08gi<  gi*|t |tgi@@<@T 08gi<  gi*|t |tgi@@<@TU gi|t`Agigigi$h gigigiAgigigiA.gigigiAgigigiAgigigiAgigigiAgigigiAgigigi Agigigi mDIJ"gigigi (08@HPX`hpxh$TgigigiN$ gigigi K$/gigigi(08@HPX`h#M$,gigigipxFAgigigi Cgigigi AgigigiAgigigi!gigigi agigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigi agigigi agigigi agigigi agigigi agigigiagigigiagigigiagigigi agigigi agigigi agigigi agigigi agigigiagigigi agigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigi!gigigi4!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi B!gigigi B!gigigi!gigigi"!gigigi"!gigigi"agigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigi agigigi agigigi agigigi agigigi agigigiagigigiagigigiagigigi agigigi agigigi agigigi agigigi agigigiagigigi agigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi !gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi !gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi !gigigi!gigigi !gigigi!gigigi!gigigi!gigigi?\!gigigi>\!gigigi=\!gigigi<\!gigigi;\!gigigi:\!gigigi9\!gigigi8\!gigigi?\!gigigi>\!gigigi=\!gigigi<\!gigigi;\!gigigi:\!gigigi9\!gigigi8\!gigigi:\!gigigi7\!gigigi6\!gigigi5\!gigigi4\!gigigi3\!gigigi2\!gigigi1\!gigigi0\!gigigi7\!gigigi6\!gigigi5\!gigigi4\!gigigi3\!gigigi2\!gigigi1\!gigigi0\!gigigi2\!gigigi/\!gigigi.\!gigigi-\!gigigi,\!gigigi+\!gigigi*\!gigigi)\!gigigi(\!gigigi/\!gigigi.\!gigigi-\!gigigi,\!gigigi+\!gigigi*\!gigigi)\!gigigi(\!gigigi*\!gigigi'\!gigigi&\!gigigi%\!gigigi$\!gigigi#\!gigigi"\!gigigi!\!gigigi \!gigigi'\!gigigi&\!gigigi%\!gigigi$\!gigigi#\!gigigi"\!gigigi!\!gigigi \!gigigi"\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi \!gigigi \!gigigi \!gigigi \!gigigi \!gigigi\!gigigi\!gigigi\!gigigi \!gigigi \!gigigi \!gigigi \!gigigi \!gigigi\!gigigi \!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi\!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi !gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi !gigigi!gigigi !gigigi!gigigi!gigigi$!gigigi4!gigigi!gigigi!gigigi !gigigi !gigigi !gigigi !gigigi !gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigi!gigigiagigigiagigigi!gigigi!gigigi!gigigiagigigi agigigiagigigi agigigiagigigiagigigiagigigi?\agigigi>\agigigi=\agigigi<\agigigi;\agigigi:\agigigi9\agigigi8\agigigi?\agigigi>\agigigi=\agigigi<\agigigi;\agigigi:\agigigi9\agigigi8\agigigi:\agigigi7\agigigi6\agigigi5\agigigi4\agigigi3\agigigi2\agigigi1\agigigi0\agigigi7\agigigi6\agigigi5\agigigi4\agigigi3\agigigi2\agigigi1\agigigi0\agigigi2\agigigi/\agigigi.\agigigi-\agigigi,\agigigi+\agigigi*\agigigi)\agigigi(\agigigi/\agigigi.\agigigi-\agigigi,\agigigi+\agigigi*\agigigi)\agigigi(\agigigi*\agigigi'\agigigi&\agigigi%\agigigi$\agigigi#\agigigi"\agigigi!\agigigi \agigigi'\agigigi&\agigigi%\agigigi$\agigigi#\agigigi"\agigigi!\agigigi \agigigi"\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi \agigigi \agigigi \agigigi \agigigi \agigigi\agigigi\agigigi\agigigi \agigigi \agigigi \agigigi \agigigi \agigigi\agigigi \agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\agigigi\ !gigigii!gigigi!gigigi!gigigi agigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigi agigigi agigigi agigigi agigigi agigigiagigigiagigigiagigigi agigigi agigigi agigigi agigigi agigigiagigigi agigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigi!gigigi!gigigiagigigiagigigi!gigigi!gigigi!gigigi B!gigigi B!gigigi!gigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigiagigigi!gigigi!gigigiagigigi agigigiagigigi agigigiagigigiagigigigigigibpf!gigigi $ gigigi$gigigi$>gigigi$gigigi$sgigigi$gigigiAgigigim gigigi$gigigi $gigigiAgigigiAgigigiAgigigiAgigigiAgigigiAgigigiAgigigiAgigigiAgigigiAgigigi tC6E8x7fYٴ&w8hFTK&^K au˜LFr3 0jD: jJ2FR.Cp o Z' &%6*^e` y ^_pzSF/zWEF 0!My,(!~q9d/ I_Q,>"\pxߝy;&0$# `KvT~Ơ-VcbHX,UP KEWWSiOj`>fI[2c(!gc\ߢMaZtt,?`uX9} w$155\vh`WXAvi_s $7{\p-CF<:4N5&GCOV`B+3ڹ#^|o=> \O&5#60t8Vb9Ewl/ `Z31e>;WZ|5>Z[|t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4̯"4 ( ! !!&&l( HH!