@2P 0,b0C?o2 7姟00H(0Sލ Ѝ! 7qS obP5S/G B !F? NF@o@1P0  0L o 'x 0S 0S| q0Sx 0Su QN@P 0 #=0 @P_F? Q.  Q<FNn\h jh oqyh Lh --\-h e h , ~&m&d |h d z-4-h h h -MM P  KP ۍЍh -MM P  6P ۍЍ i @-kP( `gP! % ` 0 S0\P @00LP J@T TЍpd i #i |0|+R/@- h@|+\0 P0D080",0& 0,j #i p@-Ph`@TUdpUP`P  p܅& j G-MM@p`ppT DE{D2PCP P1P  /PڍЍ D({P D {P3P x`P 2PftPP00[ 00 oz\ U^P 0=Sp  C ိP64W  P P P`lP X PPe j 3k k k 20p@-4 P@a 0Pp@@-G-@Pp4 a0pS R p2"4p0QSP pP`p 0S!40Sp  a`/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PaP  p@\@-@ (@A-P@p`p0S 0pp RA05#Ph00200#X0S*0Q #"0hPhp P#"4`V000S 3/0Q #"04P4C- 4p Ѝ`6AP3p⻯ 9 ᬯ# 0y /*s 0ᬦpkW@Z d@^T T \PMP `P ޯ@k k }Dd Jl p@-MMP`;  p  @p aPVaPۍЍpNp@-@P F``L P  0Qp2P p|d zd@@-M MPp; P` p  @0PEQPUXaPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP!`00/00/4\80S0 S001/\80S 0@- ``@0"SR0(SS QU S!0$0S\  0m 1Sp@- l@$\ P0"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/,H0 , 4 T 8 X m 40S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4 BRp01 408 00803/P,000403/,H0 , 4 T 8 X m 000/0O-p4M@ PPp`314ЍO$0 L03/P% Ѐ 0\ p* @D Z["H* 0*P T P , [p _8``pp 0S0P 004Ѝ0$-O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R?!S,0S 0S00 0S  p!"00 0  SPH P00P00 0 K`03/P L Q Q  Q R S, X d1  d . | _ 0O-Mc(0<00PSp@lp`00 # 80s 3 0Xh0@l0S@3 `R` 0@  "<0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 XHL0 48 X00(,(, 00 0XP23U 40p0P<0SPP0 M T00SI0Sj00q p0 0 0 000000  \0 0 00000PX 00808/iX0 PpQXQ Q(00,0 0p4 80D \`\p a X0S l^ 0$0p0 0(00,0  04 804p! 90X,-=n \,gn 0 H0L0 H0L0 H0L0 H0L0 H0L0 tH0L0  \H0L0@ DH0L0E ,hЍG!耟SH0000 #0PpG0  d :/0 00(00X,, d1 X _ ,Ѝ$n p /  O-P(AM@0pP U !b p<#`0!(<#@ {U`P $P E00 P P E000PZ!@ 0 A@BA  |!@Pt00C  L!0-  (!0 D`pUTP@!@3@OT`0 -@DPNY @0  -U!ʨ@   P.㨰嬠P00 @p ` Dw/Aߍ!00PRPV Ѝ<0X ∑0L0 3/ 00X0000t0000`0 01P0100Aw! B B 0">10CP@C qO-OM@P H(PWa1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@dşP @T00C0p0NC2 VH0 0$ 0RԴ V 08L0X T3/P10 00H03/ T 0 0000 3/P#&0 080tx 3/0Plp VX̍ 0 0|30x300 07000F00, T@2c 01 SH0 V p .4t`X0 PP00P0003/088q0X 0L03/l 0 , t T x X h H T 0T`X 006/P `0d Q 10  0!s"D  V p0 B=D!2 B"=1ᴡ0C100C0 cV `V`s`V T00 03/P0 0D 2#4`0Z5 P0a 0` 0d0 D p 00CA=D!2 B"7=10C10 0?o2100C0 !V $-o (p , p % t A-Pp`a!@0P  p0Q p=p U`P !@ B"< UT0 01`0(`10q0000ቿ< O-RUMP , X1! 3 #Q1 B2q Bq BQ B B  0VU븰0@` X@@p0 0,(00 @@@@@ p@@`P߿LUߍpv', 0v `∀p D  p 008*b0A-@0<0SH04 `pPPV09P?V090VP:0 A! 0S/ LP0 05/00P 8p<  @  0P4L p P $ Q:  BS:Aߍ L`0 (06/(0Pf 8< b @_0`4 V  V  R U  U  RE ,A0  ( _O( 0P XO ( p,$ ( ,0P 0 pP`p0  >O 0P@7Op`LP` Pp `P@0` O-0AM@-x-p O-`,M0@\0P3/0 X ĀX p ppP(W 0Y3 2Z  "00 "  !" 01 " X "  !"0  0" " "  !" 00CCW 0B o@S0E0 0`20\20X2 0J0000@0 P,<1@11((,Ѝpz'0 8 r P  ?Pp0PXH D00p 0P P`&0,00J0P9 @ p0 ZY00SYXP P00S`(Y0,(00V,000p 0i3/`< <,q@C - 5 u, p lp! 2 r\,Cq @-@P0OP/SP0S0Cq O-pMCP TtU`4{ 00 rs> ,b0  * 0 P  1@0 B )R R0PR Q0r Q0CFS0TR000US0a0Ѝ@0 pp 0PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V M @0P0 /S`Sp`` [XtT00U0,`0Hq ,pq ,tq ,C<0000D040 40PL$pUL0 R  H~j0 00H0 F0 HL0S ApMP 0S80Q00`Q0S 0 L0aA3/P 0P0P 0%003/X`\0F0 [8#p@P0?KUP 0 [0 0 Z0R0 P <0 S@00D00S8 P(' a`0" $0W$0,0, 0,0$0%$0匒 Xk( 0K0 p`(0  0K` 0R( F0K 0 H(p0`00d01` 0Dl0hm+X<+< Y*pV 0 LiU 00x0 Li0H LiH0*,0$ Q00Q03S (0A( 2PI6pp 0 P %B00P3/` 0X`APQ2VP04PLJ(H OލЍ 0 [0A 0 Z0= 0 [05-}q q q x-q q q q q q q q @-@! 0$   0 P 0"ġ0S 0$ O-Mp( ,P|@`1/0@T0P5@PZ@TP0 0J 0pJpW U T 0JY00 @$P $ W<000$08<8p, 0` S04 $i$a0LL0d00h04O0l0d g pW P d ^pQd XWJ 0 Ph 3$ 0X0 0p0p0 0\p@0800<00#pWP0, R)  Th0 0p@0T0 F0pTP0P TpKPPM $Ѝ L~0 PmhT0 0S! 0S4 `Q00Q0S 0 L0aA3/Pb  0开0S S 0%PTnp; 0U%PJ003/%B0K0 p01( 0R, Q ( , W (p,  R\ 0Wp(0S,0 0>9003/p 0Xpd0%WQXc.pE0 Z00 Dy+p IpW000 0Cpÿ D0IpWP0W000 000W 000$0=-q }q q x-q q q 0@-@M@0L0 3/P" ! !WQ 0 0 SS@Ѝp@-MMM`P; `@P mN : bMލЍp{dЀ@-@P HJP <JP ,Jor r r p@-08M@ ! 0`P 0 @@P8ЍpJPUJ0 00  0 tP@o`1C-M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPPp@G 0S0 L03/P ,0X0uP 0  H x;8/P H{@-,@-0 P r -@-0 /PR ЍP/R0 R/R  0r r ,@-@@@-@@ r @-PKP@N@`P  @p0S  @T a㤽 T @LP 4 %N@ Ѝ,-r -s s H&@-@ @0s @-@P@@-M@  |9  v9< ~܍ s 0@-MP@~  e9x  _9 0TsP< ]ߍ0)s @-@_@XA-pPG`n@P P  *M$@0 !=PP ᭾Ѝ0$ D5s ,p@-@P4Sp@Tp$ "@Pp咾Dp,Ls G-px`DTP IPP@8 0 PP$0R04l,\s A-TP4SA p`4' 4 @08 8 D,p@-@4S04pTU TU Tp`04<0 60 4.,\s p@-@P 0p@7ns p@-@P @opqs    @- @- @-  0P/,0@-PM 0 xPPi 嗻 0PP @H_DdP0^P0Ѝ0@νs s s ,@-@A-aJ?pW;$AT"0 %PPЍ @> C 01/@P  0Q$AHL Q>0 R 0S |P P 0$003/$q-#0pQ@-sA? #"T R0//s@-(@T@ЍpHʻ0Pƻ0 w003/@P/@-tMa`P 1Q@ p@@(P  90@Tp@tЍT0 @T|0 Ch0h d py `P H 8ʻȵs 0-s s ,t t - t .t /@-@}@zs ///@-0@Q s㡻@o?0 \ 0P000@-4M@0  JP0PUF0U 000 0 0 04Ѝ0,//A-pP@`VT0S0S X-GPH0P$1UF0U00 0X0`p@ t ,0SR00/p@-@P]E<0<`P" 6D0# A@$!ͺp-x-A-`8P@FpP( 6 A,@-ѽkt @- p@-M  ]J0p $0S YZP`L@@PU 0 0  ܍pcT-yt t 1G-`1MP@1!Pt1t10pppl`PBL@fKD 0[㐺ߍ Ვ@P 2bD lF@P 0=SD ?A@0 9@LT@  TP t0 2=P P )<@ UA9:t t t t t t t ,-u u u 0u 1A-@1P`p1!PP0P0P`P`P0 D <4 pg,-9:=u 3u Uu hu 0p@-M002 0`0P 0@P @T 1T 1T1O/1 ,}P1O/1 Ѝpu ;R$0 @- P B茽,@-CMp P@UIP 1`0 0p0S1O/1 Cߍ5S t tPd`X 60S  S,1 1T -u S-$-u u M;崹Jp@-P@l91 1  p-1p@-P`CP@?0  p@cv p@-P@ᐹP $I11P N/ pov V1p@-@Px1(1 1P1 1 p~v V@-e@!ov C-aM@.pHTV PS2P3PG aߍP uP L"080E0"0|tP ",t2X , vC 0, nC KX1N?L0 !0,TP P|1|10 tAtaPpU U UP10$0PU@8!88A`,ppP0S S  @6H 0 0`P@AP0@9 ED"9   & 0F 0 0 p000  ѵ,@᯲c-5v v w ,-lw =7w 9:\&,-S-T -$---4v u KA-`$XRQq@P-@T M /GP( 0  :P 0 : P *D@ᔹoЍX0brL  0 P0w w ,-w x x >x ~x h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/%-O-$p6# S0 [; P`;#S0P;p0 d00`0\ h0X P$`P`t0(0 KH000 00 00p;(| @-`X0S0g'. Cj?\0@S0h - C`0S0i/ Cd0St0j!. 2Bh0ST0k}/ pP S 0&á Ѝz z z z { O-MpD001PUЍ䠟䰟`PE 0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0@0R0 0p1/P @&-(| A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-u"@p`P1S 3/`V@Td0@@ T0P0S@000S4000S(0000AI(~ &-&-(|  Ȝ p@-@4`4P0Sp@910S 3/@&-&-0 0#0/0@0/p@-@8Pq, 00080sp` ^/ 4R R0 0`40$ Rp `083/<0 0"0`P0000X0S 3/ 0P001S01 0S0P000 00//00/00/00/10/Q@-@@@ 0A0003/@P   @E~ C-`BEM0SP;0 p 90S90St 90S 90S@90S(90Skݮ90S00$ R!000 % % F   0 0  qd 00ťp`ԩ@?0t8@,7041 `$0`p4 @4d!0 p 40000 f0,0 2dw0$10 0$10\\0d00h0@ 0l0`p700S<p0  PÁh ,`3 000000 000 0  0,0pLp` <3d,0$ᑥl0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV $SP2Q aЍMP300SZ 3/@@OoBS O00&0 1@0@!Rl!@!x@|@pPpt@屡t0S|0X*@-P PQ 0!n@x 0T:x0S@ 巨t@OoB@|0xT:@-Y -p- $ Ra~ 08` p &- uA T ,- >O-S`4UM@48 ` [D K0P(0 EpP(w Uߍ:0P,0jk30 40S 0RD 80S:(1SK 1<00J ,HLAP4#0A4  H@L#; $3嬦㩦 0@0P P@T ( (0B2" ,0!P0S 3/P20 SU0%0c@D0`| p2Rv\1@<2U?0P00X N eH@`_(HD! @<#P`T@NP ` 0@ 000000 0040{ @ 0   0  00 ᳧040P1:> 4@0 000000 00000(0 Ⴃp` D^D0S, 5#7QZTX ၧ(},{v ᳣t&-&-a~ noG-JMM/0`@0nPP+!P& 0S" h"`0Ṿ!p/5P T` H 0@T* /R  )P6@Sm+! P:6?0 `HូP+0: S pW6>00ꨠ|! PJ>0@0/SrH!0o+ y! SP`+m! P* P 0/S`0oo`bS /p/0&000 SV|+! P*+! P*P/6@+6@`޺JލЍ    @-%*@-M @PЍ(0  㦺@P ᛺ P 곺0S:$c(#"c  8#8S G-`"PPp X`p'@PR Ѝ0S @x 0Pd0 MpL嗜 P Xp $0 @ԭ F    A-Mp `PXP HP4+ ⣻@P@ 0᧭@ ⋻⁻@P+J zJ.0㊭r+Jv xkJ.P0{LcP tPP|<Z, kPPso+JV KJ.0[PPc_+JF ; JB`3 DPPLH+、J. h#p0`!0J>P 0.'P UT ލP@[+J JPPpJ.@0+ P h J>PT  + 1 ; G  Ā Ȁ ؀ d& +Q V _ i /00/00/00/00/0@-4M@0#|0$P 0.P` ᓼP0T0670 P劣 P @4Ѝ0- x--O-MA Ad2,000PB,0 00000 80s0`0Q, p $  ?(0$0L 0s$00 0$l5l% T`@ @`夝@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0T2y@X"&(@嶺@@,0S:0审,"(0P⪺P@0@00 +0@080s=0 0@( 8Y !W|Ѝ#㈡!@&(₺00\1 0+`!00 XT噵@!0(Pj R P@ _!0 0 h0 @U 0400t0S00XTp00P0 =P@| 0(7@h3 @8q 3/P-Ձ ݁ g     0@-)@Mp0 p\*4 +@,P 0O*P %H- F 0. 0 BЍ0!0P80 S+P ,ΠP   x- 8 - A- @"(0Mq0( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FA(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0p 8 X  O-p4@`00Y)Z]p !!PV 0p  0 P 0/Q 0S  ;00,0 84p $0T0 0X05p0 P,[.[ P Q  08,0 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$P `-PP $0 Sz22@|x 1 0100 0A00000%@llp2x0SS(LPPL p0(P嚡!1PA0PA x 0R`( b ",0x  B +/ '/ 0 8媞Ph lw,0( 040x0?o21000Ѝ0DA-, u O-pᨑ娱,M@0S0 /00  倠0S,Ѝ/S  4/00P`p0U1(ȟ`P p㙑!PP PP%0(` 1`. .0400,00`T00 X08`,0100& +p0P _ܞ /P'f`-WO-\M@P4 p`儰|.0 SU 0 Q$0S   $ pPd9\ЍO*.P.  P%0#p#K*,9~`00000YF(0S` ` 0 RH03/0p``0[ 80s ȟ0 Q0 0 \0  BR0S0pS 0[p08 r  *   * PU0'0U " [P R 0S  0( PP p00 . P 0$ PU$0[00  [tp0 PU[n0[( -!P$: p00 00$0 0 $0 0pS 0pW L(pWZ 0 p 0P Z$0 0 S*0 0S  0,( 00#0 P4S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp  0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P [0 0 0 , R 0R  `xR  ()P` !)P 0 Q ``T R T  R X `( 0SY0( L03/P <00S D0SS000(( pAL0( 3/P 80<00S (0, S004 Q 0( `M0Q =0G0[^80s[ 0*0 PQ 0N[pq! 0 QQ 80s 0  00UPppy0  R 0S  0& @p0  0  .$-x -- Ӂ ΁ O-@-M`,p0 40PVZ ppPU Pp0Z:`PU`J6ERUB 03 D*00#h R 0  80s0`F`pHU p ,h0S 00  80spHY pPp +h0l0 0L03/, 00Y:pPpfp0,0P80d5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0&PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`pp'p < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0%`V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  % V00 400Pm۶$ ]$-! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe Λ000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$ $ W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`r 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S| P0 P  R0P0t000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0$0`0(0d0,0 0Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8嵚P  0$ $0S p 0p0 Spm`P 80  p0R:pYP Y:PpW 00U0#S p`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0h p`o!8p 40U 00 0S 0P*` p k(_80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPF 00 80sh p @(P=p@-@P(M(0S↘(`,`c000P0 F0 0PP` p P(吕P,(埙(P(Ѝp000d,ѕ(哙0,`(Pꬭ- R -O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1XS<1@1\1HL1X\1Pp(, !P#0%@ 0$'8 '0 0 W %&, 劗0冗80000,  0 0x0s80000  0'cΗ0d0H`H0P00T0(0P X0L 'W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00T0♔pp 85P,0qޔXpW* 0GS0.>( CP$ 00S H @3/4pGWp@ 0 L03/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0UQ  01/ 0S 2 ;CQ%$Є  0<P 0} Hp0  @D@儀 0X60X< Pl㯖,0Sy"pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000z-- p408x &- uA Ӂ @-} 0@Pp`4M#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80s#    ` 002'%  ؠ`0SQ,  R) 0 0#Q! Q0 2%<{# 8 0 r  1# 000 S   PA$ 1 SR8C801/-0! /-p@-@$P x1SP 003/p@褖x1硖P$ 0SO-KMM~p@㻞G<0`DPI;0S K2 @,0$,0 0 o=(0< 5#Pⴋ 娫 K@T80 00U 0 00000@0萍0 I@@@@0GpK܍ЍIጒ+R*o=(0<2#8 ;c&@@< u-O-M0M,0t1`l@0pP 0S (0 S> 9 HO$00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000p0 0p`ލЍGŎ2,0S*< !,00+C#X0S000C0C0000S0 0,0B$P-< u-@-@#0  !<$10(10,1P001.@-@#0 0! 0O-4M\`XThp(0P  啒"\ @,@;/,P R7P _PpK #p WpF2 # "0  00 0(0 0 0Z`8ᥑg(04ЍO/Pㇾ4Ѝ[;0p@-@Q*P当 0  P㶓40 Pp尓<0h p@NPT姓80 P@塓,0 P㛓00 p̅ '@ )J *+p@-PBM `@ቓ 2 V`P|0 Ps Bߍp`h00PSb0`]40Pp`W80S80P8 < X0S4!G@$C0  P;\0 `0S 1@ `*d0Ph0Sڴ !@l0Sڌ @p0SL  @T`t0P^҅ 9T :^ ;=j >?n x A| BCEp@-`M<P@   1U%PDPK0 @00S    8PU@ʒ 0 #P’0 a܍p(0Sx  ᵫ@h,0SP  ᫫@D00S4  ᡫ@$^߅  /T | 12x 3p@-0M01P@Q#ㅒ 0`N  W 0S (0Sp M  I,`VH ܍p4b 0`N l 4 0S (0S  *  &,`VPC$0 P: 0 P40 Pt.0 P`(0 PL"0 P 0      C-`RGM8 C"\0S0 `F`| 0p⇞ 0S - L ) `,p WV o$ g`> 㑹00"  `#ߍ@+ 0  0S  A `PV 1 `SN0  ` 0  0S @0S @ ߍC<0040!00@0Fo$ 0DL03/00 N0S !0ԩ{D` 0S  ,  8`Y40p x Q0X 8 < RFO    ᥩ 0 /@6@嚐 0  m R0_ 0〈    Æ ņ І ӆ Ն  ܆ ߆ & w . @-x @ +0 @0p0rd^@  @-@ @ 000(0,0000]dI@ kꐯ @-`dQKM0@sP!   0媍1!S=0ညKߍ0@ 00 @@0hP(@UTpp (`0 0  0`0`pOV?PR?P>@!^PP@HP@@P @00P@ꘈ&u - | O-`P8>P\@P`@d0?o2d0h@_`Pl@p00 S0p0t0?o2t0 0  F-GI| JKM18"@-@EM S500 P 000 "PP 0/S   !0ᐧ>@ 0/S0 0Eߍ1?o211St!Nl,!@< @P1?o211S 1?o2 1 1S 1SQIOUTpp `0 P0  0`0`p噏=P= 1S 1StPJO 1S 1SKO_ 1S 1S0PN 00 ! -!"| #%O-,MbPp@֏X  XZX2Y 0DPp @Pe@0 $,ЍPp1PeS` 1S !N Y!Ԧ@p@d΍ P0Ppƍ1PeS` 㿍01S  1SH!0ᰦ@p0@d 1S 1S$1 !ᠦ@p@d 1S 1S(1 ᐦ@p@d 1S 1S,1 ဦ@p|@d 1S 1S01L p@p@@d-Æ ( & L -S  | O-0`QWMdv01 @T&0P 0T&<N460S ((000S'6L@TP| }1AS 0S@  1P11$P |X003/$}1S}Ax0 00 x 01!+Q9  Q 4  0(%X0S/X&0 ΃}!΃L )!6<1,!X  X"0S0b㄁0b/ 0x0S 0XX00 P}!11VUj @<T0e"@T30S D 00D0C 000H30S >D00H0P3@L00P00 0000T0D030S D 00D0p@ 2b"`0""   X2}/ 0 S"0C 1šWߍ 0 p2 0@00 0)1S080.$0X80p$P! 0 SL0X 3/P h W pW 00%$1/pt0S _PWC0A00M  000 0" $!  8 0X L03/P ht0S 0_Sʚ  0 0" 0 0p@080 0S --X #-5-P- 8` PA-h | 5-- , = K 60S/O-@M MpUPm 00 x R p#`R0]Dad80  @Q D0 hP㔔 \ ㏔PF D%DG ,%A`V800(0S%Y$B000,0S$L$B#0000Sڠ$?$B0+ 0 p0B/MPX`᭠x 00 0; Q <0 Sn0y0!$#B0#0 0=,0Sn0y0#B0# 00;80S3 0u0C\#B0x 06#=<0X#Sn0y0#B( J 0 R #֣"B 0 R "ȣ"B0x 6#0= 0Sڨ"⸣d"Bx 00 0=$0Sh"⧣ "B~0 00=(0S0"☣!Bo0x 6#0=00S!∣!B_x 00 0=40Sڴ!w`!BN0 00=80S|!h$!B?0x 6#T0;!  X B/0B/00 i`VxX0 0  @8 PQ+< 0 \x S|0L@T܍ Ѝ#-5-w ؇    & - 4 ; B I P \ c j q x | C-0pP@,M0T㲴 0^ ^ 0S T 0@` P aV@,Ѝ@ - C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"T6- 30S/O-@SMP 0#00vt3⒣`PX3X@ sH3P  ls 3v B 000 mXjf00,pP0S* XZ'0 FPP Tq 0 x0F/0I1P/S L(-0(0 00^0SvU ( 0S `P/01 00!15:%  P p Q 0, ($! `$ ސP^0 0 8a4Q101T#-46- -` & ‰  0S@0@-S@00 0S/86-< 2 O-EM 2@PT P0 |2Pt |1S$ $P| 003/P 02P ( u Eߍ$0 R P 01/0P 003/P A10SX aPPE  <0 040000,00800 VpP@3@0S. $P+ 0 x0D 0-< 6- #- 46- - p6-C( A-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T @ T6 @pW3dpW0V82# @  R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0-6--p6-#-5-\0p@-T00P DPPp0AS@  1SAzP-- -0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"&-p0\ Q0/\P  ^U Q0000@-&-O-GMMz0l7d2@`(T H2 00V 0 000000P0@@@@ @E0嘁p@a(< (G܍Ѝ$1SpA08 L03/P `7Z Z ZT7S p$ 0ST7S8 P P PP C 01/P ,00 H$L Q>-80S  0 @-./P m G-`ᔐ唠@PX0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`8 @ T P $Q$00S U  0|1 08ЍpP bP P Q  c P N ᖮ P -A-M`}8 PU`ЍGP $A003/0 R   01/pP 003/@P$q0H03/0 plVEL2 `0803/PD@ 0!! p8#  0 3/P"0#"#0 03/p 0` L03/%⏭ p` 0SWp`@`C88 0U 60<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv ʿ  0|1 0>ꠌ P  -G-`RMXr@ TPPl P\` `TP P9 4 p 0S  vߍ<0H(00,0 00004008004004 04$0D0(0P dxW[  pUt p*h \n 8 `s <T 0"U $U U U 0,0U0  U `O ᗕp 0`?`a8SٺPb   00*P*00  0* 곌 d@edAʌ zd@e   . A V A-@Mp`;@ @ᄹp@ݍ P0@0@T00 ##  /O-4MFpT(t,$ X\p&`AT  0YY 0 0<R. R 0Xpp @P R$ P#2Q4ЍS< 00 Y+Q X( Q   0T pTp 0:pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0pWW  00 R R\p\ ؀0@-4MP!! 0 P P P@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-`@@

 R0 >t!֓000㛓#000X      ,( [: J|T  P ؀!\R 0 0 B@g 0St 0 0@ H0 0S4 4 0ꨍ  yd|dT& {dЀ J R [ 0$\ (00t S S  S00/Q 0P/0S 0S P//!R808 :C@- R )r0@/_  80R*@-0M@"P0 0! 0!  P0Ѝ/00S/ -ip@-@(P0S0S0< 4 p-@-@0S-A-@lP0ST 0S` @ <0P@`PV@-Ss@-@P ' dP E~Ѝp<P :~`P (PP )P` P P(  `P` D PdRPP 0SL` P `P @00@0ꋑ 0 p@-M   P ڔ{ @~P"` zЍpnR0S  (0q P{Pz‘ ؑ O-QMM@@P;.,@YpP}0` FLpw َ0p0p$@ @Q&D0S8 CR0 40 'P[0D04@T.4@0@T50@`T$00 0G p P P    00wP  p$ pp00#؀\z@0V  00#t #ف000G  j`#APQލЍ04 040RP8< 8<0RP`z00 S 00#㩁PDt P #㛁P@p Y Y#P厁P@k P #xP0'% D00S00 D  s0Sأ  0 0 0 `[@00t#Q@#000@10 < Dd@  . P j ג @-M0 0v 0@S( yP\xX x@088 P$0$  B@Ѝ s  @-v0SЍ@-M@ vT0  CR$00S ЍwA-@lP0ST 0S` @`PT\0(Ѝp!0SQP ؁1/T 00ꔷH O-DM  0000 00 0 zp 00 4`Ro04`800,00$ (0  fp ,08<\@?! ( _5#Z<P0$P00p/2#*_.08 RP0 \X  PTuU G" ?P1 0HL R0@ p ?  0 `/G$'@ T R@`000 00 0  p 0S #"01# 0?04 SQY H0V`00P0pYkXUDЍ-/C-`@4M0`} p\ X \^ PRPR VS  RQ \R   0   pЍO-x @-1` QPp@-@pP0S0ST 0DSTPS$D  p# @0p-6-08S^:/F-O-p@- @ 0(  P0R0PS 00Sk (ppM-NM`<Р@Pp p`0  p `000 ; PP@ pNލ蝀 객 ydG-xM` ✐堠@pXP" !0 @P 0S PU 0 R=H!H0 bB00S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZD   YZ  pP O-pBM M@P`/0;( P傥@0P0P0iP) Y $;$  `i P!14"S5 0Sto@ U01U01Bލ Ѝ ^i0P0  7i?XY$0 0I0, k?X Y 0oS 1 SR 1S  RS1S1S p2?R_0Q  @0 0@QD 0H 0LD0!1F41Q 04 8 <" 0P(똠@@Q Q' Q0PUTi 0"0S0S0@0iP P `@@=02s 2 02@F @DURX A- 0MHL`Pp l1lR/ fC;Pi@P( T00H 0R`0 !?020 2002p#04 pj0Ѝ 0S" $0Q00 L03/P Q H 0Q 0 SD S003/ꭜ >6-P/@-\ @  0 2BS20D0C@AuOvO0w.#8\0 A- P0\\@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P @jp`T8|BuP08} ^\ 0Sp`82S04@1111111110 8l2~`S@0 Pe{ P0c0@SP0 0HL R   ?  ?/Z[d0P @10`d ἐ 09/0P@\Ѝ -G-p0@PH8L041\`  S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/->00@-M 410@810!b0 P00 0Lub0 I0PU ! 5/FЍ0- @- OHx@ [w@-@c ]  0 {x۠ H&@-@@0sw,00p !b0Co&z--?$M0 0 w$Ѝ-4M0 00 000]P4ЍO-p-MM⼤E Tx " `Kx4 0 Pp0 PU00( 0R0PU00"R0*Pğ p$PD0S 0s 0SMߍ0S @P 0b3堓0S  1z#HS 06{0 A(QD# A0k{ {jodVd`0y33Q-AP AQڑ""A0  2k ByŸ 0 R#3SPhS0 10`0 P"k y0 $ P(0 0SZP=9 =:qk{1 AP09 A k Q 5 P;!%#3TQ0\ A  d 0! iJ/ y$10 @P0&0` dRP* 2"%+0!@U0 Ty@0Sd| Ly@t0 0 p uY@.Az-z-z-z-X z-z-] z-Qn W ƣ z-z-@~ 0P Pi0  AcH0 A k{I{7{ZU0P |  y`fp@<<P 0x@W/ x@-@u@SRG-@  700pP ą`P:X:00X 0xP @-Pp@`P0S -S :S S 000`  0 P00 ЍU0S T  XPT&p@-@P%up  `u@4uUz700@pp@-P 4`up@  tPu@p@-M@ `vp$ ЍG-`p@T2 P  WP0IPE NPP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ p@-P R`@0 @ u0 00S wUPE P3ЍpA-@Pp sp` j 0W0 xW0X U` 0X P 0 hD 0wЍU  0 P @-`0tM0FP?o2p @Opu gupJtu@tp X2SNup L0V"4 - }tЍuX"xtpp@-Pi@@eupbPpp0 p@-@ t0 S ! 0PUPUp@_0S   0 0S __0S   0 0S __A-pM@PU `0S@PE7  !0P00ۍX700#S @ Q@BPE@C000  pL0S 0#S @UX5 @-MP @  ksp8oۍP  ^ h1p@-0SM` LЍp@p@>  <P  0 !   sp0 S 09S C1Ѝp0 S   000 00P0 PS d0@ f p@#  Ѝp@ pr \p@-@$`P\Pp0 @ `P0 001 0pSp@-PxM@`  OAj0 0rp@) rp$  rp rp  rp  P H0   p(AxЍpt rդ \0 0 s@->@P`Dp @t0 p`$AT0 1p 80@  p$AЍph Xp@-@PqP  tr0}1LpP`qpR ar0"18pp@-pM0 p @G FrpEr@pЍO-QMMڄ700ۍЍ ,  Z w` @V q@pP` @-`R`00 Ѝ0Pp@ST\@PT  Q*R@00 S   0 0S0 S *\P `]] ( 00000 0` @@0P  \@-@@ L1p@-S@T1S"d1S,tRU6\RUp`bV7\]\bp1C}]L10CL1SPv]0P11Cp]T10CT1SXi]0X11Cc]d10Cd1Sh\]0h17x2,P0Cx2xbVtN]tb*`2,P0C`27@-@0 PP$ H1 0D1-0@80@ CB Ѝ0@j Ѝ0Q@-@  9 bqP p r00\!Ѝ@ Q @00 Q p-Ѝ@ Ѝ# Q@-@  0A  pP p D00 Ѝ@ 1S770|\qZP| 01 @00 pAЍ@ Ѝd t0@-M0@Q0$+p Ѝ  u 081/@-@d'P0S P 0800L0S SB@'껥 p@-\M@ Q t0 c op\Ѝå 0@-800@@~AfP@-@Qp ?X @3 ˥ Q7@-@  ,Aa _ B6pp L Pdp Ѝ0@ P 11P,|1@ R  |'_AQP x`00CS`0X t@T0 Y p ,A Ѝ0@ X0 X Ѝ0 &&p@-PDop4p@ @pp p@o  p@- 4P@  0F8 ,p@ ? p@-P8Q & ZP X  hT080P040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :0H@ PpP  Pp%pp@-8aC,t R P 0S \< 0S 08# ЍA Ѝ ۧ  4 j  0@-@x P $ LT@F L0p@-S`@P 08PU $00P  q 81 0800S>? $0080S  p, AU p p@I @-@@O-`-M@0YR@pPT.Ѝ P X  R$ R#W 080 C B#0  C0800 @@ (H@X 0 0 '|XUP0|$ 0|x0bb n A-`H@a0 CPPj p0 ,Up 0 `pЍP. P P0 P6 pP@ PTQ IE@O p(P  08*0 1 P #P @` )@GD!\10B0H1x-h 9@x Pʞ 0P x ̨ ܨ @-@  A@ ,bkp wHP<1 u,,hk0,1ЍPH0/d<1 P6B < Q/@-@ y 0S@qC-`@ x @Py00@ 0S  /0 Sx   0@ Ѝ<1 0 ` pPp @P M@00PEV @ x  PP 0S  $0$0> > R **/X  0S @0 S   000x1  @  0SP L 00 S   0<ꦩ ԩ A-M0 P0 0E0"@0Ekp00`+pj`p Quw07S 0 S X `f0E 0\!`1  `Px1 ,dލ % R Pp3 P0 S   x 0& pP 0 PPUVx}x 6 x |x1p  P  0S 0[$0 P ! c (Q@-@  p A@;+pU07S@ZN0 S J0VSF0S@x A-`R@M@p P?P U 070 0"@ЍAP"R 0S 0 r>XU%  *P 0S <0 *#h p  <0 &V>P  *@ЍA@Ѝ| ̪ O-@P$M `pP   P 00A $ЍOiPx P000 PmPPXRP \ PE  0PE 00X  JT) $U 00#3ZpPs 8118100x1`V+  hPx1`G 81181kP NP 6P4PUPpP xP 0: 0 0nP00P 0S 0 0`  rP XX p 000 0S 0 0`V81181$Ѝ  NP XX  ap0 00V0 0 0 :0F VYx1<1 :<1 0Px R @ [P V @(00 0Ȁ0  YB Y H0Ȁ0YB 7 X V xx@0P 0S PPVPPx0 v  0 @ I H&] н % @->@T( 4"4p P`0"@4"4 0}W SJL L0 b"!4b4# 0n@> *i>0@D Ѝ耼p1p@-SMP"!` +%@P T 0p1! V S E0S X.}QP <@tAtЍpp>0S 0x1@T l1S   @>0S@ `l1S   {0 @ "P 0 @  B00.$pl1S ) 2 | U @-PM@0) \.P@ P`pHa 0 # ^  @@@@@P@ A0\0  L00B#`^gpЍ\ @P^ @@@@@@P@ A0p@-@Pp0@0D0X0\0PP `S0 0P `S000r0p0P PS00840P PR08<0pp@-`h@dT@@@0St#PPST00pRP dh@pO-@RpD@T@P ЍP@`Vt#``2T00@lPP 0 @Q<84`B(` ``0`f@R/qA- 81`0SP@p000S= @T@T2 0 S   000S@0 @@00000pp10  0PppW 0 S   00000@@0aq0O@Ppq0@-P@M 00Ѝ00S @T00 0  ! 0 0! H0 @  @000`*fpR0000C0qp@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M@`#gp P 0t`p`F\ Ѝ0S *p0 0 0CR00B *S0C00ʚ;G-P $0@`pT 0 S0 R  S 4  0pT@QT 8@T 0 S <  00` pQ 400@4@!O@P0S 0S0 @@@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@,p0 000"#} ЍMb@B00@-\0Q@ PUPUR PU PTP4PP@PPS00@"!030@-@Pi`p ddP@P@-xRO@P epP@0 0  0  004  800< l0ep`pp0@- M0S 0      ЍM-04r@Mp0p0S r 0PRr00q0U0Sl7J 0R Q00 S 4  003/00<00P ЍЍ/-@-  ЍЍ/-@-  ( ЍЍ/0/& 0p/P&@-M MP@`@  0 0 0 $00` P 0,0@ 0$00b0S@PPU=V0P0\ЍU4700@` pR0 PU B0>00 0<04  ,>  PP> *ȴ @-@T>@Q/@-@T>@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0!00 0  0S80 00 Ѝ080 00S # P`p  P`k0P 0iS.S  P`[0S4 040:ST&0@-@PDM QP@T d00p@DЍ0U  P @0S@-`@MPpTЍ 0S P 0S0Qp   I=@P @- 000Q/Px1P/$0/@-M@    0 !bpЍ~iO-YM `F/@H9X0)JpPpYߍ0pgL 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 PAT1S@\1S`1 ڏP5\1 S S R@L1SP1 ɏP&L1SPC_oRPU@P04S 0s0P?AB@@$P00SLQU JPPdh1 ≏P Pd1UP H@ `  = 0[$0D  H4 `0 S 9X001H \0:ap X0 PB000S0 15S4 S  CR.T XX @@6S! y R02 > 0*81 000S p S 0 S D@@0?H0p 0P0H0}>H0 @0000LPPP  1 ib @ A-p M X`P00 @R  RT T 1 # 0@ @ QPUx!@Tt00 Ѝ R @a`_Ȁ- 5S @00 5A 0% 1@ A  + A+": A !9 R50,@-`p#@P@ Ѝ Ὕ0PXJJ pQ,="P PPꬶ @-`R$MpP 0S0U00$Ѝ/6@P 0 00 0  0S hU 7P!P0 T/00DU 7궶 Ƕ O-@`z0"Sp0W"SpG` Y PP u700 ЍTUYP T0000W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  7A0 `P0A\0SP0S   AT PT0Pꔵ T&P /0 S S /S/P0/S S S/0/O-M ~PPЍO=)`P ЍOzI@Y@S   pWlI~PP   aP Q0A00Ѝ=0@S. P( 0S ~@PfAI@]`@YVH0P 0 @ 0 0 @ @޶ p@-@ I`P 0SI$`P PP(0S $ I0(0$0p,` P,` PO-@/4M10CXP`pS00pHU- : `Pp$=P@  ؛P7 7  '$ !0P`0@T\0@T U0 @4 0H050U* H0tp>0P H0 F@PA t014ЍJFP 0 2Ap 0S *PH01@U  CUH070 0  p P! .R@ \ 0R77@0U   0pP  H RU H0@1S}@H000|U HP00r ,0 00 0 fL,0S< a J|U ,0!00 0 ^,0S L Ux <1F8xb0w4t0000 0 P'PP00 0 P p@ 0  @P 8 UJ <18xb0w4t00p00 0 PP00 0 P0@  H0:0H P 0<0UH# 0S /A`P /<`P00 V /0P0 Q00<0000H060U ,0 00 0 K,0HST  Ah 0A  ap$  P 4@AK0  U \U ,`P 0SU0 pH0 50hx0 50,0 % 00 0 `,00,Y`$ UPePUn700 50 $g 5'@ 0 ,  0 p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 J,0HS U H0P SPH0;00H090U `  k`,+pP .D`P 0%] CrFH0Q7;0UlQ P0l1 xP0l1 `P0l1 P pmE0Ptp1tH000UH10 2yPH0 2q PH 0 2i P PH [ H000UH020PU @ 0pP$` H0 S;70=H0208H0603H0;0.H080)UV <1$8xb0w4t00 0 P000 0 P0P@0PU2 <18x04gtr000 0 P00 0 PP00 0 Pp@0  @U =0PD 8 pPWH0p000S P0<00 P WH p P  PWHp  ` P L P 8 P $ PxWH`  BmzP  ($wp= 00w꠵ &? V s ҷ  6 = q Ը ݸ   $ , ; T p ù  2 ( O _ ƺ ,3p 00ypP0 $ ( H,8   P B( KP*WH B $p JpP ((_ (\ H$8X  P  B P  PW ,0 00 0D H,0HS J  PB /o"B ($P/H P0(0EP 7$ ! (0'0 ($P/H  P0(0'P 7$ ! (0 '0aU H0[X UAXUH020PH0 000J2dH000BH000=H0 008H0 003(07600 2R  *$450S00T01=5 =5H00UA <1(0@0P@47x0'tP -0SU( H$CyP$U 81 800  (0 00 0 G(0`S, P5`( "4`4# ,,0H0800 PP0 0 P 0 0QH010H010H000H050H050H000H,';,UH090AK3O\ 00` U0 YtAKοOAK OAKҿO"U \0@T$(@ p`P  ,00OG,0S \dPPl  Q:`P00pP {  ,0{0{{.G,XLDsP>P/`Pp =yPpp"4DPp&P`Px $&DPzP `P DP vP`P  DPF|P`P CPpQ CPyJ CP9|   @28|?o2= VO 20Sb YP0, ]PP~ZBCPqP`PDCPr CP p0S TP00CPs (CP .CPp 3CPp :CPp ~CP p 0wCP@p 0 pCPx |0iCP(twպ  ! : @ V \ @] x @@ 2 r | @ ܻ   , L ^ e ~ @0:CPuI \03CPu |B |0#+CPu: 0)$CP|4 CPws 06CPwl 0 CP|  CP| CPvV v@PP00B`Pr v`P  R  R 0,PS0P , S%00 0$0(00X `0` 0 P@p@  dwY`0P ʎIY\0PY YU6HP70P7zH0"800tH080oH07 00iH070dU 6P0X2\X2S$tH000QH070LUy W`P 00^`sHР؀JP P PVJ) sP |P1Ȁ0H040H030H, 4, H020U2 t0 XpH H000H000H0@00U ,0 00 0 D,0HS  qU ,0 00 0 D,0HSp \U ,0 00 0 D,0HS G >O-pPУr8@`P P `nV<1X ЍOnR('RZ8 07840 ЍO3 Ѝ謶 O-SM@5 0P Q  8p`tj⬰<1@0  0 0Ep0@   p   P@ X 8 *  ЍH&! н ض-G-@`pPU T =PPP@P@  KT?0S DD0 !@D@DYT 0: @/@l A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90?8g<7S:8?@gD7S;@}?HgL7S<Hw?