&&NetBSDKwGPaXNetBSDearmv54p@-D0D 0@`Qp(@P`F`F&a03/T@p9%%A-`0`` 0PpU(pGpG@Pq`P03/T@0US Ц8%XH-x`Q MN h!h1 @`p0 0R0D1<  0S  /S 0S1Y Y9 T P0PUH2H0@3(1*03/T@ m0地0 [* PC PE%Q03/Zd 0 P0 0#D8% 0x%$d%% p @-l :P`@P H1*p`POU P  #@tH&P@-@⌦O-`HH2@DRtMH00$H0pWr {qP@tH$H( R 1@PpA0: S :`0SЍ@P0`0x= 0S(0S P0S S0p WP  0S;00 0 pP U0s 8#8T T@V L   PpW&<&P& H0`  BR` pR RX X/&&@-u0 ZYH& 000/l&G-؀P x0M@ Y$ \0&`p Q$ 0'6&P0 -Ѝl&Y@<&H&@-@ M00@  P  ЍA-` l1V0zP 0 @P@TV PC  W@@7v-u0S@ @0;0iP W 0XpuV np u0-S Xd{Hqp 4@0SV  W <&&O-5MpY xBp #`P` Ѝ  p` 0D`$5XP0S 5%0 0 5X0S40S* D$尠Dm00CS0 ,@ Pp  @YT `0 @00CS0X,0 X0 p00p tp@300 80: Sx h+\p@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `JZp2  pO 0Z 1(#00 H  0P \\|P 4 `+X"J 0R 0n0ZZ3r0S P eY' p00 R0S ``P0S  0 <(d P <`V k`0 ?oR20S 0  0 0R0-P `P hh`0S H,` P0Rt00!P &<&%p&x&|&t&&H&(&7&l&&@'&&0@-MM@P  ]p  ;0U$C dP TTۍЍ08 {P ,(0P Xf<&s~&Q@-@ TP DD,lP $ 0P@<&s&Q@-@ XyP HH0"P $ 0P@<&s&@-r0 H&0$/p(0$/(@-g(@-b>@-]U@-Xk n@-1   0 0 Ѝh(@-1   0 0 Ѝ(@-1   0x 0 Ѝp(@-1   0i 0 Ѝ(@-0   0Z 0 Ѝ(@-0   0K00 Ѝ(p(<00/@-0   050 Ѝ((<00/@-0   0!0 Ѝ(p( 0@- 00 $0P@IЍ@&,0A-`M!A!qX0 p! R0B=0B  P0H 8 R8B 4!010,!0Ѝ PP =Gb0P   0S  0 pP0P      0 3/R ! 7000<040LQD0(p((@#=h(1D`p0p@-|@PtP00 R 0p800 p0  B0Sqs (p((0 0 0 /p(( @-_@- @-_@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpSq0S 00|m8@@-@UPЍ@Q |PЍp@-(`Vp80@  03/PP8003/(Pp@-@P`P 80 (0(3/@q P  qPЍp(O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AV 000+ xpt| LU  ЍO0 P % pHp 81/qp4 3 ?P p 4 p0S4 tp0 0 0 0 " U0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0<004 8pX  FЍ((|R/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  P0 0  0 /? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`j4mi4 " BXX P!d4W4Zi4 y" B   !d4D4Gi4 f# B  d4144i4 S/0h8p<@0! S` d @44i4 6Ѝh(Mb(2U@-@RrC- A `00P4 2#&P8P0 (1/qp$ 㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@0  Y $ w p(l(@&o@-TAM P04 00#!8 ( 01/qp$ gP9 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080l0( p 3/p #U0* ,0P/`RP `(lmSP @-<M4@  @  Ѝ(O-xM0@S M. 8S+ #=T(T0|'0S( 000| (" ! !xx00# #q|0 l& %fݍ Ѝ'|aY 0 X0 S 0F0WS07  S  S $0S1 `7000000S@70 0070 00  0@Rg R0r0C0C00Q0 0S- ,B< 6P`0 V  $ ( ,PU 00,0$0 000 0S $Y% 880 k(0Sf0'  - 00   0 0,0S 0H 2 8yXʤ0 @@pW= ?W09*Oh 0 ,g(Eh0 $ "g`;h0 gp,00 0 00,0 0@ $0<@ 0( @ p`| h6W㐚)(0 ` ?W : 0吣$0c#`ᐅ{'00S0 ,0S # g$`V %;#40S W\ /\ * g0 f 0 g%;#   |0d60$(00Z`40L !(9#p0 !$!0e0%#],00 0 00,0@0 $0 <,0S 0p804< $`WPPe  06000#00_PdVp- ?V0)*gg 0 4Df4]g0 $ :fSg0 0f00(0004 0( X=g4 V2*40 ?V :/g 0V㐓$0吃# ?V : g5!0 0 0@0 0<yy( K@&  (8  Jg   K    6 $ = H @-pXPP`@@ hgP Ѝ`3MU@O p@-XP8@T`@D p CgP<opQ<Pp(A-AP 0P$ 0 0 SQ ( $0嶫P k|h d`P, R2DaDqU`0``000]Pk_ 00CS000 Q   0,`0CS0000 (00/U R k08 4`D 0$00 0$ (P H&T  (j (x T0 S 0SP/P/S/@-  ( p@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p ( (@&((p@- H&B (@-pp `@PFP 0 ^Uq00 0U00 V^`(P 0@-P0@@U\000^ 0`(O-P` thUt2tdP @ @P  Ѝ@4r( P PUQ  }PLP0p  R R2S4rdP P 0ST  !S@@@@P8 iT PLI00CS0410" 0`00S;dPT- 0@@00S  P P  P 0@0CS0l00@  gp@mP (S (((&`( (> H&B (l o U p@-Pd`d@000 PPPP0P0CS0p(00 3pr (`((G-@0` V VЍpnPP 0崀 尐R`00@`0SqP 0S 0 d0  0?o2S @`oP ( (((P `00CS`0p S00 P0S X0X /X&O-p`㴢B崲0S@ >pPG0`F [stlV000PX!h4 0,J00C0Cf 00CS010:PU 0P1` 00CS04 0 P U Rt0V00aPgc  00C0S"10 U00CS000 U0P 0@ g; |k V 0 00 0 @00S 0S YI(|( ( H& (( O-$RM` 0000100010S u@0Աq`0#0P 00)<0J?oT20ST SRP 匄0S  RZ  @T  Z     0010S@@  0 1P000CS000 Ѝ S 0P  BR l  @0S Z0 0$|((((( (H& ( A-0P!S`5P@fm 0LpP0!S 1P fQ 0HHH<00S ,t$0@  H&  d(#(A-P@dp`T0S Pf $ P ( H&(O-`@ ؀P0S p0 T T R R u0p[P Ѝ PP P   P Pp@(((|(A-p0`!SPP@9f 0a @ PP0!S P f 0HHH<00S ,UpGP: H&<Td(#O-@P b 00CS0/p0@g eo  0`001 pTpP@0 pW2tQtTP0PP00BPeD8 t, 00CS010 6 u0P0CS0000 S0 0 @ X 000 0 T0 `0U0$0T p 0 &(((mH&x( (  (((O-PpP0 SPEUP ЍE P 0C0 X2 Ub000P>e g 00C0S 20  0 0CS0L200 d Z0 P CPE P 000S S 1 `V% V000tP dux tp 00C00 0CS0@100 0cX 0PFHP0 0Z CPF V'P尀VP0PP002P d4t pdl 00C0m0 P0CS0<00jl00`6(|( ( H& (((O-P@`p P`CT  0PS圁P 0@^S00\P0S @\[  TP @P+0P00 @&&@-T @000 <P 0S( 0C00S 0C0 Ѝ(ht@@&P0 R  QQP0R/@- 9 (G-P`P@ X 0S@ @0S" @T@@DT qpP 0S 0 0 ZPЍ(G-@P tp0SK`HPUP 0 @+P @P(X0000@-@ 40aA R    0/T&(40000 01h@- T&(G-dRdr@`0 0S0 "3( 80?Y+Y# Y{00 R  % Xc 1@sNc0"Sz @`` IQV^Y0^Y-Yj @ 0@^Y-Y00@R($c0 0广1@s@c0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 00;Y0 00 V@ T0S(T&(0@-@00 00UP0 000 ,R;R 0S  S   0;SPp( p@-P@0QS@@R0p`V P0C(p@-P@P b, (H$ p 00H&Q 0Q\S@-A /`@-0S*  0@000S! P|\KpP \PP e@P  0 S@/R/    f 0  (( Q 0@30/@-(00@- R 0C30\(A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  aT0100CS00 :pP(&G-AP 0pRpGWR0`0`030` 001S 0100CS0H89 P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  $`p(G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P`(G-A 0`0P0d P 00CS0-0 o& 0FSbp _1S 0PEP0Cp00100CS0(O-LB`0pS52P UC!0SR0XPPP00PF 0Q0CS00MO _PP\00`F`0rP0   P*  0!0CS0P(P*SP; 0堑0 S- S   PL` u00CS00  0堑0CS00  )_0PyP(H&A-ApaV&ʐ0l00PP ` 200CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p(H&0G-D0!10ZPpЍ0S0  $SPPPP,P_.X T^P00CS00 ! `0Q0CS00! P1ȃԓ 0 S)"Rʠc0U```00P 0b0CS00 _^ 1Q !@o!S/ %S !`V U 00 0P 0帡0CS000!000\Q00`PR# !RU``0``00Pd 0a0CS00km0` 1 1S 0S"21a0S S`l   dP7 0a0CS00>@10`! S:`Fp00  1S psXa0S `10 BRpE` S`l   $P 0a0CS00   (H&"X(( Q 0@30/@-I(`01S @-0@!S @YP /NP /(67@-A0 R!RUUʐ0\00̿P@G^ |xp00CS00+ 0 @ R,\ R P Ѝ00!S KP i0 Sڰ 0R0CS0000 0 Q  vP   (T&H&9J?A-O 0 P0,p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pq PPPೀ0S!S 4 2H0S 1Sm `P0PPPbL 010,0,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S $ G h0PP1S PP"G@oG`GooPbVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  @P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1Sn P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1ST1S0!S F0S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B RZ `8r@p>Z0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P 50b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S" P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SN^P0PP RPӮ nQ pQ lQ 0 S:8P0 PPT&(^u"@&@&(H&-p(X(.(@&@EGQP000P0P@u Z`P 00 00 P0 nR, pR% lR& 00 S1S0!S D0S1Sz aWWv 0 =P0S0P0PP1S 2SqXP R! l B R0"0 S07PP0010CSLY P b@p AY0"S4mPP00 nR pR lR 00 Sy|2 00S <PPPP0  nQ pQ lQ 0 S[0S dPP0S0PPX0 nR pR lR 00 S<P d2SA P0PP P0 -@- 00h ЍЍ/'(-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0P,xX( $/ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a >W L0 0@S G 0(( (&H&*((p@-!0 P= P@01SE0p0 SS t`P@0P 00SP0P00 P0 h0T 0M0QP0Wl0 ,((8(R|(('&H&*O-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00P? 0A0CS0l10G 0P \QH 0 SP 010S mP/ 000S S)00 S [ U 000ѸP KWһ t00CS0L00 0`00Pp8 P((f (($(((&H&0A-P0 0p@ W 0 `@P 0 R00R00 1BQW@ @P喳@pV0"S,"@gR000((O-@SMpcȳ00 0GS TcsT`0``00IPVK` \{X00C0+0&SK BR D R: Y J@p RPV N00C0S @Ѝh20   K  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p ķP =VĺD @<f00C0 AQ 0 T0 Tpppp  咷Pu p BR   @W0 `0CS0(00oq 0 b( ((H&O-M 0@P0P0s <40S 0 0 000 (0LpP ߍ0P0`#2Cij 00 S pSN(0Y01 Y  $ %P$U&T PVL  B R+430 # W  BR 200S 0 0c rT 0 0(PP.00Y0 Y L $ ׶P$  BR 200S 0 - 00CS000^`W 004 00S |xP00S 0  S 4 SX (( (H&(O-pᬡA0M0CQ` 01 00C S00`NlЍ'  0P5 P!` 00000`P00CS000  E[  0S00CS0x00` P  P(( ((((O-RB0M00bsp 0shЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S Q0p0000000CS0C01;  \" \   " L\ B  @      0C LN (@&(( (,($((A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT @ 0((@&(G-@p0 PR` 0 P(S%0  d P 0 ,(張(H&@-1S0  H&O-eGM0PS@pM$Q403/P 娮0: S,S00W +:> P8:S?0P0: S 0SqP0: S 0S 0S 0/S&_P7d0p0o$NP- ّjP 0#v PvO+=0P ]D#P{]'P 4/EP/EP M0P+I [(H Z% U8.0. 0PT9.0. 0P @DP ^ PT1RP o R00S$ 0SS 0: SO#PN 6  0jQG=00 04K ^QG=00J0SP. Tq9DXG DX00CS0  p Pp  pYW ioX0 X p00CS0g 0 0S EP0SGݍЍ0c ?o2500G0 8(`0&H&&)\\$M0\\ MX X0p@-@P@@DDT ` U H H0Rp@\\ MppX 0Xp@-@P@@DDT ` U HH Qp@\\LppX X0p@-0P0@44T ` U 8 80Rp@\\LppX 0Xp@-0P0@44T ` U 88 Qp@\\LppX X0p@-PPP@TTT ` U X X0Rp@\\LppX 0Xp@-PPP@TTT ` U XX Qp@\\LppX0X @-ppt t0\@ ^0@\\pLX 0X@-pptt \@ ^ @\\ZL5S %R R S R SSh -^L^S R 0/0/0000(O-QMTh @ `u @ 0@0 @0L0@@ @@D@H@,@0@<@@@4@8@5 SS$V\ 序0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?-J$pSpVJ,0S d @?C000@$0D0p0H0D0:p=J0$p2p5J$0S00<00@0#0p"p%J,0S  @?CZ㸰张 0x#p pJ 0\#ppJ0 \ 0C0CQ0B003/040 0S 嗲YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$I[(I 0R  P 4P0@zI0S00P00P00ǯPP9\0.S0S~ 0! 