(u?Ar?q? 1`Pj?h?1`Pa?X  P T0 ST/47,`0C47(<7,`0C<7!D7,`0CD7L7,`0CL7O-MLM`p$ 0=P\IdxP ED3&7 E000 0000 0P70P7 HE000 0:00 3000%0  p S +8 0 EH@ 0`0 E+ ^01 P#Z [0X,=P0047(FP @5: ؍LЍDGP PA0 D  D 0 0G<DP078t247x204<',0Rᓸ 38>@D',0Rᓸ -@>H'0\"L'87<7@7D7`"H7L708 0p  +@0S R R P\R @=:0@ R (#P0 00 ?o2 00p0S0020pp@p(0 DDNP 0 0# 00tDP P0( &H  P;P5 Z$dh pP#22C((,#,0 @0S 0 S S0P\S  @ p:0  ᝁPphqd7sPd p(0 tP$0S P $j1 eP 0S P [Ppp} 0 0# 0 MPp Xn0D00D000 0 @b 0 S E:$ E000X @ {-@    0Q//Q *///G-p0000@P `P` Y 0 0 R:@CS@D"@3X HGyU( IGA-TpW0 %|T`@V0? C.CL0LS @sP X X| |00 S HH0P 0RS  p@-P @Pp<@-p@-@Pp PPpT Pp@1@-0@T !@00T0S0 eB@@- L T0A-p `R0080810@: PP?W0A U t0  t0 <p@0S d0p0S <%p? @U4 @J.P P @$T T0Rt0t 0SnPt0 t0 88cPT0$0x x0RX g@OP0S :@s | A-`PP c_@T T0Sp@Qp@- M z0 zB+T0S0e PUx x0 BPc_`@P @ 0  =R   Ѝp L   G-} G*:SR0M" 4P (  JP  0@0A 0(P  0Ѝ lB M@T|   FT0 R0 0800, P T8p(0SS90SS[PT0c S|  `P7 R|0   P @T T0R88oPY0Sx x0R ' }T 00 HXXNPR P T T0R88=Pk0  >pq0VS pc_ @TG 0SS`-90SS)PT00S8 0 G0*: S R   p 70S 30S @T !00, k@P  - 6 Q00@-1@LS? @q@dRl@̠ BR001 BS@P@-40; 0S /00P P@-40QD 0S /00P P@-L0}O 0S So/00P P@-H0a r0S Sp/00P P@-L0o Z0S S$0@o~/00P  hp@-@Q0 eC>RP0_ C|C0`S0 SQ 0` XPp@p0 p@f`0 p@ { 0P@-|0| CQh0i CC P R !P BR #@।@  p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S 0@0 Ѝp/0d`Q 0000P 0 CCP {- 'A-0S00@Pd` pW /0000Pp 0 C{-8 nP@-<0<.tQ(0v CB!>000P k @-@QOx C-TM@` P `ep) 0 e ````e 1 pW0`pV& ef 0 0 |L@ meT  X@TЍ00C>SO00`"P!@03@000C>S>00p"P!@03@0 İ -3@- P dp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp pp A-0Pp@`S:0SS 0? C/C  RS* R0 $`V1S* iP a 0@DpR: Q  O-MA 0TP` 0 vu6A@PAHh@081 0S  wp 00ЀP P P P P P P pPp 0S l Cp X61T!R H9p 0;1#3K0$0&&*аp L0S% %S  p H p P p $  p ( pw P0S t00$Q0p T pe 0Sz 811K1▽0x1ZsOp M WPw p@ p%P0hd p1 | p+ U%P u%P0 x1`@ (p X00SXppW0h 1SPិp@Hh峺s>P  |p KF upp%d lp~ 0S P oQ ؽZ T  Np  r"BNp8P{ (Pv Pq |Pl Pg P P X00S 0Sa Ta FQp\%P `V%RY pTr0S]  pg 0x8!pM^pJ0SL  @ pQ 0$8!p<HPpB 1 R6 0S  P4 Ѝ 0Sp pl o j y x ; @ K F    ( 3 < Q l u V  F b e g p@-@Ppp p@KRRA-P`p@@L0s  S$0 U@ p@@@dW0S R H R U p Q p@-P0U@S s00pH ᏿P@7@T:Ap/ &@-`PM1pSAT  p@xЍh bPЍ@!R 00  00 p@ a@V 0 !p@{`P p 0S |00#40 P < SP 6, 0%  A-PP 0S 1 p@ 0S @@00 S U   ^ @ .S0.S0_S-S```&00  @R"0T0 0D0T& @- @0P PT00Q    ᢾDP `00CS`0p S00 P0S X0X /XLꘟ&p@-h1@SP~iPPE @p M0.SSPP \dP L_P < MP 0  .WPP p@-@P'Uh 0 rK0 mK0 xhK0  hcK0\/T,L)D& <#@4 , $      .K0  )K0  $K0 K0 K0 K Ip@x叴 DP    ! ( 0 7 B N T ^ f m t y & 0(HLǒ -\ \` Q^ ,\ ,@-QMM@pPf[ p 0B  BaJQލЍA> 0!>0 0B TJp`0SPE@E* p 0S:0@D0 O--,MlhpP. h}`  H @P2 0S  A k,P$P@7P@ X_P$0X2200,Ѝ P,P, R $P,PE0S p R* 0w20 6$ R, R P 6$ R R ,Pp!@P !!! P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@VV00ЍPWL"0$?S 0[ PW RPPUT  P-70 0 * .0@I0 0IU:D X0 0 `TT  DSPO-`0 2"Pp Y*Q@ U V700 Ѝ$@@`FPp  00U V 00  P     @3 \Do   ' T/T$\T0 U V@@U V\$0@00@@`FPpU V `F@p~T& O-SM MPd`p`p< @(<pF (nI p V=? p (W<4 \IpTN    0 Mp PB M^P M/   3Sލ Ѝ   430"V003 0M@ p  p@`1P $ Ip @T* pP0P 0S4  \`@T*T  4Hp @ pz   ;0$#$("( Hpe @  ⺾0$#$(B(   ⭾0Tc(#"$ c$" HpF @@  ⛾ 1b"!4b$#  ⎾I  %  9 FR ~.0M/ P M/{Hp 0S @00Sh%DlHp]00     A-p @MTP VЍR` R <00P0S 0 -0 0t00#Q0 $ V0B  00 0"G/ O-4MX@p 0S\`d` (0S<0 p4 04ЍO 0  ,   p0,0 ,0SPFX ,HGp 000 ),`/4ЍP V0 0 00U0  , p04ph0 00X `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  05,PH c J k p@-P`@P 0S $`P(0Sp,` P,` P  0)D0@-MMP+ p P0@ۍЍ0;0 CQ@P N,P I@- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@@T   Ҽ0x@ `DYPЍp`Vx1@P 0>0S *<P PU@P PP`ꟽ/0P@-404 eQ 0 9 C/C@ 厼  A-` (M00>0@SP  '00x B0epp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0>0S &0xPT) A-@`lVPFPPPp2Xp`Eh,P hpl"h20 V0  ௻l20l2@-Mp@`P! ុ (⚻ (X( 8pBPU@ TѼ700@Ѝ ʻi///0@-M @ ⻻*PPЍ0 3"QAp 00000)tBpO00000@ fBpl A 00  0"ZBp<6 p 3*- 6 p@-QUp@p !A,0h1p@,@-GM>`V ]P00Gߍ@PF/ 9  0[ ph0 1`E0 DF?aB> *P80 F?TB ii@-@MIP4@ $NP P@Ѝ Q@0@ C@-ܹ0SSP`/// $0 /Lp/Q @-@?t0@0Q00@-,M@P(  ᙺ  T Ap 0 00S p,Ѝ08i(p@-MP@ u ` p Ħ  (PAPЍp:iO-PQMMD3D CoT0S,3 CCpW3 CC@H`"@0J01801\0t0P0 0K`T0`V3P 0P0T00T0` P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0T0 (@)@@FF@T0  弱0 T0R B   @ Y@ P1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP UPEPPP@ D$("(b?p`ݍЍ  ?  ۹YI @   C-`Mp"0` 0$` 0 ,pP @T?+Ѝ`Y*PPA 0 ,p0 S &+ `@`T*x0V*00+T00V:0 (P|P@# (o JY 0@P @-DM`@ pP@    a !> U 134  R2$ $@0 DЍUi@il@-QM@  00 p l20 h2"?Ѝ@-]MM`@F#P>p PP VR 000S0S S SS wR0S HcpVPS CQRS 0  Vxp@P V$0 Bp 0S$H` w ˤl ?p 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0F H⚤!>50H \0?p\0S {01S h(Qc0 0 0 00 0 0pURZ1S SN F F]ލЍRIx(@P= >@2 3P0 0- H)@b?TY$0S! H0M PPN0 0~Qii@ @- 00 000 0 +Ѝ 2S/2S00/@-@@V002@-S0@0 @@V0002S  g/L A-PM`p (P劷P)(@P. 0LL`0e=p00! @Z=Pp0Sp  >p PU0S ap V=.)@! (⧣( >p | P>p 7/PP >p &P Ѝ@R [ qB@f lBpBfB@0O-0@p`M0PU  <0S2P   U P崡 00S U 1!Z0  P000<P0 PPP0PU:000000x Ѝ@-  E> ЍgB0p@-M2S@P`x ( VP@0  `(>00ލp@   B@-P`2$MS@p0  0*00ж4%40 0 0p`8<$Ѝ@-@q< I(@F(@-@pp =p`~B 0`( "4`#/R00@-0@ ^ 0 # R 00P0p@-@^P Tt00p``0@D^d"000txœ\p@Tp0,O-QRM@@0I01`Q AV00ЍP0p Q :8Q@SI -넂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 0B  0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S ἵЍ@-@ 000YP  R ⨵ Ѝ@-@\0S \0\0@-@`q0`<;0`00@-8@$@r0p@-800P@ >Q &Tk0x1 RpR 0S TT0Q  ؊T0800 >0S p@ h A-p`KP%P@00<000S@ (0? 0@0K0cScO-@IMА`p< Iߍ0RS*  R? 0 000KC\%PP d R 0FSV (0Q 0S 8Qh00 00> 0200BS* ܴ 0360 RS00 T+ $0K0pC70`$pQ@0 DPV VdP h  Q 2  $⣴\7@ $Q DQV R <0S 0GS60 0 <≴@V 0GS80 0 |@F 2!031 0 k %R  GR0+  %A Ca %0 @V 00  0GS}20 0 L@8 R  GRn3   90GS_ 7000  0t2@,0 x" R07 ,0 4'R SH : F P41(1"<1815%#8107 dSV (1S 0 G0S#=00(  (100@0S W0 2S 0 GS <0 0 " ٳ 20@V081 0 Z00 GR P0@  k 2S P 0 GSQ0Y0 2 0 0000Y00 @  @V 00  ^00GSt00``@h 6S 0pGS^00 &A z 60@{V(9(, "  P V: ART ,0,,S P R:(, "   PV: ART`  ,0  00D0C0W00GSP9000 0C4 < 1@ 4S Y 0 GS8M00 $A  40@B?S6; B?S6o 00PD0 KS:KUKe 0 S0P0"1L 0G R 0   ڲ @<0 4 ^$S W cSc5 7@-P\ R&@P\0S x0xm08  Ѝ0P V<0@ pI& HA-PR1 W@ `ჲ0P pC R0 00 R0 6 30 00 P0 0:000 P00;000 P006000}P00ЍP 00000000 0ap00 0Up0 00 C-P@MT h"P@, 000`0001H0i0P0 0 x0`  (#0(10< P $!P( # @B  ) 0ta!P( ``(1  ( ȱ0(t!p±0+"70 (P  0  )>``` P( `(1" (> *>Qߍ 0*  d l @-0p M$M0i0PS` 1 !p  7p@o0S i p ۍ$Ѝi@ 0 !Pp  8QQ0500 0hpP P( ; &$ @- 0080@P PU@ 0S@ ` `P@Ѝp 00O-IMPp;HLPL `PR : 0@PIߍO"0,0{"600 0400 0 P` p00,0S2 V30$a2@0 0!,0 T;0 ` P ;W@PIߍOa@;0 ' P V`` ``00T;H0 ` ;(0 P @ *  G-P@pQtbP,`,x2S#PU`,@ ,x9PI`9, Q 0S,9 $9 5P,`08 X P RG-E00! 1`pP@T:p T  X ⢑00U *'"0 pЍ0R0   @=;L0 :p   0; @  :p` p@-RMM000PS`B S@ 00 0hpۍЍpt p p `F D˯:, 9p Vj @- 81S Q S0 000 PPЍ R ✯0# DPD30O-S4M@ h@@ `0 0_0P o0 00 0 "P 3 00 y0 P3 0 0S0@0k_00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  ,@$(,8`P@ X0⣡  Q*""00pP 0$00S $ h0n  ,(xt$S(P,8M P@0 Sh0` 0h0  `0304Ѝ 00 !0 pPz @ uZt $ͮ ,ɮ,0pS 1P@,0$S  S St 0P !R "Rp( $(,8oP@ n m r O-PM0@0400``2 ##`pp#`W9 pW6l0S,0S0`tr,0v x2S0`80w,0v 847S0`\r,0v `"Rtr0,p80x2 S0p0g,47S \9| 0 pߍ0$000 `2$Tp$`  `$A9 0 p $`  0 p 00 `2(4p $9 0 p(9| 0 p#0z0P,04l0<40 pl#0k@0"04,040 p]q`]n`dk`k,0 !P !904ǜ R6, `"R`P, 00`1,0,0G0 0 ` uX, 00}R0S 0⌭00P 0H` ` 0 ,V,p1S  ,0 !P !`" P ,0 0L00` 0 3p,`  @ `p@-PUp@0L0pp@- MP#p 0` 0 0 `@3p2@ Ѝp 0 `3p ` 0)`3p  Ŭ0U 0;1003p@-@pP`Z8!(0.080000'0S  0R  Odp`L Ѝ@@40 pA@ Ѝ@x Ѝ \O-`@p 0SP$H` E000 0 0000 ``0 Р0 `  $79 0&0003H081y H. ЍO <0 $7뜳  000H@0Sp3H000s$80407 HS8 0008 R#:kg{{'{z40S' zkg{{'{ z0زS+d0S( $0P$h0!f700 R::kg{{'{*z8 S zLkg{{'{* z$C700 H0S0SU h R 0R<0S 0S11H000s8040 P14 6P18 0Pt10 *804 \[00@0S0i0 N00.0 p ỳh`0 c P0 J.0S00HT{  P 0dh0 ЍO Ѝ??$ C N H n v 0 S Y p m ` g p@-P@8T    (00@x1S0pS|q |10|2p 102022p R Rp0A-p@`0P S pH pph0`00 00p0 pd0h0  0 0 0$003 0 A\A p@-@`MV R 0 iЍp@F0H8P3 \00 R,  0i0P% 0S" <0S 0 $ PP 6  |n` 0 4D0@ Ѝp0 %Ѝp@o $O-RpP\M@`$[P X0 #3P 0 RT000 qp` hPP. dL0S0 0@S@0#/L0} ?I00&P X0 "2P 0 Rzgjzzz{T0d0S  $: P $[ <Y y' `20\200(4"<10,00000<00@0,0D00 <$P(P Q48`LPPPTPH0/p_ dpX 0 0{PPN  h0&h 0x100(4"<8#8  10 mE00`0@008d#l `\0 P00\ 0 `zv 04S 1S0810 5p  [X  @0\Ѝ7S zDP V s CDC  @-`pP@`+0 h0X $7S R h0@0 < ` 4 0 Ѝ@$0  P P  p@- P@$ 0 00L0p@)  p@-PUp00CSp@0D $y4  (000L0p@I  `A-@`P p_ 800 a B00H 00<0L008 %A h  SA-@P` h 0R 00P5  081HAp` P!08!(0 AP     Pp p 0 ]B@▧ 0 d0 xP@0 $%A h00h0 C-@p0 PR  R $ RP508Ȁ `3  Ji]@0S ]PP N P0  lH81 0S; 0 S<$2  cU0 <`,0  @ R 0P ЍG 0PS 0 PD0A 50 00 0SЍGЍ l cSc  0p@-800P@  H*h00h00L0p@$` 5F_iE ( \/0S/0> d0S  0R/E. /, O-M00 0PS000p,`8 0S@TQ 0 ЍO> R*ⰃP7S Ǚ Ǚ Y  S@1  H!  Q 0 S:500 0#p00 00 ЍOo Y 0 0Cs0&0S0 S0Lp0 p    0t 0P $0 E0SY0@60@ 600 0p0 0  i`P  =$0 S 081TtiZ<6@P P0S0 0<S<0P0Ѝ0    0 0PY6S700S0 l00 0P Rh532Y@0H%KSK?305@.0 $Y0S0   P   [ i0 wt4 @R0S Y0 % 2)  Br  Br 0 3 $ 0 0P   0 Y 1 0 :|3 @S R@00 D$0ȤY<0<0818 ? < 0 P0aP5 0000  000 0P00S* -P *  p唤 @ 0ЍO2600 0<P04 a0S * P   pe`81 000 0 0000H ``0\0S   `!0YP 0 8 R 1@sЍOKY 0 aY 0 20Sg0 00 P0PY0 '0/  tЍO J t   , 1 H c k N { p@-@l PT/ p@0HD N`\P d  p@p`$ O-,M@`P Q0 ,ЍOm`F ᾊVWP0@SS 0SP0t#tx'xVI:PQUE0VB:  ᐣ"4"48#8S50V2:1 S/ 0 0P!' u0S 0000<`10a  & ! P .  ,,Ѝ G 0 B c( a p@-Q` M\@MP  0000x p 0S T A @ ۍЍp0 V`V \@Tx $~ G-`j 0Px1@pTT 0S R T0S> R*wP$ f 0 @ A- p`=@PAlPU- A0D0S0 A\0S0 A G-M0MN0 ;p`p D Pd`8b0480EL80H8$0ED80@X@8<8 ` m@TW0|` 0E 0(p$<ݍ0Ѝ`   7@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@h}Axz  P<gjzz+S$0@ | Ѝ0zD p@-@P0 0Uph0Spp@O-`P@T Q Pd0S r 0 0Gd0  ЍP0AQ 0S 0P -  `08p|0#  81- 8 0 $ 0R0hd`h08 R0, 00C0 0800<0  P`00 400 V0S $0 pWp:#<0 2 0 0 R0H0@S~ 00ppWX0H0DHt   ph00( L C ,0`( "4`4#S /0 @Rp@-L00pPQ0`PE `@@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScx1G-`@PM T+ 0S pW$ P  ᴙPP@h0 d0S4  xҘd0 0S PPPЍ|0d 0|00 00d0 00090 {P p8VPNP  j | XPP$0 00 iPP 00EBd8>dX:) 1PPp Q|0x 0|0h0d|00|0XᨘU H0S P 8 P  MU` jP < 0$Q S "  Q  Pp h  5< 0   `-pP; t0<0t00 00 80dQYx X ḘP ؘ ? U: ⧘pP ǘАY $0% h  5< 0   0<0| *?  p@-PP1 yC p`01S 0S 0S 0S  (0 @T 0Q0 PSP 0|U d0S0h0d0p@c } p p@-@T PP@0p G-Pp`Ps@Ѝ0E @P00 4 @P 00000P00 000) 9 0 '$0P pEp)0 "p0S <,0 EP  0@R 0 0000@@ @-@T PQ0 8 00*:SR h0S dP H` Ѝ$` dp P (0Q,0Q   `P 800000( ,0BP 0S 0 h dW $0Q 0h0d`0SH年 ( 0S/0S/   O-MP<`RH0@8 0xP͞00ЍXpP Pž0 U@ UP R R R0 P 0S8Y0000000Cs z@UЍO4 @PЍO5    p @@0 0(0$  j& SC 0S/G-P@M T 0p `x|$00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p͗Y P 00p0000 S0 @00:S 0S @\S000@:S @{-T&0@-P:P@A0 P\:R \:\P@\\ @R0/& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PP 00pCލ Ѝ@@D;04pW 40p(0= P 0 `R0 :R `d4@0  0(8804 PF0P {0S " p PP ;000P p 0S#00 08`p@Z +8!0P R 0!0SF @ @ !0P 0O008`0 SWC @DpW:SY @\Sp S Spp00T:C @DP m 0SQ !Np0@P0 0 Y@ S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0B @D0J`FP  0S 9!  002 @ ` P D,0僂  ,0@PE P0S !$ D0A00T* PP 0P:SVr{-&~ @-0  0 Ѝ@-(@ P MT0 0{-C-MBM000pS 0S`! \0S)  R&    RA^0C R[ ,y0Pv Ps @ T Q0%P ލЍ y0P P 0@PS0 PP U P$P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  {-T& p@-@PDp@NG-`= @P@ d Piq 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0 Pd 0:SS0AR0@A P p Pd k X A-p= `P@ d8 P`FPd0 00@0S @Ad Ps Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P #P({- G-A0SRPp`ʏ PU00Ѝ ᩊP00CS0R Pp0  |Y( ሕP r, nP 6P00SW  R00S 0σ47,P R   S@T PR   R ({-P~- 0{-@0@-0S |P dP({-P-@-@[P08G({-p@-P@PPpRPp({-@-@FP Q 087S@T ({-P-p@-SP@ P@p p@-@P * 087S@T ({-P-O-pPW`@P @ ЍZ K P PT  RT@ Z //////O-@4r00SRP` 4 PU00 Ѝ  ᎉP00CS0Q Pp0 0 l ]Z iPD S8 OP P00SX00 S ;P P00S  ,P  &P | P ` P H P 0 P$ :Ph- @-04@0P !Ph- X0@-0S H@ ;000D@JP0DЍPh--@-@`0P0`Sp 0/P PP Ѝh-@-@P08Dh-p@-P@PPpPPph-A-P @`pPЍ0 (084SPUP @h-@- 0 00B;P Ѝ䠂-A-P @`pmPЍ0 (084SPUP @h-@- 0 00B;P Ѝ䠂-@    /A-0@@`P@0 >p00D0& SQ 0@/0PA/A/O-@PD⛒pDpG``b0Y:0z  Z # 0@@D⁒ 0DA\0:Z: [=0 S: p `$ Ѝ `p꤆-A-@`Ppk 1e +_ %YA 00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @Py}p TT0 fp]@ <0@540 4/(00S &0TЍ& -A-@` 0s P00p0pGWp0PP @P @pT0 @@PP @꤆-p@-?@004@ptpG0SkX•$0S` DH0ß0 R 40><L 0 @TC3^ B00@  C31X  02` 3 d ! \C2 h00C0'0hS8 0t 0 00E\\!H`| <.,`ZPPDpAލЍgpP aP 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0h0 :/1, !ᯓkP 0H0꤆-&9 TC -(-J Y 0H0S/ᤆ-0P /ᤆ-@-P@ADM|0`S)0S&i0S S fa0P 0P@ DЍ qpW*P 0 000儌0pp@ @`0prX0 7/0S d0SP 0 P0DЍ@_꤆-(-& G-dqP@0L P12C1b05R0 0 0&0S  "h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R᳌000S0PS ⤌&0S,P P,@GJ꤆--!\  0L0#0꤆-t0@-M  L0@31 ^AP 0C! 0Ѝlx꤆- @-L 0 0@11D ^Q       ꤆-A-@@bM0u L0 @2# p PW%cP_  Bc p\  Z`$0 HD@,X#1010 2R01   000 S" V00 S  ЍA X 1(410~X1威42  SV Q`ЍQ0S 9ЍA3`\c  Z lϊ@l⹋%0S  Z c00@꤆- A-`QM0S 00S` @P9 0s$@Ѝ hpW   @`偋00|0pS0S @Pp00pFV@@P 00T l@儊`pW 0S:S* 0( I00ppp꤆-(-O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1₊h L0C R P!050%Pd @T:  i0 p[L0CY1T*Q@@꤆-G-qT0So:\0`S&7 2 c@Oo @d(0d$0P0@U1 0S.   B 0PN %Q * RG  0B408@S 1:X 0@D8C 003 c0< ?o@@D@  tPP  ᔊPNPP  0 @ S :   b1"0!00000P00,0P꤆-&A-p0@@ `P PP00`Pl P@幉%Q *0S  ᅐ꤆-$00S:@-@@R꤆-@-P`P U(0SP@P )@T \0@刑T0 4/}룑 00'0S 0( ( @ZЍp褆-&8 O-$MPpPeE00U0SXc )Z@ D3@W<3 4/KW(0Sp0eWD@XU0XW5 0PPW00 # 30+*[@C@dQS: ?L5yP KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P00P K D K0@D   媈%Q   z0@P0'0S 0L 0pv$Ѝ*0S  ꤆-&8 - @-M@p4aPE(0SWTP )@T; 0@l0 4/`0#880 P0Ur@P  *'0S 0| ( @+Ѝr@P %Q|0S0S PS 00꤆-&8 O-@QT$Mp(0S@ P xP'0S  p@P$ЍW "0T`M\0T*P* 0`0?o 0c  `o `S PP T 1b* A4 T!P030#P0S X $200301S%T#2Q FZD*0T00S<PP 00PPP0 0#  0|0S0S @ PpN<8`0<0 0 spP ᑇPP% 0   D\  %T#2Q JZ*0T00S  DDUKP )PU @0@_<0 ;4/TPPv 004꤆- &-8 @-@H0'0S 0 00 0#T Ѝ@Ѝ褆- J////&/&000/T&000/T&000 /T&000/T&000/T&000/T&000/T&000 /T&000 /T&000@/T&000/T&000 /T&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/&; 0 0CS0 S P 0 /p@-P0`@ḉPp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0000 /T&P/ 0S S//0R/0000/P&000/L&7@-@P@@P 04PSPE* 0 - Ѝ0 H&PQ 0S///L&03P 0 / 0 ACP 0AB0P CSoPS//O-M@X @ЍOSQ`pu rTp 04S`\k P0@`S@T~WlЍ_Uᚔ!` 㾌`PE`0r>T 04SJ:`\H  _T  QX Q(    x F Z P    ፌT0`[T?o20S@ z@ @0R @T`0-@0S S @0V @ X 1^@@V X*R 00`00P 0 !00S00/Xd"H&y!00S00/!&!///@-@H*D<P !( & @~H&!!-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A 00ЍQ@P @ p@-@P0 `P  \*. Q  Rp R  (  p 0 B T&<-qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00@w Ѝ0S/1>3 !/0S 000/<-0S*p@- @PO P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0@-0C@ 0 0  (  ( 0 S/! ^R/0@- @0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!q0`A-PRp `@{P 0!Ꮚ000A-@P`p0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & pG`P  B0Z  Bv`FpGPo`FPA!A-@aP0S0<R&*1 21<0S0 0PPR0 ,S*!!!0 0R0 ,S(!!!,p ([N0P A, (0 ,P&P&L&A-P` P0PS\ ]\ xp@BX T 0| ễPDPpl&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00<-< 08 C800/`Q'Q!//T&0A-sMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0W<-p@-P4`@ᵄ@P@p Tp!Q 010//!,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0P`&P&L&O-@P 0RMp\ 8 P&  @1 P 000Ѝ 0@  LPP ЍO 0 PS@ ᤇ 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000〦 0 hSFh ,VKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0 @`F p@ (Uh 00C0c-R [RS :R =R} 0S: N .S0,S00``0-S]S0S00``40\ 0 IY0 S:0`S00`0S00``E0 0I{P  0 (SB(0<R$  KP    t P $0  0$ 峠S0tS00``0-S]S0`S00`=  0 S:0`S00`0S0 -RZ QW]QT -Z00  YI 0S. Y0`S 00`0S0<Y00 Z0S  Z40 KP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P Hp00勰P00 0  EB#ЍORW =RT ]RQR :R ]R0010!7!&<-T&P&L& 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@T&P&L&0A-``Pp\U@ [U_0V:0dS00`00 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0 D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0SP;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+<-)>{^ ]T&0@-``P?Q@ $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   0p000<20to kmi0V:0aS00`00<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 S`0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00!<-T&^ ]0S G-`M pQpG }pL2@P 6W:} Ѝ>PPP P $PPxP @劂P 0   uPP6   $ ( , 0P4 8 < @ D t| 0000L R:0S005000 S8:  0A 0!GP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RQ00p< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:_00PS, 0E10S*P8I0@0CU00C0 RB  \ U B!U  E 1U, X0C ^ဗ!1L0XRU!U!  R0>P P PS 00 000@0000 0H @ R00d000G 80S@ 0Q10CRZ/TUU@p\o<-Ee,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0vP`&P&L&0p@-P0@SQʡ@P80 p<0S P pH0@0@P(00Ppp@&P&L&O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  \P%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(T&x !O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0, 0 00$002   0 @X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _V _UQO  X 0FPyu   p$ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  X `M P0#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2T&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@YS  D>31># R 0800 0@~Y_  DS S- S* S( @` PS 0 b800 0@YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0, 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  NXP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(T&x !O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  GP A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E00  R?o20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!T&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-u!T&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  ZQP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(T&x !O--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 8[ <``F0` 0Z01S` 0s vQBo \R 0C1!S` `0m0 0Q[ 0000,@4H80<@ = PP  TX0\ L0`r Vd 00 S`FY10`0 0 ,`NP XD0S 00D0 ,>`PD00D0 0R < 0JS : @P PZ Z `p3`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$00D0 ,LP5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y),Q~ 4^e 8[b <``F0` 0Z"01S` 0s vQBo \R 0C1!S` `0l0eE& 0Q00000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S7 00D0 ,r`PD00D0 [ ` 0R< 0JS: !O PZ`XD0Se 4P,0@P4  p4P HP lЍ,0@ 0S%00D ;0$00D0 ,[P5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SpPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80 0So <``F0`$0Z"01S`$0s vQBo \R 0C1!S` `0k0$0Q000 0,@4H80<@PP T X 0\ L0`dpV 00S`FY1*0`0 0 ,`4P XD0Sd 00D0 ,$`PD00D0 0 S` 0P< JP:$0 M $0PZ`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$00D0 ,4P5DV/0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SUPHuDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppp pnpl-Ѝ///@- // //p@-08P00@S PpbP pH-7@-@0P0S TP Ѝ0P H-@-@P 0S \j@P/`P 00 0/ / 00 0 0 0/////0P  P@-x / !H- !P P/ /$P0/ 2#0/вO-,MP`TpP0`pR0X@$*$0S$00f 0Z0000\0 0 0 R0$ό030#QZ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR# 0 B 00Y00S  000CS 000G 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SB0 S H$0 0CR0%2 L zU1000S 0!03S 00C 0t0 S 0 0S @ $ D$0PS$0C[ 0SW  00,Ѝ 0R3Z0B\\00S SC @PTP>: 0; $ $ 20fX)(Q@-0M(,4`@0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ {zЍ䰬Q@-0M(,@0  P#U` `0`/"`o R?#0.o^,AUU-00ĵЍpFW`&TO-0M@p`0W PV P'Z P2Y PyX PV P:$  ^YW Pr  WY  QYV1  IY CYZ  ;Y 5YY;X% h )YT 4#Y*ЍZY!X3  Y , Y  Y <XЍ X $XXVZ  PЍOt&@& &&%%%%@%(%%$$$O-@Q0M0R00P$値 0` p 0P R nRk a BR $  , h PQ D hPL Ѝ3 00hP~Y U000T0003 0$0hPNY U070T070H hPY} U000T000 PhPY U000T000YW U080T080 oR 0hPT000U000v ~0 X{hP 0 4uhP 0 `ohPjYL U080T080U0 t^hPz 0 XhP 0 |RhPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t hPYv Y0 hgP 0 gP ##|#8#""X"A- `M0 0 !!0@PH@>SHPPP PPP7"`!P`03 pP0  p+ 0 zlp@ glp@   p@@@dl Pdl|lPzl 0PslP`Ѝnl00@ŸO- 1M MP (@PD`0\ "( p (-pup^ @D;h@ 0@k 0Sr pء1 00p 0``00p@, -0)@t0p )0B 'P%P 0S Rl001ݍ Ѝl0S 0F\ R Pp @`0!@DD4 [@ 0 0 0V   0'. 0p,R 81ݍ ЍpFtHgt0@-M0P  Mp Op@ Pe ` Ѝ00 0\Ѝ0@A-@@0s- PP0P 0#p` ``>00`kpp3X`p wk``(00`kk 00괟p@-@PCM0 /[P2 pP@ ` @Pk00t1 @ 0F0 F`0S VS00 SCލpp@@0S k@X00P0@ " P@1:k?00@k00@p@-MQMP4@SZ TF /8[PC QP0s, &fP!QaP` 0t"pO @ 0@`qpF @ p> ۍЍp00si/i00p +Uj@0P0@  P@1:j?00@5p 04j0#S8p@ j00j@j@l8 %@`HD @-sP`O-$(X,p.S`P@+Wu00Sb [0 0NP: $" 2Q > !"04x"3S20*rW00Sa [0 0N P : )" 2Q >@AQ!Ou0 {0Qq w{` N P : 4#0"Q . ![0 0NP:t' 00{S' w{Q e 0{NP:  4#0"Q .@AQ!O[0 0cN P :[y'@w{ 0SNPy: 0ᚔ)Z@0S20n2" U%> "Ww{T 6N P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ P, `S 0 S1h!R 0SLXB ,007H+Q !POT d! +0C 3S00< G {{xP 01C /AGPV P   00%Xp X P$0SP i$gЍ00[pG* 0C!< R Q!h! R@( Qt08$0p|0xpx0(0|0p $0ptG 9p00W1<PSQ_ }Q<) ^( S*P0 09P 01<p@(Q( !hQ0Wt08$0px |0@x ( | pt0@$ pP4  L A!h!R"0( SS:t08$0px |0px0(0|0pt $0p 00WP<\Qp5 LS 0,^0F <P0A  0=R< ;< @%0Dh0(00(0000,00,0  G ,0P S G"x  RQG#0 SG P\0sG `0d   0 Q0*0^*{ r0s{P T80< D000@ h0 0$% 0S 000000(00(0,00,0(00(0$Q0P S %R" :"  R#Ό01"?!x"0x$00$0t 00 0p000l0S <\ ~ X  NR HL\ @0DhT 0Rk{AP{{$hE `&0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dSH0 G`0G0Gd G 000#( R 0S $0S 2S0 :646 0Ÿ! 0Ϡ!>! 2#1110N 0pP<0d2@#! (1#@ 1110N 0  ΌD !` R<l?, | 0/  "1? A D  D @0<0S H0Q 004 0 2 0< Q00:P0 0<R$0h00c 0<0@]< "0RD01H0<0@ #:6 00" 0Ϡ">! 2#< 1110N 0  ΌD ! R@$?, 4 0/  "1? A D  D <0@ S0H Q0#Q0  0C0h  BQ_ $0 h00$%; 0dR  PM<@ \@@@Q<&<0P0T8<  \00 Q00000S$PT8< G ! G! 0 ! 0 0S(0S `5d0 Q00: c 0<@U\%20SD000@0H<L#:@6 00!$Ϡ0!>! 0H!!!0C" . D @" 0D, P<8? D 0/  "1? A    @< P0LD \0#G0000$02p rp t t z  0 RR  0 & G%g G RQz#Z!G RQmG# &K(0<0S$0@00`0<\[=QVH NRL0X\q<0@0@0D0h,0 000 0%0 0" P9#R3 R0  \Q$% 8<& dP(  01) :60 0!$Ϡ0! !>@)0!!!0C 0Phh)! /.P P@<΁!@? < "AL00 h00H%00<0@ C00 00S ^0  $0h0 C0000S ^ 0@D h0 BQ0 D00@ h0  \ps; 0 *R" O-Mp@$ia0l`00da0W0 T# 0 2c1  ?<0PP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T ;0h0PJ 0TP dP; P< $`Pf0Sc R`ʰ  R\ʸ  RX 0 0\ 0S0`@dp?O$@T'pET0}Np0`@dp00`0@D HPv^D PEJ000000 0H0!00R0SX0 0h080000R4 t PQlpx|POXRSY Y  h@p| Ux Zt 0Sp0Xl0[h0 Rwt XXڸ8常0:=CP0p00@t0p`VPu x0S r`pt00 0800@4p0 h00 0P |0( x PZv> 00! 0#/!! !./ B 0S!?.P  PɊ 00#1?Lv.C BAQS| \xt Pt`00 ,qp  A 0qp `pV@P 0R?o20S_00ߍ 0_0h0O0 qp@pS Q#! !pY@2NRp/ h0 P0,P_000 `0  ZR 0`S 00@ _0 0h@_0S 0V0ZS0 dh`  ?PhT0z ?8h<0r ?@hD0j ?HhL0b$`X\YZP R`\_T00Y_0S@TpR_0S? 0ß園"b^2):##c2S# \TP.j<PP 0l#0dT0IP30@pD(_0h8P000 `0@4pP ? /( Rß&0Q 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 E2qp> @p(pQ^#00^0S @㼀p h @p^00@pߍ輀X) XXʕ 0^0 Q  s!P }^T00z^0S10(` #ΌQ0"c01 2c1@Tf^^T00|ul)\P(\ ףvɻ %I$@-@T jpTat X00 R 0 R 0Q/  /  j  DQ p@-0t` SPPH 0@#  T\  Q(p/i8$H  Q j.0 0#  Q/h00Ɠ\ 0@-o>lP 0@" \ 0 /hA-@P `p@P0% P @PPA-`X@@P pjNP0& P @PPgA-`X@@DP pH@P0& eP @PP8gO-P M C`P; p pn$0P0@P P p % 8P pP0S  Ѝz P0 0V V 6C0`0SfA-PpQ `@Q P 0@DDB(000S  Ha@- M`ppPP) \  00S@ \0"S# 0p000S0 07/ Ѝ\0"S1Ds`0pX000S @ Ѝ1Ds( `@4H`@-@5 3@0O-MP@U`  PP2SPS rPW Pp B `Xa `L`@ P) 0nS: P= LP0 0Q Q WP P I0 B" S000P Ѝt0 00 S Ѝ0oSP  P^O-BMM@p\d `0 0NP:FLPP  8NPn00U@P C @PP`J$  0PPp +0P0  0PPp t"@P"  t0dQ PkPUPp`  pu x0 VP{ @PP0 PpL dlP lP1 /[ 00BލЍP/U ` P )p8[0SI  FP F0H00 PPp:  GFi[ X0 0sFP@! 0  [0 0V[ X0 0`FL[  x 0 00DS7Z00/3[ 0 0 0  PЍ- M? 0  PЍ8-0M  0FPЍ--( 0P    0/ 00 dcp@-PEU@pZ,0,0? `0  6/pcpp@-PkEU@pZ000? 