0P$0 V 0P(0 $T (O R P0FP000Ѝ(VUUUG-@a!80S *PP v-rpW G+<0SB|+@P VO@+RO@PO0S5!0CS0\0$ ij  (00L0S \0.S0S -@0S40S t2(-#<0Y?o20S X (040( GG-`㨲.CP0DL0 qP0S$00D0H0`P0pP㔔0$ƺp[|4T H0 `F0P 0 \7P 3a84X0 s0X00 00dt |  P PRPS Wk( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30V L 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@PM 00@`0S0\0S00S S S0 /0`0St0\0Sh0h0(ht@@&NH&B8(@&H&Ș4`ܕt̖80p@-@PT @@\p(J80p@-@PT @@\p(J-L0MSM\0 "+ `pgM0 ލЍ 00  >04@pdl0l 0 0  L00S   NLUH&Obx(|(T($0\ 0S <9(OL0L0S/0 0 0/@-00 SM   @4 @$;pЍX0T0P@ CH0@ B ?m1 0Ѝ@( (4(<(t8(P `00CS`0p S00 P0S X0X /X&: S@-  S  S/ I* S  S%|@=A-|1`@TXPM !\@T10S H10S. 00 00q0p'p  *@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?E 0hH00S ( (4(x(|(t((<(8(T(s@- P@@P `SU00S @JT FЍp0t  Q \0 \@0U +P@'U((p@-P@Tp0 0C0  $D @C-@4Mg03,30S`sV4Ѝ0 0C0v 0XPS !$0S 20Sh  4 㬒;$p9 *0( \P20S 0< ,(20S  0 : SF0( " 08"$410SP ;1!0 0P 10S10S : S0: S }`}P1 0IR<1 B?D 0 ]'Q 㬐Op , *IlN\,@00S |00S (P(( (4(h(0(p(x(|(t((<(8(l(T(1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ T0P 0 A`0SpJQPPU% Ѝ  B 10`    0S[  L0  $R,   V ( (4(t((@&A&(410G-S$0@010S 10S,0000 0 0PD0`VG`IEpP儠UG p0 0C0 W gp0S$,  `YpP W`( (4(t((@&0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG 00 0C0 W ,'p0 00 S p0S$,  Ip` ( (4(t(@&@- M @ Ѭp ЍT P 0@  QQ  00>:T 8P S  &0p@-0PS``rC@P [DP P.A⻩@P4& !Pp|(C-CM@LC `HH DHPȐ`T *F 0bpPPCߍw ? P@%Hw0S ?@P?oP@&@-2I  H& 000/(@-"I0 ZH&@- M'P<1$ /A&mL00CS0 0 /G-\D`HMp 0008T8$8t0000 00 $0S0V"4`0p Q 30Sa3PZPZ{F0#/000 0K|#jPgF0`#s/V 00D30p Q   #MP0 0HF0"T/V0020"6P3F0"?/2000HЍp(0: S P. S+@ P00S`0:0 03V-V)V q 1X  ?~? 3 0~\P F ;0L S0 00 0;qpE0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U )? XPV P 0A&( (PE&HA&((yA&!A&m8@x4(t4(0A&}D00S/@-4@~M0S~, jP~܍(A&0@-p@$0l00S Ѝ00 0&;0Q UE, b.PA&(L0@- R8-P 0 0 -(1(x4(cA-pP@` P@DTP`VA-pP@` P@DTP`Vp@-P@T0` Q@P 0 Q @;;S p@P00T@ D(0( -( -A&(x4(s@-R@T` V0a@$00 ?00S 0CS3P3D0 S9k-00@ЍpPڀ;;S" 00 0j:0Q P?P00@00" D0S @@D0ES TT 0$0|D0SwD0S sD0S oD0S $0STڄ00Q Q`-T( H-PD(00 \-$A&( D(eB`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     P000S, @ 00pT0pS 0L9Qo 0u=p T09Q/(A&PE&m,G-P`0 P ,p@P"ڰAQ"9Q 0P P 09QC@ ,ЍP PA&(`@-|A`MPh1P0S2 S VPLDG,00ЍV0App0 J90QzC , P0S(0S 049Q#dC ) Pڐ0V 0?< l0 ` 0PGC 0< S,00A&(x4(m2O-M4M S0`RX0E@FP0 0S 0 Ģ00rS '0S    G⽿000 <0  ᰿0" #⪿T~4"#> D܍4ЍT 2 R - ᑿ1[ 0`#⊿#<# 0S1夁0 L<p 0  p 0 #jT>4!D #>,1$a0, 000p0 01尐(0C0N  H,00( ,0$ <$ 0 5 000 p #*#,<# KTPE&H&(D(]4(((M (4(A&C-XRXb0TBS0000 Ѝ440 0 0S 2r0S 2 (4 0S pP (0: S0 0 p10S10S P/P 0 0 0S(q<<_ 1 300 0S000p000 S(00(000 P@0S '000S 0=P 0+0P0 Z; 0`势3HA& ((((((((PE&,(6D(=4(B4(C-M M\ PAH#*E PA#*SC$0`SH 0`E0S2*p<Pu <Pp 0 m S( 1**2r0t0CS G)|)p)5)])\)PL<P0000$2) 2 `ލ Ѝ)&0S  R  sS SS YS}P )yS)Dq儁)3)P)P@J<P00000S()( )0S0 1<P :0P)>PP H_P0000)P0Wi)ĵ(OiA&(|((A&A&PE&m ( < Z   |  ! 0!O!00@-@DpOp`TE&O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S =)@DT  A&0d#0UPTP&)PV0S p)@X`ꓢ" @2/PL0 !ᒣ#, 05DE&8D& (PE&! (!D(G-鈑0@`pP@FcU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ A&P 80| 3/PrPPTT00S\ T(R <003/P 202D( (!PE&!"( (C"i"@-AMP/M2@P+ p`pP/0P0 Uh0h (AލЍT0_":/0P0 000 `((" ("00CS0 Ƚ0 /0O-S$M00`Y P$ЍP0,03/P00T30 S,@C@s2PPPP 0030SY PV "20S P P P x4 CSR oP8 ,  P?7"( H0/S4P8 A%X m 10S  P0S !S 0l!202;/P K ,  41  0S a0S 11004 `]0D0 3/`( 0S 0S 0VP0x0CP0%P!P0403/OD(8(((((ĵ((/(#(((( ((`4(@-@@gPz>( '*8 (*#@-p @@e> r'G#@-@ApX>0 d'@[#p@-MPp@H>0S  0C0@> `p 0: S@S NS Ѝp,>`C-M~pЍa0H03/P0 03/P㕙plA]P@ 0AS0@0 a3/PE0 0P)3P/P 7P0/SP7 A#0 0006@ =t &0(03/ XeZ0 PD((((&&p#ĵ(O-MpЍe0H03/P0 03/PrPD50 S 05P =%&50SuJGBP 0(03/ [ P 0AS0@0 a3/P|4C003aP H4 CP(40S  P T 0 0  P 0R S = $ `0Sd003p0St00PfP pS`3`0Sd00/S5P6, A# S0 0  eP0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 H^ X RP$PP ,1Pi.0 P Ex @ ;/0S0S P0S 000[\000*4S 0S 0D((TE&#8(/(ĵ(`4(4(((( (4((4(((((((XE&(G- R@p T T 0 $@H03/P0 03/P0SB0 X Pqa0 09p1MP \P: 0 P0(03/P@!P0 0 @0S 0 00OP@& mP0 0~ p0 0S T/P \0 CX RPD(#(((((((#ĵ((#`4(T0@-0S^PP 00H03/P@((D(0O-M MT崐 $0& P`0@@z=0 C>zặ @3Jލ Ѝ  ⛷r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00x'()((()((dE&*"*`E&))/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 1@0 X2@ @?'Q*1@0 0嘠P TP` hЍXX ґ  ` `@X*:*((J*((Rs@-Ѝp@ 0@`Po'Q108  oP10 p*(X*0@-@MPPᚶ00<00S  = J"Ѝ0踵(G-`QM MJP㠔@ Y #p WP 0p 0PP=! SR J(ݍ ЍķPJ=18 I= $HL0Q\ J(L0 00&QJ!18 PT****A-QP S 000p@T+`00CS0@pT0 0S0T@ 0S@ 0 dA P 0S@ @T@ S P 꼴(D&& ȴ(0 0 S00@-@R00000S0@000S `忐P Lfp 40P((( ( *(p@-PP 0S|Hp `ᖐ@P` :*@P0/S000000f PR @@@p"+=+(h0 RX R  H R/< R/ $R/Q/ 8꼴(,((<(`0@-0S L0@0T R S$ 0@긵((d++H&O-b@ 04MS0S zB>0 PP p0 0p4Ѝ5h"0C S.0P20S 0X0(00!P0 000" "  0!