0`40  6/pHc@-^@P 000l3/b@-&@P 000l3/bp@-PU?o20S@p 0 0 P5/$Pbp@-`PVU00P00S@p$$  0P 5/ap@-PU?o20S@p 0 0 P5/P|ap@-`P@PpZ,0,0 @p@/4ap@-P@P p$$000 B3/p`-@- M  qp@,,000G3/ Ѝ@ Ѝ/P|`@-kqp@  000G3/,`G-@- M 00`P N0Sp ЍY880M0 P@:/d_G-@- M 00`P N0Sp ЍpY880a0 P@:/^@20!P(///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ /////HP@4$tdTD4$tdTD4@-@$ MP05505#0%A0!0%P$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 CR$ *0#$00S 53$07$05 0$0(0, 0 !PpO-DM@X@fP, p@V Z P a@: Z Z|7$0P$  0@X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S 5,3407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S 5>37,05  50Q,0R 0 CQ * 0CQ,*0#  ,0 0,0S 537,05 50S 5,07,05 50S,0DR0#0C R700C 1L5$0qS 5<37,058`0,0 ?R0@SKW0 0,0S 5#37,05 50,0 QS 57,05 50S,0 R0#0C R00CP,@DЍQ T` 0pFQ)Q* AR bQY fQ ?R0@SP 8 b@S B;; # C, 0c0#80 S ,0 S 5,3407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS 5=37,05 0 ,0 0bw@0`fpF2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q 5<37,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P [P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R`0W  R `S` 0P`0S 5<37,05 50,0080:Q 5,347,5 5,@p`0%#jo%#jx%ju-M{00{Ѝp@-MP@` 004 4/ЍpO-PRM^  `WpP+a@/cFP L0  D pp Ѝ@0S 0  D  ppV0S Ѝ贠 U0S(D 0@pD 0@ ppU0SU00U000(@- @MЍO-EM MaX@Pp+`E@ T0P@(T 0 T@0PT 0 0EAP o@ k@UEލ ЍU00Eލ ЍU00<@- @M`p PPP+ /lT R rR  P   0@  P@ZЍP  rR 0rSX 0 , @E0 Ѝ@x;U 0 HA-` @p 0P/S /!TP @0 Sp 0 S '; Tp@-IMM@`PP p 0: S \0 040qp IލЍpTO00@IލЍpT00,p@-IMM@`PP p 0: S \0 080Ep IލЍpTO00@IލЍpT00|- M 0  PЍP 80Q 0 08080//p@-@P PP`  8PP u _FP  p@*PPp-40- M,0   ЍЍ/|DP --M  Ѝ Ѝ// -@-MN<@@P 00  0Ѝ@Ѝ/D0-@- M@ OP  Ѝ@Ѝ/O-`Pq,Mp;  PR$ Ppp @P$PX P@ 0 @XP N ,Ѝ000:Q!0P00,ЍXTp@-0(MP `& (Ѝp0 0  Dp@-@`PNpp p@808 0p@-(M P` g& (Ѝp谥DHp@-P@0 0@`  qNpp p@m`Dp@-(M@PcNp ?&8 ](ЍpX@-@P0 0,M`P KNp '& E,ЍȤDC-PP,M/ ``FV` @R p V `@0 @T N ,Ѝ00 0:2 0,Ѝ`Tp@-0(MP `% (Ѝp0 0 DDp@-@`PMpp p@808 0p@-(M P` % (ЍpDHp@-P@0 0@`  Mpp p@y꘢Dp@-(M@PMp %8 i(ЍpX@-@P0 0,M`P Mp u% Q,ЍD P $ Q80 8@-M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/ᠡlP/0@- M@0@00S 00000 X | PP  h00B/T00 Ѝ0DZGP0]Ƞ,((D3O-0MPP 0 @D `p@ P P00U pp00C  Z 2ATT00  RF LD@D T]:[ 2 0000~`K L0 V0 W8 \2ATT 0`Fs 0Ry L  0/ 0 B)0SH L0Ѝ V0  0 L ` 0  0pHX;0S2 0 Lv 0 B@  0 B  BtL`FtY  B 0  BdL 0 z YL 0 0S B 000Ѝ 0 ] 0 0 PDp@-@P*Lpp p@0RS00 /D0D0p@- P@ Lpp p@؛D808 0 QR00 /ᄛDp@-`@PKpT T   p@php@-P X @ 00`KpTT  p@pܚD"O-P M q 1D`00 SH,0?e@Qpa A10A1[10GPp`u ,  PPDEQ "$(Qp|0Bp7 @[0 S8 0?# R R!R@[u`p ,0 0 00NC11n00P0,0@ Ѝ@ 1l0 00udDD0D 0@-00 @T %AP80@080D@-@P AP80@080-M0 Ѝ-M0 ЍO-PؿiM ̑Ёqf Q`P@ P?`K͌U P\?K͌T P?F͌(1S P>F͌(Y nP>C͌ X ]PL>JB͌8W LP>̌1S :P=^B͌`=@ 0S708x H0PP `P, P  P P P P P` P@@ (P PpP (qP PD PxP'( Q780H0x100CS00000C(0h00Lp P 0QP ,0 `0p@ , W @  gpV/!01AQ 0 0 @T @aT, W   @@daXhP 0Y Piߍ P 1 S ,0 0 0 !1S 0D 0| 0?p00,,(00PpL!!\V( @  B  $48p< [$ 00A00@S9 00a1 P Ua PU, [000 P,0匐0Yp$0p1P,@`@P|P ` V ,@0@S 48p<PP 00 0R 0'LpP1L0ṿ0P@X1@ @P0屿0P0$001T0ᪿ0PP1P PX0墿0P0000᛿(,p A8 P40P0@AT 0<O< U, p@PW 0g1pY@10P00 `00V00 `ZV,0W0 P `ܰ少[@`@PP  ` V @pY @ P @T 0 P8 U`T,p40@T`0 (!  A A$@ 4 p,`0[T0, q q000 p`8@<\V 0f1`W10 @ 00 P00U00 PU,0 V0 @ PqZ0P@ 〻P  P U `W 8@<\@7P,0@0 0 ,0pG0H W0A10D|ae>pU( `L( L( K( K (  K,( JK8( KD( ^KQ,0 1@-( `BU0,p4@A,   ,0@0H T0封"1D|Q>p T Pu[3p,`4 TP2 00RV 0Sf ,00 [D k! 0 SW !L011@ @ T @T,00 0 @(0 pPCT,`4 0 ,01 , 0@ H 0T1D|=p! 0R1B@Pㆺ0P @T  0 P (0 SQ(0 00CP, P0XT0 X" 0 0 B00 S3 0 a0T !1 @Tap @嘼T,000 @,0,0Q@ 0@1P`P00P: `V  0PP$0SA ,00 $p1@T d!@W3 !P011D ` V `RV,0 0 0 `Tq[V` ` [  0 0P,p40 0 (0 SW(0 00C,p @0 [# 0 0 B0!0@SB 0a0X !1H P U a PU,000 P,0|!0RP0P1 `@㙹0P `V  0 @ p3 00R80000S p,`4 O-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @iYߍ 00@0Sk HP90Sv p`20S @+0S p$0 S 耍 0 S  10S N ꜃T0 D@-<@M $( ,ЍD0 D@-<@M $( ,ЍD`0` 0 R/DDQ 4Q(00?H/PD|$T0P0/ D @  R 0  R$ 00?H/~|$0P08 A-D   R'P?UH0@aaS@T,p10 0D   C(   S@T,  R 00/h~|$0 0 \}Dl P  `0H?30\ -@@  D\,00D//8}|$O-P␲4M  0pS4ЍPD H0 L ! 0 0|!0:|@Pq 0`D0ZP`@P0Z0 T〷0P V@H 0`@:1 0?3Q |QN D pH0L  00|"(0t:B:`P0S R,@P@RP 0 : @RP0`S4ЍP U|00 )0Px ``0T `@004  0`Pd @|`||$0 0 LzD`0` 0p@- PU 0@S RP7ppyDp@-@P 0PS ;P lpp0P0& H -? \| 0DR0S  0R0000 0\$( /y|$0 0 TxD 0 0 /O-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n j1Q0( 0 0  pЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 x h<0,$DC-pP␂M@ |`P {h2@0@Z  @03""BBB {6`@"C{@@ÅCC尵PU Cb pP 2pK 0p RZ @B0 @@@(P9 0 @@@(P. p* #$p& p0 @(P  a'f*000S :3S 6ЍP ZB2S@ T嘷ᖷ`h0S,;pPcDu4 A-Z`pPp ZB2S@ Tbqig000 R A_ A Zr@-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0dEl00TЍ!fXq$t<0l 0 S/O-`Dt@M[p+s(($ X&0CS0S<3((,P* 40H @08p{8 x%t{ġ`X(ÂPPßHHßP@@ß88ßx00ß $$߂ß@ ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ h2 0 0{DPr'>ppGl`( D(@ T (0Ѝ>㝶@ <㗶 ^㔶v㑶#㎶x:㋶'㈶#ㅶ0# 0偶H#~p-{-x`_u|rooplriyfzc{`@|]h}Z`ap %+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz<l$00p@-0'N[( C(@(0Sp O-M4g47`,0 Jҭp7划00 7 `0P `00 S00U0S}\ p @00  4` S  00 4 `0 s 00bR$ 4S4 0((&0 0Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Qt l   P5U0pS  p! @00 4 ` $R{ 4 0 0 ; 0M $Q B q/ 0 ;0 >p4 S S040ST 4 0r0  cR0$0GU  p p P p0np P 440 s 00bR43 $0$ 0fS t30l3#`w pS 83003#`h p3 0 B ` 40q0cR 4S02$0$ r0 0C aR?o$2#n p Si p  0 s 00bR40 ;0 㝴p P `R pa 40 s 00bR4 4$R40 s 00bR40 ;0  { pE `Q q 4 00 0q0cR  0`  Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 03. 4 00 40 s 00bR 44 `Tj A\ Qt(h80p@-P@ 0 PA TT Tp<O-@Pd4`DM0 8 p$Qq  :Q#R3Z 300S 81P@P@P@p@-@pQP<P <P 6;P10S. ,! P:p0@Sp0S0[S0mS S@ 0S 1CQ'0@S ;S 00C S0000@Sp0@S mS 0C;S P 000@S;Co08O-P0lvSpM`Xf` `JP U0 `r(ʍ"(0%I"R` (0$00 03S6PK T$5P  XRڈ5$50T p5"00`4S03P00S5 p0S2 4S, 4S 0t %W、匑Tp"2 0Pm 4p2Z& LQU# P P ɅP ?<oH5S4S 4S0?o2 )44Ytx2 PuX  ;P3Zx2  ;Px2?;~0x2W  ;Px278x23X|2 PW x3|2fЍ0 D $l h $ <% p 0$0(0JXj ;P Y y;P! Z$ r;Pp2?;~0p2|20P?0 r("(0:H"R`p2Z ЍL8 80 0P T0 0//Lp@-P|``p@0@ Q=0SP0P0:3S 8 80 00 :L#p@L0O- Mpp3 0hS0dd*B`pP 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S p20h2#`pw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR 1   S7K @y ` 0  S q$ lR Q1   ЍOp  q B`R/o"n000 ?c Ѝ 0`0`0 0R,g<  0 KQ(G-@P4S43P`Y 80$ RF U ʌ3S23pSnW " Rp{ :8.P?o6τ p_ͭ dc00 0#d#lm0` F?2? Y00s"/ " bP`(0 # 00 0>p@-D@D0@Ppp,0 $0l0m pH=p@-@0@P:#R|  l ^- # 0p P`pG:p<<hp@-@0@P :QthQp- p #P`p :4<<hp@-@0@P:#R| Ó \ "R-- , p #_P`p:p;<p@-0@DPSP @p (0008 <@%8 pp:DL0L 0@-@0:#R#R"#0::d0d 0@-@ :Q Q- :$:0 0@-@ :QQ σ  #p P{ :90 0@-@ :QQ σ  #p PR : 90 0p@-@P :QQ  Ãp #Pp# :eph80 0@-@ :QQ σ  #p jP` :Q7p@-@0@P:#R   Pp @8 %8 "R--  p #5P`p:pp8 :7<D@-<@<0@00:3S 0 0 6 @-8@80@00:3S005 0 0@-@:#R&#R) -̌@́ $p $" "#P`[:#Rt5p@-@0@P:#R(#R+ -́ " "  $  $ d p  #P`p:#Rp4hp@-PPP/ 0@` :QQ" “Tƒlp lp  #VP`p :Qpp3h0 0 2D0 0 2D@-@ MZ(qQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#cP`D2<0 0 000:P/(1 0 0@-00嶲0X0X 00:3S 0 p @-*P`/0\0\ 00 :3S 0- p @-P`/`0$0$ 000:#Rs//$0$ 000:#Ru//000 0  :#Rs30//(0( 0 :#Ru30/L/ 0 0 0://p@-@P0P`M00 p p 0S|000 SC q R0 :#Ѝp R 40,00 3/Ѝp.ht@l0A-MRBP0@Ss Q `P 0S^ 1P 00p ׻10p Q61 1`p0V0S  h100V0S  034p ) 03, p /#%ЍP  QÁP 0:x   000 00850 0@400-ht@0DT@-,@@0S400@-$@@0S400X@-MT@@ 0S Ѝ< 000 0040 0Ѝ 4@-Md@@ 0SЍ 4 0R  (00 Ѝ 4 t@-$MHBH2@PQ :cVW0r3p p)0Scqp 0SQ1p0SB '0  B0*1`00|PN 1@ 300 R 8 D 300 X30v&0  :3,p 4 P`$Ѝ0`00|P @ U4 0R` 00 `300T @8 300 84\*lTpC- M` ὸS P@᳸Ѹ<0@00:3S W 㣸 Ѝp ' 0 000:3S/D<'X0X 00:3S 03p @-L(P`/ 'D0D 0@-0 03, p 5P`&@0@ 0@-0034p !(P`P&0@-PP MP* 0Q0@00xP 000 2000*C% Ѝ0|P H000 24000*|% Ѝ0%l/ 0 0@-P@ M0:R# P P&tP 000 20S% Ѝ0`P D000,PP Ѝ0%l0 000:$!0\ S0 0 Q/p@-@Pp80pPU,LQ (0 P0C0S0 U@Tpg#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@pVЍA-PPM Q@`Q00?`FV`V` ,p(L 0@pqVЍP/\ , 0 B0/\//A-M`V,P@p(L 0@pETЍA-M`V,P@p(L 0@p+TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ , B(0 @T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-4 PlMVCT_ ,P@Q@8 =$^8R@ 0000@0pP 0-Pp4S-`0@PP#@  p) ,4,  [ 0 + 0 e lЍB 019lЍOV0*O-0$MP2Ut 0$ *`V} 0` 0P 嵢 W):0S`H9 0 @P$Ѝ 0SM S7 S0W  /0 04S $ЍO@ 0 @S S" S0V   /pG0 0@SG0Wᨀ *H0W0 `@G0X0  m/pG0Wᧀ*`@0X0 `@ 0S S0W0 @Wᧀ:0X0 \O-PQM0 43pS`.0S+R= @00! 0@ @00@ *TP/  @ ` LP @ PER 0  h`PЍ` D  P 4F " 2 Ѝ@ 0TYP0  0 / 404 0  R *P /lL0L 0 \ ʌ-P  /(404 0  R *P /L0L 0 \ ʌ-P  /404 0  R *P /,HH0 @-0^ @P 0 @0 0@-0@T J#0R4 B0pQ 7@.P f @808 0  R *P \/D D0 00SP:P4@//000 000S :P /dL0L 000S :P @-zp @Y/$0 0A-0`V* Z3 S$P! #Rp@4Swpp3@Tw AkB0tQ 6A$.((0 -0 i000 000S :P J/00O- M X% p `P 0 p @P  0 Pp@ 0 .@ M Ѝ@tP  P /p@-JP }3S P`4`.30PV(  03s S 0P 2 $R 0X0S H03 20X #$04p03pp萳Hp@-jP 93S @P4P30@Sp@A-`Pf JSU?sW< ?3$@PS3 SW*0N, SsH0S0 WP3PSSpP4Sjpp3PUp,0\4000?a000401C0010L10|1spp@-@P X0P:"C0T0XppG- ؀\/P@p  `lP LTL VW PT VW  T000S;0 W0 0 |O-($Z Ap`PP@8P ( 8,T2P* T P 0 !, @00 ,0\ WXP  RX8 @(  !R,@0 |d @-?C0 @   @ (( 1,   TA-@PQP% pW# 0 0S0姝,奝000 R   R   R  P 吝᎝4劝`T `TX *P Q Sp QW02op p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S FP00SpX@ '(@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pLpH0H 0 R P@0?30Q@ 080//D(0( 0 Q /HD(0( 0 Q t/DT0T0p@-PR ` <@78H@?`ppDl0l 0 Q RQX@078@08Q 0@0//pD0 0 D0 0 &Dp@-P`0`0@T X0:20T1S@0?;@0Z<000080S@078@0vpDP Q@0?30R@080//R^/R/p@-`S 4@HP@?Ipp R P RX @0*"7 8@08 R (0@0//P@/&p@-@Px`P` X0:20T1S@0?;@0B8000080S@078@0p0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/H0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/p@-P$@0@0p@ lDp@-P@$ p@p0p 0p@-@ QP00S ^ p@# p@DL0L0p@-@ P $pp# p@Dp@-P@$pp# p@p@-P | @ 00`$ppT0\ ^ @ p@#@Dp@-`@P$ppT\  R @ p@|#@Rp@-P@00S ^ p@sd# p@lO-`08O-PM> P@ ,0H100 0`0  0>&U,00pW$ 0 0 00$ 0 (p PEU` 0 wP@p  @p& Ѝ880 -0 M0 00 Ѝ D- M0 ЍC-@P M(p, P00S 2`0 GR 0 O@0L"Lb ``8 ᵘ (0 0Q 0 GP0D0 Po \0pq1QH``00CQ000 Ѝ0`00SZ00%0   T 0S00% , W10X0PXp T0RpG WڠP`PW 0 ` p Ѝ80  080 000 S0CpC5p@-@`P\!pp 0p@- M Ѝ\p@-PT0 0M`@  =!p 0 ЍpDl l0 00S X  8Q Q @ ,@ /&R//0DH H0 00S 4  !R@ ,@ //D`0P0 T 0008!R !R @0<@0/6S//T<0P0 0 0001S@0<@0//l0l 000S X *" (Q Q @ ,@ /&R//D$0$ 000S @ /DP X0:20(!R !R @0<@0/6S//0P @ /A-@Ppp" 80  P P`o  h D000T $000S0lLL0 - 0?o20QQP TD,0, 0 RP00T00/`DA-@P``$ 80 ! QP~p P eT  800PU  000S0 0 0 hD?o2?PRPT //PP00T00/,0, 0000P/P/,0, 0000P/P/O-@Pd30Y Q T# PU D#00SH04SPPQP0pGP0HS``HpHW, 0 ^  1  !!#pGPI@Ye0pS a[0 SqU,0 !0D|000 P0pP`a`0IS`IX`a,1 \  0  !!h#pW`YH0pSa>0 S:,0 !0D|000P0qpI PX 00C +0HSP 1TX[00CS``[TY0IS`YPY0 0CPYh|0 0 Dp@-@Pp`P0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@00C \.0 00XD\000S  Q R P 0!00//8-(^Q,0 , R1S ^^1S ^@O-MA!1@ 0Q4p, @p P `0S" S#A 00 0C ```P 00(00(00S00C0T0 03/p 0PS@(  Ѝ400<(0A-S$'p`4@P(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ 0 @ Q@R0O-@ M`P VTppD0S  00C(00@00 T0@ 0 S `&, 0 S@p  Rᰁ@`pDg ` | p Ѝ@0 S RR Ѝ,֑P d,0ϑ0P `00V  ppG , B,(pqqA0 ` T` 0Dp4ᤑP ,00 G@p`4 0Tp `0Dt@U   PB   0SQ 0 0PC $ 00\R <@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP \D0@ PQ0 /$ $\/ P/A-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ESpL @10 0 QTD$ 0R U EAp: u0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0QtD0A-PQÈP0P`@0*$ P uT00pW  0TP- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 BS0@( p`0,,0 0CA1!0 0s`@0S( 8XE?*0@-0B  80 P R00 8  $P R  R0 00S00!R0$R0 R d1S0800800080$O-RQ M40z`pᛍ@Ps 0ሰ(ᓍP,o ᧎PP0^ X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 4!8 \0`0d0h0l0p0 ЍwP4, VP& :"R- 0 R80SJ 0  V 0P 0PʬR Ѝ |z xv@ Ѝn A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,APP  D0HRD0000H p0$`!bP@0SЍPЍ0@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED   0  PI jL1D00S*Y p$`(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @X|$000@-@PM0 pp  00C  ?o2 0 mPP <Ѝ0PЍ0tDH@- @  0M 0LЍ-QPDM00  ( 0@4ЍP8 /0@-0CM 00 @0C0 0 0D NЍQP<O-DM@hlp0tx`PP RK TNP@[ B^@D࠳UEpAPpWAA^APU0E pCPpW\[4AAA!p @lp0,00@0@0*l@0 @ V 0 000@ X@* p0Y  DЍ   Q Pp X@* 0Q0 00C0CO-P 0@000DL0 0  0SO (@@000h0S80@080 L00S$0>, 0(0\ ,0!0 8C8  S^LPQL00 (00SCL00SW ( R), LP S800,0 1G$00Q$0 0\ 0(0AQ 0 , S(0 0 00,1$00 04 S 80pLH0@0D00|00p 0SL01H@804 0,0000t,04 0Y 0Y 000S`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP  YqH @ R  T000P P 00 SPS P*0 R00S 00P ɟ`V0 0CS SjpO 0 AS0 S P0P ` P R  0R  `9,00Se@ Q0C0] 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   `   (`R r  @HDHT,0Q0 L000Sdl8, 0@000h0S(00S80y00S3 80r 7r 8, 0`V 00PU0 0CS<0 HDD<0NN Œ Č Ȍ N LL\oɟ`V?A8 T0V T@00D R 0 R PPZ| ! YR  sY $Rh  0E0 |0p`   0E  @000$R , l6@  ]@000!R 4x9 8000Vv00C000C05, 00S?0X *1h"0 , 50H 0 8  0 4P, @ (ep$`t00S000 @0p 111qWP40 @00 00S~ 0 5# X0:h280V @ l40S 0S84, 0pQ0A0 0C0胟 10 0 SPP 1 11RY@z RRQ] 0    U,Q Q !PB"`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00} XX0*P0P0;^O L00S6(080 { 800  L,10  Np`dЍ80GL008 0080@080+ R d1SdЍ( 0 09x \0, p0, Q0A`0Չ8`! ,\'PY @xa`0 |LYTtXWHON /8,  @00 0@ ` `(0,0 000 0S 0 PC@08 0 0U0P$b pQ_ R$R $Ry X  QCH5S@  9, @` 0  `q@0 0p0 `d00P n 0@` 0 B00b 0P PG00 p 0 P;+ 40U( R X R$R`V_ 0 0 0 " ;, @p@`0 0`oUH%RPR p RO $R $R X  Q R; L5S>  ;, @` H0  `@0 0p;0 `00P  +0@` 0 B00 0P v  Q@ 0`00 0 @000P  T P$ , (=@ 000 @000P" , |=0 0  0 A R! U =, @@p0 0p1S U >, @`@0 0PL5S 0 0RU l>, @@p0 0Lp00 0  :@000E, >@ 0`C00`0 $@000tW , q 0 U@`; 0 0LaP2Pj @00 pRU xʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0 0H`%UnH50S0X0S* 0 0 0 0, @p@0 0H` U~00 0  @000jP$pPb?lBp@-@PPMP0 0`0 R    80x t000 0 00P 0  Ѝp80 D000 0 B/ 0C?0Ѝpp0 00ꄔDC-@P⨐M 048! \` d0hlp`PpPa80  D000 0 B0C 0/? 0ЍЍ\@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT :#| cp @V0 S0( ?3 S 0S1S0 S  |0 00HD 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $`U0 VP `"Vp`|0P 0@PUpT` @ T @pp ! !@-@P@~T R/0A-p,SP` @T @~T0`SP RQ A0@ ", "Q//@-pQ'`P@0D "! "T "! "U ^ 0N "! "\^`WP@@-@@@0S $0P0C$0MlFO-M:z*0p$P( ,pP `*00\c S@@s  nRXan HR@ @j`40IS0c0@T ^ጰOoB@TP AA  RT0)\ 0  |  bR\ `)` R&P) R! CP'(I@, 4R S[80S $$ 0P00B$0X @C, 4R CPg S ^\ p( 00Q P80, H04(0RK0((H 0@0( ~ $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S  0P$0@P$X70 R(,Ѝ<7 0( X$(00 SB G @ `5 & (00 S5$&P0C (00xP0S $0P0C$0*x&  l&@ 0,@(@ R 50060, 40RofF`@0,0 $P,40 P@0(@Sg 00 CRcڴ%%  pp% x%@ 0p(`Y w| `nR`F`V,00P0S   $ 0P00B$0X@@aV  @ Q[Q $ 0(@0C,000 0CS[ pH40,@4!0,01010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# ? l# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R w$@ P  @ lP "  20,  , k40 S [ (L2 0$ ,B@0S H$ 0P00B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S $ 0P00B$0,@%A@0S $ 0P00B$0 ,@F|EDhDDHCCpChCBBpBL>=`==<<d<P<;O-lsl3phC@00 M S 4000400c`(,P Zn34@3`0T'#0C S402PL좟 >0@DS(00S0 0l0S R "0 0 204@,P0T0hP \RP0 @P 0( 0CS eP 20 0 P1040 ,( Ѝ00S00h0S00}1 0T0  P,P@ ~@1(`0 R*T$ !P00 @T 0 R 0 P$ 00 00l P @T00,P0 0( p0  04@SRCPE@D4@P,K 00SL004P0:X::h:l9`988777<7(@- 004 (,6(@- 004 (,6|1|!0O- p *⨒YX!X P!0P[& Z( 0S!,ppG`P@0   R    P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0~0 00 08QD0S0l%R h%R /!R!RtP/P//T} 0 000 0P/|G-MupP/ 5` 80s2 hD  SP̠r HR!1S85@050 50 `\P 400 ~0P 400 s40 0:p@00@00l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q j`S`" Q _SP Q kS` Q[PS ڃ0Y[=20  0S R!=@-pBt000 0SD"D2 R8Ÿ8 =01U+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  Y)PUЍY 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf STc|,3l0hx0\1P0PP PKPK 8 QD\B @- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //v,ķ1P0= 00` P7ʀ:l2 S3030 /@ P0000CS000000000000000000/0u@-P@M@&\\ Y #3t P P 00 '000 0 iЍtl`P -P\P Y # /Ds0 0 |  0S h h0 8=0!H00 R/@- r8,T*0*((1 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R  AR  r\,)\)pR0 000:h/pp@-P@0@`M0*l"R R &Ѝp`   P H000 40@ 00 @ &Ѝpplx02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20lL100 C0剑Q:20h1=00Q!0S0`20 000 #0剑Q:20t 000 0`0`U0!Q 00`I0!Q 'ol0 0 0/m|0| 0p@- @00CS0 S 0 S P00npP0hm0p@-0CS@0 S 0 S P00PpP0000 0p@-00Pv@<pllp@-Pv@2p 0 00S  @-@J Q P\,Q    @/ lD0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp03O-0PP`$MC@ V ivpP 0h#0C S-000$ЍpT0 S80  2 0@ᡪ  B@DT p`$ЍIɟ,0 AA!R1A0 CQc(^01H1H1PWZ0!! ! :  hJ T0@ ?Zq $`P@ rP, @ T  @ PW0(@p TDI0WD@0 (0C\00Cb$Ѝ\ X@ @  D0|0_p H0001@D T `V `tV ``  @~H$j0 0 xfDp@-@Pppp@@0@0p@- P@ ppp@,fDX6O-0lM@P,0 g Q 0pRu`P^ Pq0P0X W  0P <0R0 080ąP 0@SF00800`P0S P0 0 0PEPUS 080 00PS0P<0< ,5 000`Pp0 @R <0T R8 / 0<00800C?80t0P`FtPY`00 t, h480 pP p8K 080 `0`p8ppP P8 0E<,Q4pQpP Qձpp( X< R!! B qH" RW`!: pGUH0< S8 8 `< (P4@p$0,0 1400H0p@0 @0 0D#PU<$0 (Q0 0C0 Ss 0( 0C04 Q00SP{ 80 0B Nt,0"8 P 0PI00 08p0l8 0n800C?80-t0pGP0C00S`FT t0pP0000C0P00 0PS8 0E!q Xi 0 0H000ᰡH XD0|0prlЍ80< p` 0<0T pR0`<0 yPo 0;rlЍ`~reX0 0 Zl_Dp@-@`Ppp p@L J0 0 B_Dp@-@Ppp p@5Hp@-P@0 0@`  pp p@!^DD0D0p@- P@ pp p@ \^D0p@-0P `@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``^O-SؑM D@HP 0T p @` 0Z  A 4/ 0[ 8 $[0<SD100.0S0!10>0P 0@0 0}00 0GP8  #8 S R0 0?2P4/ZXЍ0G\8  #8 S R@0p0pP4/pW\tQ# @-@M  R ! R "R pP^ 0 0 @`Ѝ/@-0QM   S S PpP$<R@ @ 6Ѝ`Z<@- M@0 @!ЍL0L0 @-@ 0 ,M@  ЍDtY p@-B\\@0N ^\1  @ %  ^ ,\'\{ X"LB!!N0 ("!! L0 }p % !  ; { \PU@ 0 ER7d!@`PP   P0 B! {c\ "0  '  p @ p %X  + {p\\:\ c YQO-$M nPE@PP 0@%pp 0 6S pp; @`\,S 0  @000 S  P~%S+0LGS00 %0i\@0 `f` 00#1.Q0*Q 0 S @0 SPQ0% p  0  @0d\% 00 @ d @ 0 S4p300 0L0   0  00 < @ 70 0@D0 (@00{0 S[o 00P$Ѝ0 SQ0%  p  0   0 @%@  c  t 0 SQ 0% p    0  V0% +c@ @  00@Q0 S0 0 @0  0" T 0@40  0 @0  0 T0 S\R$ W. 0C00 S $0< n>0 / 0 w0`f S` 0S0\S 0 Sa0 000 Vp@-@P0P`M0S SP!  00 0!Pl 0 Q00Q H  < x0  Ѝp#0P@,A-M0PSL!00@0@P0S? 0  ` x!~r!!`"bNL LL 0 0210B q-0P pW$P@WP 0fSPЍЍ 0ЍO(NgA-M0PSL!00@0@p0SE v 0 ` !^RRN  L !0 120B Q0P pW$P@TP 0nSPЍ"0ЍЍNkL>G-M0S!0 0`0@0S[  0p P T1T I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qhP)0< X" pW $@r0sSTP @WXV @T mPPPЍЍL4-?L*S0 O-TMl7kPPPR ,$   0: 0 @P> 5e000` 0: @P 0S  R 0Z I #Z =Z =P  00pP0 p WdZ p ^0 0X*SUl0P0 0S, 00    ZP  VmY P mq0,0@1 0s p3$ 112cAP3L112c B L00'pr!qpC 0qP  0 p@B `@Hp, @W 0S  m = @P0P l WP00TЍ  0  x "$p΀‚ €‚ N G !1 qrpB 0qPK  @:p 0pp K`1 $ ϊ0K $$N04!b1c$!b1c0N K 00  0ɉ)1i1c1B뉑P 0tS0cS0Spp~G@ < pPUY 2l00u<6gݵNl4(kL>t*S-?LA-pP`0\ %\0@pS sS lS P0\UUW o000@1CP0PCV`1E !^00O-Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ   Rp| PA0JlRpY PA0Ja0J Ro11OSr00qߍI@[/hP 00040hP, 000#pRp  Pp1l X   QU PEQQQ W! 340`0 R,R*P  0Ip 40P040 P PPp1  \1SB 0C111S? Z! J 02( R 'ZPOQ0S'Sl! 0S'S'SX AT 0DS11a x7@D!&J0qAVZ ຠ `OTb1p@ aAl!AT @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ6 10}RRl1  R}R}RP!R[ 1h BY!u S400 P1`Q,*P  0ᓁpa 40040l10J Rg1lp1OS!!0Pl1XAT @D`1AP OT1a@0A1B0Sl00l0 0St00t060S&   ?R ;R P0S %S0 01S/ 0C11AT, 400 Q,,*P  4 @ , 40,0PPp1DA0JS30J1OS!0l1 00@1@`hPx 400`,Vp p2hPm 400p,000S   ?R ;RN eRQf P0S %S0 0AT @D1! AOTA 01!0l1`V Ở```&``VP``P``ø`@oobP``V ᗽ``@Q AIQ AAT6 @D1!Z!oA媢Vp p22hP 400p,PWu0`0o`00k01 0&J GZ @pp]00Y00xU!J0o ᪢0M00*H0 0vV@``pO`V@`pJ@`fpF@opB`@p>@oopb94Dv'  V8l- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/ A-PQMp@ 0S XD eY PE _\qp4P0  ۍЍCD0P L  |P<0 \0P 0S/S bpP xeX0 ۍЍC0  PۍЍ  p 0gd XW L0L 0 (04ۍЍ,0, 0 04$0<G-p`@P  ^PdU  UP `P@PFP @T P  0@010G-@- M@00 Ѝ@ Ѝ/> Ѝ@ Ѝ/@-@xdvdtd@rdpd nd0ld@id 0p@-S@M 0  Ѝp0`P0 0  00` 0 Ѝp 0p@-PS@:pS QcP!paC- M P@U pᬐ`0fV@@PU   W0 nV sV { PU  @0p00 Ѝ R@@@O- M PU( `pfSPU  R |@8C80@P 0nS sS  =@PU@@300 Ѝ 0S00PA-P% Ppp R,R    0S,S@BMa`P   `00ppp@ȟ8C-@r Mp`P(P:pW`*nUB sUc fUH0D Y2R4 @ bP( H0D@ pH0@0 H0H0nUp@0 H PY sU> fU& L00L0 Ѝ @CP Ѝ@P ` 0S0080Y 80 H0@ HL00L0 80(x400H0@ 400oH0@04 H00gH04 0H0L00L0 @H0R ,0 0SH00H000, R0 0GH00H0 D0O-M@0[ ` Z p p(080H0Z`P; P  `00   ἀ0[0   0 pZ0 0   0 0  0 @ 0@Ѝ 1 !00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S008A-`P0PUM@p"S& 4aP !P  ᴀz00V0  po  00 0ЍPЍ_ pY  O-P@ 04M 0"P a`Y`5   p`0P  0- a`| Y@P  @`0P a4Ѝ  0 a a,0Y (0 0$0,0% \@ ,`, AR   0S00XPw Y  Tr  " faLp W@H @ D L G ,` $fX7  0 @P- pW;  BHDDnXDH sX  "0 S   ,@ 00 a4Ѝ  B $ a,T>WH9W@PA-P`0`VM@p(S, `P$ A`  㶀J0 00PA00 09 0 0 0ЍPЍe^0@-P pW M@`R _P 0 `0  00P 00 0 ЍP Ѝ8^O-LM<0 <p*0 0,, 0@P ||P0`0PP  p00 ZP_V PD}9P_P!_PP @ @P W 0V 0,P * 0p100#$0L90400 0IyX 0s 0PQ ,P  0S $ .S  ROS9 = P# @PV xhFhv 0n P D]WD00S P P& 0 " 0S v 0# 000 000 0 n0=0TS 0  0 00 0S(00W8 ( ^8 0S)_9PLЍ @0@S* Hx00 000 000 f0Pr[N (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0&0HS y  0lP (p70 FQ4E F/R) ` pV@ V,%`  @ ` @ T%,  / P P``P` p(\8 ]@T@@B`  4X Yx0 0MPDx0  80g80P p` P P P P P P P 0  80@80P P?U P#v 0 S00Pp`@ 0AP<, ,0  80W80V0@A T@@p`F 0 00000000 s0P (p]@ Hx] hFhv9 @0n DPH 0S00 @P>qPVVp wP:p0  0F(p%ᝓP00P hFhv0 0@s 0 P0Ph 0  S 0 x[ ^LЍ  0Mt  mG0 0 a;h<  `Z4 p(dLh4ȈP/U$P00//ᬉ0@-MP0 @ 0^S!1l!1"b2cNL 00$@B!A@C0?PЍ0gݵN8 P0`0K?//Ĉp@-MP0 @O 0nPcl b N00PEK 20$AB@C1dPЍp>kLX$0P00?//؇p@-M`m0 @@?MD@D P0ec`E $`L0b!b4!b ER1c1cL 0P0@$D$C!d!bA@C1PЍp蔧-?L*Sp@-0MP0`2@P 0Ѝp\, 0 0S Q20Ѝp1!0G-@q0PP03 0 4`S 0`02,0XPP00|Q``  FVPe`EȄQ  ;V|0`0ȇ`H00dL@-@P \\\ \$\,\\,00!R  ! 001/ 001P/ P/К@--@P X@X0@00s@ H PJI HH @hpp@- @-C(M3@ @`3P0R kU{F{{!00 (ЍpPm P 300 U  {Ukk!00 PS ~P 0300 U 2 0"P  0cP0z200{U 0kkP PA  0cP0wʜ200U 0d2ŀ2""P  0cP0P200U 0 0"P  0cP0200U 0 P  0cP0100^U 0 !1""JP{  k0cP0Gd100U 0I B \0cP0f,100U 0V1""dPS  I0cP0a000U 0Q0""QPP  60cP0ʜ000U 0uh0"">P  #??p`țp ԚG|0H@0cP0Y,000U 0 0" P:  0cP0t00I? 0 0Ō0U"f P  0cP000E?{U 0kk] P  0cP0!t30A?{U 0kkt P&  0cP0,300U 03""P  0cP0o20t0U 0_2""P  0cP0ʠ20l0U 02""P  {0cP0iX2000U 0Yd2""Ps  h0cP0:200y{U 0{ qP+  V0cP010h{U 0{  `P  E0cP0Aʌ10W?U 01\1""MP  20cP02D100uU 0 ;P  0cP010S?U 00""(P  0cP0Mʸ00\0U 0=|0""PT  0cP0p00P0U 0`0""P  \ĕx0X  GԒ<0cP0Z,00@0U 0J@0""P  0cP0p00O? 0U0"g P  0cP0ʸ00M? 0U0"  P  0cP0%10I?{*Rk 0F{U{O P  0cP0D30l0U 0d3""P  p0cP020d0U 03""xP  ]0cP0ʴ20\0U 02""eP  J0cP0xl20S?U 0hX2""RPe  70cP0i(20Q? 0U0" ?P  $0cP010d0 0U0" ,P  0cP0ʘ10E?XkU 0{{ P  0cP0P10t0U 0(1""P}  0cP0 10 00U 0T P  0cP0ʼ00W?U 0s0""P  0cP0t00P0U 0b P  LGhЏ|4 ԍLj4ԌT0cP0PP00\0 0U0"& P  0cP0Wʘ00d0U 0G0""P6  l0cP000l0 0U0" tP  YnP  S,100 1,1 U""00 Ch100t10K?Q10G?c|1 U""00 -10|01001 U"x"00 100i1 U""00 2080{Ukk!00 30Y?300|3 U""00 X30T0L30N??@3 U"i!00 30p0Z2 U""00 20U?20R?2 U"m!00 20`020=x2 U"J[!00 h20h0;\200P20C? 2 U"E!00 20p0200:1 U"r3!00 10U?c1 U"%"00 s10H010K?X1 U"!00 ah10`0\10h0;1 U""00 O(10Y?z0 U"T!00 A00|0E00`000G?*00T0s00(0J`0 U"!00 #00h0000ԋT ԊĊ|l4$l\$܈̈td{Ukk!00 3003 U""00 300{Ukk=!00 P300.D300=L3 "ZI I 3 "UMl"00 2009{Ukk^!00 200x{UkkP!00 20p04G"00 B"00 P200D200A  :PI S @ ~+"00 y&"00 t!!00 o!00 jkk!00 c"00 ^ "00 Y!00 T"00 O"00 J"00 E!00 @kk!00 9"00 40Sj !00 ,0SE !00 $0S !00 0S !00 )P  0S !00 -DT! @t<,І`(0S !00 0S "00 0S !00 0Sm "00 0S5 !00 0S  y"00 0S q!00 0S9 i!00 0S a!00 0S Y!00 0S Q!00 0SI I!00 0S A!00 0S 9!00 0S 1!00 0S )!00 w0S !!00 o0S !00 g0S "00 _0S "00 W0S !00 O0S !00 G0S !00 ?0S "00 70S !00 /,3 H "}P !H H 3 "0S#!00 0S !00 `300T300%"00 "00 "00 "00 "00 "00 "00 "00 "00 "00 "00 I I \2""T2L0 02(0 0u|20 0z;T20 0k,20 0u20 01t0 0 1P0 01,0 0 ~d10 0t@<100 %j!00 T10 0\U00 0R[0h0 0H*? ~~~~X~0~~}}}h}0}}||{{{l{D{{zzzHzzyyyLy(y(y0 @@ l 0H00 0 p00 000 0[00 0 00 0kJ1 @@ T 0\H1 @@  010 02\10 0/1 @@a  0T>!00 280 0D2\0 0l20 0e)2 @@0  0r2 @@"  0d3 0 0!Z,3,0 0 P @!A*?B0CS Ϡ-S)!R#  S Q0 {+C 7G 03S S 0A.B B03200P1046nT kȠȠ+S 0+C{6F{7 +S0+C{h{/ /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! bV @D8 [,0400GT,0 4 00(  @(4/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?0>$ R&4000  0`h>@0U 0PEd@T$0S`0  0@>`0U 0PEd@T$0S  &$   0   0c 0$ @R`x=`0Ut 0PEd@Tf80070  Q 0SU 0PEd@T 0S 60> 00L70U 0PEd@T:0D 10*D0 6a@Ddh0lZX0 #P$U 0PEd@ 0S\6c@D0l0Z$\6 R] ?0S50>00(60QDZI U01Z!Zh 0 PE C0 p 00D0 0CD00i`l Qv(T%  UI 0PEd@00Rl @Da0^ T 0 $ R40,0000 400U"  PEd@T   !R 840d0U 0PEd@ T: ,H06l0*H0; @D 0;  0$ R# D  $ R# D $ R$# 0+R D U1!Z $Q ^ LQ0Q 0 B0 ! 0  0D PE B pD R000 R=0W U 0PEd@T20F?o20X$0S 0   l"L2$&$B0#22cR0S 2000d20D10 PN6c@D;D10 Rp 0 B D  0h10)@`Uc 0PEd@T$0D`S`  0 "H@+`kUJ G $0S  $P (D0 S2D57ZU0  0 $ $ ZPEp'0? 00,??u4u6?7?8?=?>?N?P?5?rJ?M?oH?A?L?m mk\klj:?;?0,( 粠*@D6`%R l!B0$ Q0l0S>0p0P00X0?0X00 p0tP 40> "@z 50>050f8 0p0P0X 0㽯X0tp0 (0$$(0P, 80> 0080 0c&80>ꦀSR: 3@ 0@l0%(9@0A@ `d p T  \ \  h }P |90>(w0S90<Hp@-@)PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  < 90S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /X#X3 C- M0P000@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 2#\p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R*0Q  R*0Q  R:0l00p0C0l0pSp)x 000 0P,04R0p0 p0 0 0 30 Ѝl0Sppl0 @@@ ̿S???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pW`P 0!(`3/@P] 8X: (0 ( 03/PM 8 $8! P S>0Rp*p  BS>00p0(0 #88@oRS B P T X B T p 0Bp8 p P S>0Rp*pS. 0A p oR$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰PX 0C00$P $`0p sRpW0- p p0 Ѝ0` Q`V00p=J\S30b608#8P0X 00C∀ R"P @X\!\ 0!01 002T 0# T 0SЍ0W0T0S Ѝ 0D?o240%R00S0020 0(0@0 ,000@(,04@ 0 B80 0 0$ 0PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0=l0\000Sm tP `H0P` R P lp"p  G R lp` h0S:l R1#P0 6SF \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 Bl0\0~00SЍO-tdt`,M Pt \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ3@0 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tR` l H 07#0H0Xl \0P8 B Kl0\000S,Ѝ806&6!Ɖ909t6l L Qtl \e /t0 S` R S; SY`l r (l `m 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 l0\0l0P,Ѝ\P80 B0 l0\0Y00S,ЍPO-@ ,0K[ 01PQM  o 蔟   PBS0U000u 0 0 0B 0 %B  0B 0 #40B V \0U8`1 \0 0  PE B    \0UW %6*0Q1A4:\0l` p`F0 S P!P1UP!U:Spp   W  B0  0 PUp` , 8 RKAƋ,l &\ PUp`l& RƋ5V`(0'

 0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0O00S8#  #800#"0 ꔎzB0 0 0 0 0 S0 S 00R01 00 q00 R000 0 0&*W6: &R \ R80l0 C 0 B 0=L0DC0C qt0S*l0\06y\0l S8  B0 l0\000S10f\ R80l0 C  A-`pPTqP@B Q00V0SI0S: (0sT Q 1@0@!A00000 |0`cp( 0S*t l00\ R$6S S L D0 B C060@D0 0!1 0Rpplihp@-@3PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S{ $0Ss wpVjV`F0HSs0FSRo WmZkYFo᫲[dV @!( `4/@Pi !@  X  P "L  BT *   A0`, `4 ( P6/ `, 8(6/ `L @(6/j 0 D(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO|v `fp00$0` (0} Ѝ8  40 000&z -M 0 0 AЍA-PCU_8 `+p! 0(3/@PR T!@  0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/O-@QM R0p  0S " !,"pDP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4T@ RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C @0S |0 " !S," ЍL ""pR1C2PvL lD4 A-PR` @pPp 011   0" C  .P p@1   0" C !& A-PR` @pPp 011   0" C  .P p@1   0" C !& p@-@P |`|`P@P 01ē1   0" C  @pPp p@-@P |`|`P@P 01ē1   0" C  @pPpH @-18@ 0,C    G-Rx 'xh Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#pG7&c20N 1pW|GpG|1^NNPV=F10C=@L   0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq'R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/%U/0S0`0/ /HW$2F56@-S k>@@0 #400k.06S0 k΁ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @O-@ 00 0pd0 1Z \Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C0/ LQ @00^ P0 00U00S@ T R 000 R0@ T<ЍW@  xyQ / !02@X1Z Gೠ6;#6pQ^p N00=C-@TppR!ಐN0+m^\hT( Y!. Q A^0 pR% \LANpR 9 ^0@ Tp9  \ʰ Q ^0 Rp^0@ Q ^0 pQ^0 p^0@ Tp@@  @O-MⲰ[00Rv!+z   k@T`[0 Y ANP@>d8Y#8WD@ 000 #4060cUS8#8 P >b8Y#8 000#406 B 0cUS8#8@DHR$H&"0("(P P  0#4PP0&0bTC8 B#8V0&7 V0Q PV  ANk`P弦P0ᾐ:`i8Z#8`I 0 00#4 0编0iUS8 #8 R0἖P`U0S P U`0^ `0 V \0ʀP` TH P尐P eY*P0帠PE0#406P0cY ) UV BU@X%Xk>PP@P.V@nR$ N D0Qi PU ` k Pᶐ>i8Z#8I0 00#4 060cUS8#8 ^S B@P.k>@P.V@nR$ N 0Q$ PV(0S `0 _28 #8 P `0^0  U4 `P 0SЍ@@DH$Hk>PV㸐V @DH$H>k.V0v `0 %0S `0 0S `0 ^ U P   @ Mʀ6O-SM 4004`003k^0 0300300 !A 9@b8 T#8@p000@p#406 B 0c^&6S6 @ 编0`$0 pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>Y8#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&02Pa8R#8  P`0`00 @#4PP0&A0b^8 #8k0&Ѝ 0&0p0v, 0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&BʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@Y, R 0)p&]#P+}(+z0N  q/ ! RF@P j   Q& R \3 "[$k 0("( Z:38#80 00#40缦0jR#8 J#8+ ZB!(:ἦ 8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦ8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦ8#8kΆ000#4 0缦0jQ J!PMk>⼦ / ! Z! ! 缦jR! J!^ἦ 2 / Mx  \ P+R +R ,RE R  Q ,Q3 "[R&k R0i 2 8#8000 #40&0bP8 B#8pk0&N.V G.0 0R0 0xS0  0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOi 8#8#8#8!88#8!28 #80  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P 0@ Cp`BVUV `%P 9%/@- M`@p)PP PM   B `p "- @P  Ѝ臼 0@0 Ѝ耼0@0{@ -T  Ѝp@-P(@P @00pg 00p@-@(0P 0 00W 00Tp@-MP`(@P P @ 00hBp ,PЍp9P,U 3PЍp0A-S ` 0@ Cp4P%BU 0 B%0PP$yara0A-S ` 0@ CpPBU 0 %0PPx$tcid0S A- p@0 CP`AV `ӻ/0S A- `@0 CpPAU $,0PP崻?$/yara0S A- `@0 CpPAU $,0PP咻$/tcid0@- M@ Ap  P Ѝ0y Ѝ0u0 0 Ѝ00@- M@ Ap D  P Ѝ0_ Ѝ0[0 0 Ѝ0yara0@- M@ uAp D  P Ѝ0D Ѝ0@0 0 Ѝ0tcid- M Ѝ- M Ѝtcidp@-@PR$0PPptcidp@-@PF$$0P p00ploobp@-P`@PP  EP#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@/ @-@@L @-@@e @-@@~ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@@3@-@~@J@-@x@a@-@r@yp@-P` @PP  P#pp@-P`p @PP  P"pp@-P`^ @PP  P"pp@-P`L @PP  P"pp@-P`0P8 @PP  qP"pp@-P`& @PP  _P"pp@-P` @PP  MP"pp@-P` @PP  ;P"pp@-P` @PP  )Pq"pp@-P`0P @PP  P]"pp@-P` @PP  PK"pp@-P` @PP  P9"pp@-P` @PP  P'"pp@-P` @PP  P"pp@-P`0P @PP  P"pp@-P` @PP  P!pp@-P`t @PP  P!pp@-P`b @PP  P!pp@-P`P @PP  qP!pp@-P`0P< @PP  ]P!pp@-P@<"(0P p*0P 0pgntsp@-P`@PP  :P!pp@-P`@PP  )Pq!pp@-`P@"<P pP U patadp@-P`@PP  PG!pp@-P`@PP  P5!pA-P@!X0P p&`P  P `)gntsp@-Pn@!(0P p0P 0pgntsp@-P`*@PP  P pp@-P`@PP  P pp@-@RP P pp@-@Pp!$0P p00ploobp@-P`@PP  P pp@-P@PP  P p@-@@ @-@@ @-@@ @-@}@ @-@w@; @-@q@J @-@k@g @-@e@ @-@_@ @-@Y@ @-@S@ @-@M@ @-@G@ @-@A@ @-@;@# @-@5@6 @-@/@N @-@)@e @-@#@| @-@@ p@-P`@PP  3P p0p@-P@PP eP pp@-P`z@PP  Pp0p@-Ph@PP BPpp@-P`W@PP  Pp0p@-PE@PP Ppp@-P`4@PP  Pp0p@-P"@PP Ppp@-P`0P@PP  Ppp@-P0P@PP P~pp@-P`@PP  Plp0p@-P@PP P[pp@-P`@PP  ^PIp0p@-P@PP P8pp@-P`@PP  ;P&p0p@-P@PP mPpp@-P`@PP  Pp0p@-Pp@PP JPpp@-P`0P]@PP  Ppp@-P0PJ@PP $Ppp@-P`Q@PP  Pp p@-P?@PP Ppp@-P`.@PP  Pp p@-P@PP Ppp@-P` @PP  Ptp p@-P@PP Pcpp@-P`@PP  fPQp p@-P@PP P@pp@-P`0P@PP  AP,pp@-P0P@PP rPpp@-P`@PP  Pp p@-P@PP OPpp@-P`|@PP  Pp p@-Pj@PP ,Ppp@-P`Y@PP  Pp p@-PG@PP  Ppp@-P`6@PP  Pp p@-P$@PP Ppp@-P`0P@PP  Pzpp@-P0P@PP Phpp@-PO@(0P p0P 0pgntsp@-P`{@PP  ZPEpp@-Pk@PP P6pp@-P`a@PP  :P%pp@-PQ@PP nPpp@-`P@<P pP U patadp@-P`L@PP  Ppp@-P`[@PP  Ppp@-P (@PP !Ppp@-P 8@PP PpA-P@OX0P 2pX"`P  IP `$gntsp@-P@1(0P p0P 0pgntsp@-P`@PP  Pwpp@-P@PP Phpp@-P`@PP  lPWpp@-P@PP PHpp@-@QP P>pp@-@RP IP4pp@-@0 P )$'$p@PP!0S !p!0@- @@!P 0R @-P Q o//  P ၮt0, @-H @-P Q @o0ft0 Hg0 H t 0S p@- X@`@@PKPpP p@ DA-P`p)" E!@P  ~P` pp9!ӪP` q0!U @x#'!o#l#p@-P @`Pp;P p@1@- !@P $ 90 0 0 A-pP @P  &0 0 0 QP `P  ᚱ` P((0 H\@L /@-@P 2@ k0E/HE }-A-M `V $P0 PW:@P pP  0PK: EЍAЍ/ЍAЍ/>Q/H U 00 @-@P @ $0E/Hh }p@-@P x0 0 0R0 P] 0P Q " p@pp@  p@-@P `0 0 0R P; 0P Q " p@p L P/0 0 0R /4 P/<0 0 0R0/P///  0P p@-  o QP  QQ x"/ L P/ 0 0 0R/, @-@P \0 0 0R  0P Q O"00  P/00 0 0RP/// X A-PPM 00 0/o"P R Ѝ R0 0 p`P 0 S  R L  Y/<9 P` !  000  d X A-@PM 0 0 0R ЍQP 0 Ū 0pO`P 0S `  Y/P9 pP` !(00 [?-H0  t ; P H0-0 0/o"^ R  Rv/DP/D0 0 0R /@-P o P/D0 0 0R /@-P ߫oH P p00 0/o"\ R RP Q  Q๫ /0 fP 40 0 0RP फ/t f(0A-SM`.P@U Ѝ0 PP pP 00 0P+ S(P0S0"Q00+ x@P \ 0 0 0 @Ѝ, gP  x8 P 00#0 0 P 0S S R/P/ R0/  @-@4dP.0p@-S(M/ {@! S   P{ 7` `P -P 3(ЍpX  (ЍpD P { 7$0\ x} 0L 0 $@-@0 @-$@@T4 00 S 0 P :\03#/S 0 P \0///A-P``@P (pP  ˦@P W@s$$0 xx M 00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ |Ѝ00@-M @P  @ nЍ00@-M @P  @ `Ѝ0@-@P ,0 0 0R@ /P/0 0 0R / 00 !S R!* R0*/ - ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //P $0 0 0R //HP $0 0 0R //P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/\P/x0 0 0R / 00 !R0* / - ^ :P/x0 0 0R / 00 !R0* / - ^ :TP/@0 0 0R / 0 0 S /P/x0 0 0R / 00 !R0* / - ^ :tP/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/lP/x0 0 0R / 00 !R0* / - ^ :P/@0 0 0R / 0 0 S /dP/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/P/d0 0 0R / 00 !S/ / P %:/(P/d0 0 0R / 00 !S/ / P %:/P/P0 0 0R / 00 R/! /8P/d0 0 0R / 00 !S/ / P %:/P/`0 0 0R / 00 ! R0* /  \ 5*/\P/`0 0 0R / 00 !R0* / \ 1*/P/d0 0 0R / 00 !S/ / P %:/tP/P0 0 0R / 00 R/! / P H0-0 0/o"^ R  R{/P/L \ /  JQ\/<P/L \ /  JQ\/P/P \ / Q/S/Q\/|P/P \ / Q/S/Q\/C-M0PP0p00 00 pS Ѝ(@Y` +0B( 0R0xSH V 0Ps&*0 00 0S  P Ѝ2 g0Ps:&0"S!0"S bqp 0 00 P  0"S@ O-MM(@PzH100 p0$`0(0 00[ Q`$ 0 `;/0 `P Mߍ RP0 3/P 00 $ 0 :/P 000 dPMߍ |0p@-PP0:A@L7LT#H0a`L8 0L0WL8V @#88#8P0p ^pO-KM3 `0 0R@ @@@$@@@(@0 0C0S5 0fSQ ="SE [Sl2 0 @3/P 0p0 0 ̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RẅP0/S7 0(00>S: SA 0S p03  0B0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8⮦ S =SB0"SQ0SN   0"R "R RAC$ >R<0 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Pn \P@ V   WP UP PS00S@Ѝ pR ;R@  uR[R<\ BR  ;R@<{  @d0 8"R /R  0mP 0 +("( R:Y Y +     SP,0 Rg \Rd  uR` > PZ +  PU6I0     0 # <  P,!*-"-  ƠP  *  (  ""0 . ".  ŸO- M @ 0D0S<^QQ@Q  0>S 0 T @P (0SP  R @ ЍT" T& @❃P0 S00qP @P T eP0S  0SP D HG-P-M`"@PL ,{+pC ,pF 0F fppSp>C0 ӌPP u+u&  0 p `,9Ѝ00`0 ୌp``,$`Ѝ C+`Ao/A-PP P`p @@P@@@P p40,p0P4080<0x  @-p@ ؒL@-$@@u , d`@-@@O-4@T ,p` MP @D¤@@`T P礀Qㅑ8080 0٣PZ PZ P蔸  @-R 0P< P 4Q ,  4)`0 0⬣0 0⥣ ȷ p@-M@4 00R1SP,0S@R 1`V, P` 0 0:P 40, 0C40P" ;`ЍpS" R3d/ЍpЍphZ<.0aPPj?.0Z<co?.0S$$N?.0L븶 y d iA-P`,p@P W 0 !j,@0`,@0`C-`0SM@PpH  P 00Ѝ! .0P ,0SW ! v/0P ,0S(0S00 0cP 0S?0S0"SZ0:S Q0}S "S000"S vWP  QP \ @@ 0fP m$$w?{/0⤢` 0 8 , ij 0p@-S T  Q @PPp`0!.0⃢D@ 0S ,0 00?%.@-0q 4 @-R , B04 P @ 00'>/0Zo?/0S뜲  80O-M@ Ѝ@Pp4 B`P @ p @%Ѝ娒 y ݛ`P0 004QY  4 ,R\ 牱Q1v  i P 0YIV  B B!>,0 ` 04 p<0 04 <0 a̝`,VM<V7V+RY& xx@ ` E ቛ`P( ~ =0,S<SS8 uPw @<0 0`p4 <0y<! ,0` ᱛY`  |,\0\02.0␡LW?/0≡4?/0₡HX@p 2X < p@-@PPg0S D  Q<0  0p@X`0/0] p@-@P 0`0VPP h h0 0  0@S<0  0pPp `0/028< 0O-S M@PT p}`40SP p `pP@ ЍSP P 00S 0r  A> 00-PY 10Z/ @0R+ P$ [] P 07P 0S P( Hqp4` ЍO Q P 0  03/P  40R1# P P6>/0⟠q 00C 0 P l`/@yTT?/0∠@+? 0†T$ `  4T 8 \@-@0,S<SS&?/0\먞 PG-V pP0`WSW@6 404 S @ 8 6S3 E000,0 100,0$ 100,0, P   @ ?o2\0S0S P@P :  404 SS@  @<<-B> 0$$-F> 0| ! 7G-PS @- Y`' T 0p 0R   004 00R$ uP 0S 0 GwXXG>I.00⭟&0,S <2.0➟P 1 GFG-PP' 0 0R"p49`P 4 R @,0儡ᄑ1 / - ,04 儑@ 0T:80804 a`(0P 0  Q@-P80080/pp@-P@E80080p@>p@-@P 80 0R@ pP04@-pp@-@P \0 0R@ p`P00S@#:p@p@-P@@pA-PP 0 0R4p`40S @40@S ,0 P `A-@P 0`0VpP0S P @T <+? 0Ğ@@`H A-`P 0P0/o"Q@@T @0R p @P @T @+? 0⍞l 0P T@- ^ 400\@+/<2.0r 0P @-op@ T\ @\400\@/<2.0Mh @-PP M 81 0R Ѝ`@/80  Ѝ@( 6P 4 0R S *,\$0 B!p@^400C40<00<0``K.'> 0HHK.M> 000N>K.0 0T u4 v w0P/4  ?o2\0S/0@ S/0P D- ?o2 ^0S 0 S /HP/0 0@0R/P/0 0@0R/ P H0-0@0/o"^ R  Rk / 0S /A-`@P=pP (0Sp  0P  pAO8`  `O-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L d!X% X0@#r 1 @:  @Pp <  /P/<  ?o2\0S /0SP/$p@-4P4@P@0 0pطX0S   0ꌷ|@-@<< T (@@@@ @lHką@-@P (0 0RP/0 0R/ἶP/0 0R/ᔶ0P D- ?o2 ^0S 0 S/l0S /(0p@-S@ ``P0 _P0 XP dd X@@ @v@p<<<@ @0p ⳙ댗 i$hiA-PP 1 P`p @ @P] @@ @P p<``?`p 0,p0P4080<0@-@s @p  @-R 0P< P 4Q  ,  0000L t\ 0L tU똴L Q4 VPG-? pP0`W<W@ 404 S P . , S -000,0 10,0$ 1P0P :   404 SSP  P00 t0 t Д p@-M@400 S,RP, R4S 1CaV' P` 0 0P 400C40`ЍpR S   ЍpЍpLkE?M/t⿘4|n?M/t⸘lR?M/tⱘܓ A-P`,p2 @P W 0 !ҙ,@0`\ ,@0`400 p@-SP8@S 84 <0,04Q<0pPpE?s/tn똒 o@- MpW4 0PS`@%  P00 Ѝ  /0P ,0S p @0 @P  Ѝ0]Sw?}/t+ L Rp@-@P 0`0V PP d d0 0 0@S<0  0pPp00/tL|ܐ w0G-S@PK Up40SG |  ?P@#P P 00S 0=P6 0 03/P/  40R 1#P& >`P 00C 0P  I@t `G sL?).t▗h(?).t⌗p|l H8  40S 0C40/ =/@-txĎ 0p@-S P  Q @P^PYp00/.t]눬P ip@-@P |0`0VPA0S R <0  0p@4,0,0/t:00/t4č  wG-S p)W@ `V 0P 0R 00 |` V 0S  G883>/ts0,SLȌ @?A-PP 0 0R42pP 40S @,0a, 40a@T:8 8 40p`@-P80080p@-@P 80 0R@ pP0@p褩p@-@P 80 0R@ pP4@pTp@-@P \0 0R@ p`Pz00S@#:tp@p@-P@gI@bpp@-P@[80080p@Tp@-P@O8@@@Jpp@-@P x0 0R`P<40S ,0AT 3p@p@n?/t1 aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@l@44?/t ?/td  p@-@P H0 0R@ p`PE@p\A-PP0 0R`@4P%80,0!qW# P P ,0P < 0@ 40< A`A4?;.t◕n?;.t␕< 0P D- ?o2 ^0S 0 SG/0S /p@-`P@P (0S p p@ 0  0 //@-SP0p0 A밉 O-IMP  @T p `0 R 2/0 SX P X @ 8/@0 pPP @TL0P 003/X@ 8/Z RZ Z X" 000 R 2/0 R# P/0S% 03/P& Z :/ RXL0p Дd0P ɔIߍd0p h0p ⹔Z :/[ 0 03/(0p ⨔ ԇ P P0/O-MM(p@ ET 000 000R+`P$  T%0 `aP4  0@ 4/@P`P@003/0 @FPMߍT00 0P $ 0R000 Mߍ((0 8 R00ꐅ # 0/0/@-@@A-pPM`P1 @T. 0@0W  WN 0/RA 0CW /RW  W0 0/Q B H!0C@T@!  $@0 0.0 0ȏ 0 S* ep@  U P@Pۍ?00@ۍ S0p PDp p ەP@4  p@-R 0@S PR:   Ppq0P  , 0T90( D<:p0( Dx$;0( Dqp較 p@-@Q PPpQp0C-S M~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ輐&Q P괐&Q xPPU a/U`U"0E'S0rP\bP ]P PU /U\U fPnPtPbPUt 0 O/  PQQ 8P(0F/DҒ ԁ X  0S p@-P@ Pp 0@Sp/p@-@QP Q  PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@0Q/DcL #0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@Q0Y/D*h~ 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P >p@90-D֑} cA-PP` 0Q ppXpW`V5@PR  1PK <V`p p0 8/PqPn`<`nQ P P 0S 0P P PPT T /P P 0 1PP| D{ p@-P@PP C 9Pጓ`눓`p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0,0A0 4 B`0 4| t| @-@^ P ^%QRS  T00NQRS"  TŒ 00Z0 4ߐ{ G-@R0(M0QP P 0 ` p Pt p `嬪T0?o20S00(Ѝp`0 { p@- M`P@00ё0 0ˑ0 0ő 0     SЍp0@- M0P@ᯑ ⪑ ⥑000      S Ѝ0 0p@-Pb"!4Mb4# `@0刑 4 40ထ 4 40x 0     SЍp0@- M0P@a l,0p.l V 4!40O0$!$       P Ѝ0p@-@P(MP`/ 0S, R00݋$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 :V P0V00(Ѝp@ R 0S V00tx @- @㧐T00@-@p00T000#@-@T @-@T000 000S/@-㘑t000 000S/@-㈑t000 000S/@-x耝t000 000S/@-h@t000 000S/@-Xt000 000S/@-Ht000 000S/@-8耜t000 000S/@-(@t000 000S/@-t000 000S/@-t @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#YXpX001/(X001/X0 01 /W0S@-@1/00/T0T0p@-@ P`\ FPpp㔐t/000 000S-/@-ゐ-訙t@-000 000S/@-o\tAo//p0@-@ MP 0 P Ѝ00;0 xvt`r p@-@M H P pЍ 0;0 _wt@ 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pဈ8000 0@0 !0#2 /UUUU3333  ߍLRp@-PQ@t : Sj H Sd a Sp  S?c r0-0!-w- R00E ?Rx  -  d r - w- Q  8 'Qx-1r-@w- T% Tt0 T-x   p Ss  Sw S?lQ s! R0s  S  0TS S?bAa-090 5k O-P,A@:  pP? P?  2pP% 00` 0@T% 0P0=S AP` AT BX!  ఌ߄<0>0  00蘏j `2C-0@TM PD@0H LP@h X`P ㈐@@@@@媍pk pp 㣍p` n{ P  {j{{5p[ X0p 0S00R4@8@<@@00000+0++0+b@1@000@0  00o+X  "ꀍ0S Xlp@ Y U  Ѝ oЍ @]0 0 < 6 2j 8i O-PMp 0GW"S00` 0w@P-TPh +T@`0? ǿ 0 q 0 q P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`꺌000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 ⑊UWp psW ꙙe 00M 00Ѝ6؈3O-PMp 0GW"S00` 0w@-P-TPh +T@`0? ǿ 0 p 0 p P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 $ʼnUWp psW ꙙc 00M 00Ѝ6ꨅ3O-M8@t P T0  `?uL P T0  `4j0<` _ ^ ^ <^ ^ ] ] ] @-M"{ @|d{ @0S H @0 0 |0 30Ѝ  @/h\ -M{(, {Ѝ 0 0 9/!mNA00/`!G-@SP+ pE`J/Q" /Q JNXP0 S0C0 P Y 000 ⥇H\ O-QI,M 0@pO Ra 0S 9 009 P0S009`0S |) l)l  `)`   @n~PT0+0CP I @p  q 0| 0  0C 0B00 S00Q? 0X00-SQT0:~P0-S0 !000 ,Ѝ(8(H(0@00q p7 0  ,Ѝ01 0 B0C0@崧 :Q 5 0+ B R-y0 P( WY :R 0S00087@0| | -Q000 $  6 0R&0 0 `=xPt A 0Z @P @p` P@T ΃PW2 PN v `  Q Q 0@RTZ@Phv 0 Z Q! 500S 0:S  0Sp5 00+ C :S:P ? ,Ѝ0JS0 SP0 S,Ѝ@PTPX `0 @W 0S 0 6TPX` H0 , 0S dH0 ",400S 0:S ( f3 0 h0X q;R0S00%X03 00S 0:S Ah3W 0 0+ C}0{ 0S /0:S  X 010300 0 0S000200S 0:S  20LQ 0N00P200S 0:S hRZ; 01 S0$0001100S 0:S I00C 00!S 00 00+ C H0 m 0Sth0 e|10 _4 h08Y0 T88!0 00S 0:S 000+ CR@@q 0  10R|h0 'T}D@([ [ p8Z pt@tX |W XV _pV @V V U aU T $T $T S 0S R $O-pQ ` V 20 R" P@T6帢 0 R01-[@P-T@PC T"hRPP wPA -@v0P  :R9 $2 0 0S " 000PP@:T0S! 000100S 0:S 1d 0?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S O0 0tP00P0 0 R0 QVWST0 HOQl0l 0 rL33dPR x2(xQ 0 z~Z7x_0 q~/\! 0W/60/$0S㈀]! 0 -P6 0 0W?.@6 J %pE\$\ZA A pA @A A @ @ @ y|@ zX@ {4@ @ ? ? d? H? 0? ? @-PP!P1 0M`P@000:  ~T p T0U0P @@P@ 0 0 0 30(Ѝ/000U00000|P 4"48#80D]?a/ }PtPk%WVt= @-@P  @~]?f/ }< O-M M <'$0P47 (800404 40 80S 0Ss $0Sz (0Se H 0 h0IP @<0pI 6&0!>06 000@p6@0P}?`@p, 0 Gp!  PjJ00S# F0=SPX PUPVPU =c`@P30#S< v@T< @00C@0뀀 0000 00 ,5*P% 00@0 0 00 4P 4 nA,0$zi00$zi40S@00C@0  0D0p@ 8t@`xPp0/wx =px0Y056X`@~X0 0 KPڶ6 J‰ ^XY400Sg Se @Fx  $@?x (@8x  PD R3<"2 0 4 30ݍ Ѝ0@f~x""0 f< T 40D@0 D0 S  P @`V 40<  0000D  PCPႜ P~ P|*ml0. |P0. |$0S,0. ||i?. {80Sl0. {d}0S %#80@`x$)#@UU < ; ; ; ( : 9 P7 7 6 6 6 p6 P6 (6 5 5 5 G-`!p1 0PMPPpt@0L00F VM WT X[ 8D#=-$M|x0!0 ,0 (0 0 0 30$ЍC=H=G-p PP`  B;x0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00C QaCQ~WCP00C PTaCQWCPACQ7CLS00 D0C?o2R0SW ? R0S*@D T T-@A CRS^ @ A BR0GD?o2Z0SX  Z?0T*Y 00A Pa0ASW0AA0AS70AQ P0 w00C P 0 T:aCQW0CACQ70CS } h0v   DACQ 7C|`0C0 v H@dS P_$`@0 v& & % % t1 0G-@P?  @RP<T !4*4444a4q `???p.0S   Q#2 0*00 P*0U 0 R*Q *0U000?0R*00t?Rp1?p#` nw R ? Q*:  T: p $ $ tX@-PL@L0@p M`400 0%@ Ѝ 8@-@PM 0d  0\00 08 @%Ѝ030 v# p# @-@P(M" $0 0 0 0 p0 1<P 04P  8< $0(Ѝ BX0d u`# " p@-`P0M@P! T( U. ,0 0(0 0$00 0 P;P$! 0" 00Ѝpx0 uTX00 uU<0 uw 0 " " ! ! "2 O-P0TM`0L00s Vj  0 0 A000@080 0 0{PPP @ p0 p@P< 0+S+0S((P,00$00(0 P 0$f,$,0SY/ 0 0 L0 30%TЍ0 KP SP=/%w00L0Y0 u4X0 u<5@! 3  !1 O-IM0p010pWX PPO l@ `~0 `T@P; 0+S+0S(P   0 0P   Z0SU. 0 0 1 30Iߍ P qP.v00,00.tL2  1 0/0 0 0@-PP0M@000' T  t0MP ""44  0S0 0h \0 0 0 30Ѝ0!@P(040 Ut1T 0 ! 1 @-FM0 M@Pp0d40. `؋ PPd@!+ P ,v@(v R@` T0 0 d4 30 Fލ Ѝ,NH0X  t0X/ @-P 0 0dMpP`0\00 @ᎋ ᣋ]P H0 0 \0 30 dЍ(hd0p s.. 88@-M8@8@ `0 \Ѝ, ,0`( "4`3Z1S // 0 0@-@P0MP000' U  0 @  ""@@ 0S0(0h \0 0 0 30Ѝ0)PP(0F0 ws(-l - G-p!@1M 0砐 040 U$eRPF0Q W0Cp +@P1  ZPUo0 ;u0 U@ @P  GU0PUo0.u@*u@  s 0 0 4 30܍uPuTP  0jQ'p xP|`,l+- M0 Ѝ@-P 0 0dMpP`0\00    )P H0 0 \0 30 dЍ(T0` rz*D*, /?O- M0@Q000 0S @ TsTX a! pP.b"? a. *b i!*DPP\@]!  "P dX$%T\dT%``.lČfH&bȌ̌$DLfD$Li.`  i,-a.d`ia` hh(&d@plhphd&%gX'%T\gT%$l͌hx(b!aA"8'tp @|ht'aA$i) `&@(l"<`t`i(aa.%jh*M`&dlQ l jd&Px "lQ%P d  'ix)  l!!'t| it' "(] n(|d!. i)dd!"*hH($Di*LhD$ + e.  '0,k+.-ak.eq! `&p*eq'4͌epiX)b!} %Tl\iT%, ( ,(o&@$O$,`ba,`H@@@ba& g,`hH($D !LhD$,++ ,+0 ,+...$吠bj*. j."$ " (,+, $ , 4P%++H (" m_%_%` ,P gQ PO$O$gQ%f P $@gA , $@..@].apf!O͌@f.e! OfA O@lea,`?ea&e1ꯠP* )!P@,`(o)_(0P(P **P!!! n,*pyM !`nQ 0 P%P =d  ]n,c1d#!.... 4 0 $ ͌e# dq .O,p/$/"p/"  O$O$4 O$leq, @O@p'?p(aA,}e1@$n_@a1. P0#0_% ,, _%_% M_% g.$P_aQ)0_% !/!,_%_%_%(PX=dAg$_P*㝉cQ$魊i P%䗟 ៉gw Pc.p )O$  O$'O$(' wO$],@jA.cq@$@ ?'?#$ 0/# 0''坉?'eQ0jq%?0 p'p?j1i%诊_o%o&Mo&} . dA$`_%i1$0#_%` 0ദ_%PogQ$iaP%Po&,((=o&(no&o&g.o `(]O ca.午gA`&eQcq%`Op'@@ pmc1 /'/"./", ... 0 ' 'M'h%uf! h!f10/  Pd1f1d! 0]?h1 $`d `10f0.,,4..-. $(`e`e d@Ϡ0,`!! ,,4=,be bχM` cbc ePd,pcd b/p"++0/"/"/"`d( `! c?  #`!o!`$`?#?#`͌?#n`0n1 -0dlAnA0lO=`A`bAlAbOnA4`O.O$$@..@.cA pbAca`OlAϠ`,(@))@ ,,aAcA paqpOmbAp`A aA`! O}cA, fA0P`Af10OaA_!-_% 0_%4,P(P!!!$PgAfA0gO`A @O   ,= bgb돉fcbca`ꏉ g`acaqpP菉b /c!0O$0O$㟠?')?# )*0?#*)' m) P?'0`1' Pϋa1` 0P捈fa0忋`!&a "= - 地 h&⿋` !c1h#  l( ⿋ ⿠o+,PL o&o&_ꯂ$`` +o `b1# )yZnܼbʄ  0 0#+⯊, +/ < 뿉⟉h⏠ 0()d )O/ | (⟉ abb!! "= `!-!c1` `#P b1#0# 0a=bAb!!`! "! Q @-c1(O`A`# b1# 0# 0a=bpb!!`!!$@ " -`c1`#b1# 0# 0 abb!!( "L@= `!-!菄c1``# ͌8<@plDPbb!# "0L"0P2  0 0 30Ѝ20 n0S_X0  nW@-@P LL 0DDD   00,d0t m#EgܺvT2D G-PPp`6 W, 10.!00% "0 ?0%0?S @@h  n  0hS@H"p ` *0V@@p`F  Gn80 md0 m<  t!t1 p@-PP0M@0 00@ TG  R00113 R0a `0~? S ` 0~? S U PE "001<3 R0x l0 0 0 30ЍpPP0 SmT44d0 Jmt l   0 0@-@P0MP000' U  |0 @  ""DD 0S0(0h \0 0 0 30Ѝ0)PPP(0F0 m L@ G-p!M@1M 0砐 050(U,ePG0R W0DA +v@P2  PUo0 ;u0 UB c@P  U0PUo0n@pn@  r 0 0 5 30 ܍ЍnP[nTP  0_dQKPp pP|`B;- M0  Ѝ@-P 0 0lMpP`0d00    &P H0 0 d0 30 lЍ(X0d Ult {$0 k $0{0k/ܺvT2#EgO-0|M@@ 8;m @/LPp8`pPp, p'+phkg| `<뺅Th,`&P !`l[kP@a lK+P%@$P 8@g[h[DHhKh )k!.h \ 隠fl j (nHla$j ,L͠kˌkd . @艠eg g*Pp` a n,+aTddKdi{ꨠfpf p' pl +@Hhkxe{ `e`&lP `K 4XnKn`!+\llˋlj[mikPiP% Pa$+ Pg\h[h) `ɠ`ˌ` d. +d` a at霠jjfn,* (X hgghpꨠddKl{ p'epl@ g}n{+n<@@ffK`k*`&i`pllk+lˎ`@dIeKej['hP% Pt+[`[` Dani+iˌ hd g&+lʠhˌ;h+ )Tkjf+% f+"j P i#M(a, ,$ a+n Hꬠge+   g+e( d dpX+)l hlpfd+ !kK*@ f+kK$nDp@ +` ik n+`&T`dL< eKj{(p Me+j{'ph$lkly`k{h+$ kˌh+"P! P`[*j+d'P%P jd,\i[ L8&a it.ˠhˌ g" n`lhg* %f ꬠDd`)b , db iaLఉ @.eKhg a@$l*@gl!KfK`dp)n{fp8` p'bpj `ze{bkj(MѼ`$ik$e`& `h\l`+!P l[`+" L(j+a[(Pja[%lnk Pनt'd [@`[n,h" `h.X \̠ iˌipab% & ag b+ h ` d M,ќf$d ! d뼠hhXeK.0H @MeK$ь @$ggI\pbKb; l+s "Mx |b-$pf+f{D`n+ ndn*hlj`eek`P nTk(X\芠Pnn[<0!`;0#M08$l;l@p"a{Ìp'MȌp̌ `$y`{`` pdk&`nČiȌkǩkˌj) HP#b[nČP%iȌdP̌ dˌh tZmČƌ͌3a[aˌ\@@ncK$ j @ jf,LKm3bKbt n$g.lɠ(hˌ,  h+i!< m$&-3 cc+X0n4e(8f<  0f;`+" D0舠m46g`=`30g;dk&`<0)n48i+p<p0Ti;l{'ࠔjekp00 en;#@ 0xt`{PP `a[%p PcpmnܼvmzNSaP<@nKi[%Pze\mb[ &cK vg@b.cK$D @lJiK`% hhi ,`!f+  hd "฀ac e$ ce)H+g+gtp0.l;zt0#imx`0v|d! p`{d(lpc00P``` 0 ``(`0PPP#P``p` 0``(`P P P @ \z`w`lЍlЍ'F 0H0 ctD@Bh @- M PXpqp1p`@PP@@T 0Q P Ѝ A @XP @ Ѝ` ~XP"0S, -S?@0 0000 ` v V RP +R@@D!0DS UXP0S +S!@?@!@p  X ?P L0P00 1 R/@P/!R/80@>S 00 00//@-Mp @e``PW P0D>S 0!3100 0dЍ>SH 0!3100e00d00/-p@-MdP@U@0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, ,  $   (A-@PP`p= =U( X0ES  S0+0E0VP00V&2!0` 0`00+WP -W =W00V-00`00+0+0`00@@00(0]0 sb00L p@-PP@F 4a `0RuSpWS6X0CS0p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D bF I@ O-TM0wSp @@0 0P004080<0/- 0(0c @(c@T$@7(`0p00000G@  @ 0a0GS00c00c@^c@`TЍ+W = W0 -S0000 0P X B R = GS/o"!!   ( P:0,`c ,,c R(""@,`0 @(  ( 0S" (p W:,`|cp , tc0S"@(ppG,`p(pW 0[ 0I00X00p(ppW ,WpPxS(P Y0,`McP ,Ec Rp"@(P0PE,`P(P   sP(=W +0GR?o20S# Y,`#c P,c0SF(P"2PE,` @P(PU 0[ 0I00X00P0(P 0 U:,`b P,b0S"(P"2PE,` @P(P0X0 0%0() KR;%I?#I0!0 KR<I b $0@$00SPb0"SB  U*(@ T:,`b @,Hb0S(@,0@D@`(@Ty -00+0"00 P0TЍ'pC  001]0 `1]0 `pꔱ1Esxb00(0VpJ 0Xp+P-@ +B XR R  0+B -R +R XR 0 -R  X@PPQpP0]0 &`~80o0P `$X v @ $ 0@-@PMP 0  P@p`Ѝ00:0 _l P 0 @-`/o`/00/00/00/ 00// ///00/ // /A-@p`eQ+PQU PU  0   P@P PPr`P \000p@4000zaP.,taP< 0p@-P@`T @T0rS Ppp@  P0+Spp@긯0@-0P$M0200n 0Ss 0P 0N 1 00S$Wp@2 P! X0rSB H 00Pp!  \1 P @00S5$Ѝ00HP0T X@\4'`@W0 00S  z`@P" 00Pp 0P$Ѝ0T 0 ^8@0 ^t`(~ }\} 0@-P$M  0d 0Si 0P0@ 1 00S<*p@& P 0rS:  00P>P! <1 P @00S-$Ѝ0!m`0 00S@ _`@P| 00Pl0P$Ѝ0P 0d ;^4@0d 3^t|{l{8{ @-PPPA M@I D1p0S+41@T4 `0`S@' 0S'0V0, 0S%P`0S  >p  Ѝ50@T0S h+_00P$D  088l0x ]xtyȩyy G-`PHMP6 0p0 0 p@  p@ HЍ P 0 p p@ *HЍ_0S @X@0>0 ]@0P R@d O-P4M\p@Pw WmX0S0 `00 S 5/040 00!S5+0$0 00!WaW0] Y[ X00Ud5S`50 0 0 0 0@P0` (0`0r5`0D0$0XX 0S20`iW A, 0`XVW ,@P(05#[0tQ` 2P X $ 0 4%*&  # #.ğ BPU 3 2#0!/#1##* 0 # `V4Ѝ3+00 00!n|3/00 00!f`30$0H\.Ld0a#0L0|2pST @ P, ` !X`P 0V ^ ,@Pw ^[X"$:600%$0<"%>4!!!0C$"0TAP%"$A0O#QX00 0 0$00?S%4 P! (W`1T101! T$?01>! R01"_0A`(0l10X00`d(0@t0P`d(0 W  R.AP5Q4 0A` X0A0PE$0 `0P 0  `1`190T d[t8H0T d[` GzG0 Q)\(\ h SQd ̜ x X O-PP M@`o Tu V| 8p0T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @ @0<0\; \ @ p R@p\ p W R:\#Yp 00 ][T80 T[VllD0 K[zp,@ \?[*!]-Կ  p@-@PP U p@?HHT0` "[U((h0` [p@+H Ⱦ EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` +PP0 X= V  00S0 0 Q 0  ! 00S-*_oRe`VVP" U ! q[xxt0 ZT\\0 ZDG0 Z\00P$   C-P!1 M0 M@P`040$ Q? U5  00S0 0@ $03/!1 0 4 30<ۍ ЍtQpp0 VZV U G0 KZ0 CZtt0 ;ZX0 5ZD40 -ZĻ C p EP D O-MMMp\&0X6 PL0 TDe040_ XB 0SI VP 㰰\U\0U@@ R R 50B?o2 000RU$00S0E0 @f0S0000SgV 40F+0F 0@ 03/[o 0@ 0000,00G(00 3/ P    0S00 * y 0.S Z~00S Wx:0S 0S , P80: S $ P (0JQ/030J1 1000 @P}000$0 000S  0P)80: S%V 00S 0  000S0 P@T  00S0B[4/P/ 0,0" $2 MލЍ  0.S0Sn 0.S}j0S  0@0L  2/0S0>  000.SQ ` %P J0 @P@ @h  2/0G(100+$000  `P0hh0C/Xr0Z R 0 ?E0$0 X0S0 XV0 X0 X0$ /QRZ0/ 0 0@ 0 3/0{ E D0t6D0* L /\ 4   O-Pd#``3 KM0MPؔܤp040; WB VI YP \U /\@ 0@ \/\0 U'"2 0 4 30KލЍRZ/\3/00`/\U\% pD0G/XW$$0G/XV0G/ XY0G/X@`p `hP 0   R  Q 0T/S 0: S+ S 0 0 0 0 `X# +00S0 0@ (03/0S0: ST/03010301:l R0|`|`0I/ WG 0 WQY/0 0ᲰO m nt o SO-M$M %5 0P`P0004 UD @0~S<    pH 0S/S;RL 0B0 4ZS 0H*0 ;P4S 00C PR- IR*00S;R# 0X @H p S   lll *S1 0@00S ?S! [S!^H QM00 S@000XS 0H , R @ 0<@Ⲑ 0 0R  R QR Რ@  +Pm@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S 0 00-S]Q 0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 FY0 [0!^0  @E  p 4` bM0P} H *; P 6010Q@@Kp0 ;VU 0M/4V0K/,V0M/%V 0lV\0M/V@7@5?**T[-]ܫ !\   O-`QMM@p R W T  D VI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B00S08( B0 SV 0F0C  0|V0 0 @ ]RR ]RR xdd0R/^UX Wf@FU?R/SU\$$0R/KURܧ  p@-@PM`P( V/ 0  0 S /0{S 0\ {\ 0 P# Ѝp0}S0S Ѝp@T0.UV40.UW 0 ꠦ | A-MMp`@P00P00 0< 0000000 < 0 ; S \00  ލЍ℀ @R0B \ 0 \\ 0\@9*ލЍ0[/T\@ p@-`P Pp@0T1@D 0CPP (@T*$000p0]/Tꀤ 0S$ - *S ?0C\S0P0S Q 0S 0 0/$ 0 RT 0@-@"RC ^ 0QP BP'  R7 "R- 0 @\R "R  R&   0BS0 R 000 R "R @0 #  0 @ .R0\000/ @-P a `1 QM0 MR050  0 0 5 30,Qލ Ѝp p @, 0 p @EO0 P@0  0P0bpL Ԣ 5O-0$eP`M 0500S E @p#S!"U0 pP$ 0S (%P @ 0SvU0SЍt `p  0@S0 04 0  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000 ;PP  00#3R0000 4)PP 00#3R0 (# 000 PP( 00#3R04 " 000 0#S 20@ R@@EP00Ѝ0 S S DOP 00#3R0 (" 0@00u LOP  TOP3 00#3R0* ! 0 00V 00#3R0 ! 000GlPT I0@S0 @  \OP =QD  0P00 dwOP=Q 00 @l0喞wD  0P0 0ꨀhl< 8 4 P~}}t}D}| d|(| Н {D <{ {p@-PP tBOP e@PDPPP  00p I0 QL A0$0 0  05p P2S<000S[ @RU\ T'H7 0 0 30Ѝ `s?0l0` 㰈pp  PWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S  I BQ #S# H BQ #S" G BQ #S; L BQ #SP M BQ #SF N BQ #S< O BQ #S5 D BQ #S  E BQ #S F BQ #R 0S:U 0p0S8 Rg BD{P 0`000  00  L$   ,40000   $   30000S0 @  # 00   pW p[ pR005@|R@W 0[ uR000S mR 00eRY 0 [ \R00@VR@00h@p00,(@ (@(00,0uX X[  tPk0Sy[t+P_0 PJR00Q P ppfT pw0`00X0`0 0SCQ DqpLp jY*0p0]0 Q0SY00P pn0S02 `00C0* L Dp;pRpOpLo[? 6pEkp0pkBX8P  @ D  ؔ -0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF2pP P ЍpppA-P`@ A@0S(A@Q0,pPpPR 3M@@喿 P p0 @BA QA  p0 p0 $0<0 &Ooooo p@-p`pP`P^@T T0T0 R@@RpkP00G>nnx>A-`p@p@P90S x@@J R"@\+O@?P00P@>,nn=@- 0 0 |m@-`AM@PEpP 0SA|@@0V ! p @UpЍ ♸0P  R 0QTG B&R 8A@ܚ4ٚPԚRS' Sp@ S'@z@ @S@u@@S 4ⵚ@q@0@@4⫚q6@4q㣚@0P@@4⛚q; @ꈐ \ @ $mm H ,  PP5PO-BMH% M08u0  p0$ $$ 000 0000 00 00+0WP 4 @0 4;P (`P,@\ P 0S x400#S \ P 0S @D@4@08@\ P 0S D 4@08@\ P 0S 3 0   \ 0P 0S n30\ 0P 0S nl30d3dSd@F0P + < `: @P\ h@P 0S FIPPU PU JP20P0xS~ "x2 0 $4 30Bލ ЍP@\ :P{ 0S `200#SJ \ +P 0S (B(2@0@\ Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  A1@0@ \ 0P 0S |m\10\ 0P 0S om,10 1P0P!0 $ 0 T0xS}0S y00  00 0000@JP긎 4kk` `j jd iili8i i 8hДhT gglg (gfff\f̉ @f0f fp@-`@@0S P Dp