$$! 0!㓽K X.($ * R=  R7  R$  R03 0T!  0J (!$1$*P7 R  R/  R $-0400S ̈́!!" # "040+04 wP~/0\ 00  0 0 X꼴(*(++++ (,+p@-8M@  ᥧD 0`P`ՊU`$ $ @ 0 P8Ѝp,(,C-x1lM0@S XlЍC$!`Z(m="(<Lp@WpP00 0000p084 Ҭ40CSH$0"60"$Ĭ 0( 忬4 CR+p ᶬ lЍB>'"⭬S+0  in괵(5,4,],c,k,@-@XM="r:(0 _XЍs,7@-@Pp "P Q Ѝ0 0 K Ѝ0@K0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  //$(|,A-@((PQ U?-QQpW :WP`0 M?`S AՖAs0:S@0 R  0 `-(H&,H&,/(s@- `s$0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0S`Pp 0P  T @R p00T0p0S ,-@P0=0'PP?.(./s@-@`P0l C300PЍp@00S S@@ҌPP 0 @D +00(@-  ImH&4/0 Rr @-/PE&@-<@<I0bI IIO.H&G-p pl7@d\P,p`y,0, Z/00 `33O-lM/__Po f@P= `P0p`ᐟ/00? PGP@  l?l/@p\?X?A0sR  S  R4?4/0, CR 0K?zP<N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/ 4>  ,> > 0S  > 0.0.0-0==P}===|=-=   H-  g= 0@T p)PP\_y,  0!-1 @ L< -=@=<P? <;<,<,<,t<,h<,\<,||_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@T&<A-Q@pW :@-<@0S $喂P" X( F>O-1MX@ $PR4 84S00 {040 < 0`[ @ 0SY $P ^ 0@0T @@P ⦼P  0000A}x  h  +  $0R  0CS$00 0caЍX( q> 0A-@T:8$R4 CSR [xc$!AT0WV0 $P ^  @S0/A,X( X0A-@T`D'L@PU pPUVX(@-@0SӁPl_ `0`@ X=L0p 04  X(G>ܵ(ص(>hE&>@-<@ 0S $墁P . X(>@-<@0S $十P X(= ?  @-o`O-aM0Sn [0p 0040S W00 p p 0@P 0 0+ @ TY    L  @PJ 0 [Y00W00S #P; 0 " 00 RQ' 0S0 W0P QP MP `0 P 000 ` ` "04Ѝ0  X(P??@-<@0S $PvX(=?C-d`M0S PHp0@T " !B(@PUЍX(O-M`P$ %!0@pDW% @Y 0 QPQP (0S0P P `!! P"(Ѝ ᾁЍOX(=?A-0@T `pP1AT  RQ( QP (0@ 00厁ጁX(=/@-p0M0PS`M 0/S PP ۍЍ(@P  pT ۍЍ@^uP 0$p0$!#!0 00 @ (+@B@X(A-P`@p娀TЍ000S$0S 0 0 0 00! !h<00S @X((dE&`E&\E&@-0@P@@0@ A R\ 1  S:0 ЍP`^P ppG-鸑M@TY `P!ApT 0S @T }~@PP 0P0 02QC CP5]" 0`! A*00!!QP I Vލ P ;   _P] $0 P  0%D 2(  X(GhE&s@@@@@1G- pWP `LY @ ~@P oP` iPAIGt@T P`P 5LP$X(ALA1Ad0A- @T`pH PATP @X(Qq@-0C\N @\N@N@N\*0000L000\:0L0 S  0 - R 0R$R:/A-0A R0.0L!MMDq` ^ 00B0/S$ 0! ,P0ڍЍ@*Q.P ?Q0C PP\P0PC0@0C0 0 ؙ P 0` T͙ P 04 $ T&A AAAp@-`0Sp@e\ 1e #@ PO000p 0A i00S  /x(0h-0^0 SQ 0QPx( Q#p@-0PSp  lP`0 r   H_ @Tp /AlE&Ap@-`@PpPP@pP 0 \4L0 C4/p00CS0  0 PE&B(B.BBx(A-`PpЍ8" :0J840K0CS 2  `>0 01 5  d (l} <tx @ |qp}  h=/ 0$  4 =CL2Q ! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$( (C-Z4,#0C@EMS$0 30S`` EߍJ(`J(J(J(@ ; 00$0$0<0 0 0ݍЍp$E x(p@-@k PP hp@@E@-0p-S0S( Pn@P#| 0M0` S0 \BPPP00T Ѝ@`gEE&-@-0@P   ֩O Ѝ@Ѝ/ᠶ(p@-@ATp@0 R PKVP ` `P`p蠶(-P@- 00|0 x0x 0 0 h@0S XV00L0L < ,喩$ V Ѝ@ Ѝ/Ե((((H&(Fp@-x@PlhPP XP p000S   pF%F('F8( -P7@- 000@ 0 0 0 P0S x[V00l0l h厔 X@TR{D 8傔0 EV Ѝ0@Ѝ/Ե((((&(FH&EF@- lkKFH&0@-MM@P@Mߍ00/SPPPtKPP p Tp  0RP 0RP \F`FdFiF 000/ᨶ(@-O )(FH&C-q`@$MT pphAPDG00CS0>@ Pp< @Y@DOoB0S@$Ѝ0P: S "P 60S lz pW U0圀 SHC@  0A@ GTӓ0 @00CS0,I0 ꨶ(FH&FF&O-PQAM }*$ptY0K9nPo 0) ggV0T)jpm]:y0 pz! 8 PQpY  :y0 pz! 8 P?pY  :y0 pz! 8 P-pY  :y0 pz! 8 P!  8PpY  !\8Py Z:v0P P! 8əPPV ` pꨶ( G@- 嘒㗏mGH& 0p@-@PT 0Q00S0P0T`00000www00CS000S p踷((A-pPd@d`0000SP'U`00CS0$00SAw긷(ض((p@-@PD`0S@'T`p QPض(G-,a000P50@ R'QS g\! 000CS000S 2 0` ㈐pDVG50lU0W00CS00 U 0`긷(ض(G(DPG&G0@-S R'Q ض(A-pP`V@ 9@P+Pp@-T<@P jDP0P 0@00aT:@pG(A-ppP`0005@&50 0!5000@0CS000SA긷((p@-P`@T PV 0@p@@-PG-a<0PU:"0S TP0@ T =PP0 TTZV00CS00 @T 0 00{Pp(GLG&GGPG&C-brP 00B Q W 2@0 @@000 D> @p2 l2 00pD4< "0@ Ѝ/R#RR@ :BQ&@ B&Q@0=S0  "?R|R& ~RR ^R X!000P00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 ꔷ(!l( H(|(NHGG0@- x(H0s@-0P`0X0`0@S P 0R@P@j  x P@b0S00S Z0ST P000 R  Ѝpx((@F&HH!lH@-AL ^`X sr^0 \   1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !~HHHIO-p`p됰P0@%Sy0V0&S T4m! i0 00 @ P@P@x(I@-0@!4Mp PT` 0 P@4Ѝ0@P S=WP@V P @0 F?P@$ P@* Ux(Ip@-@P0)Spx(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H  U! z! 0  @@P! 0  @PV`'T@@`@P, @ ⌍  x(KI"I0IIO-p`M8P젟찟t!