LdcH  A-0XPP 4P 78``pDJP@HTc @-@@P.00bO-@P@$M p 0S Wp 9P` 0 0p 0V;  8000?Q WQN *Q0@0 |8000*S' .Q S /S$" />PP$Ѝ[S5 \S/ 0S@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLpW /W| 0p!S^SV J  Ɵ  P 000@ 0]S2^ -Py 0]S00S /SD .SDB 0S} = 0U/S:w\Qv 0@r/P P]S /S \S$ S] -P8 0QV]P 0XJ q  0@PR ?=P@ P0V@0S 00T+ 0-S T~VP]P0 p P]P \P^ S0S00@00  $ P   R   U/R S /S pT 0-S T@00sQ@0QOS@00]SQ-P ]Go0⨂\ V@T S0TF 0X q R[WP 0X q  0@PV<2{0 FJ0S<|<0 (@04!50;:`P6&`p`3x@y66U`1p 010000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J@ @-p J@ @-p J@ @-pPP `@-tD00p@-@PP   p@010 `Blc p@-P@` 7Ppp@-P@ 7Ppp@-P@`D 7Ppp@-MPP`V ⊳@T |00*CЍp 0 : )*p@`$ ? IHtb 00 R dH,@-6D00 0S@|(H0#/"br1 0!@0lR0cR0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`H= @|6P PXY  P A-p@  1M00`0S 00S \P#P3.000R`0@ p `0 0 2 30ߍPP @@ @(@$dd(dO-`P 00YP(<Ѝ0 P( 00 0U` 00S! SJ 0 @P$ph08P pC @u< P5P  X R0 0 @P$p0 pC @Y< P5P X R0 (000@ 000@(Y(P(PzX0  GS(  +S -S0`000 PP䅐ಐ3P:U V P( 2c2c2<,S \0c$00P 0(0v50 ,P(]U0X0,0h000;0 P#5P: ;P 5PP. 0(P 0  R7,0Y0!0 @ /Y- 0( 0 0; 00P(/0 ,0c0,?0S,0111v>C 0C,0P(   /"b!!A0,0 Y0 00 000X: ,0L:,,0 v>C 0CY0P( 00 050 ,P(0PY%S(P 0,, ,0 0C0P( 00 0Y` 0 0 SP(L 0 0 0Y 0< 0 090  0YP(YzY80  0GP(=0 P( Y 0P( l8,, ,0 0CY0P(k 00 0w0 P(] 00 0i 0,{,0!/A!b!b0C 0P( E 0 B0 S_`(`P0Y08P7 00P(? c0,Q0S, P(? 0P0?2c11!, 0  0 0 000Y60 0P(Y;0 mP 00 S 00Y((P10 P(&(P000c0 ,P( 00 000  R 0s @p 0 @00v0 PP `H 0@aa0K1c B  B00  002  /#b!!"A ğK/"bP 3 :bQ # 3,P b4x$ ,  Q0 00 00 0 &0H0?3c112A #K?###cR 3:#cR # 3 00 0010!, 00C0 0 0@QP1 R0PR00A0PY @$p(P  00 00PY @$p(P 00 0P,  /#b!!"A0 K/"bQ:2bS0#03 |"  1 ,0 B00DRd , 0 40N0 S0(0!0`@YPO"  FP@~ 0 40N Q@(P06Pn 0(P0 0(PP @ ACLC  \^JS S  0 0#3P0 z H(/o"PzX (PUSX ZSP @  0 0$0t0P0(050{c^ QH[ l'\Y Y n$IV P)\(\ ףT |T S hR QB10PE0,P` ( P& Pd!/"b!C;R, a2ba12TQ(tP ``@CP(fMP P(P @j @0C2c2c2P$00( (0  @X 0 @R|YP(  00 0SaYP(  00 00@>0S; 00@70S 0@0 Db0`,0 0 0P , P(01(000C.$0r,^2000c^\0M0c P  0P , aP(00(000C.$00 0K<# `  0P d#,   P b((0$ 400M 00Ѝ$P1A-0QPHP P M@S Q(h10d0 P1&PD@@\p ",. R!  vΌ @p `U# Ѝ0 P0  $ Ba @L  p `U=T 0 ЍL H<=00|1L L *LL K K K gfffK `K /@-0M@ /0P ~00Ѝ@-0M@X0P q00Ѝ@-P@e$/p@-Pl5qύˠ@Ѝ,0  (@P - P |0 0 5 30ݍ Ѝ\0D0 9;00@;00HG8FE $$0 M000 ЍPF--M  ZЍ Ѝ/ -- M0 0 ЍЍ/O-@PℒM p` X X00?/W-00P @ P 000 00P ! !  D1XPF -VP WT V[XPVppPpW` B 0`f0` ᮩpP `PED8 0 ]9W`!00 ! 1 00[/ Ѝݫ0XPC0 P P00F/ Ѝ 0 19`npPP V gpP `P00?0 9eE\C lB @-@ M /(0S2 ,0 `(0` 1/qp0Pp)  0 0 PUR <0PU. ЍPPTp 0S  0CP.:00Pp.@-P M.(0S: o,0 "p(0p 1/qp0@`/  0 0 @ToR <0@To.1`V ЍP@T` 0S  0C@o:T00.:00.p@-PPD (A0S5 @Tp1 Rp0P00 P 0S P0 0c0( 0P0 0 Sު,P ڪ4P ֪8P Ҫp@ϪHM@0 680Sp 0K0 ,8eE4? ? p@-P$@@fRp@_$!@- @@XR@R p@-,PPK S@Dp @-@PQMPE 1 `0 Pp00S   0 XR0@ @ S6 <$ \80CS0D0 S0^U(:Ѝ\   "^  U #R.S(@ 0A a 0C0F0 7 "U #RPEUU E0 0Q@>X= 4  R  *4 8/` 0X\S 040:8 R РS /J:ixB@-Pp`99L@L0@@D尀 [U   +R<<(4< @-P`@=90 A-pP℆`@P( T.  0 SSS8 S00 S 00500000050 7T40 6%0 0  00`50000  = 70L0 20-V00 ^V00;\ 40000 0K/l R000C000LS0 100C0 0?V`00 0 00000 \ \ 00y ,40000  70L0 0 h", 3010CP;\ cP3`b0D001dP0j R SXc\Qp3 01K00 M \; =\J \7 00C00L S e0 D100C07"00 0 0  T 00L0a" 0W0C0Z2 F0nR \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pi00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP>cP%dP:00L000L0 0<00sP00n;l; < ; : 9 9 P7 O-MR@p 8 0S? XPF DP 0 0`0 @F2P?T@D 00X `R%R% V 0@F 0P700ЍU 00?7.>50S`?7.45 R @T  0E0Ѝ(7005 5 4 0  00  ㍻,> A-@ R`P0Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@!0081003/0P !p0 $@ƾ0V0 00 R (000P3/0P! U  R  SV  0SXP000U />3\8= p<=A-@R`P 0Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@V!00810 03/0P !p0 $@40V0 00 R (f00 0P3/0P! U   R  SV  0S]P00 0U p<: (A-@P| P/`Px rpPh  00^c<!"#b!0CaqV8 X p0PXU $001p00S  \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ģP` p  0000SxͤP0000H0003/P 0p/>3`tD,=,A-@P{ P.`Pw rp Pg  00^c<!#b!b0CaqV8 X p^0PXU $001p00S , \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(+P` p  000$0S4P0 $000D0003/P 0l    ll SR: G-P000pS` 3/0Y @IOP 4 T0 0 0 0 Y @IOP ! TT0 0 H H0 0p`P   /d X H   SR; G-P000pS` 3/00 Y @IP T0 0 0 0  Y @IP ٤ TT0 0 H H0 0p` P $  /Hp 8 (   O-PPM M Q \ /\E ἹP-P:p/\ p P/ `K`\o @ /RR.\)  B R/0 D 02 I  pd 0: S$  S/ L/o" R/\ @  DQ7 .PQ X0  [K/R 0W0[0娐 !uMP-U  b-   RW  20/\0#p0@ /R0 X0/ ލ Ѝ@  ލ Ѝ.00z3 X 0/ ?     㬡PEf300b3>00]300X300S3?00N300A-@P Q P`\Pp@P ָP`V 030"S ἣ(300@p@- PHaM`=  ,4QP00T P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P j<0 0  2 0 @T#hx`p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 0 00 0 pt, T, 00/p@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D Q0U(P0D H0px+ X+ O-M M ( 0P8$ p00D40w 0S~ 0S 0S t4!S S4h`P PP7  XpP 00S RDP 0P'DP ` P@U"0 S* Z :S `\S S S 0T:Hᕡ@DP U@p +oP `0P SZl[@00#QQ AP6P00@S0 60000040 p(0,P= P 0:R pR0t4@00 0(<P G<4`PD pP? :00`00 [00S   `P  u 0 `q PPu0S00`Y@D*0 S :S ``[ ` @d `` 0:R& PR0 0E`F00S:S:00` F0H[0 D0C  ? ạ0 @Cx `! pP H @DIpGǠP @ p ,P pU 彵 D0AX0$0p#3 0 D4 30ݍ ЍP ហPpw0 00%@ pP 夡(3@00@S0,P`U9 \`PU03S< 0@O0@0080` .0SBh0` .0Sy``t0` .0Sr@@P0` .j H D0@0S> 0402*0S00S\S00 R|AP 0S7\S5 00S1 :S000 0 S4Sl A 00S :S|S@0@ A@0S'!|1 0 8 30V ލ Ѝ + @P 0 0 CT1 0 Z P i@P @@QP P  @1 0   0P 3~t0 ,0 ,0 0tP_ @\j l|,8 | \ p@-PP@ T `` P 0 0d0 0p@   @0@0 ,T(t0 {,tPD $ A-@P`P V Ux = @P d㥜P 0:SS   4r`pd \S@+  R0 0:SS ^S0S:S 0 R0@AdPb 0:SS`d A0R@A0,`0S:S 0C^BC@2P 0@0@^1 0@P0 0 0 00:00ᮝ`Pሞ! 00 +~x0x0 +Vt``80 +l@ @e@- 00X    A-@P`PF VL U: = `P\ d@P^ 0:SSpppdG0:SS   \0@@AdPP@ pd@ \D@ATp">Pp@+0 |+00 u+V80 l+xF0 d+pP @@@U- 00( $ " # p@-PP`@2 V8 T& # vP8 00S 00XS@<,00A  RaPAU70AA AW0AR^p``F?C/+H0H0C/ +V0080C/+p sd qD rO-pd# `3AM M 0@P`0(0 0 0S4 &/4 PP; P0D 8T  0凱,00CS02 0x<4 B ><4 90:S 84Sq,0S,00X"D2 0 (0 30 K, p!P) 0B.K:SS B000$ 8T S#葟 0440<4 0 S BKI ; /04$ (4J}+<4 0'$CB>K0CP04 8 0S:SYD H R0 0  Q!0A00@M@04@0Q+ 0:S E, 00UePBaE40D P4*G0 :SS008$ 0:SS004 0       H  0 0@-0  -H-M0 S0 00 0 0 @0  00^100M^ 0@    RL00 劰@ 00 0 0 30KH Ѝ/}8p@-(@(P@SHPp O-P"2 @`0,M0$00ƚd20 R[ 00@`pR 0 HP Z p P p J  0J0PP0 S": y*$ U10 r 1$4S!$@ 0$ P^P0S "<100S (!1 0 $0 307 ,Ѝ U r pP Р ,P 5SX0(, VT00#    B&PP (P0Skg\ l  @-;(@M@@00@PЍ   { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T l*P0 0# 00Ѝ _*0Ѝ-$M0 00 0P$Ѝ-$M0 00 0ޮP$Ѝ-M0 00 0 ͮЍ  0A-` !1 0rMPPp010, V2 @X0^00pAtA`0O✘0 TA0Ό`p 00`L PP0x @h0 0 1 30rߍL0F0 (V0G<0 '$P 0 $$0 M000 Ѝ -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/0/C-`0!,1 0sMPPp010. V4 @X0^00pAtA0O0{PP0P >TA{ P#0 0$00 @0| p0 0 1 30sߍT0G0 'V8H<0 y'*L$ x $$0 M000 ЍO-pM/0? P0030_ We 000!R !X P   "P4%X 00S)00 R 8/0? 0 3 30 ߍ / `0zS 000P0C0 pXP l@0 0 !P P0C SP @>0 $&W$H0 $&a`0`F p0p0S8@0 !P* 0P0CS00000偼0S0p0@0 0 !0P 0C P0 S;P 00 pj0p0S.P 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S`0 ݰP 0P0 0`00050p0S 00hʠ@0^T@pp,(0&TIN 0', 0$0 0$`-QQ ]QP0 ` Q8 @$00!0SVp!p3@0 0:0X0`P0 ZP$ 0C 0 `&0  p PTPpG@0SW 6`P 0@00:0偼0S _P /00S?0p00p0S00 ;P 09pG0W[p8pFW mp!@.p( H 0+0AMS00 [m0H000CS0a000pWH R0XS 00 ( 0~ 0        0H 0 0(0 B0P0030F SK*N (@`Vp0t7t'000l7(`0 P( 00@0$pF TPpGJ JS/ +Pr 00@0PS,0S 0Se 0P H D0W 0S@0iW nW0 P T 00 0@0 ᧖0=>p>(00S zP V ,$00SGV`@ T@0  R  R=  0 BV0 5 RNP/0pH  R~ @0H  R'  `V B   H 00 0S(P HX A 0p0 0000P00s BH H HQI@ `pG00P0W0S`J 0000PP` 0   V  H ( 8  | TD  T0p080$@0X0@ 0LpP00( ᓖ P4 0C 0 2$0 Gp P p/ Ep @0S $0 PS0pS`F V _ P0 0@00bP ($@X T 0@0 0d0S|P [($@  ( 0w00 Ci00 >Vk5$   ]R $R@Pp00@0 000Pr$ ( n$ 4X @P0 0P 00,p004@m$P P P P Ph  P tt0 $q"000C,00V[ 0$@(k ` @vV @ ^(0R0BH0R 8P-@0 `)V`p ,X@0Tp@H0 H0P`V B   H  0SP H0 p H00CPSX0p050X@LpP0 00 V?o20SX 0p B0V 0c RzP]0 P V0 4 P 0C ?0C ". 0(  p0 P s ,PX P`Fp0S ?P [[ (0 {/(0 SA-@P`p0 .P@-` MHP@p<0P000 P ЍA-@Q8R`Px v $200S8 b0P1S010r G000P`$ pW@0PD PP^ 0 B"00P0 0 C `C000:0  Q  Q*RQ1 <0@08 00 0B`0P$00P0 BP 00+ B #A ?#@ 0#L0`0   B0 `<X p@-@P Q}Pp0@-P$L MT` 0S pW 0 7/@P Ѝ"@ Ѝ0804 H 0p 0 00M 0Ѝp0A-P$LMT`p 0S $X 0 8/@P Ѝ"@ Ѝ p0 Ht 0$ 00M 00Ѝ0A-P$LMT`p 0S (X 0 8/@P ЍK"@ Ѝ y0 H? 0( 00M 00Ѝ0A-P$LMT`p 0S 4X 0 8/@P Ѝ"@ Ѝ >R/H 04 00M 00ЍO-MD@@`PVpZ T6 0US`$[C 0S@ `V= 0 6/0S) $l @V 0S HZ 0 :/@PЍ!@Ѝ0$lV?%.H0Hh[y?/^0HJ>s/H0`$}>[/^ l H (@- @MЍ0@-P$L MT` 0S 8pW 0 7/@P Ѝd!@ Ѝ ?/HX08pD 0 00M 0Ѝ(@-Pp`#!x@x0@p@  DU  0 $  11( 4 0㜥O-$M03`0H0  0P 0u 3p000ʿ0P0! B0 b8<B p  UQPE @4B 0L3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  0s0P- S@0^^?0 0`0  pP 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `y0\  n  `r00PU 0 D RQ0\  @`b@ qA- Q@Pp`" P=0D! D?o2]R0S p0$!0< @ 4 140= 0 V V 0 P0 A A-P@p`᎐P.T T x0! D32 0 A_T D0$!0@<  1x x0% (0D,TSI6 O-`\(pX8SM 0PP0D10880 0t10x1 0 ?o2V0S 0S W w@P  0P0 X00 p1# 0@S P)T, U T 0 1 # xP00? PPm@T`P @  TP 0@T0P 0IC1S@1@!0<0`╎0P0; p 0S V <0 0C BP0ap1  $6* 0_?  Rp1  5' 0>  Rp1 00p1 00p1 00p1 "00p1@\00p100Np1 p JP@T`zPH> @L$$I?  ,P1 NzS?   zTPQ{0 0 0SE? h T $P(Pp `@T- 0 P9/P00 #3 0 D1 30 Sߍ0 <⨏pA `aIꐓ $P(@@0S`(r 00S  Vu Uz 0 0p04 00 0 `P, $ L l7 ,P`O@@@Q@TAO ,[M* 2,@*$04)Aq  0000 0R$00#(00S(0 00 004P 0 0S0"700 0P収 ፎv0S 0Sd ew? (0~sW(@20 0T400IH1 `@0`PXP 0Y3*  (0@0S(0 0 CQ ώP0 S @V< 00P000 Il\ 0  <000D $0P [ <0Sy 0PD0W`p000G< 0 000p `;/Ppp Xd*  0 b @( `P RPp`,004PZ` ;/P  R ,0VB^P5P1@1*`Ip ;/P  R <0 @I 0 @W@ 0Y:W0@  Y:p I0;/0P  <0 0I 00 p' R` P0S <0pP00Z ` P@000CSv 00`  F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ PW  0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p,04P8` 0S"*$Q R0B0C0 00W0|@D 0pS+ 0Pi< 0 w`<0 S<  LЍ <` UE 0N W00 Y ( 0  S``V 0`S`j @p@pPꊠ W@[` ;/ PP @ pT00 501 *p`p ;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 U0E0C"030 00c   S & @0PCUP00p 0;/0 P0UpJ@ p a%;/ P`pZ0 P00 JU0 U0E0C"030 00c   R 0Q$ @0JS J 0 0Q $0S 0 Q 0AA0 $0`S 0JQ 0 A <0SD F 0`0 P`( <0 0I 0p' 0W dPh `R^t0l  }xxL0\  [aXy@0\  Y<<@0l  a000 ' ̫ &- M0 006 Ѝp@-@ PU 00S  RQ Qp|0P{ P { 0pD0D 0 Rp@-@(|P(|p蠑tp@-PPM`% @T@T T0 Q 0QP ``I0`P 0 RЍp0i0 $l T p@-MP@fPUP`0S$005000 0   P& p" PQ! 0 00CR 000S 0S$0Ѝp*00%`$0L0L 0 Rp@-@(V|P(P|pPt00p@-@ `0S P(?|P   (3|P   @p($|@tp@-PPM@  0! @  0 `p@ @Ѝp 0 S `0<0 긧 X!X1p@- @0(MT0$00: 0PS` RT= 0TS@ 0 0 $0 303(Ѝp B (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@ 뜍8@ \0P@- D  R4 S  3  $ h 0P@- XS HH@ 60( ( @ 갋qq qA-`PpPp@ U T 0`F0 P\ 000Q A@0?0  U$@\0   P T00@-01@UT0P 0 !0ppP00@-01@UT0P 0 !0pDpX0@-@UTQP  0 0!0 poP00@-01@UT0P 0 !0o|o000/,/,000/,00 0/,0P /0-@PQ@0/0P /0P /000S |0| 00 9/X0  \\ $0 /0,,,mNA,\, A- `PV(Ep@0 Ï@hC12c` P@ R0h0h 00 PQPP@@U0P10+ ,_ N*+p@-PD@@ $z0S,000P p@ zx*+H*1A-@Q`pP`FP t z0dS AA0U0FU0!0 0p000 0 y?UU @P P0p0p@ ^  B0B10U  ?ࠃࠓPL0V0 n 4` y***)L*) ))l (1A-@PppG8 `0#P #Qy0S PFA@@A00 0 0!xUPdPP h0&&```bXX00A @ey8080X  )<((( '',( p@-$@@ @KyPGyp'0p@-@P PP P @p@p0A0 ȝ A-PPp` @P P iP  P@3* "00@ 00(0V0<  00@ Q:// BQ://@G-04!00S(03 0p00Q= AQ@P``P000QЀ @P  P 0R@ zTl@0@S z000  B B!G `i8%i%Lihp@-@P P8PpU0 =Sp=Spp| p@-@P LPP@Ppp@z0 $|$ p@-PTx@P 0 P0@p#p@-@PP DPp P3#p0D $#L 10O- M Zp @To p `P P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 Lz<1 0    `C 0S:a  D!W0 0 @ Ѝ0Z   RS@  ` 0S a1S  Ѝ PP~fTfeep@- @t,PPp 000ppd|A-PPh`` p\@P 0=S Sp (00@0 | ,@-w@P* 0@h ,@-w@P 0@0 ,@-w@P 0@0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1   p@Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPG-P@U`pV1S @P@E  8/P?@P@@@0@ģYC !Qp    / @ q  0W000 @0S@0  pPT1S1 S Do 000  q@@0@@@ @@p p  qQ0 @-@"P 0 PCQ0  0 R QP 0@/0p@-P`@T0] \ = R=    T0"] \h0000000000 0#0 0#0000`0`000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! O-p` uP$ Q@@P0QpG@`X 0Paat0O6u00pG.wTaX@Z_B $ 004 D00.[@-,@@0@P0S@M-`@P@_}P(p0@aat0Ot00ZO.TTaXPB, ,0( 0  _Yp00 0Ped/ B/0  Q B  / 0R % B   %3 %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 P 00 0p/0S :p@-0C@0 P 00 0p/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0 $000  / 00$0ThTp@-PP@ T _P 0S Sp@_+^Ppp@#^800 $]TH0 $T~ } p@-PP@ T _Pp >p@+`4Xh0T $90W0T $2} p} p@-PP@" T( Pp _P 0S S]P p@]p0p@/80w0t $Tx0t $| | p@-@PP U  p@_80g0 $Uh0 $<| | 0@-PP M@ T ]P Ѝ0)_P 0S\00 /`<00 $T 0 $Qt{ T{ p@-PP@! T'  0Q  pU]P ^P K]P F]P p@@]800 $zT0 $qz pz G-PP@F T  R! R `V" V  0 `PqPp$, 0P R R/ 00 0 `V00 0`V 0.00 F0R"  0 I0,$h 0K/ ` 00 00 0000 0 `y %Hy y  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 0:0 `x @x C-@!P1 0MpP`030L TB A< WP8 -Y` 0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T U p0S Op% 0 0 D0 ;00 4  T .  RP R0ȥ YXw 8w w v O-IM4M`p$@PPJ d4 0I ,000 pW W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l @ J- 岰p~ # 4+4J8 #8T  Ç qJ- 0S 0UV  SV S RNJ= 0012 00d$00':00H0 40 }RP @,VU  W3 0Sa0S  0S0s S0S RJ= 0 J= 00ZWJ O<  UP^ 0SI mge1a! 4a4#Q #< p0<0J8 0J= 00$ 0 X\0Pl J- 0SJ=  0;pS SuJ͍ 0 %! 00S`LP P P J= 00W0  UPJ͍ YP ꞤVVu Tu t O-`H$@D4 0MQP@pDH0000$0C S0#3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWXf t4"4 8 #8 ឆpPT0S RM 4"4$!$("( #8 #8 DPT8VT00QWX00 R0SY 0Sf S4ZP00SP"0 T XT@@O 00QWX00VT<x!  0T  < X: BpZp  0PȐpZ@D 0   T00? ,!0  piT 1i #Z3䐟P p0PȐp  T00?pW@D 0 DP^T[pAL  ҅xꁣ\R`q QQp Xp o 8o n tn (n m O-`!p1 0IM0107 P@Kp/ P PW PWD H0@S0h 0&h00a 00  0zP 0 0 1 30!Iߍ Z k0VX 0S P 0 0MLA-@ 0P`p0 { 0P p@-MP`TP@@P@T 0S  R0S 'P@PЍp PPЍpp@-@P PuX%Xp0@0 j 0S/ AA. 0C.S .R Q P-S Q P_S /@-0S0@SO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJS 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0Sp@-0d M."P0'  @ 0R0 0S  R la  haR 0Sd .P 00 Ѝp 0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0PD@0S0S 0S  Ѝ00n0 e @-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R# R!  `0S Ѝ Ѝ00S SD<0 9P 0  @\Kd d p@-@PP` U V 0p!Pp``D0P -UDD`0P $V((l0P  d c c O-M J 1 #E 01p $0p8 `F  P0 0 000000 8  P [ 00,1040300؍<Ѝ0  R 4"48, #80,000(0PU,(Q Z Z Z[ ``x0 hc{[00w[00s[00C=G-@P`p W"  hPP   @  @!<<D0 vW 0 m0]  ] O-M4M@<($088Q 0$h0,00&<00,`0 $0S 0S P0 <0&<00!S2 &<00S &<00S @'t7 0, 0 306ݍ4ЍS@70 000 S _>`C @80:0 0ᶀwYpP0  03/P 0@&<00&, SS 0040R0SY pWp@`$`4(48X#8C 0,P: P00(Tq*0C 0 @00@$0 `` pY:9 i2 I520Y0 0 S   S  R  R Q\z  ^ \Q/o" S R0S 0 PQ 4-0 0S Q0S %0P 0 -P7  B  0 (J(P?Y 0( P p0`8P<p`P,@4Y 0S@TC 0SV 0S S 00S P(0 0; R=P R: R70S0S `;0S PUh;35 \ ^ 4; 00U Q  P \ ^  R R  p Y P` 0S   0?S C" 0c6#PY A ^h #\S㔐Q^'@ pTp0S 0` p$p@ T :4 d2 D52H 0SE0 S > S PR  PL @0P0 0`P`&)0 0e?0Y?P/ @|]( 0@S0`P@T $PP@P bbT$PY@T@ pTt W 000 P` 0`pVPUS ga0P$0M PH0:L0 0``H` dPPP<$b0S4 0S |b 0`@xx?3.QRSP㔐  P  P \R?o20S c R㔐Q OP\JR PMVs `$p(,PP00 00SrP@T0 H6$p0(,PpP S 00 0 P@T 0S00S`<`:  0 P pY 0VwP-v0 P R 400S R00U  P3 0 PW 00S*%S㔐R-0S  =6.! 00q,@P8P p<aRSQ \@` T% PP@ aaTS㔐e ``a@  0K 0P  0GP ` @P lajaY@PP?/ ` `Sdb PNa` 00^P  0 ``bPPH [:P^P HHH HL0[`0L* &aX2個0;>(0$00PpU 0@Yᠰ @H`}대pPUp`K|0`B l` 0 0( TP`ph !HvP tP20KD  Dp,0!vP`K(,>H|,<0[ Sh S \` R` 003 Q  R0R`U`P t&H&d t@ <@ \? > #; f: x9 Ii $@0P0 0 ae0"0S0$0u`H@P P0U 0Pj`P0U b`0$p(,P` K b_.x> f? uP1x00x0 >`uZ@`H`0V00L0`,`P``O-PTMc Zj  ?Q1@0P=>p=^0  `Pp 1PF 0p R R R0 T@!0P p R 00 00  BP0 0 V  Y [ 00  [ YV,@TЍTDD?/"Z((D0/L5 P5 3 k 3 l G-XMp@I~P `P@ 00   0R~P 40S0. XЍ TP u_  04~P c_8<8 2P 4PPO 0 (3 2 O-"M2M 0`Q<000 Z 0Sq ppr@ p <  =~A. *8PPh 0#S( EP$ 0==0P  @ PRP R R UP*P ItP4 @ R0 @P;tP $K$ (0K$ K:P0(X PPU 00   P  0@PKwP0 x0 0< 0 30ݍЍTTD0/i<<x0/_귓1 1 / h/  p/  A-(M@0 p`pP w .P @PP $00S(Ѝ. @-@ ']P 0  @0O-p"|2 0M020) `@1Np! P PX PPQ P Q,p!1 0 2 30`ߍ00@SPX (0@SZ00 0Pg b00 0 T P ZY0 Y  0 0P Y:[ 0 0 X  R  XR P 0 zӒ  A-pP`P@ 0 I 0P 00 $|1 0A-.L RO-LMP `0 D@00p840 <0T 8 0  0%00#0(<  .  " xb*. ,\Hǂ@# @!p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpGp,XG4pǂ@@# !84Ga@@ 0"00#V 0:  5 C0hS@H"p ` *:0V@@p`F  G4\0P 00P  & & !1 p@-PP0M@0 00( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t T,00t v% d% $ C-8802 M,"0 P00  `p 0R @  0XS @@0 T .. 0N l!\1 0 0 30 ЍT  0A a 00C 80BS.R ^V* 00RP 0FS0 S S^*0X 0n(."4n4#0000@^0 8< 4^*0 8<- McP ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D{D," ! A-P!1 0rM`Pp010: U@ @X0^00pAtAV0OW0 1TA Ό 00 LVP2  0 swpP# 0@=XP 0 0 1 30rߍx0<0 tU\=@0 kP X00d 0P0Bh H $$0 M000 Ѝ8 -- M0 0 ЍЍ/-4 -M, 0 0 pЍ Ѝ/p@- MP| |@|0`  @  P` @X@PU  Ѝpl p(LL1 @- 0M`!000mp P@   np l@ 0 0 0 30'ЍlPpW @@T PU 0SP@]TX00@did 0p@-P0@ 0 p04X(0P1X(P,P-Xt` 0`0PP 0&P 00 0ppP 00 0pp< 0@-@ 0 0 0 0 0 ~ 0 0 00@-P M @0W 00P 0 @?o2 c0 Ѝ0J2 00 0p@-@P 0U0 0pp@-@PW0PPW(0PW(P,PpO-p0Pm `,Pe 0@00 S S0 S S |0PS 00^P U(4"<8#807 ,,P@P! 0P,00S S S@ 0AS AQ@P$ 0 PS0Q0000wVP  VPP@~@PPD    O-P Mp@,0(Sx:  (T] 0 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0T 0 1  @D@T`G 00S#0A S00R K0S000 A Њ:0S$ 6p@V0ppV(0pV(p,p&@ ЍUP  (,@(  Ѝ0 00@- M@P   p P  Ѝ0 0$  0$0 P Ѝ08p 0$0$ 2 Ѝ0O-PTMe Ep@,P<@0 ppWPb,T`P^ 0 ppWPS,PPU0@ \ \G \Q \A pp 0U00S SP, p0 0E 0@ ` R  R2 R[ R 0 @U ` 0 U 0JX0L 0 TЍ @\L@ 0U  0⼰  B0 ` ` SPE0h I4 E0 :0; 0Y= S81P3 P#S41PE2s2PEsSPE0i +0 E0 809 PEPE0i U0 8PPEPE0h U4 :P 080 4:0 @-pMhp) @ip, `0v0 0 0 @bPhu l00 @P Ѝg<00@Ѝ9ig / p@-\ ,@\ \ Q :\ :Ap 00p00A-@$MPJ P 0( T 42~|:pB8N87 @8nj;p$`137<Ǡ  B- @0NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0 0 0@-S@ 3/@3SO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ |3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr ` 9  P4 0 p. 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z " Z Z 0 00  0 0 p 0`\\ 1L0 10`ZZ- Z) Z+ 0 p 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7( $  @-@P  @I0/0  1p@- 0@P0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDL$ ʚ; 0  Ã0@-lPP B1!1 M@@HD0 #( 2 AD@ (i;  Ѝ0@ Q2Ÿ0@-` 0P 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> 0pC0@@.SM 0@00@000@ 0pp@qE0Cp2Spl 2S 000 @ @  @000n l `Ad Dn l lAp00@  0pGqqAp00  0pGq@p0000pG00 @ @@jP # O-IMM4`'D 縔 $ `!P@@p7R@@T0`0T7N0P@0 4p0 0 x@ N'7 x T &0 8 H < 0`,P0P06 U0X06 0< ` 8 , 040P<0, R00S D0`1  P0 R 0 0 0R PT i00S2x0S 468 0/ⲀHp0p 0W9 X%U80 P?Ⱀ-1t4D 80  4 (  4 8 h  \ h O-lM8@p P Pv0H 0 H`W 0 0 L`!0(RᴴẤ,0  |&| p&M B.P  SD00 0Y0g`!R   ;`!R0  ee0 0 Pa0 0 PM  P90 0 P%0 0 P0 0 P0 0 P0 0 P`!RwXy PP Q< `0Y  0R  0f R 0 R  0Q(0sf Rn 0 Ri  0Q,0snf RN RK 0 `SL 0s]f`!R   .0 P 0 P@0 P0 P(0, 000Z lЍ   X倂 O401h"40 t e($8"0 t e/ "0 t d/ !0 t d/ m! 0 t dŸMOpS elЍ lЍ@0 o( $0 n 0 m0 0 k 0j0 i0 4D  l  4  P  x X 8   @-`0AM 0M@p 0 40 0 <PP0S oD 80 0 4 30AލЍ.*$0,@- M@ pp P<`PP 0SD 4' Ѝ00S.S 0S Ѝ p@-Px AM p00 ` $ 0 @P 8 ,0 0 4 30Aލp要 0p@-S@` P0 @S aPV 00pV00pp@-P@P P  ^U00p4 0 t cU00pD 0p@-S@P  \ \U00p4 0 t cU00p  p@- P8  UpPX``t 0tcU:vp(@0@ hcpxp 4 <Q@-@ ||  Q< 0 TPcH  t 0GcZ  O  P P  p@--P<  UpP<\``t 0 c3U:p,@0@@ cp(  P} @-@ P P= 2 @0R8  P@ &@Pm P.P]  P:  Pc  P P+ PH Pp P\ P HP4*$!( /03b3'}{)t/h\%2  p X ,  | l \ @-@|( Ptp ( /0Tb h h @-B.@M  TPV0  t 0:bM萵 L Mp@-8MD` 0 I0PP@0400 0 -.bT @D OJ000` T0 0 40 30 8Ѝp@Ѝ/.0 L0PI넿 O-@Mp@@ ` P0 Q ЍSq SR@@ -R 0 0+R0  0h300 00 B10 11 .R 000 @T@0✑)SQ 000R#3@0SQ #3 00R0#03!3 T$ (<0(80(40%<0%4 0)< 0%()4 0)(0 P 0R0P 0T00@0SP 000R#3@0SP #3 00R0#03!3 T  0T00@0 S\ 000Q#3@0S\ #3 00Q0#03 3 T q  00 Q @0N0000D00 0 0 >ꀾO-`QtM0D S 04   $ 8  ( <cH#  $D ,Hb"L,ĠcD$a8!b,#4" 00  8  /_Pc$Ѝ4 C-`@P@P MpO0(?͍0,0= 000=00 0P8 Lp4 H Dp 0 PW *0S@2 P_P0⯭<0H0 0 0Fp 0(00H=`0= <<0@PV *, ?0 > 0 ;/0H=0`F$`x` 0m `d0 ![ 0 p ( 0%p Y1 Y> H= I0R# P0⯭<0H0 0 0p  R 0S .S 0S 0S00S.S=L@0@=00Sༀ@tL 0@d/ @@Z 0 p 0 D;0Sf*2$0墏#8(08$0000(  C0 `CBZ 00pP@<00dd ZU@80  pU Z8@P@0 Z~pI 0 0@pA 8;0 020#80B,; B00a0.0 .0 V0$ V@80A  Qp <0 0S 0D;:04H+B 0?R0S d d?/ED00<*: 0  0 30  ݍЍP0⯭<0H00  0p@ 0 /p(ꠉ฀> P0⯭<0H0 0 0p0< 0@08 BP0H4 0R0IY0S ?/=00S3(@ R/dpD{0 YP 0  p < 0@8 B VPH=00S2Dpd^/0WWD{ Y 0 pd =00`C7 x @P T T㐀 p`P 0U0 0 F{pF 00e0T0PEm 3 0 mp7<0@p8`P@C 0PP( 0 Tp 0  P`=00Sx2`@{20@DKxdf/`0 >Y 0 (p 5P*=00CF@@LF0@R_ d #Y 0  p  0D;d0 Y 0  p /2 d0 Y 0  p `0pVD{ -8 zOP0 d X 0  p 0SD[ =8803Y t p 0p 0DK`VD @0TF1!PDQn `  0 PPr DD0p@D{ 0pe =00YU   0PX=00@C+Y =00SCD`@R_0 d Xp 0  np9 0 d xX 0  bp- 0PU0D[q* p`zOUD[h 0 d ^X 0  HpD@ Pc @0TDKT:UP 0gP+@0T 10"3h" 01;@0==1;@020!201;@000301;@0<=1;@010 1;@=0;@ 0 p 0D 0 S 10k @`V P  @$`U 0S @` 0V4 ] d0 W 0  p @T +A0T 10"3  01;A0==1;A020 1;A0;< H x d  Y؟  . D * l  l D p 0 ====== 8 VUUU @ H L \ l  +@0T 10"3  01;@0==1;@020!201;@000 1;@ >@ C=0;@C+A0T !1 0014!;A>A C@1;3@ ] 0,p@< 0@8 BP0Dk 0PCU.ȁQk@p@T# 1 W2  d0 W 0  p=00S!)0@&0P#0p"PP0p@ U/2D{V` 0 p < 0@8 B@pPH=00S/SP@/0p@S/2DpD{V` 0 p{  @ ` 0Pr Pp 0 DpD{pf 0 P_ 0D0D;P 0pS 0 0PL $0D; 0 up@ < 0@8 B P6/@/0DpR=@ 0  0-pAP`\/x%@105X0DK 0op'< 0@8 BPU 0P p jDK5/`Dk 1d 0 V 0  p $/`Dk  d0 U 0  p  /` /p /0U/dp U 0  p H=00S0H[=@0 0W$P{ mT` *, (7(0 t7 0 8/'=P@D `0.d@ 0H[U 0 pU 0pWD{.*`0p] @ P0D;0 V 0 [lp7 `0 d uU 0  _p* `F@P0 S 0ZMpa=00Sgy.H@dR/pD{0 JU` 0  3p <0@8pPC 0 @P 0 p 0 @PH+=00S  I=@0@9=00S I=@0@-< 0@8 BP0DK 0S4zPpk@X: `D$P PVP. 0S @ 0T8 Q d0 T 0  p X <0@8p`@C 0`NPz([ 0P pq 0 @=Pi 0 pb 0DK 0CY@-0pD{ 0 `pL 0A/d T 0 ` tp?  0 p7 B 0 ep0 -p 0 PDXp# =H{` 0 PPV *, <0 < 0 9/=`F``p0H{ 0 Sp } 0p E'p a-  0 D Pp =H`  0n PPV *, =000 08/=`F``0H0 p ~ 0p p %- 0 DPp =H`  02 PPV *, >000 08/p=0`F`H0 p n 0` Kpz ,@ 0 DKPpn =0H{P @PdU *, x?x000 08/=PEP_`P0p 0 NH{{pF 0 p> 0 O lpT6=00S /0 S00=00S ?d0RO 0 _SP 0  Hp `0 dD; 0OS 0  9p 0 d CS 0  -p > @0DKR .$0 w/d *S 0 p(< `0@8 B`P`^ 0P p pDK/, 0@+,),dv/0 R 0  p H  0PM=@0@=00S 0]/d R 0 p PUpDD6 1R`@ `$ @@@@=0Hp 0J!Pn `W` *, <0@ @04/D0$ pG0- p UD0HD; 0D S\ @ 0 xpC 0- <!?C0 S  0obpv,=00S 0D KC@@=00S< 0@8 BP0DK 0SS`+C100 SrD  0o.pB0Hk=P0 0 P U@ *, :0 : 0 8/0-`PE@ HkDKP  0p0Hk=P0 0 P U@ *, 90 : 0 8/0-`PE@ HkDKPI=@0@9Y =00S.I=@0@=0@lI 0D @C@TI 0D @C@$P 0PU0D[:=0}` pP?WW @`P 0U0 0 FpP 00e0W0PE= 0 wpA0`hd`/ ~Q 0 hp3 U $pPzoUDK 0 d gQ 0  Qp` 2@PT.TW wpp`P 0U0 0 F3p 00e0T0PEV 0 %p0H=P0 0P U@ *60,& P  5/0H=P0 0P U@*h60  0p@ 0p 0CF@@ $f ` 0 p  PDK 0 PP 0 p 0E@ `@p< MD;  0 pw 80 I CPoD;V0 0Npb)% R/d0D D P 0 pM)` @DKj_d 0 P 0  np9 )@DK d0 sP 0  ]p( )pdR/D{ P0 bP 0  Lp < 0@8 B PD  0`C 3 $P@PI spp`P 0U0 0 F%p 00e0T0PE 0 ps p 0 p p@⸀@T N 0p "0 b/d P 0  p 0p @RWT@ 0p NT 2@$` 0`@T0DK: 0C@` PP@U3U qpp`@ 0T0 0 Fpu 00d0U0@Db 0 pf 0p_ p_TUp p 0pJ pD@:mȀ=0@帀 4   غ  VUUU8 h  p T ` ܳ ` 0   *d  x Э t P +E T0T! ##,00 !+E T--!+E TT" !" !+E TT  # !+E T,-!+E TT! " !+E T 01;E 0 p `VDK@J@- R MA P  ,@@0(@;@ Ĝ0S Ѝt M-(040 1 2Ѝ/PA-PS`/p@@W0 V:0 $4"48#80@PU <'P@(00T0T0@DT0S$0l0 (P@갬 G-0PU!::0` @4$#4T00 0p4$#40  @T#0 T4Ġ#400S X T0 $( ,0 P @d(00QA-Mp$0PS@` 0(010$,0v(`V|0Sx(0S! 0, $P(0, V3100&Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$0Q0 ( ,0Ѝ0F "P5, (` , Q/:04800XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQ 00000  0C Q700C20@?D0 D$0>0 =8e  d A-p`@HWP. T @00V 0Px0PV0 G.`U` P7000 200p0 S700W0 U00gD0T X /mo/m///po@-@DM0` p <2J0 RP300000C0< 00 0 <0 30DЍhhXb( aO- M`r 0X婒'`r@B( 0 rgqC0ሀB"RP C@$A i!dP @3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H}p# W0Y[0S    00000000S 0 WZp@@ 0 DO p XW  0 MBp Y H_0$ 4 Ѝ @ꉈ%I$: (aPD A-`pPẻ0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0. 0 @@( 0 0p@- M0P @0 80p k`d p Go4 (0 0 8 30ލpYg^]PRp@- `@PRPIP0 ?p@qG700pPRp@- `@P0P'P0 ?p@RGc00pp@-@Q `PPP0 ?p@,GC00pp@-P@GP  p@ p@p@-@P 0PS <0S P 00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00p{P @ppP Qp@-@P P`P q U 40,E0S 00p UPpp@-@PTp (0":k0cSp: A pO-0 -tMP@0 D18up@@(50S @P/00% 0<0-X000X 00H S0 100H < 0H P-\\Ё0HL4010X @X `V @ ER>    0S PtЍ P EXH  @0@ @{ǻJ{ǻ3 $SQ 0$@ TPR 5o@pD 0H5&L @  @R[PQk{{+ Up{ L( k`Q Q4QK`7HpLL{@{0S0H000S0S0SJ Xxk@DpBp@p >p 0 p 000Dm0T00XS<@ 00DA B QR ap `> S0T1 W  0ptt p 0`@> p PPD1?0 0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP ph0p 0> 0W 0@ p p0@ p 4333333o 00M 00Ѝ- r  Q0?0S @-e[-- Mo ЍЍ/G-P`pP WV ᘩ00`F! R !V6  ᖧP 0PE (脴`V PUU@@nPP X1 00s  @@PE  Pa00c V000@00XH0B0 EW,C40 <Cm l A-P`H@H0@@@p 3>U  R A+(l p@-@P00CS0 S  P 0` P p>`@-@P  0`00@060 k - M? Ѝ 0 0@-PP0 M@000 T!   ȳ y0 0 0  ⽳p h0 0 0 30 Ѝ0H0H0 ⨲T00D0 ⟲PZ0*)k Mj NA-pP@`( T/ V6 0S 0S0P00 00S0 00000 R` F`Q000`6P0\ aT@@p0\ XV$$|0\ Oi i ai bO-p#@3 0OMx0410PP`1 dh`0 V Vw Z.` `P 30 00 [ .Q Q\.Q b :0 = 0PY [ 00:[.[#4O[0Q.SI Yg0IS00`0 0IZ 00 0W 7 0 P00 ` `倭0 0C SB: ɲ0   ` 0 #+00巳/00H!81 0 41 30EOߍ:[ 000$0( @,O0 0 00 ` P P00 ZW00儳000 yB<4 PPH U.R|  :៣P pY''%$ f $\f BO-`PM@p  0W0p W0_( 0!PD ,% 000 00 P @ ppP 00 0 "P > Q Q 0` @V 0`VI:`F0V:\`FX @p pZ`FG R #0 0 00@ߍ Q Q0 S S   唞 pP ` Q PG PC T :  r"@DP  0RP@- #[z0dpp ZX  ᥱ[`F Kq꛱ `F  W d ? Z V P, 䠊0`P `p R R R RS T * #P p RP=("@D PPT @`V0 P& !T<: `P  nP T014 @1:o0 ,0 0"; 0 @ 0 @0`P`"' 0@ 0@ 0 PP P 0` @pe c hb (a ^@-@d!d1 0LMpP0D00G DP0`S- @.0 rP( V( QPP0 0偫 0  $AP  S" 0  0 0 D0 30LЍ@PlPPP L@ 5"T88C?F/ ☯IWX/_ ._ ^ C-`PM@8 pPU* Y @@NO00*  0@P ! 0  Ѝx@@JO @!T Ѝ@P P$$C?R/ H-\^ ] ] O-UMM( t*0p: 0hz0L50`P|5pxU別0 (0S 0 S00W :0$0(_0P,0 0 @[ S#p`P ,!0)09 0 L5 30VUލЍ50 0 eP0 $03/P @[:0CoᨂS  Ri  哪P0 `PPP0,4'4Wp8#8X uD PT4R pPHL@8< `\ T]*`P0C 0 `PR0 $03/PJ @ Y%  @ T`0@ 0S4<0S 0 S  R0a6P0 0S!0S H0S0P"P0X`*\0L 0R *P  aH0`0H0LPZ84H0S , 0d0L P0QH RXK p XPHp `BZO[ P0 0 00PT ! R  ȠLȠQo \ V SppQPW  WX0 B@GAq 0SPSPڰP!^P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @l L0X C0 0CS`:Ү040$0S?0@0 (@Pe0 t V?@gX00`VX@ `0@庚``(PM S  C'SRG 0fP 0` P 0a`%{"3V?Z/ Ⅽ(0SX]?Z/ {P(0P04D0,0_?R00 @P0 9 VT D0,1Q;*,`P P P`P0 CR00Q 84,`@IPPp0`P CR00@T@@P`@9$03/P `1,0D(`C 0T00Pv  , D00D0D0 (4PH0 h@P0 E VH0S0P T D0,1Q=*,0P,0ᘨX@LP  0%!}   Nҭ81P!   0!`ዮV 00S S Ѝ0pwЍ00C?. A 0 |Q O-@#3 BM0MPP040 0 000S0 S 0 "2 0 4 30BލЍx A~` @፟ p0vG#" 0 6P@T*X " Ә2P"0 / 5#@PH pPC 8 0 0@PHp 000 0000 0 0`VV? 0 @ @IP  ᶬ00S 0  0@T.   0 0ʭ 0  {) 0 tC?/ ⌫_᳭ 0 dᬭ 00S S[ Y᢭'SLP P N G-M0`p{@P0P0 V 0   0 pPzЍ 0 PP 0/ ;dM A-M`pPI@P ,  ( 0 P PNЍ, P00ЍA-@P M@`PpP UX&0S8 0S0S8 P,1,!0( 800<0 P0?0 p`(P 00 ЍU U* / 0 0 Ѝ0S ׬ 0 00S000s S 04 @P,,?/ ⸪0XL  XK O-DM 8$044 @Ph00<00 (PP s`pp'0 `P GP 0,0 P0à RR RR 0 R R $0 S S 8 !@P 0p 00S S S@ 1U h*@ @P 0S 00R 0 0APEB@ Y  9:I S@ 4 $2 0 @0Iץ Y$:  " U@Ir 0GEPP `p   @D  Y>pᴥ`V `p 0  0`!L1 0 <0 30GDЍ(PE P Pp 6P? P0 0 0 0 0Ip `pP 000OM  0A 0000婫00pSQp` J J I p@-M`@P 808 0 0 ɠjЍp@-M@ ((  9Ѝ@-M@`~ p~PP0@0 ) <0< 0  0 p @}Ѝ8P0@- MPP@T x 0 P00 000Q T 9 @ Ѝ0 @T? 00C-@PaM`P^ Ud !0 `   p0S  H  0C ^0 .SNW 0@ Ѝ0 XR   9S 1 @ pG W 0  RU 8 <04 c#!$c4" 0ũ\0m0 ⷨU@n<0 ⮨ @S \E E O-P#3 0,M@Q`0$00 UN Ph PV`0:V000 0k Vm ß0 0 HP @`0  ᪚P \ PUW @ZpWP  p$`WH(4"<00S W0G> S0 s fP J(rJp<0p <V VS 8/ 0 !1 0 $0 30j,Ѝ!1 0 $0 30_,ЍO`:V@ \p FP :Z<U2 0S 0$ S$!, `PqIp0p U V V0| TT0| ݧ<0| ֧E0S@dp$`r `.V0p$`WPdqOWpXE D x B hB @-`!1 0,M@PP0$00' U- 0p0H 00000001P* ᡔ 0 0 $0 30,Ѝ脩 0 L0h0 xU0i<0 o O  B  tA TA O-ptM8%045 Q 0@0l00 W P P* R/ 0 $4 0 l0 30.tЍTIP`<0T :Tu T 0S0` .p<0` ' 0 4$ ( , 0 4 8  001@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<000j0:0@0T0` 0> Zg 0Sg* 0CR00`:Փt"2 0 l0 30 tЍO@PPUF*0: T00S DP"H 0l 0[P3@T` 0Z00S RZ  @T`0zu YPr S 0 S P0@n Pa0SA:e 0 Y Y Y@$!0Q 0 H P x8 @R0PHP`0T ;W Tt T0` 0uC@ < O-@P⼥M p`  500SJ ([N W W W 00Ѝ0P R $ >0[& + ᄙP$p 0;/qp 00P @ P S00 0 00Ѝ p  - P0 Q+ L WZ p  0-P 00 0 SM  00 0;/qp 00PPßQ <PU;0 {0p ;/qp0P r 00 0PUßR <0PUß`X0p\ Rh00cX0P[NS  00Q[ <P800CPU0& Z  "  RNLP0Pe? P ;/qp? 00  P @ P 00 0Z 00 _P(0 S%: PE u ?J 0C09PPT 0S  0CPß,1G0 ۤAPU0 Z 0CJ P%JPP @0P Q0000 00P0 ⮤0ᴚꨦ00᭚480 ⚤0 <p7 6 p6 O-P,MPP`p@ T 000S000Z00y$0 0`PPW0 00 @P $ 0R00SQR+XP `   0P 0T0  UPP`O [XhV,Ѝ CR_o$ R  B0 S $ PRPPU8 0BQ: `PP$ RPPURP%X00S PD00P \[ TP|[  0P \ `PdP^[ ATq [H S ` P$0c z  P 0S   00S S0S S ^ S@@T000S00]i0\#00% ^@ [ @@ S@ S80h0 ⌣0咙0D2 p@-@PP` U 00F Gw p 00pt060 hUX7<0 _ 0@0pW0TSS00L2 ,2 - M0 3/Ѝ/0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04P0 00 P1 01 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04h0\ ޢ00\ עt0 T0 p@-@PP U 0S S S 00p@/p00p@/p40t Ⱒ00t ⩢/ / p@-@PP U 0S S S 00p@/p00p@/p40 ₢00 {/ . 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 K00 D(. . 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 00  D- &$- %0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 ١00 ҡ`, F@, E0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044>,⠡0Y0,♡|+ e\+ 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044K?G/h0a0G/a* |* 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04iS?O/000O/)) ) 0@-PP M@ T 00P00 Ѝ08080. T q[?.,)  ) 0@-PP M@ T 00P00 Ѝ08080^/T [?^/ߠ( x( 0@-@P MP, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/⩠00a/⢠' ' 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044j?g/p00g/i& & A-PP`@7 T- V: 0ppgS S&0 03/P" W 0  0A/0 03/P W 0t 0A/Co<0<0m/"(#[?m/ & 0% *d% A-PPMp@`2 W8 T& P R P P P @ЍPX 00@R X ЍA|&w?q/۟00q/ԟW>q/˟ # P` Y0SP@J$q{h$ H$ ^($ _# p@-@PP U  ;p@8080,☟U ?,⏟X# 8# A-PPp`@, X2 V9 T P  R 0 R 0\A/W 0A/|| =/Wd0d0/PXLL?/GV0?/>X" 8" " ! A-0M@PP` 0J U@ 0pS S P R`V V V ЍW š 0SP00Ѝ W` 0SPVll>%.T0/0%.ݞ 5 Pp%{ l 4 p@-@PP U D p@<0<0/⹞U$ >/Ⱎ(# ? 0@-@P MP1 U7 0S S S Ѝ00 03/P 003/P 0  Ѝ00 0  3/P 003/ Ѝ08080/nU ?/e W 0@-@P MP1 U7 0S S S Ѝ00 03/P 003/P 0  Ѝ00 0  3/P 003/ Ѝ08080/$U ?/ {h p@-@PP U p@aD00/U((?/p@N  p@-@PP U p@D0D0/U,,?/ޝp@x t p@-@PP U p@ D00/ƝU((?/⽝p@   p@-@PP U p@JD0D0/⦝U,,?/❝p@7 p @-M@ P0.S00Ѝ,@-M@]p  B0?R0S Ѝ 00 0n0CЍ 0SB .-R10 N R8S) .S .Q* A BR00C S(^ .^0P S.S A B R0N \-^ 00SS 0.0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /| H0 0 /\ L0 4# /0 48Sc B P_^p0Q ^ QC G(00H0S 0Q* 0F S0S 0 `  0AS"`!0}@T`0\0Yp 00(00@$ЍATw0S@A@"@pZ  @0Ġ?  0^0A>Sp0pS000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/Pⴘꮚ00@G0?Q0Shv?}/P⛘ Vw*p.Y P LP m?.P∘B X p@-P0 0M0 10 `00Gp !@p < 40 0 1 30ލp@@  A- `0 0M P0 10@0 (qp 0 p0 (0 0 1 30ލ?0 Կ Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?Rۙ00Cԙ(00/C/G-`@pTY( V W TP@TY 0P?S  00衙(00 QSp@-`P@ uP`VP@  0R p/pA-APUQ?UU@A`pp W ڀ1AP^(00Y00U?00Q A@-?SSRB 0@S A:005(00/-- M ЍЍ/@-M@ p TЍR/0-S0 \ R ^000O-P MPp 0EU"S} `@᳑P-TR +T| Y >p]00D`" [*SP# K@00D P a0D0SW0DA0D0S70DS| Y[SP;+ꤘꟘ0S \0J0 ЍY@0Td UFap P 0A0C0 A RSkUPPr]`q>pa00Dn000 S   ЍY @0T+ U#8a Pp00D0T00XS"@ 00DAA PQ0Pp>ck p>cP0?0 6CPp>c00D[00XS UPpb 0O00XS UpbPPp>c 0@U0@PP1@ p>cP433  00M 00Ѝ O-@SM ^ YXb 0pS000!R !3  PP E`#3`9P*Q30A 0#1#2#4#8 z P8   0 A 0U0 pQ?PP 0@pQ 0S  Ѝ螗T000@0000@0 ␕ꏗ0000 A-@`Pp》0 }P။$0$ 0 M Ѝ>ꨴ P0 0p@-00St@@@pdddPPud@P@P S0000 0p td_@p@-P@8 p@G-Pp` t@t0@l@  . U  40 {   G ꌳ (\  A-P p@` F  }000 @P p@-@PPpp@O-MBލЍ 'P (&@P  4/P Q Q 0 0X0 00P 0 0  @d P 0S 3/ H000P s;̯  X ` p\\0@-@P$MP U! 0 P% 0 0   0P $Ѝ0XX<0H X⍓U<<|0H Xℓ@X ~ O-@PU  RM `100Xqp0S@ @@@ PⰀ $)A0PS,00a000S 000  000 000 000O E@00044<0 X ` \ X X D A-pP8  0S@`$ 0`S @0PP0S `V @P ~@V0x00 zT@ 0@ P ((<0B/X˒,t O-RlM 0 4 吀0 R X #`000Sa# 0S00 h#3 0 4 4 0P Yڀs倳3@0p P0V^ p p @QS  QN YP0S h @p $ 3/0  0PY@@RP00SS" 00C0T@lЍxB@@@0d20\ 0 00SN  R002( 0 @ (,0q @p 0TT}P 0S 0@00D00 0@0mP 0 S PW @@E(0XS, @ , 0; R1 1S@X  1( 0 @ (,0%6&>I/Xב0S XQ?I/Xˑ@lЍE?I/X@^(  (,0̩ t,W`8VXUdUT4T@  b aC-L"`H2 DŸ0M000P/"b1?2cQ 11QAQ@PϠl R QE00å?8@ 0 t0 30|Ѝ x?@O3d11 "@(,p0p P$;.#"0.cR:x.c2Sp>  PP 0 0C@aa0C0C Cr  \\.N2?#c!!"N -  ! bQ@.5:bQ,. 18.#c!!2N0 ] 0@ S 0Yv0 `R 0o S `k 0@ E``0 S0C0t  B1<0Q/,0A!b0\P  @BYF0 `R 0? S 0  B1\<0Q/,0A!b0\P  @!Y%0 `R 0 S0 @`;Q0,0 0\P  @Y0 `R 0 Sh0 @` (;Q0,0 0\P  @Y0 `R 0 S^0Q!/ b !S: 0,00\P  @Y0 `R 0 S>P:Q0,0 0\P  @Y0 `R 0 Y% 0  @h`@0l @`z9 0Q,00 \P  @fYj0 `R 0c S)Q2?0c01Q 009 00\P@0 @FYJ0 `R 0C S8Q0 0\P @0 @-Y10 `R 0* SP8 Q00 \P T0 @Y0 `R 0 SU,P!U(P7Q0 0\P @0 @Y0 `R 0 S~l7Q0,0 0\P  @Y0 `R 0 Se040080 0<00@00D00000 0 P0@ &\P Y0 `R 0 S> 0@?0@ S0ŘY0 `R 0 S'Y@ 0 `R 0 S00&@2?2c  1R11Aãd0Sâ/c1S0c0l5\P00 [Y_0 `R 0X S 0@0   0  +00 S0R05`@4 0\P 0 @/Y30 `R 0, St0 @`0\PS0044 00 @ Y0 `R 0 SY@0 `R 0 S0 @` 0@S0 @ #qp oqp  0@Sj" R-Q RuŸ0c "QY22"0"b0@h0Z YL `Q \P Y0 `R 0 Y0| @_`z0@S !YrI0`Q0i R`eUPy 0@S]A P  P Y 0 S `Q0,PE0@ p@`<0@ S~ 1hY30 `R 0, Y̢  lP)\(\ ףm H H  * X p  t  p  t @ L n x h X $IQ| ( x 0@S 1Y0 `R 0 Yu 0@P !  P$(,p0 VR\ 0gS 0` ` D ! D $0L! P?A1c$(,p0P?"dN2c 1 11N @1?2c1Q11@  ã/ d0 S  á/c1S0c01\P00 uYy0 `R 0r S042Q0,00\P ^Yb0 `R 0[ S  ` ` o P 3 \<A A-MPp@`40@0 p0000@p T p`0FЍ"00Ѝ(@- @MЍȎ O- M`p@P댠 mP0 X X0 00p0 @f Ѝȍ@ Ѝx HO- M`p@P눠 >P0 T000 p0~@8 Ѝ蚍@ Ѝ輍 H@-0N \0N@ T \ڀT00\w00p@-@0M-S` +S`P0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-@0JS( MS 00C S!00 [?P 0/S 000 0 0P 0.S  0{P 0.S 0 000n@0 d m@-10#Lc\3j*0Sn SW @Q 5?0cTa0@1L 100\_?L1ceSe aa p@\0 0 @1\00C L``S0B0S0B\D@Ql`LPQ S5 0S``Tàn 000@002c2cPÌ 0;S0C l là0Tc\0#3S l là)\P*Qgfff$Ih  ף404 @-0,@ @M .Ѝh P0 0A- R`P`b0SN@P 1sPp@ 7P $ tLp(5190@-mΠ0l6@NbG`122d3c@By:E.€Q_uk9"mnףp= ףD Sc$IųQ\(\ Q)\(\ c 00 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0㳄 ):60 0($0(>! 0!‚)a!!!0C00!YoÏ(" ?00 #2>[?G'PE@@Gp1#! +"Q 10,U#1 ?0 25:$20 #4"".<2Q D2 30 #1d0T\`"2? B4sppp0/SX0 is c 0I"):60 0($0"(>)Q!!!0C"0Y_("Z0%R^PVXPo`v c 0!0#&: 600+$0+.P3& 1110Bh#`V:+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0$):60 0($0!(>@$ 0‚!!!0C0\$)YÏx4(" ?00 #2>0r/D B  1?A1c1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\X%`;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0t&`000  @000TP@DP0S@ @0 @ 0$ Ѝ& vc 0 -'):60 0($0'(>$!!!0C4'0Y)("0,".L<0@0P<0000' 0 P<0@0PxT 0 O-@P`Mp 0S+  U 0&ZP? ނŸ01# 00 0 Q 0  ! P iB00Ѝ0 S! 01P0 U 0UPz? ⧂!01#. 0!U00 R㨡!h&0pP l6m&NS@0HSH0P0 0Z0d 0S00Ӄ!10001[ 0<zhhpPx@2[ OX10\10 01@T% <T>0pS0S >S@p=S*S0S -S0 C R@0H0010H 9 b@N h&lFpFtF0 h 0 @10 0*T@T -T00D S0@0JSl0S,S  ;S  RfH .BL S] ,S;SZd00PS 0,SPx@PJ 0SGH  L t& `h& lp& u&g.l600%( ,0P ş pP$D $cR-:$cR 0#031d002c2c# b?0cXZ  ^  RPp N p$lpLP 0H$,0P 04,004Pğ P0 #cR":#cR 0#031d002c2c3?0  cRp c sP  R PP# x3t3p301c00,^004P0@380@00000 00N  0h⊅@ 0@⃅ @u 0048R'0  Z0S  *` ϠϬq^Z R pSH H D WPE&@@$[j( V.i5:IPI%^ 3#adO0RS@lXEW`` ( p y@F@Fp pX%HpI@@HИ@'Q_Y$AXO@P1:H.BXN T3#dPPS@X0 pTHP@1S\p WPE` 0 ": 600,0!,>00Cࠇ0R?#00 nC1( ၢᡍ H 0R0`(4&^  ((`3`#`a P p WPE  U6 00c\;S9;Q$0(080p P`P@Lp40#XT YV V0Q#`? 00?0S 8@<V 80<8`<  05/P `0Z\ QX QT Q{P QwL Qs p0pS P Q(% Q!S, Rl0S Qh 0 SeJ1Fp Pe,Pxp BrIX 0S@`TJ#M @A 0S7 0N080+0+P0P㧾 0` [*[:[$4[4*[\4@E$*[OoB@#[1 "*[$![[t*[[q *[ [$Č*[[ *[$[*[ *[$ [*[V Z2\S}QQ [ *[$ [$ RH SF WD .`,^6TE 0 FC:  0PS.`Z00æ0@T )9 F0 0 30_Fۍߍ0/S <0BQ 0R/S  8P  PI@@K0 0cIPUV ZSZWQ P ,ppH`3@ $(004U> \0 4 Q"<$1V, ⁡ZF` R@!W0( $,p004`@T@M`^v  \`0\ \0$0\4 \$!?8:[ S_0J08*S RZ RZP 8ZC6PM L| 0Wp@ 0P0@E+C.E 0a S`Nhp@@W {P0W00 @PY a0共`PVP{P  {P0/SS0/SPxP$0/Ss G`Fh QPQP Q Q@Q@QDQ PR: 像AN h 0 H 0Nh    Q)j@P ph` p $0(P0 ^0 4Q"<$1 WZ  Q\  Z`@p0^ ^04 ^$0^$!? L\ Z Am pdj0S PW @0W[ 0 00S -<=0- @0 R s Q t̔<\070 A+- h@0PbTb``0SZ0@?`c0SPⅡQPZP }SPPA@QM0`0 RW@0# C !ps~@p p$0(PPF̉S n 1 R Wo0!q0S 0H0B 0410S01 R  0S !0S RNh 0-~ 0 PW @0 0000F a0`ᅱpk@2 \像B<02i$ p,_  @ 0\ hhNA-pQ@Y 0Sl ɀ001N  hh6l6}`P`P 0:S  AP `VpFPPU N hiP0T`VNLg@`_ S T 0:S*S+0C013ZS@Sa0CSQ`P T p@- 0P0@P@CPp p@ 0 00P/P t,0, 000S  ./P t P/ #x @-\F ! L3/L2S @00P2S T? # 3T #0R00P0P@T@@P20CP2P2SU P#U Ѝ\00P2S `@T 0400P2Sl4`4@4044|3L3222 A-`!`\1 0M0100P0Q0S@P1 V7 T=p`0 80xq|q8OT8@D@@@΀TA `pP1`LPP0@ 0 0 1 30ލd0P0 ($vVHQL0 (vxT 0 8 7 T 4 0- 0 M Ѝ 7 @ - -M00$  0 0 0 ЍЍ/6 0--M0 qЍЍ/0 0p@-@PXk`00CS`0p S  P X0` X PXkpXH`L6 (\ \0 `00CS`0p S P X0 X /X )5 (-40- M,0  XE ЍЍ/85 (-8 -M0 00 XLЍ Ѝ/4 (G-@SpP\ 0S:X' (S" WH bk0` V V,* Xv0p0J0/PM`IwT000@00 `pp`/P,0`VpC0 00 7k +v0 0SJ 0 00(kQ40 up0=0  uIqPD@0 u0 0Ck Iqp P --M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-PP aM`@8 .pP& mp@P# j0P S00p@$ 0,0 0 ( 0 0 Ѝgv0000@Ѝ 0lЍ00>0 tD2 8H؂ @-@P j 0#C@j0;0 zt꜂ R\@-,p@-@QPI 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00Sp[hP hP `hP 0PW40 )t 00B(0<0 tv 00ꔁ h A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`20[ 1!pP  w0S<0[ 1!prP  w0S p w0SB0[ 1!pT w0S,0[ 1!pE[O[Mw0S0[ 1!p4 P>   w0S pT 0[ 1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% 0[ 1!p0 *R# 0B Q@ 00B SP i  w0S  p q  w0S op  ;  w0SV0[ 1!pw0S Rp 0[ 1!pw]0S0[ 1!pw0S0[ 1!p~wR0S0[ 1!pqw0S pw40S0[ 1!pXw0S0[ 1!pK pu pn pgs R  0 0pZ  [@ 1, pJ pC  w0S p6 0[ 1!p  w0S0[ 1!p I w 0S p J w0S0[ 1!p }pD vpp T  jp$ cp \pI Up)_ w0S0[ 1!p] w0S0[ 1!p , wy0S )p 0[ 1!poE w0S p$R_0@' p7 w60S py 0[ 1!p@w0Sj0[ 1!p3w0S pXw`0S pL@ wC0S p? 0[ 1!p  w0S p* 0[ 1!p p P  pC p pD |p P  0B Qc@ 0B 0B P$R= w' R 0Z0p @0[ 1!p P  P  P  P { P v P q P l P gq0 S p 0[ 1@!m P M$R@00 P B P =} Pz 8x Pu 3s Pp .n Pk )i Pf $d Pa _ P\ Z PW U PR P PM K PH F PC A P> < P9 7 P4 2 P/ -~ ~  P( & P# ! P w0S p 0[ 1!p P  P  P  P  P O-oMMD @/0P0? PL@0060 D0S 0P00!R !0s00d00 O 0SL   RR l /0 0 D   ܰ00040, h0 \0 0G?@$匰H `00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0P `@r01(0 `0 0EZS00PbP   R00s D0S< P=*X1RRXOX`>pTQ`C. D`Pa,`  : R 1P0 S0r0<0qV ]00,P0R00S 0 ,P `S-0`r020 @\ sMdpk`pGWdW3  r0WX0PP@T080@0Sy H008 @0 10R0bB+ S- C S!!?/.BcSC0P0`EpB00Q0@N*n0 BPk   B.Q r0^0P Q0` 0 0YJ( BZFZ#匀 0 JZ R Q  \ PJZ$0$ 0  \0 S0u$0 @ R| R4 Hp8 @GT@T ڐ 0 R`@0 n8TJZ^\8 Y`   d R0M  @ 0 pGWpW ڐ 0 R`p0 ]WHXX f$p``@HX 0R`0 S \000P>0Tڤ$ ⌀@DT 0R0 S [000P@DT0 8'0 P @ 0eS0 [000P$0W[000Pg  R dPM@H00Q@`0 S [000P$ 0HLXh0P08 Rڼ匀  K[0Q0S  a[000PK[$0 d0^ 0 rQjQS$0ld0VrT  0WX0#S] .[@@PZ08 ( 0PBU$U4j$p`@PEU 0R`0 S [000P0PEU0*0 PP0 Sp<0 0S$0&P Z000P H0$ 0C`0 A0@P0`08Sq Z@@Ph >00 00$ . 0 R +0    d   d 0 R   0|@T= H  4 pC @s0<0\0 , R MRd  d`0!"0 , 0f 0dppG,Q0 `bSdp`F00dppG`pG,,0B<P-0  P0 St EZ000P oS0 9Z000Pdr0Se 0rQ00$Z0PO$LS Z0PB$P400NS `Urxn`(`0P@p0X@T@8@@0S80Sp0pS@@X%n$p``@HX 0\`0S Y000PHX0 x0P0  -@  RC ,0P 0P0 0  SL0, L0Ϡ 0Sq-0r00SP @-TX  䯟/s@  XP@@P@T 8pUT`ڐU@ PEI@D0Q 0T8 BXX ڐ0Q@0SXpApWWڌ 0p`P@JZ R Q 1Y P\JZ$@0P` pT 0^p0\S0  Y000P8$0S*0$Z`ڸ-$ @⌀JZU 0R@0 S X000P 0 X0P$u 0D \0f% 80D \(fl`0`S0$6R ,0PX SL0,  !00L D, 0 P  00S0 X000P$0"_4`@X0T0@050\Myo\ { P8 @TX@ `""   . B Q/\;2#0/0 0 !.BϠ # *@ Qʯ P  A0F,FP# 8 `P QP Y <N8""P 8@N@8@ @ `N  BP(Q B JQ/P2#΂0/ 00,# $!L Q. ! A0  @8ϠBP!.up p0D \Eex00CH0&S0_$0 ,, s 0< 0 <M,dp\ ,P`pG`, @0ojo ^5 ,  r0R]P @[@  S R ,0PϠC 000SQ<+W;T ^3 ,0r 0SϠP SL000 ,pL0`b, @0Bj? ^ ,  r0RP @0PSL , 0101,0@0pML ,0,    S ,S0;$0+; ^ ,0r 0SϠP `U2ڀf` `0p@P0rXT8\0S 8  B0S0S S0p\8 TX@_4`@@e`,`S0$0S  L000 ,pL000xex`j S |0s8 H00S0$071SH 000S00G00$F@ 00 ER0 nn"!  00Bh00?R0SF 0h Srpw@p_4`X@T@8@TPV0P$80SpH0pS@0H00$0 zV000P qV000P ^~ 0, SrP  l PS,L10L , SL0, @@L0,p0^f 0S r`P @^O 0, Sr^P ^| 0S r`R ,0P1 ddR ,Pu V000P 0U@000P '000 a`$` Q`&  .! FtQ 0#e 0 M 60 c`39![U@000P S  L000 ,pL000U000P L0 RrL0@ L0 R rL0?@ 010h0X@Tdp@pG,u$ K xK 3\K l G xD HD C ,@ > < 4 `< ,; Dh: 9 ,8 7 >S 1(0P`Tp x0@ #RppS 00C?@0oS$0qt@d@pp$p⌀@DT4 0Rp0 S  3U000P^0 080_4`@X0T0L000 L0PSY U000PQ =!0  P@0 |@n? PecP 0p@S 0 @00#L 0L ,pL0PL0,,L0 00rRL0g0 PlL0P00L0.qL0 00rRL00 PUP$$0D \bx00CH0XP8p\V`!GL0LEG040d 0 0SL0,L0 00, H 8 BR@ c@`0`yyT 0P$,L0 RrL0L0 RrL0&@``0A/\aSo , ,p1'h > 00$ Ry ,P1^ ,0r`0S @]^m  ,R!r0nM^ ,0r`0S @E^>  ,R!r0?~@@L0PL0 QQL0PL0cSg|@$0a0 \UaL0 RrL0xL0 RrL0L0 R rL0$P @ 0D \*ax B0?V0H  @ S,L0L0 00, 40D 0p 0S*L0 ( L0'L0PL0Ϡ<S 0P|@$4}L0 RrL0L0 RrL0L0PL0L0 RrL0L0 RϠrL0 @|L0 RϠrL0o @o 0@00p0X0T0>0S* P,pP`00E SIpqp00A S$Q0!S- 10P`b 0 0]  S,L0L0 00, 0D 0pkS,L01` `0,, L00D 0pU 0SL0  L0 p,P#@-` MHP@pBV<0P000 P?V Ѝ A-@P`p)V0 P*VO--@0pj/ H30P (  O{(0:j0P00JPP+   ! G\,0P00b00P$@ 0k0 ~K ( {{[F8N:N0CB:N@:0000 R0 R Y Y 8ƋF* ,@ 100@QN0S ISj 0,0@10?[k[* Q BT@,(@2Z 000SY 9U& PP00@P X0S0$&R0!**R 0P000$0y0P$@?@0 p0< RTڪ@,(@Z 0G0SQ0 R f Yd Y S` p`Pd  P9U $01P00P00S YE Y 0p[P (@,@@,(@ZM Q QD Su0P[p00C0S0Sh00 S000 p @(@0S0SP 00r0S V00S>0S 0Q0Q Q p 0S0$0G$&R00$0?0!**R8 0P000$02100@0S@(@P+ p0 0[0S0SU #G00S Y Y P  p0P0 4[4 0090 0pG04a^ pl0G040S @(@ 9U Z$01PP000 0009 0 00400@- M@P`e[ p cZUT 0S* P  SZ@N[p Ѝ @@EZA[p Ѝ$S 9[T@p5[@P :#46*0/Q /46*0/P@-@00 R@P@Rp@-P`0@0R@*0Pp@  R 0 R Vp@ !0@20O- M@SX@DPa`101 0lUYq`": 06  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ`P0-UM0P,@.0L10rY{ {{{0.Y      ?Z/Z p  @-K @- @-p@-`P@ TP 0FP R p@P  .Y00pP P 0?0 XP p@-@P S`PPP  Yp0:0 X` -M Ѝp@-@ P` !LN/U !@Ap- Mk ЍP/L -2M")2b3c1@2`1  0nЍC0@-@PMP 0 00 0 Pp`Ѝ00;0 W8 0p@-@Q r  P p0 S 1P p PP   ! X @0O-M`pDI@0D0Q0P+5X! @0S Sj @   b 0P18 P T@@  0  WT` ЍW Qz@ 0Q AX00@P00  j 0`00QB@`VRTQ`p0 0"!` b  V0 ZT@P@0Q=W 0000! @TQG 0P02@0  000X"000@000, @i 0Se0T0 2aPPlv"! 0#000 0 0 @ 0j`@Pp !R/0S 0C0/ 0RA-@P'`Bp1W@* R0C@C   %WV X@p@p0 `f360@p1W@:b S PPO-p -M0 Q '0l0x0 0 Pt0-P000P00 00@ S0,0r `@ a`0`Ft@00@ STT!Ђ 0 B0SpЍ 0 S0 EP 00Sl 0 $@ < SV ?o240$ 0R0$0jTpg{p TGڬ5j0f1k5ZT 0 S 0SB %0dS{ 0|  pDpW!0Sp ,%W 1  @pPxL |0p0 pLW|0V |0 0p|0  A R8 ( QqpCW px Wpp\ws0p000,0( S|  800S(08000 0$ 00M `۟<0 﫟T˟ﻟ 0H0 0DS?<040 B 0S0$ L0D@_ P  H ! \Vx0T P x   !PVp@|R PD0P 0 X$0<0 ( @pC0D$ pW pGP/ `Tx 800C|0p PxSt@P5P t00Ct0- Pt00t00000x l0 !\ \  XXQ+tP0C0@00a` 0ES00 0wx0000 00P0(^  < 0H`P00p 0P00H `00P`@`t`00`@000 0 `:S4 01c:6||00` %4  0!{5Sl 0'0  H P 00pP0P0吚00cP0相 [ 0 @0 X54 0  d{  A1{'kl00 {'0G GP] `T(A4000 0P000pP0n|0050`0000(P0l0!S!00 `Tl0Y `Ti 0S x0p   ~}\ t(   B!0p| l0Y `T^!0Ul00( P80SPU@Pj PPr0S 0S 0 00x lT Abg `Tx 0000(0|0P0l0}*$&%&x*!z(GH pG'U!08 l000#Z00S5x 00^ Y^ 0l0U0" R   l L Px  pP1XPePPp00p0!0l06 `TQ80( lPS |0x 0Cp|0Kx0! l  R!0S,00,0000|0x 0C|0 0pl0Pxg@-00PO-@ 0Q@P MP `PO p,Q 0@  "($(!(  X"8H XA3pIqW K "8 80W#8S 0Y  0  0 Ѝ@P   ! O#``3ß0O-M 00@Sp 21`C`0 00 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 Y \ 5 Q0R i T0#03\0SWe* G0V*0F@S3 F BS   3O0WQ 06S OW*@DPD@ Q0A Q0Q l l > U00XS Q0Y j00Q )Q 0Ѝ|<^0 n 2>0 00 R)AoᨂX 0v Q>0?0l1 c 0R:j O-M<0p wHJH:@`00S 000S 0P0S EA R[ % @E  \  P 0PS8 Z@@@Ѝ @0Q[V R 0 BPS10W ^@0D0CSڣ0SqP [ IT 0 TD\ @N Q T   @T 0CC10B3P0DS0 SE@TS@DTDX`  `R ߰ BP[10@0+S -S0 R: R800BA\ @@!~s 000AS0B[0bZE^ @d\ [ 0 S S80S 000 0 b@0N"00IZ@0E^0[ @T0 QL 0SP00S P3 4^E *@C $`P D21 `2 Q\` V00 00S@0T@DUQVD`b 21 8PE : @0T0 T1 T@00@0PS  Z PEP R, 0 R Q 00PS00= 0@0@E IP 0 C0 RZ@Rh@DU 0S{ S SUUv E Pq C0C01` Ѝ00S/0 R /@-pXaM@`PB D1P5PP3 opP-0S  Q4 p 0: S-HBP  8#80 @0 $ 0, ( 0 0ЍH00Ѝ<0L0E0 FH00~HO00z 8Hmp@-@P l<00CS00 Pj<pP0=0 SFh@-@P 00CS00 @0I04 ;Fp@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SG 0 p`0>0 Ep@-@P8 0S< ;P00 P! !' 0S 3/PP೼000P @ P W00 00Q00`aa;\0`` 0pB^9P,080 EG 0P0D@-@P 00!R !#P 0C 0;0 E@-@P 0 0 S @(90;0 qEp@-@PQPP 100S3 0  RP 4000S8 0"$0 3/0:0P3p00P @ P η00< R 800p@0P9K8P009\0J08 E 0 @0 0p G 000@00t <h-Ѝ/@-@^S S S  \0 @b @0 @fF00 0 @m6@000 0 0000/@P@- 0At @F41Sx O-@ MM Q 5/0Q PP $d |@ h|0g'( $g* ph ` 0 Pp$   T`  8 X| lp`0 tP  !p$%d),P 8 $10-` (4 td8 T59ċ<= "< # &'(* (+p. x/`2 |h3P6 lX7: \; >, ȋ? $l` ̌+$a(!`+" 0 b"a +4k+b$! 8 ,` k"!$  Q 0pkP4Q 0pkP*Q 0pkP Q 0p{kPPQ 0ppkP YMߍFEOCEp,qMߍ/aQ@-P @41S  P mP0"EA-4!@r pPP/1S 0L1圵 @P!啵GPPPUQMoPP PQp {W Dp_oRDpDppp@-@P PcpPA-@`#P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V fDPDbDPSSO-P M1 Sz$aVp$q q(SSp A`TR X`D (0Pʀ 0S `(q\ 0{ @P A Ѝ C$oB/갰[" (hr 0^ Q `VH$ [ pVpGp@(VJ ($ AT$$( 0 [ `( A^% \ :0 + @PC@@,A 0 S$1N(!r5 V(* T$$$H0 A( [$9(~( 0Q0 0 $A$!