@ p0 X@ 0DS'00^* PU @ 0 c 0DS00Y Ѝ` pUU x(HC-锐p`  0BS0p0@SP&! "0 00P@@@P@ Ѝx(G-`dP0@S! p0 00PP@x(@-@MP1`PLx0P  IR NRpp iPpEp@@0PS@ $1Ѝx(mIPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 PB2@2Sp0@<1PH0@P 0,&Q@)2I4F&0S @T H1 B@G8G1{G0S  1$ Iߍ0A 0 000 0 AP00CS0 0@ 0 00x0 >00CS0 0S GlGD0EGX00S d@00S ^ꬷ(@F&(LG&(MN( Nȷ((N(0@-$M00`o00 00^0SP4P @'000pV p&P 00S #Pl>8H0 p000CS0(00S ($Ѝ@F&(N(C-@?mM000@H0?_00?0,@0P@ '@P0o0`p00dp@Td0hP@0`o 0lP@T 00A0P0l $00`0S$='`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0F7S 'x0R8 @>0S900SE $.0000,0(00 0p(0 p  =&0S(7S%00S 0 0S= 8  h=, ip@ P 0 d= L8 P= ,=, R , 2,( /%P000<=0S :U0 0P@I/P  @J$ 0 $ R 0T@ =\<\|0<0\FhPU p`P,lUI0l PUY00CS00 E 0 ;EBT 00CS00 E 0@1`P 00G00CS00 E 0@G @PT 00CS00 E 0pF @P @P @P07:0P lPP@HPL: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP   7S 0C8#8S0PP)SS A708#8SAP0 Q A!Q8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  d8 @  (00(00@07004087<000L*P7 7H 00R{0( }>$0SP007dGQhI 0'000 000 x7 0p'0l'00$(0\7  10103/$0 6 F(7(' 6 ' TDL0S tJ8 6 6 @ R[ 4 0  V $"Dp&@00CS0 7hP60S ⼏P l60S%,0+S5H6$58 h0 -K5,,0( n0000*,0( #0\E$0(0S,+ $ L5 T50S O5,0S pwt;%0 50S =0 @0 @P$ET=0 0<0$0 0C0 000lD000d4 8\XO00CS0440S 6P( T40S)T0SXOI8 3 3 3 \ 4 03)ß00:d3 0 0S '|0R#C#0 0 x3 Bph|J00S0TN0"0C0000OoI8 2  t2  p2 \ 2 )Ÿ00 0X2 T0S8"00CS0 2 R   01D0Ss$mߍ:10S r0(!SS}1 08 L0H@Is10@0@0S L1 @0S1 01$ @0S  1@0sD1 R#0S,1   B  @0S @0S7S@<e 0 00S !9:T@,0S0  <,0Sh@3 D 0,0 0H 0((ȷ(((@F&((N((((LG&̯,N\hG&((-H&PG&8G&TG&2N((!(( DN`B cNE@T(0Sp0 t0,0 0v,.s)DlFG0/ȷ(0 /ȷ(0 /Է(0/Է( 0  /ȷ(P@-@_'P@<0 QP cR   eNȷ(0 S0/ȷ(0@-0M0/0@0P P 0: Sl  S` PЍ0P0 : S# PP(wNNNp@-Px@x`M$PL*00S #0`00``00!`=+#$Ѝpȷ((@-h@P$0&0 RP   BQ   ȷ(//C-LM *8₎8 p@<(P@0` D40 `G 0KBLЍMPG&A-@P`pWU La>" 00'p((O-pWA R``%` P0S:S SE@ @0S(W@  @0T/S/00ld0p0 R00P R:R:RPPPV@DO!"4F&0DS(NA- 1@PM`Rk01000  ;p!XZU pdA@A Q X;AT9AQ@UA 08AS 00CS00 @ 0* 00CS00 @ 0 ЍQ A(AU P000K @00CS0T00S D@@80N(NOO!OPG&$O((.O4O8Op@-P@@Pp 0S%SpP @rp@-P8@Pp 0RPp@q- @0@ R0S P P\ 0E&(G-`P@唀0吐00|Up00CS0h00SG:0S0 S 0S00aPPp긷((E&(A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @$P`0W:SP0R@('E&VOA-`P倀000|Vp00CS0T00SA0Sp00K=a@T`긷(((0A-pPS R+X`a@T"W p000q0 @0 0 hb00CS0H00S `P `@(((p@-P$@Pp0P0@q@-L@000@00 `00CS000S@W긷(((O-PM/`@ 0P @@@k (⾄P00š0 U0S Q0S M000V#   P@ 7P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @l 0|@?00Ѝ H" R," R8pP B0000S R  pbcQ  0X/R0XZp Q#P pP tG#P R  R (P0 * R; R 6K0@@D P R  P@0000S R    BR 9D R5 G3 P(^OE&(LG&O(VOgO@$Ѝb@DT@ P  p R  U 01W VYXU' [1 00al 0aS v00@0S v P >W 00SY0 0 S0 P 0< S0XON((NPG&O(E&Np@-`P0000S S@eI000 00 00000CS0p00Spp@`긷((0@-x@M0 0000\0P>00 I 00CS0$00S Ѝ0@?Ѝ0踷(@F&(@-yP 0S"IO-`pP@Md%%P0cS @@ <=pPp vPP VP@ 0 RNcS @ :$0S2UA ̲P0PPF UB8= DP9 1=@O=T( 00S$ dB00CS00 < 0 U= 0R PU E=0@ T  Ѝ<@W P` 1000  `@`P1V>0/PW1  *[ZU<oPU<U~{`<U Ut Uh UX<OOO(OP^LPZP3PPG&7PjP(NpPuP{PPPPO- M$B$Rp0@0`V% VV:V  V /V   BR <` F R  Ѝx! R  \a[  k0000S(@@PTP@ @T ~p [ /R0/SI0STW 0 BR  R  BR    BR  %  X0$000CS0H00S 0S 0Pꄸ(((p@-@ PTp 0@ @@ꄸ(G-` 00 SQA0P ؀p R  R+  R B@ R @ S  S =RR U P   40P  PP!l0G-p@ Mo ࠀoF0P (oCav000e U00SW-00E@`PIPE@T Ѝ00CS0@gfff(O- RPP0I-S`pM Sv! C R ?Sn @Sx 00C Sg0 0 Q`0S[ 00S=SVVD90 Q89 RM0aF1P 000X00S~ph& ~phX 00S8 0 0CS00CS00 p00CS0 0 00 `p8pplXWPQ0S 00CS00  `8IЍ877 0000  Q 7嬇 pR g( 0S 0 0S-00CS00 w 00CS00 v 0S 00CS0\0 00w0000v00~* 0S 00CS050 00 0 0CS00CS00 00CS0 0 00 00S00~00 0  00 0  00w0000yXyw X5x`0H00S 0 0`G`SHQ  D0C 0 =[P   00CS00=00~ 00AS Q10 R 00 SQ000CS0 0 00 00~00 0 000003c 030PpT3X H0S 0 Y~h 00S0S W Y 0 0CS 00CS0h0 ~ 00CS0d0 p0 0CS00CS00 00CS0 0 00 00~00 0  00U 00 S00CS00 00CS0 0 00 00So00~00i 0  00`00~00Z00ppU00~00O 0  00U 00 S00CS00 p00CS0 0 00 00S%00~00 0  00ꄸ(P(((%n[[@F&((0F& @D%05 @AQ+TK[X H0h0` Y84 0 @0B L    R1 @@9!@@5m\4T\$  0 Y00@@S@$D0[0<00 S 0[0 0 @R# R@@ @ #$Q 3 @P @P$8#~@P#K P @P"~00@P"|b'TB P%U 000S  0HŸ$pAQmUx RA00CS0,0 a0 H000P  00B 0C 000PT1 L10A+Y00000U> 0y1 GR600#S00 B00+S0p0 G0 B0 T,Ѝp U   p  R00SPhTs!l((00V00CS000S *0S @pWZ00萠y@ 00 ZHꙂ! P00 R @(((@F&A-`!