@`$ A(aV 0 $AP(` 0 `_qP_ 0Sp{$VdO-,M R0  1 rp3/,0 (Q0 P{ @`P@P^$$P 0BZB  @PUpWW 0 `PS @R㲀K PUJ[Mp p,Ѝ 0 oPPu6  $`p$`P  0 ]`P) @R㲀 BP  P^ ^4 ^%  gP 0  jPp@ P`@@,Ѝ 0 j@ P@⁠Ằ[ PಐU 0I   gP(A DR 1V(Q0  oP 0@-@ 0! \ @!B,B00,1S@-@0 @  B00,1R@-@1  0@qB,kB ,!O-`᜙0S ]M9 pPwᴱ@P Uq   @{ NB0S 0 p/  ,p  8p4 0 1 D@@ @) P XP $V  PpW4p^ Z !3[@ @8([[@4<P30Ʉ  D H p $hP00 A G, <0(  Q PVY[ P  0~p pt 0~ V% 0S" A/ 1R*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂0@ >$@%0S 0@00@@Pq@Pn @P @PdR0a@?^d` Ta tHt,O-@(P`P5f10pSp(P6 R ؑ6P. ( ,0 [ D`D` S`1005,`5Ohꂡ P ر % Jh> ?ؑ@-@ 13/, (Q0@-@Q /00 2? 0 O-SfM `$ [pW 00!>0S >` ?-P  9-`P pW0!10 ! 0p< - -G=O00000 0000 -0%L00KPdd0 ,;w?q尀T 880b1`*@-`@MpPP  -00U' `P$ 0S r?(p0 4" 2 pЍ -Ѝ -pЍ=00p 2/QA-@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   *<0  '  P        P  0  V/0 0 0 0 0   0 0  0  0  00   0ЍR 0B8#8P P0#0BR0``      UЍ40b0 $: 0(0S"( S: 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 X@00 0UXS 00 I;s0, T:)[' P0K/S  000P0: S /000S0I S/?00 1X0 -QP@PV# 4- Tp!/0SY  \0 RK Y P/00W ᛵp zᚵP /@oo4 G  tssR Q0P:Q0Q:q.@-$@-@@᫝ $ @ p p@-@P#)P$  p@Q d0@-0 M @ 0  @DP 0S  Ѝlrlp O-dM@\0P T 0. \$.\p @p.\0  (0 .\` D`.\ ,.\ 0- \@H@-\ 4- \8-\ <-  \PLP- ( \40 0 ` `0< ,@8p$0P` "  0#0b0 P%a8 p'egH` ,. alngx+b(*`gLb0l$`&0feX)c8(n, e cl fj!쬊̉b,,g|*gbH  ,l*錈e\(l$gx" fe!c<+b(*cig eX(enl*c8+bL i!c fj$ n Yc:0 $7&600 $-&hbL0d p%&L0 $&`0pW|\\XZ*1 #0C8 #  b#Ȅ 0 F 0A 0<S@@ a,^p  800|8 00,0F 1Pd `V 0`h0 &h0CcS00 p㰑1 0CS'*0$ S 00(0pP `VP 00 0 00CS001!R p0p  0  00#0VS00 0 IY㩐* )ቐ 0 0 0 LTPH0PH2/ 00W p0 01p0 pp ,0!0 B(S"8110  p"      0<00@pS- 0S 2  0 w  p la0S @ L3@ 00 ,k 0 S<@p  M I E\Ѝ3<S00 01040封HX㨀*004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H4 (0 岁ᴁqpGpWx'x*W 0 08#8S:00T#(@ IY㩐i* 8#8V * ("( B``F  1`0100[p@   @  Z`V<@p "   p    D$D P 0 0 0}각HX㨀d*(ሀ10406각HX㨀P*(ሀ1040RbL0d p[# 2  0+ W)A@P00,bL0d p@# bL0d p8#0bL0d p0#IbL0d p(#pybL0d p# 0!VbL0d p#hbL0d p #Lq0 $#@pKTSSL`L@L LLKKKdKO-M %@ ,p0`Pq0 p WPK 10C0XS%X:*U2 PEpXXP+U px'x p @P 0#0!01p0 P [ pKx'x 0m0p b$" 0 0Ѝ 2 p  @[Q\@10CSP*8#8TQ 00@Ѝ P   ᴡk PP ^뼡 0 W0 8#80CQ K뼡P W 0J 1P 0ZK[0嫰:2b0 $0" 2 p @ P 10CS@d*0D@ 1 PPF 뼡 0 W0 E@ZTj 뼡0 W P0J 1lP ^1b0 $!1@DHPE$H up@! @10p  KP 10CS@: B01b0 $!A  ?0b0 $!0pPEu0) 1 01p01 0P@D1H $H @U0PE10Z!08#80 !KIGDGGR0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/< @-@P , ;"@ (! 0"`E2O-$M p0P`  (@$\0 0 p 0p pP`@  "l(,"$l$" %  0f  X Ơ d,  .d, 0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$ЍEC 0G-1?p@P` @g(X, q! 0P0 0$0@`F0($0`2#?V@F?p@pp& 0$ <@P U 0$ ?@PP?`V (E! 0$ a0 0$ ?V@F?@(p@ 2! 0$ <@P U 0$ ?`@?V PC-@P MP) $ap6?`V&7 ) `0(0 `!W``Āapa8!#4a4# 0 Y@h  ЍC  08R(@R )@ b (`8  )8 b (`R @-G/ @-@-@P 0  @ (h 0"T?R @-(/r @-@-@P 4@  PH 0$$> O-LM( 6,p0`00( 4^_~?<$P,< @$ 0H@0@8`8@40P`pp  00$(0 P00p`$P`p,0 4F e0%)'&ɠnj)000000%  &') "ˠČ ˠČ "  (0 00#0')  ,  ! 0 0 Ϡ' . (̠Ì  ! $ $ ,  ,  ,0 T(03`0~?008`@P p480   @0  @$ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90#  ..YW([T0#P P[T(P  P%0P P P%P 0!(pP00,p/!~,! rp', /!!0 (,#p'\ )S  $( "P p P% p PP%4pP8p p0 4PR8 P(,P]<` 000 0 00 0 0 000 000 00000 00 0$0P(0$P0(0,000,0008 400 408 <0 0<0LЍl><p@-@@DQPU  0pRPQp bPPo QP0P0H @ p@FR Q bPP;p y@0G-1p@P` gPX? @0D 0 #@0D  H00H0L00L0`FP`P6VFppp@0D ;  SP@0D *H0L 0 H0L UPP`V Pu@0D a0 #@0D H0L 0 H0L VF Pp X@0D ;  SP@0D *H0L 0 H0L U`‐V PR @-t/G-@PM ,PH8 I `p `! U@ Ѝ@-@P 4@  P 0$$4R @-</nG-@PM PH(  `p ` U@ Ѝ 0` a!, a c,/0@-M0<P0 P:7@0;P5zP DP6E@05P(6P &ڼ6P 0P0@$  005 P0H 塐p Hߍ000ߍ0?CPq 0P@  @0H vp HP ߍ0L0@$EDCB4P0@ PH A440pH<,+*)(&% @RPA@  0@$  00P\vb^GhFdp0@$L+X0@$<@0@$=951-)3/H㱣P H㧣P h0@$,H0@$|00@$d     d0/00 0H Qp h0  00 0H @p D ? =@00S,$x0@$d`0@$]78086Hd5444333 i111{G-8M(`pP {{ @W@V@U@T4 0S !Q4 0S3 Q!-VM W0`c U pq P\L 0 020  @܊ ‹8Ѝ0S[  Qq {0 0h2{`" P0x ! ("(R  #m:VW$ Upm P`10   0 0UU0  P R& U  Pl\ P0 0VvW0 UpM 1 P0  `  | y00 Rx000 P0SQ 0Sx Ya @`U] PS`0P0  Sy y x x xw w w Dw v v .$v u 0 P0  7p@-0@T 03/@TpPP l00@T 03/@T\p]H00@T 03/@T$׉p|u u Pu u u t @-M@@P Ѝ{ 0 { 喍p P(0A0 zdx,H-Mo 0ЍO-@Rp M ഁУP  `C80 S" 0SL: f0  0Z 0"80S8  0Q@0 P 00 Ѝ 2  Z  00  00 0 P 00  |P00 2  ḊP   걊P  000 0@-P RM@PQ    s/ r? DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP @`( ``0pV!ؑI@ T`1 `! @D s T@ p PP Ѝ ЍpP p`O-Mq  PpG  0H PU @P U`1`!  E[  0PU0 % ЍЍ@- M` @  P 0 q@pG{ @DP @PPW : Ѝ Ѝ P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:5080pO-@R"2 0|M`P0t00] 00S80S p`"X2 0 t0 30|Ѝ4P  幆P8~ 01 0#\ %$`0P  8 0 0p Xp; P&8Z> !10! ` 04 4^ 08P  R8P84P@P`0XP:A@8ˆ 0801248 Q:%0 S P8孈P8VP 8 ` 0pP 800P8又P8m00phꦽP  @0 p 000Dm0T00XS<@ 00DA B QR ap `> S0T1 W  0ptt p 0`@> p PPD1?0 $@0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP ph0p 0> 0W 0@ p p0@ p 433333300M 00Ѝz @-M0 | @  KP 8 ,0 0 0 30Ѝs8`z 0z H0 S8 0 / 00 @-y t0 S 0,/00(@-$H0 S8 0 / 004@-y 0 S 0,/00<@-H0 S8 0  / 00H@-oxx ,0 S 0, /00P@-[H0 S8 0 / 00\@-Fw 0 S 0,/00d@-28H0 S8 0 / 00p@-0w 0 S 0,/00x@- H0 S8 0 / 00@-v @0 S 0,/00@-H0 S8 0 / 00@-u 0 S 0,/00@-LH0 S8 0  / 00@-Du 0 S 0, /00@-H0 S8 0 / 00@-yt T0 S 0, /00@-eH0 S8 0 @/ 00@-Ps 0 S 0,@/00@-<`H0 S8 0 / 00@-'Xs  0 S 0,/00@-H0 S8 0  / 00@-r h0 S 0, /00B@-D0 S4 0 / 00E@-r 0 S 0,/00G@-|D0 S4 0 / 00J@-tq P,0 S 0,/00@- @/ /H-M 0ЍA-p`@P0 8#@T0P@@-/"O R ?#0!PMO$T P!Ѝ  0S RP/0    P/0@-$MP  0  00@PP  8P< ,0 0 0 30$Ѝ0跫$o ho o A-Q`pP@ S V ("RSR P` 0Ck ?o/o0CS 00cÎ10VpS& /o?o BR Z 0 0b1Î0pϠT\ ^ R0V0 BV  T$ 0d0?o c007/ooAq!  R!0r b<·V Ve0o`100@b>07Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000( / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @P' TS0 C0 ^@DP \T^0L Q^ PPP 00QPS @R S Q0 S00  / 00/U/S 00R0Q0 / 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@0@-Q @P ST Q@DP  ST PUPQ P00S@Q RU // Q#/  //s R PS  00/ 00/U/ 00/SR  Q 0/ 0U0/ 00/0/R  -/p@-@R`P R U  V  R 0 p00 ( QRp@-`P@ 0S0 000 000S0 0pP0l (R S 0Q0 0S00/ 00/0 // Q#/Q- S$ PQ PP0C S00UPP-Q S0S P 0000S00 @-M0| @00000ss00m o4 ,0 0 0 30Ѝ4` _ -BMMR d X @  P  P㋆1   _ t0@- @-`x@t"pr M Mp $( PrM TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p\ @0p ] 50 xaB^`P.d0a/tH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 200 :P0ЍM00_0@@- 0M@>S   "0!,03,0 P0Ѝ)00@-@X@X0 00/TW 0(0(0-M 0 0MЍ4W -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/V t@-@p@-0@ ,ppP`0Pp]]////// //1O-0p,MWP` y m1 0  0 (05/,Ѝ@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+0 0 0 0 00hT0 0V0H00 0N빈@_^^^X^^]]]4//O-M, 0< 00000P0Q0S Y [00<,0 0$0 0 00%SS  SN pX  0 HZR X: ,0 `P,@0 S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V*  0BS0C [ ʄ0S*0 H0 H R;  d  \ rSi{- R@0%%%!:0Z0Ņ`% 0C RZ%ȅP  dV0  d/*00  D@D` prpo@pl 0 , 0r *XZ 0 H R 0^0100 H R? T|P @ T S  0Z 0 P  BS0 cP`C 0H p2 $P p xSPS P@ p`0) 0P  Q D Z'* 0[ʅ Q   BR B0 [ʄ R* 0N G   0lX pp|    Sp+pp\{#0S P@`0 0P  Q Z 5 4p,  S@ 0  d0R\ @RC0?T0SPA`B  0PSe     +  n P gpd R  ^{[y,  {UPP xr    S ǣp@! ""d   S   ~    R(0P0000pCP`@00  BR B R' R, Z  048D 0Tn  BR B  [ʄ R* R\ [ R   RR R f       BR B80`P@000 Z0J0(#3 0 0 30Ѝ    @   ,  0  D @A [  z 0 R*6 `  0P`@ RPP   ! 7   @. +  @( "(y   "@ (B(pp-DA@  @ !     Or(0D T$Y|0D T@   0 ? pT0 0@겡pLS |xlTI tA-Px@@ p0`pP@PU J0S 8/`PEuX@pW0:0 F x 0SS S  0R @-@o/ 0R0@o/O-p(!$1 CM0 M@`0440PP  0 0 44 30,Cލ Ѝ 000 0@0`0 @P 1nx0 0@`wP+ k 0k/pE P p ᰐKP R!Rs )P PZ@ 0S 00 0[ puo@PPP0S@ 0Sʰ00 9 S  R-<0 d008,0[g040Xv?D0 0@0\4 ` 0S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@( ᅟP m @j0P eP > @0 40@ 040D00D0 0S \ R ) H0S 80S F<00p  R  H RY ꐋ*000ppt`|@0 0 @5/P|<+,; 0 6 30Wݍ Ѝ00S0 Q 4@PD0Px !~D0P0 y  0 : X0x PD0q4000SB0T0C@0`S\0c  Խ`@pV  `G00`P?60 0$` ,90>P090Z?L000 0,000F00007}PP- U;(0 0R0K `1  0 h9L0X0 80Z80   #080>$ 00 0 SKb0!刀?A9c!@00}P a0S ] @Z0P k-0X , 8080PH Q!  (< 0 0 P_R`1  0 7P0X0 800 00   1 01 080<`(0 0|P& 0I PT `1 q 0 60X0^ 80^000 M 00d6T PL0&0@@ 0 X߀@Q1 0U0pI0} M 0 0W`@vQ@  2ˆW0000QP M 0 vp01000P w 0 H5@X0M 080HP 0|P0D s @p0P $jR/00  : (0d0080j<K/0d0d@X0 0WʤB 0+S .0CS:9 P60@z1@ +@)0Pi$P AQPRl `1SC 0    R 0H080n |P8R9`!!! Q5   30 @| X0X  0H R. , qW |R*`P|@p t 0@7/P0 80k h`V q0 02@X0~  0`!01 @XUMS0 \01S@ 3`0`00S S``` `P1= m`0 |P0 `06{P101<0@PD WhP p0< (00 z<00Px00 P 㸠D-@ @ `; ԼļC8PDt| ̰hp(Hج(` TP B("(R D zP#0d0 P0@@ d06SDVB `s 1WXpl0(H0"( D0 P TP B("(R D zP0d0@0P h| 0d0S_(0 0RV 0`1 u 0 10XP 0)X0   ]b sh$ 00d@~0 42 X@d0rZ0   : PD pH0Se=00^Eh0 d0~e0|p x G0("(0R D0 P T B("(R D  R,#yPʅax0A P 2@0 0{P`P "1011S1 9000 4(0X0 %<0d0(d000 X4h@X@" 0c~Z0   0 4 X0l00`d0+S .0CSP@0P g$X 0070' (0d00d0@0Ps g 0`0d0``0x  _s05 @X}og&00 d}w P0@n YgX&X00X d}a/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@zP$Ѝ0 zP0͡"c1010$Ѝ00@-$MP@yP$Ѝ0 zP0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-<#83 0CMM0,401S03Xd0P@,p 0$P0000 0 )| 0p v P<QP0\400Q PJ0T0= !8 S000 $0<e \40 ;0 P 0000 ; PP_ P0. T l10,430RCލЍS! }T 0S0Q7 Q1 Q+ hT     `   4.48#804"4 $,$8(#8"(d|{0WV!: @Q@WP``UW@0S1 S P  P ;O-_MM0* 0: 0@P050N0WU: 0[`p+,= d!0  d!5. 0`1q1110\PP~  ʟ0ʏ  ~Wό d10 d1 YSP& `P ]`0SH _DPN p\ S S00 PpP0S SR#3:0 0CQS0 0CQS0000088vP >0{o000p+0L7P 1#S;S 0x(S$ 0l(So 0`(S@ 0T(S 0H(S0 88R00sS1 S S(0 n/ 7R1 S S0S00 S S SS@@ `0 \_A_t00P@0Q"0A'A+S}? H7R1 S S00R00S 0P0 S S00  e@@0S S| p0@ @@@@@sO800g/ 0050yt0G bPd,P R`P 0i,P 0R@m`2@L0d!S 0 0 2d1pF Qp @|]1|erp p0ό`0S W`0`SHPDHp .Sp0SWP`.TpGWV 00TPP /Q0$00x4 0 5 30_ލЍ4 Rq W W Zt$t k?00  $`k` V V` VV00;V0SJ`V 4 @0p ;V  00@`V  PP 00P 0 Qh!P ``V;V \# 0 00@`V;V  00P 0 Zl` $`| 2R1 S S0Sq00 S S SS@@f `P [ _AH P@`0DPS \ S S00 QP0S R:0 SQ 0 SQ0000047{_qP.kP `[!0x3!|3p\aDP` DQ }o~sQ(z`,MP 0 Qh!- =pPB-6j`P@8pY2  LPꚐ p <T domasearnamesortoption`inؐer00 listchxD!p@- 1hP@lHMP ^  T 000HЍpp Qx#r cpV p `0!0x= 0p M9p  u p\TmpP/ 0. S 00KL `=Y@ pXT,lXd l~}l ,}P|D|pX@(t\@8zz41O-0 MX B*1a001Q0,`P0 ^/^_?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝ,0, 0(@- nk (܀A-@@`V 0 CQPq]UP pG ZPTP 00` h@-@00 R \\  !$00D0 0@ ($ Td@-@PL  0S  T0S@UU@U P/0d 00 0Q,0/01P/0(00$ 0/p@-@P(`L  0PS(  1T  0 $000`pp@-`0PJS@P  PESP 00p C+} A- 0@S  P p00   ($ 8PP(p`P0T$+O- ,0ĻS 4Mt 0 +嬫   /+~ ` Px+ @0d{d[pP^/^_ @   Z@ }@Q0 :Q , @T  :R^@Z :0 Z:P00<0` 0 `@ P 00 H4  S   !d$R; PSu00Q0,090( RC 900 RB ) 0S  !R 0 0($ jIk@(p` 0!\90 4 R B<ɟ  B QR 90 `0 PM( ( ( X 0 80P `I V4Ѝ8 0É`P P l8@p0 00  H( 00Dw0DS:$8B0`800H@004  P`0 00H 0C 0 1 ,Pp$p($p,(\y*ppQq(pW pA$pW P$G@Y@`A$ppW0@  ^(0 1,P1 @P(@ @(`P, P  RP P  BR \`A$Ng0@(`P, 0 P1#S0 0 PPp`@(( 多( p Pr $0 0@SA  1@`p $P  pW+00^0040$p ^P;  0 @000`P000$4000C?00s( $0rR$0( 0P A ,P$ppT (0$0 1000@`p $P1(P$@ k@` p$0 PW$000\KW 30$1,k, _0, $@(P020@ (kP P R-LP( 01 (0jPP$ 0 (P1$@;0 (P$@$$)QOSJKF 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `{@ @0`.V ||0`|\|\{t{pD  (LhyP|d,xv<0 @r,rrqq|q( q@-@P  0Q ^   00$0000 0@ ($ p@-l@@`VpPPp0U1pPE1PSp  (0$ 0pHQA-pA@PT`QV0O@P  0 pPP``p`"@ YanA-p`@eOPP T  !0 000P    B _> nm@-@@0/᠌ 00(/t000/`004/L00/800/@ 00(/000/008/008/A-``PU 0AP p\pM0APJQ<0< 0 ,(0dx NWP4Q/@@ <0 -b M00a.~S Ѝ8l @-@P 0`00@050 xr@-@Q o00 2 f 0 G-PdsM@p 0 p T 0S00{000 00 000 0$00-{PP 0` 2# "Z &= " 28 +0 000 0qp| X X 00@ݤ dj <R 2" 00@ͤZ 2: 2( fP0 0] 2< 21!001 001 0 01001001 00RP 0 R00   0T 0 2 13/p ЍTh00-0.PP ` 02 2y00@Z@P0S~X 2: 2l ࿖Py 2 @0 2@001400H 48,nC-`@ MpPP  m000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH nP (0 $( p 2 P7 ЍP Ѝ*00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR m@-`@ MpPP  00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00P2!O-RPM4: 000 X'*q`I`[ p@ p W  A 0 PtZ 2< 2ЍЍЍ NP 21O-MrX<*0`0A̱PpP W [K @DMP$ @̡100DS 0 Y 2< 2Ѝ10@D @ 0 Pu YЍЍ2!C-R` M.:rBW R * U"R  R00U00SR 0 { PpXB Ѝ 2< 2 ЍMP21 ЍG-Z RbMp* U0U @ RD0 E P XЍ@ 2< 2ЍЍG-@ap0LPP FPx1加Z1X%81ʠa%X @C !QA! @ 0S001Q@10CS㣐3* 8#8 0 BR ("(R B("(  0V8#80R!2 B0C!22pT00 (G<00 (@$bP0h t8epeTep@- @ZP ` ~PP $p Pp@-`P@0S  00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-@P4M0`S  00 Vv 2+ RJ 13/p* 0 00" "00  0$04 p`0 9/P 9/P a0  ^ 4Ѝp$  0Vqp 0 P 2: 24Ѝ?(0p0`,0 09/P  0ഐS0FI S)0 0 B 0V F B 0D 0\ Ƞ.,Ƞ0P0000 0@ @@T*80`F0C@J`80000 Y ,)Gd0t L\G-`M( yPXPpL P;S<03%R @@~zz0 L l3< 0Hp P4,0SJ 1 R ,  0#, ##$\A A0AW@S00X0;(0H8#80ᴀЍP007LS <0 PF,0S0S !Q #$ 000#$ P0A 0S"S8#8 C( 0"( 00 # Xp0h"@0@{@0@@@0  0 O00YY61Sp@-@M P6HaP8 0P,0000P8ЍptJЍp/G-P4"M,2M 0` p0 002Wpx @^ 1 R2Y< *5S0@[ZZ 0/, L. l3.<  0GpF WP`!P1 0  0 30I؍ЍU9 0`J8  8000S   "4<Ġ"< ̌Q0Z0 "Q Cx/pa@0[@0QO00~8 ` VO-P  `G@P H1嫲p0q1  J08 10000N`ⴜA40O-Sp M@`0S0040000 PD $ 0B;110C0 X0M ^ Q 0 Q @0 SX!B! 0PR|   R 0S  "  0!2#$ S C$ U@  UX SRRS5X%XpUk 0 Pc 000@@℠0ᄐ000ಀXcH0PIᲀ0@ ЍXD  $ U D ] RP1 PD D00CD0 0 10CRV  B Q" 8#8ᅅ0X%XP!@ 0C 0$ 10C0S  "0e Q 0S 0^JPM Ѝ1 \=000,1 r@0B YPUڤ0S 녅0P!D PD 8#8LPU PHD充ADXR(RQQLQO-M@P`pV 3Q3⼀ X j*^+PP @`V ᆰQ0  V\Q  X 0 PPЍ0S `0@ 00S#@P 0S 00 000S[ 0P00080080ЍO蘗 #0008(8u40PЍ0KⱰ Z 0 0/ K0 +ᰰ0  r [4:K0 +尰 g   `` 0 X0:0 H0ಀ00ര dd>I/00DD>I/&,,I/D0 $NqM}Mu 0A-% !@ ::`0$0CQ @3A@D$0@N0qPW T002!@$!A蔝pPQ?U/LWO-@ P5UP0tM p%0P(0r 0  P4 j (X0%X 000 00`0SHH00@0@ 0 \ EP) ༼  I  ᲐP R@ڴ R  ED @0I Ƞ ,ȠP AL  H+P(0 4P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT@0:0@I@0, 0ഐ0ᓛ0P,0 R 80S* 80<0 ,080 R4*Q^P0@00Q0 00 RPP ` 000@H$HQ<08#80 ᳠Z100S B CX TP\J0S$0Q0 00 R 0P 0R 0 $0w 000 $PnQ0b80S 88,00`00 00 0 P)d0 0S% `P0U$0 h0`S,0 80q 0B8#8 Y@00:0 I 0( `ഐ0004 000tЍ( 0,0800 <0S80StB,0h800 <0HLUY?]/k0,=.b0GFO- @T1T@0 pS0P`@D%P E DP( [  8#8R40 G 0 S(!$10$10 10 0S0nP 0 P0S 0^P  00S 1$10$100O-M@YP000X00 ``FV*:S 1 !*n `p pGx'x  F0 pF000H00 B 00p0@000 ``FVA*hY0&hP Vp `!pGx'x ĺ0I`h&h08#8አG0Zp01`*0ಠ0`0p00sPP% Y```0S`00Fyp0 ,~0xp0 ,u000S`00FЍ``FVg*hX&hQ p0 0 00000``FVH*hX&h9 Vp1p!8#8 R0C8#8p  ` `Fh&hG0Hpx'x08#8ቐF0Y`01p*0ಐ0X0`p00 00PP @Ѝ 0 ,0p0 ,p0 ,heT0 ,0Dkl80`0b ,DDhDdDBBBBG-0p`@PRI 0S 0U@ TP5 0X RI R Q00S00ô0000 0A8#8R0 BY001"*("(00 000tUU800C80t 剐BY001*\ ]HHp0 ,l 0R0ಐ BR@O-` @0 T @@DH( $HR1(PXί0P(  Ꮨ`JPP# @0T @@DH( $HT pW  T P  ৯PPPA-`P@0T @ Tp Q Q\HPTG-@P `R  R  0 R '@PR#  00 SᲀR; 0@S \> R0  P  0 0(!S$! 10$1\0 P 0 㼐ᲀ@p 0@p 0 S স10@Rx ἐ՗'xP $10 $1(!y00O- @1T@0 p0CS0 M@DP`!P B AP' 0 0 cP 8#8R0 X Ѝ0 0S0㉗P 0 0P.000@- M@ Pp10 Ѝ0O-@Mp 00 pH`pb _  PPM0STD0Z 00 @@  0 pWM0 @ pGW 0G*0@p 0@000S  p0C8p#8W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 P0 ,x0 ,0 pLLp0 ,44p0 ,0|9f\9,9} 9G-`"2 00M0,00w?0 @Rpq2SP:0JSM P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00CM1!0C8# ∀! #(@< 2 0 24!,1 0 ,0 30B0Ѝ 8P1 ZP崀 Z (0 p啩P202 ᘶp   0  ` $0} 5p $0b0 $v묜 H (7A-p@MPP`  00 2   Q Y:1Q|ö0" B`1"0001 0 VA00PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E0 EP VP V$P 2: 2 07ЍZ00Ѝ0PU Q:(0 $P0PU`P~>P  ?P 21 z@D6@--0M  Tl lP 0PS @T000S 3/ T0Vl4 8 80 $0Q/$$0S/H l@4<<0 0R/( 0S/@H d t3A-@T 0Shp`/XP0P@QD 0 <XP0 A/PH&O-@$MpjAT$Hpp4pD0q$4SO 0! 0 05TpC,}BP b0@S3S103 j733 $$3 $ $3  3 $$3 $|3 ($l3 $,$dMJH3 $'D @OX$Ѝ $40$0($0,$0$0 3S000`V" XP  2RC?XPP2&C5 p000Sh'P`R0 p0 00CS0z ^ p` RF(4S VZ  4S8 0V$0R0S  W6@) 0@ 5000`006@FU0`00 ܆ 4S ! DW6@ 4S $hp ` V V ,4S ^}hp Iyhp4S VMohp -khp `000 ^ahp V@?0`gjf H&<&Aض-&gH&&T&%d>O-@Mph`kiTPA@ @@004#43Dp: RPGP P 8hf0@ 3 hP>  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y PPXPPqT! i`P "  bPP* ᎶP0SQ tلYhqPPSp@`< Ȅ%,1 B R 0S ặV X Ii 0S X  R 7/P  R w4$ [@ |$ R@ \YS56%ض-H&G|O-yMP}hV?Hx0`00 00( eFp8`K[( 0RJ S| 00 0 `DvPePRPGPif0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0S%RK,0,R4*R q'  P M6pP/W  0 1x0S Rp0S &0S0@0@P0P/S R 0: S00! [sRq0: S 00000#/W00S %㙃0S0(00S00JpW   0P0M l50 0";0P @/P05,%0CS0$ `.?   `pPPd0S Y0Ss 00   B R\ L` V, `Q' /0 D 0P0 P@`j 0P` J/R  S/R/  # C  R: t `  3 3 0S S/R$ 0hSR& R0sX/ HL!R\0X\!R\ 0HX00: S  C C `Q0: S P1: S  : S!  Sp  Sh mf Sa S L0S !gPL,0SJ ! $TE0(尥 0Z Z80 S800 fQ xQPP1: S 00Z0S 80`!0CS!80 TT0 @ePR X0tP 0S !g0S !g害aQ[ (0S0S 0 0 HQp!:l&;H&5޾%y%8ȿ4h&6?O-P@!f\<L&Dp@<6gXP\`0O ( I(0, PU`00 XP\`> ;O;<H&\'%p'''P'\ ` '\O-MMcd<;XGw' OBp 0 Q 0  xH0(0h7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S XPU R8nR oRP0<0,`P  >8P8`P, PPP{ QNRN , 05 PLwaPhp4 1SzH0S?80S<@0S9 P0SP 2wP4PD0S 0$S, + ⤳ P44X(D`尠pXV 0PU 0040D0S iލЍS ,0SX s P㨠=`0@0S0H0S 0  FkP P 3R㓵(F  UP3m W` L0Z ǤP t3  dI7P \T H0`F40P -NPP pkPPT0S.0: SakPPP4 01!ĝP4L  0R p 020P T0SKH R 0 T0SP <pNkP4T0S 0 4+YX 8SU # WpVJ  h."  ."  $."  (,." 04   8<   @D   HL  3]P +  }hP40SP8`Ƚ'ض-?TH&~H& !/@-04e,UO(u@P00000Sr0C?o21 =@p0 1000C00S9 000-S4 0R2)0pP EP SP l h&P&MsP xPqD+84 4"4 "4 "3 !00000C0Lr)P&}_@P |S!}TXcQLhpPN<32S L#L0O@\/l3 0S 000S 0wP 0MoPPH000!S 0 山0S XRd000S źPK}DN@i#A1S bVqQ"4}᧺P2S 1"tO:Ua`0:EklQ100S S }!0`00~01s@Pw Po rPj @[sPg 2S 0"r r r2S`A>"|SPG2Sl p0"PGP, H0"`(O0 0O'H&H&ض-Txc$'' LX'&&@-P@M`/\P@L"@P3 DBDr00 >p= 2Q0=q E  -P W RZ R\ R3 0!BSQX KPS0: SO00 | >pd10 ER!JpD|wPePLP PP0 FP ȁf0@ S00000 0 0 0 0  Q |箁vK fK@P0: SpGP ᘁ@lo'%H&}مO-`M@K`$7kJqpP!5>p 10a1S 00`F00PmP pP XQaP ||``P5[A PDpV40Z 0KP0 0JP 00+0 * R 0Z /0 0 U:Ip @TJZJP U:IpnH&ض-oO-JM M@_6 R`"=p1 @DTԸ a.0S T  >JiP fP hP ϊvP00`000 00 0`QDyJpP0: S! z PP W{P 0Y/S J>00/ P$C@T 0p/SX/EP0 S:Pp` D ؊pU'YH&X^A-`@MP D$_4 08 *JP  II  JP  ?I JP  5I  JP  +Ilh30d3PPP P$P( <30P+( P3( P7( P;( P?P(  PP( P "P8$@Ѝ(P (PP"7(0S (P(0S (vP(0S (lP(0S (bPq0S HPm|!0S0S ip Ta`PLa @1R`PU 0E /R 1P(㈻PU  B00,0/00*0 0CS0P0$0v00S xzy0s00sq(H&Pq(MP&'^'+p@-@P^4`LP PP û`| ;ph00SVᙏPy뷻P $廴 0@HH&&&O-MP]h4`F`pX&;p D6@X/,60S ЍfP WP! PP p `RP dP vP iP00p `rPxP pp0p0p$pxq [,1@ES ᫶V8e  0P0S$0P`S 0S@ өpP܄ PP4V0S Ky @[*0/S /CP0.S0S .S0SZ< 4  0  R @ 50C SN00$S P P4 a 00$ @4 0x0S $ ?RR00R0SV1 $ 4  0SX  P ߫ 0!0 0C0~ +GP 0S' (0S 5S 0S 0SGP0 0] 0 0XX  ̺PQuF0SJ*P D0S 0S= 0?S9 0SGS C4  00PU G$0P S`0S;HC(0: S R   S /o" R 0: S!FP0S ! hP SF 0S?G ºP 70S 30?S /0Sr(HH&rREG-P@ \42`p$!:p 1 R1 0C@pP  GpP vP0p`ꙻHFP'p0S VP /P 0S 0S *FP4'p0S H&r(0@-TM Q 70 $ 9EEPE@FU0tF0T0D00 0QETP00ʡCz2▵3P YP 30S S S" 30S!  R h#6 R P#!SRL3F,3 ! ,3 003 3 3 20S! (l2 20S 0S(002PU%B;@ 0P@LpB00CS00 @ 0 4 "0S60016 R0S 10S<0PT< 001 10SQ 10SM(p1\1PNL10S H10S \1 P1 t0S 160S (P@1 F01N( x 0S0F0S 00p0S0S 00/tP@@P Toxy(l@&s(s(|(t(s(s(5L&T&(&s(C-PM Zi1b2@@@0 S [p 'W"n8pC 0 L1 0巳Pl7h EPT.&Px ~EP<&&88 vEP$&T7 0DS 00S8 0xL@"Q0D0@0 0Q%@0SV L PQ%v!a0@S0@qCP dv@@L v!P iP !P 0@0 00 S@L.L.0@0 00 0  PL. %D0S lx DPX%DCH&L&CCCBt @Cht@Ct@CT&CNCض-CCCgtC@-Y)CDO-MpY00눾@ dP@@@@0o0C?o203#4p3 X XT 0S9 ZP7 [PP3 quRPGPP $l3H@ PPhP dP fP00vP00 3@00P00Pk 1 0T0㠢 00B R; :sP" @$ A0S #S(hr$ 00 0 㜥PP4 04#pǦ@P/0Sx '. P ! pph$ Dp t0S<0 0@00tt5h!0C S?00S ۧ$ p0p (0 R qX  Pp P    3/P00 S $$ pm0 |p[p000S r~CD(&DH&DCض-D|E(DDCEDO-M M`pbtI^^ b50 0 5b5005fb$900 kP g$ fP ፸P9$Q DtA0@6S0Y S~(?6pQl Q` 04(TȟS SS @ t05505 00505057 FP  @P# 7$꘷ p0"S tsP p 0"S ( pؼ0"S P 06tp$0z05000001 00 00g0e0c ^D ^  ^ QS00 00055UU `* BY5S50`FV%R" 2) 0%0;fpPx%5S 0BP80: S055@%0IS00YV05 'VU*J܄$0P0 HADp #P ^s`PP  *Ad$iB*/%hy0;t50000 00@C@P#2 @1A@-ABAF S0 E@PC  0SE   nrpP-0#S n@F"A T0D?o2? [@ PU D@P"f/&PsU *PPAgBD喭00CS0 tP Pp PNU0 P00CS0<s0 V)0S:00S:0c-0V51)1S'1S #$PdPh!iBk.%l|/V`DP 8eN&P )P0V0 J)PBr0`FVzP@rP  f/: T  j+x9$Pꨁ( UUSDEUUUUUض-EE0UAUZUsU&H&t(|EVVTJЁ(DVTPV&&mdSkV(P@-G00 P `P@@pUC p3`00CS`0T qD@T ЍX0 X @3ꨧ(o&o&O-dM@` $t~ P 04 $030p+$p@DTlUU!Z %rUdU t0B?0p`$ y dUQ 'RU2 SU> QU040, ( qtPcPSP PPʤ3d @" nP tP0 aPP pU] [1lUT 3  $qh$ @pX dЍ $c8$ u@p3!Dq 8U8 g@p2/( 8 8DY  H>T@Di(PPp` q|`TE`8 <@pPGPE<"X0B!v  0!"X 0  1 P Q !p0P0pTK 0S@d6B`3B_*["p08_08 p0PU 8 " P P P0ZS  434*`V  !x tB0P```Qض-rH&rJs~D(rD{DPr|D(_rlr}Drrsqs!sH&yaratcidO-0-O堯堏aM`p22242222322$ `/V2pjL?"42`FS 20000b2_S R2SVV10 dbV%L0 ``:+p Lf'pP L0 ``-+ppd2S P?PX0: S0d2232d2o``Sn}0 =%cPpn0S f > zPRP3P/P3S@'Px=1@P A@PT=P00j000]0 ,2,00SP o<P0d2M042J02G02D02A02>\@ @@Taߍ02.202*02(PX0: S:  PP (/4P ), ( 0Pn]<PP U<=>p X:{\10 % [ *c<[ d !14\)ST l<̲03T8  803M88 P 0@B R[ 2SX 2S 0sT +<pXd2SL =plV X!\1 H\1X! 0 \102T7,2P7H(в(rdA{edAث(`((>܈Љ(ʼn&x)/1P ⋟팃`0`p0"0,00!0`,"0? 0,! 0 `0("-0(/E1P s$ 0   072S3 bV02@tE/@2S1P# [=넂 0 0 0d?0@H1P D2!` V!0Tp2<<23Sa 22AS``b2S e:8$)0 s1PO p4n44I e0 g2 @T' @ET0 @@  z  RT 0 S`0 60s r `Vm <T <"20"04P`4PL`]&Iuث(`(ZO-M E M-0P 00P`00PPP@ 0$ 2-؄p0040pV4$R= ލ ЍyPcP PP! TP' \4S T=:H$d0@S0000000  +0 000003I30S : pPj00X S: P_:0SH8S )R Q$nQoQ 0)#0PPq "&:002"@xɮP' ĮP" ΅P  }jU.; P]p@.D F8"89PB(8$R;00  :ZpWD ` j9W/P XP1Z P;Zd@Pd[?o20S@ d `@T jW`P8j/+jP( Q9p. 7Ѭ(>04P`CQښ. . a0C2,S!R. !$RU>"0i((H& `H&@(ض-8(i$&К0(0QH(zd@("-edAbG-pᬁQ@`!+p$Vㄑ 0S 0S l`d10pWA QP @L0S (FpW%ZЍyPmPPP fP = n0@ S000000000000000`JV 0 KPPM=P=P )7Xض-(H&cšO-MD4D$` r8P! 7DP6p000PPP#F+p4W00S 0S 0S Pp3 a X( 0S00P l㹱0S X㳱P㰱WPY430S ЍzPOPBP FPL a"P0@*S002 (P2  "P20꜒"00 0ba C:00P2` P00 D P00 , 0 caPx s000o00l00i!0 ma1 P :1h100000P000L00I`!000D000@1p=0000070003P10S@w_WPwU 0 P8!`IF&wLaZ 6DaZ((=TH&ظx(ƶض-ƺɺϺ&p(sO-@Mp@@8L,]P6WpG102vPlP+HP1 TPH 7 p0` 0& D GD0Z`   Oqp` 0S  g 5m@ Pက$ )p R 0S00S!0  4 0040Q 00P0Sd  , X 0H}PHK00-S 00@0`( 0P@媜`PЍ@}0 <0$P@ᚰ000 R0Sk3<0 @ t#  lG B R. 0<0@ 0R T 0 00S00 ]gR R@uDK0T$0o R" 0:E%KU0<0 iR BR0<0 BR0<00ST  R\" :J%FZ R  :O%A_$U@*DP Q@:IP0.,@p $0S$ @ 0 200S0Q@$0S0S (00(0@`4P@ `$`(`$0S (,$TUT[D$0 1ă00S00g?;;0 4;$#(Ć,40 3/p V p`T slH&T&L&^??ض-対&@-44~,儾$0$00z Ѝ䌾&(|O-@M -P`,@8`F8 03T`p8^ @p8 4p (df 6 R 0ᙌ,0P T4p80P\80pH X7tEUh5uuIH吅Bh@%1(p0)L5O005SO 15. , 0(0,00(00 0  EPH PP$VBAfzS `SNS7 AS( CSt 0E0pRdaC QWS@4$  㻣$ 4RD +$K L J sO 05N 3 W WpM H $0%s0!0 0  ㍣$0S@ LeI 3Wpph zS dkSLS` #m0C S[00rTrRXmýPH0SI0SO005SO L㳽PK ( pp (0S 0C !P ᣸@P4 L@g=p``p/<ᲸP 24ᅽP!< 0S!0L BB@3/ 0x@ TPd `P ᩹)4D P414+ CV HR # 0 rp0: PP 0"0C" B @9 00 Wp0 yH&( &1&10(&2&H&<2h&8&)ض-2P&+2)&A282X/2*2+ ,*i2iui m@-ڼP d墼@弼A(@-HH咼@嘼<<呼,0400卼埼 Ѝ䤼| &((@-HHx@~<<w,0400s兼 Ѝ䊼 &(( @-t@t ]h0(,Y _(]0HV8@Q@040P0b8WЍ@e(p &0xG-`M2P#~\P2P1 pp* P2`2@PP2H@R0 0K0P @O" \3 Hp HQ 2P  a@1  p00 @ p0| @l 080<0@0D00 0000P0 0 80$@0P 0 8\1 HL@P@T@X@\@HP嵬 H㱬1}1{1 0400,0( ,00@@0PpPPUPT0PP 0/`ЍUUU_TUUUV &-L, ,\+p+(O-\FMX6`pP(` 08& %p$6U K V0S@`@0VoP 0SЍuPfPFP RPZ 5g@PP 0P 0 hEc0#S [P` $9$00S`  $-$00S`HP #c0#S (3vP $$0(0S x $$0(0S|00y0P 0P^4q Y4q T4 4` @s0KSq01CP1 @Q 0cR pR bRJ bJK[g0Y`[J0^00I?o20P00 U.Ux U,P 8 8 0,3/8 RPSX 4G@00S_ w0P| R00C?o20SV\ _ꉫ0 $00n,0$00S 0U00S 0 q0S0P000010S1 0S 0処0 P 0 0 Q0s  h1000T,0 008B1P0S& SR 0@0@0 #  R S '0P(0s  0p 10S / 0[0ض-2WH& (&VVWiWWWWWWXW9XT&&XLXO-@'M⸆V M`$@@@& #됦p/6p0PKlU00S0C 0 1U0 U!qNPPy YDrP㬀H= P/p`*0S   eAP* a@P5P00@50S $l@Y h|aXui@000@0000p ᠥP ᛥP ᖥP4 0P/ LP*pᆥP P( ?a}p q NPXq/:a00 000#0 00$000 UPPo[`P'ݍ Ѝ( P(D@TPY -u1 PP(!hP( ][P`P p8&0 0PP(`p` qMP 00 00$00 0PPj[P 3[Pb[P +[P PdP TP DP!@jP0PZ lP( ]Pp` aP( +⪔ /▨Pm``AV":r0 0%.p` h!h/P2.0SH0 0 000$00 00P0@(p /p.. 0Pa0SJ(S'- 29S!S1X/0S (W`P@\p2`/Z(I]LYH&]4Yض-$]%ZYV]\]`]]((zd@(edA p@-P@$Dp@-P@Dp@-P@D%@-p@-P@ Dp@-P@Dpp@-P@CpO-nM M0㐎800`4PP 0d~0 P PPL 0@~S$0Gp000((>$00 000 !p@9=> 0S=D$R$r R  $}Bt $JZ<$.m`|0A: @ x0<$0p(0J-p P" <4 4*88 0.`PEB@D4T@@0 0<@ᣣP< $ᚣP  ~< p< $$r $xL უP8< $0 00 T 0 \=}0L0(0 0,N;0@m !