@S1p@!P HJ%Tp1@WV2 `1N0SN U 0S0PlPkV 1PHpoJ J#G#060S$ @#=#:#V=%:%U 0S fPPj\jP L WT 0 Vꌾ((((@F&E&+ST08 N R S  0S  P `@F&O-`R0pMxB0 pP P Ѝy0S0S "0@0000 0!P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 咺* S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S \  @Vz   B/oZ"  "0 ((((@F&LG&( G-pPK@P EP1N0St `FG@UkT @Qk'GpEI `㜠@0S0S 0S0S.`@Y 0 X 000 8@F&E&j+S(A-@q PPT0P 0S slP@ pP@ ZP@rt06 R0S@@PX` p9 0 P mT(T@F&PG&O-`s$M, PPY30oV &P *P |4nU pUV `,`L3 R ZP$Ѝ 3P\!ZpP'0?oQ20S P VP   Q6ZP@@=Y pW  pP 02 QY QuVP  H(160SG\  \@ /o"/ S [ #(\@ Q 0p0Z#Pu@T R *  W R "0PS  R 0 S0C 0 ` 0 R00YXcX `Z^ R[00V( U(U&UT(@F&2Up@-Ph@\a000 R 0S 81Ep /G!50S 0 00E1  S h00P0  D@ RQ D@@@Q00R00S 0S|00CS0000S p踷(E&+S(5rO(<1p@-Q00@S#$P`0SP00CS00 # 0 $0Ep 7G.!#PlP000V0@0CS0800S xp(8THTTPG&E&+SS((@-j @ 007T(@-@ _ @7Tp@-`@0 0 p 0Qp\ PU#00p(5UO- 0DRDb@U 0S 4@Up@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 p(@F&A-0P@`Tp R@ 0N@T P 0S@@eW\0HU 000000V0@ 茾(@F&E&A-P`pNp P@ 0 AD$0 VO-PP 0rM00S _o1С R100 0000 S @PЍ~0SF  0 Q S/R C8fP Q 000S* 1Q@ `` R:RV@"00S @C @00CS00 } 0 ( @0 RH @ 00 (P(((d(Z((V4F&(6VLG&PV@-0@PVp@-P^@\BpA-@P0PS`~Up~0000 p 000CS0h00S g0p000000C000CS000S T4F&((P @-(;c= 00C00/V4F&00  0 00   /4F&(p@-@tPt`0000S0 000D0 00CS0p,00Spp@00@긷(4F&((@-D@ 00040 00CS000S@긷(((G-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SG E  P0)` 0`00긷((4F&(T 000@0A00CS0/00S/긷(4F&(p@-$@P0 0C0C0p4F&(p@-(P(`@0@D00C0p4F&(( A00C 00 0C0/4F&(-A-@P(MHp@`DpPVP u rT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@@0 P pV O-D4o@@k1000S P 10 A0 SFp!倁V@0  R0 0C0800030 000CS010S)0@0 0 0 0 02 P B1 0R zz0u`@0PEPUZJߍ200CS0`bR \{00$G&(0!Qp R00C0@R 1 00C0v000`@F0"0 !0`0C0w001 0`0C0v0(PA(P0@0C0y00 0"!0C"  0 0L$2  `!!J00pS 21 냐`00C0@50 0C0  00S 00C002  B )Pp( "1@0C8#8S10`0C0x0000C0p0 e00S210"QQ 21Sx0pW 0 l0 m00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP2>P0 |P!000P$@B 0Ѝ@PE0 ,  s0P* 0&P00 0<P_ >P &P 00p0pr0((0 @ -P 0(0  p 00@ 0F$G&E&'o1|0000WPI@1| 1Q @@00< dv 0S $Q. 4QG Q ,4  8000<  ,000 0 0 f0 0 0 S00aߍ0  p0 `0 MH0 D0 H00S9WS,0 0ꬷ(@F&($G&'o P0, RP 000@ 00 00 R, RP3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 `00_`0 SljP X0 R   L000`0S0 R Ӻ000P 0 R000> 0  P 0@S P 000| E`@`#0P00`g P0.    00PU# T 0S "0@P0@00S0P0S0S 000@Ѝ$00pr$G&(]F`\`(G&@F&A-Q@`pQ` @ 0p P0 0W@ 0q R$@@`HR ( X% R"p0 `4 P */囹`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0$G&E&_`~` A-P@0 P/ 000 `P s000p0l@`g`@@P 0`0 U000 TPPe``0SU QP$G&@F&`p@-@|PP 0 @hP P 00000Sp ϼpp$G&`  P/0S/80 P/0S Q/0(A-@Pp`00p` P@-` |NP嘼0@ pT@< PP  M Ѝ E@PM   Na0G& 0P/(RQA-pP`%*NVU``P``V@ UM`0 R@NP P1, 06@M0 0G&aaA-`P@xpT@Q00C0U U l*@P0 PM(p@-X@X`0P0000N*00CS0p00Spp@˻긷(((p@-`H0@TpV@PU PLP(|0p@- PR QP@ L0 bP `L7, 嶻p0G&bp@-@pP0 S00C T  DLP 0SL,0O@dA T @0@p@0G&gfff(p@-`P0 Sڜ S  L@P t0 R@U Lpg0S 0 S jL@Y0S ((0G&p@-P @0Pp 0  0p(@0@-@ P  R )@LL0( 0 P/ R/(C-(P0 U0M0000p#0C@S0` L@P @2@u   V  L L2 R@Ud2T /o"Rm Kh`0"0K@P2V0S' `Kp@! NMpPKP 1 . 0: SK00``!l`P!` `V'oPP "+ 0堺 V U0S00! 0 "1P @+ 0K00CS000S WЍ@rGT  0P_* 8X긷(a(,b0G&@F& b ?b(cbRp@-@`PP Vp * x@?KpPV +4KpV !* 0P0 pbbpG-` PppW@  NPA p0S T Y  <G8  t20@ ,V  H&T 0S @V@ PPG&pcucccxc}cp@-P  @Jp R  Jp d0 Rp  Jp Jp Jp婹(0G&cp@-@PpD0 0RPPp03/JPp(O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P ) LKJPs:PP jT EJ0SX jPS.JP0000 Sm\1 0R  JpP0C S )  Q JPP 0S( IPP0 RPU I0 600CS0p00S T0 00`Y0S((hG&PG&LG&|(c(c0G&(O-P0@l#lcMhsP P00P#0p,`U4@D\T(Sh 0Ta000pW` ,@p00S0S7P0SV0SS0sS vS yUPp0+S -S Tk  <Q, R: tP  1  u(PT 0 @0SA0MЍUF p p0      "TR  00( r   %5S Ipx( 0Hp0Y0 M I 0H -H&-cc|(((dccbdcPG&LdlddA-PQT 00CSPDq12SK R@ 0`0CS00 `0120<S R 0q0S 0CS>S RSxh R 00CS0N0 - adddp@-@a0TP R R R& 1S# 0 LPpR!Q QT " "D0600S0T0S 00S0(((@F&@-@P @&PPP3e@-@P UQP0  ? =e$(8eQp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `@eCeA-@|P|p0`00 T 0000CS0H00SA衶0S 00S %@긷(((L P0  /Q Q0 S//(@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: :p3 0S$ UEop' W`RUP0@D>T000 0 400 GTPx0N R T  DR 60SЍQ Q2 1 @$ ((@F&(PO-@`P3P p-P (P0@DpSppTPA TP@DP:P5@<P, (4  @P@sSa0S 000$T $00CS030S @@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 @`1 R B#T` F00CS0400S EeMePeHe8ePG&Ke(((Se]eCeaeleueLG&fze fG-PPE o@0p` TUG0S 00S 0@0@000CS0 00S y@((((p@-H@P02`S@20CSpV02p(40T0P?o20S 0S//(C-p@`1010r!Q0@S10C1 ЍqXPU X2oP"bP 0S e((?0!!R/P/(p@-8P\2Sp@\Bp(0-MM01`"R !R X"R   1 1d"1!d2S ,LPl1, ,LP L!0,00K@P$1, k@T0diF`0P, U @T 0S P埶00CS0 ! SEI00 0$0(00D>S 00 D1FD"!031(((( 0@-`"dy(p@-L@n'Pȯ0PPp0C/U00p$fp@-T@TP0 0P0 !0 0000CS0p00Spp@G긷(8G&(A-@R`P`p *D0PPEUp WDA0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000U0 000CS0h00S sDP`000B0 0C0(((p@-@P@0SH00Spp@00CS00  8G&08G&08G&@-@hPDz!Ѝkf-@-   Ѝ Ѝ/-@- 0  ЍЍ/8G& -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`ẮP$ 0S! l嵤0S00CS0?0 "  v00CS000 " 0S /pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' f$f8G&0Q8G&@-@08G&@-0rS˱ff0G-p0 P0R(0帐@0=00=``F@VPpPER000 S=S B`` R`ĥ`PG苜@P Mߍ0D>P@D 0RQH0PP00@-MMP +>P Mߍ0#>P@D0 SPH0PP00@-MMP  >P Mߍ0>P 0RP 0RPA-@`>PI0 0SC P=UA =PPPp=PJ! 0RA@- 0-RS# 0S0 00t_2 Ѝ0SX0 0P0S00 040,sP$TiiDj\jLi0@-0P!S@M0SPЍ0Pi 0SfPUo U U U z=P7 Po8_=PL1PEU@P b  P  P  P  P  P  P P   p0St00@H=T @<0(S0)S0 0hp@-@`P9Pn 0Sk0 "0CSe0ıo pάPᷱᲱPQ`@MTVF@`BVT;`@7V@0`@,P%`@!P`@V@He 0S p0!Sp(S0)S0Sopip@-@PBPPE<P*0U%P0opMpp0\0!S@p  p(S0)S0S p_jajcj"imj@-/0jLG&@-$0$0 00 ש(LG& k@- @ì R1P\ * ߩЍkO-`@HMJVPpF0-S0lSB 4S -Sx `GC@Px2 000G @PmpGW 妰Pi TT2Hn`0%SbPP`復pW 3sS0S`3pV`/ 孩0SpFPPW1 000 @P@@T`[Cp qCP bx@1lO@P B@PPU0St@3CpWpGh0 0   0PV 0S  P1r0*Q0S lQ0@ ]>~9pXu0 Zp 9lkT&kkkkkkPG&kk0@-DM%0   0@@DPU$9@0 [1  ( $  );PP@E L,  YDЍ0=ȤP 꼸((,D/ss|G&sssp@-鐩00S 0| 0x 0p0p p@0   PU P@P0P H0H P p PpT갷(((($G&(hG&PG&8G&LG&TG&p@-@㖟0@Ar 0 0@0PU@EO000nA d0 R 00CS0H00S p@@C0PC(0F&(@F&(0((P/p@-@PTp000@A-@P`pT0   S*0 @A 嗭0000   冭0000@ ^t&t00C \ /p@-@P P0`@  0!S00 0 000@0pO0 0  0 000 00 3  0 000 ^tBt0@-@PM  0  U  0P 000 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /}P/z 000/ ( 0P00/ (A-@pP 0` V  V @00CS00  0@ 000CS00  0` (PG&A-`@pxT [TP'T TG "T R( x1 p\0DS0@@7T/T@ 0`00CQPRA`ET@@0P0  aCQBW0CACQ70C00CP@V `R| ``0 \@RTئ 80 @ @ @ @ @ @_u (tT&u4u@-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0 (T&0 0T(}uLG&p@-0S @0AA^00p0@S tPP0 0CC``L00p"Pp0`0PPEfEQ0 :00p (uuu v@-P0`V) 00Ʊ  K0 0@00p 0 AdA0@0T0 A$A00 Ѝ (T&v`v@- P@pDF `=0P h@ 0\AḀ00 ЍV@@T @ 0AAϥ (vu@-`0@T/ 0'R"R0PP Ѝ@T Pb p+0BP d0000 0 A@A៥00 Ѝ,pP (T&vG-ߪ`@V@TP L傥0@`0pF ,/0p@P0 (v8(0O-ph,M0X0d8P P1@01%:Pp PE@ LP Xp (p80PEAU,Ѝ0  000P@`V7 0S 0S\V $h7P00CS00 87 0$ %V0%S@700CS00 y6 0P`y0p*S`p0.S0@*S@pZdX^`p@Xp@0xZ0WZ%Zq A0J R %X0J S00%S00;됅\P  TP \S \0t\ s00vG t 0 D\ \LQ b '\ \\ "\  \M \^0? \^0@-000fnrtvaet >P0030  C 1 01렓`P .d` P ( db  Pd  xps0 v0 t 0 8jp B$`0 0@  0 Xt0  O#l cZv t0 O D"0P 00t W 1|j  1v t  j 0et 0^p0P $0'S"S ^X0S' L v t  {;$0$0 $  0g't 0` v t   0t 0NVBT0 H8 (PG&vH&vvvwttuT&w8(tw'w 0C- 0`qMP` Pp )@P 0 0p)@PC 0p W ) PuY <YP0P( 0ES ; P  00S00H l{^YPH0?S0 -S00H0,Ѝ@"4wxHxjxpxxxxx7@-0@0 0 Xz+TPQ Po , Ѝ0@k+00 f+ Pcy4wyyA-p:㇞P008X@P3 0S0 =uPP X00 f`cVtWP 00 `8iVPLP 00 8EP( bf 0$00SЍlV3P 0 0oV)P 00 "P ?f 0(0 Q 0SP00CSD )f0 0 0Syyyyy4wyyyyyz0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 /@0D 9K<@0(080$00= 0D00<00,0/+$@忨0@-0$ 0d8 Ѝ@-@4000@-@4߿000@-@(0(S00 030,0Ѝ`t p@-@W2PPg@8><<@:GPD[`6U2\0`, 862`Q2V0,0p z@-@4坿80,0@-@4哿80,0&1*z@-8+@)* z( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ r3P mW Ѝt$z@-e3P`Wnt -z@-Z3PUWot 7zp@-0MP`0@-S00(00P0 0  P'P 0( RT  0 0 S40(03/Ѝpp'@zH{]{A-@`PpQP-U@QἧP00  P᭧P0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp||}~p@-$@P0S )00Pp(Q+  0 BR@- ( M| 0- BS^0@Q ^ 40 ? 0 C  / /((p@-hP@`V P)p该`HV4),)(0( #&O-M`pAPU d (TP L (XP 8 (PW $ (PU ( P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WUP8:TU P J(bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU P0U(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?P,s0SSUA ⻵t⹵<ST[ TZ TY TX TW TUx tThh BPUbЍ0i0d,"O& @T   Q ! @&0P녡t0 ! P4& UP NP pꋂЂ݂,5+3*298A@FGMNTU\]demnvwŁƁ́́ԁӁفځ%&-4< :BCJ4w R[SZabijqrz{%@- &#1H&@-000 SA 0&#(H&s@-@`000 #S@rP0S  0eS00S 0 USЍpor0S/#Sp@-@,P$p0P 00p(@-PRP@ p`:p 0R" Ѝ襨0"S0SO 00SS  00@OT&@-T刑PL0  p@0"SRЍh(x@-TmPL0 p@d0"SRЍ藅(p@-h@P0S 0S 0SS <<@ U   S1000P 0p(Ʌp@-Px@Q dRaP L0