_; ;$d00 0 0 5d;V0|0!0 0 ',; H0D0(0 \ 0*:$:0 0!0 ( 0 :(,00!0 0 :,00(0 0 L:0h:@8:0S  P00t: 000`  !00 8 0 :00!0  0 :00!0 0 H940`0c 0 0 (: 0(0!0 h 0 888Ȩ@0S C.00 JPa^JᑢP0@4 ኢP@ 0 =E^\8Ĩ@{PD40 sPD40D4y  H ,0P$0n L800 1 01 < 8C]7@P00U7 000  kHH7G: P;P/ 6P ]0S 0T4000-00* PEU UY~ V⛥ ◥0. P`S 4S<4Y1 H4L$0 V,pk?HL4P80S $E~G?;GHtLW0.= 0 $?,p5WLHt,4SH$L4R0 & 3+pP # V,p  4S@  \JpP = u]  mQP%;PPPPl%ld]V,p (:: S@%D/ $R(*@P% 4TpP$ e m0HP 0(0pWZc>$R $0@0p!$Tk = (,0MP,0 r04 QP LP $<03m`Tk 40S0X44S.=0@+$R)SR- (8 # *~'bP0T40SP \#00ST4S`31 P H3 50c (8p""ŸR H$L4P*`\p0p L4H/0#! 08]p<2 C  \ 0- ;U{p~`j z 0P0< "  C!L4HqϠ0#4S 0-?W p0$$4RT SQ  W  0)0px pWS  !S0$Q\ +S0$0 Q$ Qg*c8(r>}H&ۂض-wzH&}ǀӀ&:^T&l}Ɂ&ځ,P^(ov-@V@(]oE(Ѓ:<ބ 'p&L\~ngo}HL$ P,} P+P *+0$PsS0] 4S$iP 44娀S04144 0S @4S 0 $L0@4,4S $4R#1ѣ1,40000 $0Uu a)t ])0S ++ʈp@& PQ' 0 d|,;]P`E}J+ @zP9+-XQ :$43041$4+T4S,> * d0|l,)))))\4$8: H4l<$4: x00@ 0+)pQ||P Z +jPqP  <p  T<  $+-00 *O-MIi M0p4,( pP_8`4pGs04WZ h⽢  ⹢YaB 4S<44S $$4R0d`((pT  h*p<  4 SP,0S x$0V t$W0 0O $0JpW$ t1SF $$4P?*`ZZU CUʇp7DPEUPPbPEUUPP6 ( '8#80( R&0C Rn ("(wZ044s04b00 0 0 6T0HV0(0 p0,0@E L00 0 0 0500*0 +0 )00*0 +000!0  000c 0 0 sD500!0 P 0f,00 1 $1 Z40(40SY00;h$ M0P0H$Yh )p 4S 'PP$t$fQ`P#\ T (@PD4(0(00`V Z<000 p"#7$p = 0ٝP0 r04 ݝP ؝P$#0Y3}p$p4S804Sp 1S !1B0"L 0S FQ_o|+:(T@nE`tטO-GM MP`h `0t@,$p40PEPEUq@@5P3RD0403003E3ؿ(3 p00,p0T3000D30804@3@#(3 @ 3 wD2 oH2"g20L02"[d2p"SDp2P"K{$T2 Cp00V02 9Wi2 1p00X1!'W1 `Op0x0p0d1 &p㸐%  r?qpܠ0 S ؠ D 0Z W0SƠ0SPT0 A/P 0$ 0 0 @x(xF@PW Gލ ЍH&ض-ȡҡߡ$0>O^m~O-` -M@p L`K@m&TUPiW b&P4%p`3%%pP ``;@@4$ OpI 0{0@{{SH{{S _%P{{ZW%P<;SP%Pݻ Q[ $<o[<  AG8 ({:S[d(;t X30Pe2pGS<+10X2#(30S" )C@4P 09 0$3 PP 3P  Q R V 0;8;08; 00l2H2P0"2 P R  (x{ l+SV42 PP 2 R / < X 0< 0: 0 V@0 010@;F 0@0 00 008;0t1 PP \1 R /@ 1P& 00z 00w 09t1 PXP 0 PR` x0 PTP 0 R @RD xh?{Gz?eA`RMb@AYn *ƴ-SH&ɳ">Wi*~*ض-|P *8 *}T&ϵx*4* +*\*ϲP*8Y*z*¶&x *K 0; 000 2 0 0 000 0P 0 P R  Xp<00 ,D d P 0: 0 l>t|1!.8@ Z12@TȌp Ťpp ňpp Pt  U 0@ 1@  0@TdPf 0C Sc0400000,00(00$00 0000000000 000000 00b 0pRA @@&̂WB &r8;  00L0 3$p.8; 00L0 %$pP 8; 004L0 $p8; 00lL0 $p pC  |0 x; D0 y;z+(0;0; ; '0cy;0z;(0x;+8@ppL0 #Pl;"0#10@00 0`K`QH D `   `0 #PnK0S ``K0 #P(a 0  00D5 #PTTd '0d h!&``p5x%p#P5%`#?`!2(1kkkk,a0a4aU0 0P````}&<;SVd#>˟@ XzL{ k A::۟SP#@ XVz{ k A9I:`"2Rgd@' R{ `30S 0 ' C L N@^IN2 X0引!pV00 @+L0@W0 00Dh%@X2 .ppW S p,2 "PK,"0:CS0K"`ojL1堋CA{8ZA {'NjG@8țIN3T{ X({*!P"U7 ݜ0S3 S<e0T0xpT00p0p+t^!P Ȝ0S >塎"t;<000[ X0 0 '|& %d2"SS$ 0 ! $@-C6?8~A@@**& x**߶*"H&+& *< `H1 PS, 2R`2p0C(4"<8#8W`0`d0 0 0 d20 "  |  `X`>0l0hd9?ph9{3{7@{{{{{ {  M 4'4#0à3@0h2 0h22d0@#Xp |K&0H $#$<0(0"(0@0 2 0BS; (SC; = 0;e$p@0S:0#h2!(0H0C8C8S!* 0 0H 8(#8 "(G$ 0 @1币  hٚh⋚;    0;($ 0W|%0H $#$<0(00"(@0p0V 0 1 J%xP<0[@W 0 0RZW|%0H $#$<0(00"(@0s| 0 0D hH#p0WpD#<#p *&P˷{x*&4*69t>Zw$ 0CS00 P \0Q00p# x|0#!#0ꋟp@0|xt0 PZ T0 PQ 03Q0R#^ E#0 P3 0$#$0(#"(!1#0 P '#0 }Pl 0 tP Q Q 40r,p0 bP  t0 XP 0 OP 0 FP 0 =P 0 4Pl 0 +P H0 "P $" 05 10Sl ES` S W|u$0H $#$<0(00"(@0p6"Hڸ9Ofv̹|Ceĺݺ-Q[k˻ӻ *SIZ0KWI7Lc"DDD0J0ZD0 I0) 0K J0KO L QJY0KWD01ʸ+Y ZvP WD0 /"D0J C 4 ḛĘW8T"pDDLD0I0YD0 0J #1 KJ " W"O-M`Pt0@-S@ᾔP-3 @ Уp#~p*30SP a`F0P[:PQ9 KJP9  H RP8勔P@3 C d0@S L@p20SwK@HGG 0 0Z W X dPY'G`P;P`8b2 R    0 S    U+ 0  !. !000( W^zwtqn kzp40 ppȘ0S|W3|` ^p0S묘PM 00p@@[  0O Vh|`f4+tH&k}Kռ5>O-PAM Mʾ@`t6VPn&0P000-S' @P 0P0QOp0@I0\[00`F00S@DDA@D`u%6p ,0S@bLP53 Q t ϑ\P -00 `@[-00  D0B5S0 00S NPN0 0꼄4P N0000x44 0S hN P4  00 8 P   300S Pm0$0h0(0e0,0b#t0Cp ?o2R0S0$0$PtPXpx@Da0@ T03@00`FrS= RS iS1 wtS xS묢Բ +0p 0@00@00S  0Y 0S w8< Q (0 B b/S CD?a((0S 4 0`5^kk0S (0S |10 0\S @1(0S ( 0`{ ,99mpP+)) 0 p[PUUZI@+TDUmfض-=+¿&߿ 2H& H&F&!%&2 PO-LM'8N8nP0.p>,# PER a0: #@@0SCxMvPcPSP TP LP d0@S00D003030800H00 30$30(30,30<00",0@0)@0,0p  qW3S(z)P @ P< P/P LЍOz3S s00lp,g0b4 ]8X<S@N 0RWS[0ZSPQtD! 100gS @L{ EY0`,  aR @L0Z S L0-S0 @ 3R: "00: ` P00 |:00 h:43043{0830<3@30@3ppzzyyx||{U,0 U ,0 U ,0 U ,0 U ,0 0 0U ,0 L00L0U ,U S SX0X0(0CS0 P0D#8 D#<#  P Q0P0083 00b0X0(X0 X 0X@0X0X00,0  [,0 S=<P PdH0S7 0"09@PH0SX'B0-,0 SSX 43Spᰔ0P嫔/^aUF cU2 gU0BP㝔03S_0Sa 00gS# H0S |&Z 0  `d0Sa T pWpUpWX 0S00 ,048<@DULЍ0000H3P0P xH30娐PQD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R B    0'z< Q $0Q P0 00 R B    0z< Q $0Q P0 40 R B    0y< Q $0Q P0 80 R B    0y< Q $0Qp P0 @0 R B    0y< Q $0Q^ P0  <0 R B    0y< Q $0QL P<0PESZ $3S0S vD0S]@ p9y07S uC 00&c;sr<  R  d  v      UlP90S 0S 0S  Q 0   9ypqPU }8 30(#0<   N+H&oyX0N%&0O+`O+N8O+@O+HO+PO+XO+(O+pO+` O+O+fsG-PXMp-PHh  IDP b0@SS0t80 6l( pX80U o0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06lShQaPHiPA87=CP 咍WP0S f P 0000P6T&0 T"AP_P061 u(VU^vpX90+SDp(86 000z<0 0/015T& P 0p00 :XP00G00X[pᣋl5 @P 00 B00C2#S0d0P0 00 B00C2#d Pv>C 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#004qp 0P 0PQT3HHJZp=V w`2o`F#P0 0SU030#:U %5$PB+P p= \6P&T6K/r043PvTS0 0 S6# G@Xu SPEX!EK/r0PIu 0 0<6Sr46Sr 06rS 0GpRP2 01.u6S 4[P W0`W  0㖊P u,6S m/X`P b{Q0 Q`"fĨ'tD⼨<6S46S^E`^E`@6D&SH1 0 00R8!P H&,QR(! $& R! 8&R0&PR  Q @  @ e볐  @뭐@{U+@ض-H&>h[+Z4V+(V+\~T&BYE&pp[+|A-PHM`pI!s p10PEU HP h0@ S SHHIIp1嵮h1X1 T1 pa@ mP (1`$ BaPP 2G䀟 L`$@@`(` `C wRP FP0S ;PxW fJP XG0 0000 H&ض-%&[+ yt Ct #.G-0HMp`0*BR"p 2B1 pGS 1S 0$  !RS@# P+PTP<(FxP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0*HЍP PP  gF0S  1!0 `PqGPW a W !pGW R $Sw ,0< sW p[++-H&;z%&ض-H[+&C-Mp` XPPEUy%p5U@U`F V/@T |@P l;P 7&aP tP,5 R i%0%  PV 0S A@D %P`VD  tP@PA@3PzP0S<0S000S00S00S00S00S 000#pPU 3 `V= V30SU7 0S4000000S@0000000 0 3Ԭ 0Sr<0Sm00Sh2哉P0$0:]0S 0SW`V UUQt~P dyP htPB UB U UR<2PEUNPPUH Q [PA !E U2 @U U60000  $'- U+T?PJq 00000  'P  $  %$0S & $ pqp岥*b@?T ᨥ 0"600"$0/$P @P xPd `+ H&  ض- H&5 0 '  K e x  w t  C-Ma M@Pp!p10S Q༑PE R ލ ЍRP fP74p=)P1Pd jDWOJ0 <[⯁@P P; T(X傌[@·0Ph+TX8\ 嗁P;P  0S4;8+,(Kh8S <PU hXJ~P@ ⧇OoB:p *:8(p P Z`T`h'ZPdh8gd:xJ 0pP0 `*Np`W,J0 P4* 0 0C 001W0܌ l>  \8T0P`>0 XP0P- S)#0 ]P\9Tp  P89 h(gP9 T(X(]PX*P8 h(\40FDS008 (:8 X(T(8 ,8 8P 00S| h8l B(8, ,, ,o8 ,k7 H(g7l 8ff^7 L(Zg+v PS:?@_ 0|7 P(H7hgfpƆP78=l7 87<(8,7 T( X(2@7 y7P 00S% 7$ 6 t(6 d6P 00S 6 6p l`E gv68`BfF08`0 hP 0S46E `V 85p V+5 ,5 L(5f00Pt5 `(d(`5 ebH5P ? |5?Qt(VGލЍP5TL +ÖD04<<0P 0S e 9P@PD8SQed4 ePD Rnpu uSS> ` V   V U xV VpV   jVW cV q/r\V=  UVY ZMVatYhY`YTYLY 0S0SA  ZF@288S2q@Px |b<S P 0S Ee BeD2 kN @+[u P:B?l |081<Sa\\+u P*~Y0:_zP 0cP E@P"eY bY>W"@PXY UY0@`8zPP0@P`ۉp@+u0(@0000pU@p,`40 U0(P<P8f,(PR00S ,R `0 ,0S d,8S= m,8S 0@+4}2#4&&0V5H&}5o4ض--&4+44H&444Զ-5'5=555 h 554+ l <6A-P`$ E[hl廄P03pp2S l+ Ps@Uxs}PO p 9P/P00@˜7' shvP303L$Vp840pEWQU 4 000`P C,MtPE0S34# 3 3P㾈㻈㸈qP|@`ph `\~X3P04wHt4S 8S tP  $?h P 4SsRtPn l  PpR8},`p1<01 1> 11bG01/΅01$1sRPN,R# 2R CzClp`d Pa Q18C8S laiq́`r  lQ00S t P +`P3?o20S R=?o20 P Pl s18C8S 0 S ES 0Rr  \ s=S` 0 0000l s18C8S s`td0H,L4MLLLH&T&LL,LG LM&M0&JL0&M*MJ,0J, LL& L@-@` PZPt1  lql!pX10SAH81P@ -{ 1*$q<P 7P0 nPbP 9P0P  c0@ S0VP  00@0T0 D0  40  y8{0STO,P,UH&TTH&T3&A-`4C00P@0$ 0崚КsP0 0ނP00{ zh뀇h-˂P000"SBP U 0+0C0SPP \p8ᧂPEP ꑙmP 0Se倚P10^y P10Q U 0S`fPk[ݥ㡥PEh10S \10LDQ}~0S(1(WP#P "|Pqp 000000SO (듀[PP`0S PPp00S38O,NU,YUIU^UaUhUoUrU{UU,P,,U,Y&UU,,U,t,O-pP!LDBD``<"p(2 0 qQ pPpGefuP`P GP IP EP 0  a0@S0000P @:=:,# H&H&ض-;&=a,O-MplxzP`=P4,LL9@(4/40P@ 00 0P#0X00@T.`P@@#p?30HXD[p 0S hz@P X@ PH3 @3< 3 -R R -R iQeRQiR kR eR" ""sPPPEP IPF -PF 2Q@"P00h2h~T2XD20P^U0S ?SPP20`^V0S ?S``10@^T|0Sy ?S@@u1100jhfꈱ400 \ (0 `0w !1R- S` \0  0Z, ,AaP GY  ;0SG@   9S`0S   Rڰ1\0 14 ꔶ,~ -T&H&>hX[&][&b[&ض- -ht@,H&gtO-@$LMPp`@"p1 UV! vPp ;gP uP GP `0S@0000T PUP  3 p !;P0P 0S U; p U  p T X p V pu;`V `X \qyX@0m PPP: Jض-aH&hzYO-0|M0t5@@l5l%@h5P `5b@pP5b/HEHeX4%05,%,E5(%`5 0`0-yP`%@1 P P  @'omPD DP4 fPğ5 CP6 #pP8 rP|$p6C`( P00: S0S00',pPP( puP 00SW p3 3 CG3`3p>nWpP  FxS_`0 @KePPD zP 6zSC* . +(P%t 0@00P@UP@`Q e)V ((P,@44`(PV,@,@hB0 ((P404`V(P,@((P,@4`V(P# 0 0S0 0 00 0  p  W-%@P 8 @F001"1pyPZ 0Q }pOmPB0 ЍpS--X-K (- -P-H -|-T -(--K H& K ض-SK L L L t-,-MK -L -|-L ]Zp90|n0C 0 0R080  h0 l10 B1!1pq头0 0 ᮱PP 0 p寰봸 84'000`1Znp @ .1SP =8Hᇢ:0P @@ @0 Tp 0 &pA@ⴡ( P0Q819:d!*`1 xjpp ☡PL 5  o<:< @匟p, D&`11`V xy)PpYGB Y9 +0d1 ဗmp<)p[?spP \X 50S` ( %5PQ 0S Zo F0080x8"/0  ӑ  0  2s<8"/0 ő  2sc!"# ốp B 0< ǑP$*ɠ F 008 @刞p 138Ǡ=72 @stP@ z@ wx7  @ p0S à 0HX0S0S ~0  Q 8 0 +zp~0S &BA☠p~0S t&OBA⊠P qL S@c8 ᆠ_,Wm0 T 0 SQp) bp% P 0$A>0 0T1a5T @啜ptDARp$0 T1Qp mbp\@$Pp p,k@T5 @ipA X000-0@00 UP  {@ 0 30 Zpt@ Fd#\ L$# D43FᏠpI  S+p3 @pTA֟!R`14`11!P0@!瞡0P!tş00!R00SRd188(“`1Z  R! Q01Y<(p ኡҠ`1 ᝓ1Y4180; X >< 4900ဓᓮ1PU| 0S 1 PP 0S  E 0S ዑ 7 R080SX  R   P1p弜0 S   0察`Va7,  H & ] н H&|  ض- 3 Y l @ İ  * J l / p L ޱ  ) @ l K L w   % ܲ 8 R y L &岞0@0@ [h8n0 A  Q/0@-0t h P ^0I8f@6 0 0$010K 1O-0bM!Mb  Z !1 b0  0 30_bݍЍn t( Pp  0 #G \ ,l{` ; (0$(00G +x(80G( G p x8_S  000 00 0Ԁ @G P 0 wP x8#`@#Z* wP 0l8 40G PU P0l8 40G wP"+DJ J *tD*0ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/P)<) )p@-`hAh1M@0``T!0P1 0H 0 0!  0  QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp| ؽ`G `` d` P4( @-M   Ѝ*/4T*/@-@y@*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: D`HeNhiQrTyWZ],`0ftiȎmȎqLu$x~DDt$L0Ȼѻtջ0޻ 0 8,X6BHR_kPp8w8|d=d=DSX]_bh kxüxƼ~˼~Ѽ~ؼXݼX(Й %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s?lB0F KQT@@W[^ @@djqu x~|@@@|@@%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdinر8}xvHfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|Tiinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.EG9 total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s"5'5-5522Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"}c}Tcc}c/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+LLL<LLusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression:C5@FP%-V"SKarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %s  )  ? Q [ g t  g t      E Z   5 #?  ? _Q ^Q FQ <Q >f ?y  error %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQ?>TTTT7goujjW-EHOME :]./%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier%lldnull or %s %.*s: parameter %snot set%d%zunot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused$4ad;AD:ZZP'/]}64/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes%ld [%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d %ld[%d] %ld /dev/nullCan't open %slpZ%smore than one -p unsupportednp:invalid name: -p '%s'%s readonly%dYou have stopped jobs. ${#${"(()(...)$(...)">>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error intv{fds{cmlr pnv b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:/\(8nYShjrltEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpected6!B!J!N!R!W!\!`!d!h!m!r!v!!!!!!!!!!!!!!!!!%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \  !! !!!!!!!&!(!*!/!4!Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) %%@%%&%,%2%8%>%E%O%@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error $$$$$%%%%%d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATION (0(d(1(P(1((8((0(h(0)Ѐ(0)(0)|(0)<PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad number*** ** ******* *** ** * ********* *!**+++ +!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unsetP1@V1@_1a1f1(k1 ap1w11814|111011commandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp$2,222=52X82X>2ȨC28G28K2Q2tY2`R\2R^2f2k2(n2(v2H?|2@J22222dg22222@2n2k22HK2&#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260420072437Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failed"9*9 094989=9C9H9M9S9W9 \9d9 j9q9 v9 {99999option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOP;&;';@&;@&;%;H%;<&;&;&;h';p(;%;p(;';(<(<4( <`&<%<'<'<p(illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedtty@@@@@#@3@#@3@2@3@3@#@@@A A@A@AA#A*A:@B@K@R@Y@`@g@m@ t@@z@@@@@@@@ t?C$x?C}?C$?C?????????????@?@? ? @ @@@@!@(@ /@4?;?C?H?N?T?Z?`?g? m?@litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %sYY'Y@W@-Y@5Y@ MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFOWWWWX XXXX'X.X7X %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd %s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:daeeejerewe|eeeeedeeded#eeeeeeDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>adhdmdwdddddddddddddddddddde eeee#e'e2eAeMe]eFilesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdDYDYYTYDYYLYYYYD# %s: Niiij jjjj"j(j/ji6j:ji@jiiiCjIjLjRjtype: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u hiiii$i+i:iAiGiNiVi[icihimiqiziiiiiiiiiiiiiiiii%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. opp%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:'@*TMP-1  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootableB|ԋ:Mt   ? [ }ݍ*OcxŽ ގ!#$&1234568&9,93:L;f<=@ABC'DNEdFyGyHyJLMNĐOԐPQR S%T.U6VNWh\racdґefghip"qstu8vw>xRnȒՒ ,LhՓ 6Rj͔Ӕ ,4AKRuו1>PjzЖ3He}җڗ  @[vט #8Rr֙ +N~%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype(-37>EJT^gn}Ȟ͞Ҟ֞ڞ*:vfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY3:ACG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:x4&@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:\9&No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec],>&AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions] A&@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x), %,?JxUnrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functiong&Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:h&@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored'9M[bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGG,,,",>,,W,,Pgpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: !LxhT"  Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*'27<@DNTX`djnyPartition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sy&@Afp:sNo MBR in disk to convert*Qx    8 Zj,@Uk !#$&12345689 9:);C<a=y@ABCD+EAFVGVHVJlLMNOPQRST UV+WE\Oajctdefghipqstuvwx/K\ ) E e }       / G d t          D % H [ j }          # = M h          8 P n      .I %EX!QMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s@&@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremovedt&@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ct&@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]&@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] & a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l+%')Hx %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)%den_GB.UTF-8 (active)UnusedExtended MBR - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s ()start %*ssize index contents%5d unknown%*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: None %*s[ %*s ]Could not find index %dDetails for index %d: StartSizeType: %s (%s) Attributes: =&gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed &@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l 2& a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eCSFU0eCHah!IdontNeedEFI (s*K>;*.|nQn- q+9E|nQn- q+T^|nQn- q+kt|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(YbBRuoqr 3Dh&"\ M}-5F@Mjy֬Wh-чHy}-чHZIчHIчHIчH2IчHL6 %?a  S'@ )Ѹ  *1@ )Ѹ: ? 1x )ѸK V ST.qBHo6֯if q %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL &@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-"&o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin%&@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeee((([%+-/EXXXXXXXXifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s 333 linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroy_4zi&f4yialiasdeletetrailers-linkstrdescription-descr-description444h&* &444h&k, &,P &V* &2 , &* &4h&7+ &4h&* &4 & 5h&5h&broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6z88888 888@8888 90 9@99!9arpdebugunnumberedlink0link1link2<<< << =@33getifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %dCGCCCCCAC, CC CC`CC@CCCCCCmedia_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaoptB B??0 &)B B??0 &? B? B &? B?B &.B B?? &? B?` &no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %d(0t0XL0`0tunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnelaEh&ZE &bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanifG@ &jG@G$ &GjG@GVLAN tag(ELly{}NONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAj@DjIjPjWj]j@fjljtjxj@jjgetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: mount_kernfs [-o options] /kern mount_point :lDlOlRlUlZlclglllqlxl ~ll lll@getmntoptso:kernfskernfs on %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsrealpath '%s' failed"%s" is a relative path.using "%s" instead. & 2usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath uooooooooooo oo ooo@ooo@getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead. '*? -($25GJM + Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupvvvvvw w wwww $w+w 3w8wDwJwQw@Yw\wawkwpwsw yw@wwwwwww t@tttwttt u@getmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpsrealpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s $thw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'n|u||||||||||| || |||@||getmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}A*LZo%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).WJgˆ ,S{'Nnusage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead./+-$ ")7IKWco|%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @BCF I9LCNPO|Sabceǣf٣h i,k8mFnWofrusu -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jdݮ@@@h pp pp ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880bj #'@PSVgmp>Gey  "$&(*, usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%x     pusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uC+P%command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c ũ©)+S QJNChecksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s &UUU*UUU/UUUCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood 5Mv(T N%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +8/& Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/ *<IO\^llhX88p /AM`lMy/Eckccc-4lE<<dov{regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): JOSZ_fCTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c///421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)6888888 ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBA]Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEY?ett Cett pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4]WValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGSFGI%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s7}}}}}}>}}[g}}}}}L}h}}}}}}}}}}}}}}}}K}}Ubn}}s}0}X}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     "2( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. M 'M /M 7M ->M GM 2-TM \M 0-]M \M t-iM rM -M M -M M -M M T-M M 1-N N -N \M -N \M -'N \M z-0N 8N 4-EN -LN SN -]N \M -gN pN \-tN M 3-~N N -N N 4-N N 0-N N T -N N S -N N R -O !O S-4O N Q -=O \M o -FO \M n -PO N |-\O N {-mO \M z-xO O |-O N y-O \M -O \M -r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eulaRR Z NR Z %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5X Z Z ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalid c M` c c %c .c 5c Dc Kc Qc Xc `c ec mc rc wc {c c c c c c c c c c c c c c c c c d a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF \^ &^ 0^ c P^ /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug#.q q q q q q q r r r r $r )r 1r 6r ;r ?r Hr Sr Xr ]r ar er or ur yr r r r r r r r r   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s d1 X _ | d  . @/ E E 1L e u %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error&} -} 2} <} F} O} V} e} l} r} y} } } } } } } } } } } } } } } } } } } } } ~ ~ "~ /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijz|   ( ́ X p l Ȑ 0 { X | ` { { Ę X Ȁ disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS(|  Ȝ %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhck;258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new `s$sH}| ~{{0rjlrq~lfPi8f(me4f  @xvXdhgdb hlgggout of memorya I < < D D H k M X  ܔ ^ c  j  ! -a t }     ,gpt %s %s -b %llu %sB I N Q T Y ^ a e k o u z Ɣ ʔ Ҕ ֔ ܔ %s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eC쬵 SFU0eCŘ Ϙ Hah!IdontNeedEFI٘ ޘ (s*K>; |nQn- q+  |nQn- q+  |nQn- q+) 2 |nQn- q+C N |nQn- q+\ ` =rGy=iG}d o ;Mt?z mWC 3KOO yD<#*=( YbBRuoqr ə 3Dh&ؙ \ M}-  @Mjy֬ & -чH7 ; -чHP T ZIчHn r IчH IчH 2IчH L6 %?aŚ ʚ S'@ )Ѹך ޚ *1@ )Ѹ 1x )Ѹ  ST.qBHo6֯i$ / %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/   ! ) 6 A Q AV ` h r   %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new(| П ğ Hhlȕl0\ оh@xėH̠LD%s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s n ȣ ̣ У ԣ أ ܣ %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOPų ȳ ͳ %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init SY^}22,^222.4jn22v282=Iy21G6~2Bt!',:?DI^ssplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument, b7 c> dD eH fO g[ hs id jl kt l~ m n( o p q r s  t u  6 v w x z y A B C D E F G HԸ I$ J. K5 L> MF NL OU Pb Qj Sq Tv U V W X Z 1 4 6 % | ~ }    ) 5 : A F M U Z ` f l {                $ 4 ^ = I S _ r    option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLHnHnkk(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deletedllrt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deletekksa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULLs } - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%sQ V [ b e k protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)$ + 1 5 : > E ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %se p | %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s       g BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- 4?4?H?H?: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc$?$?VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory . (b Hb hb b b b b c (c Hc hc calnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ \& < D < L        " ( @. 4 q"o"m"ASCIIcs_path!X(! bc_base_maxx! bc_dim_maxx! bc_scale_maxx! bc_string_maxx! coll_weights_maxx! expr_nest_max x! line_maxx!  re_dup_maxx!  posix2_version x!  posix2_c_bindx!  posix2_c_devx!  posix2_char_termx! posix2_fort_devx! posix2_fort_runx! posix2_localedefx! posix2_sw_devx! posix2_upex! stream_maxx! tzname_maxx! atexit_maxx!/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[>!h|D! }J!}P!T~V!~\!b!@h!n!t!,z!Ђ!t[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d oh  SL} 8" s$$ januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDϲ;15MS7) |;p%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nny:mWnC!n75VPLHD?;9/-11)15-1$1TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K6Dzg Tr_I" 6A.o\vI16Dzg Tr_I" 6A.o\vI1" acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C025J.0tcr>q Tunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist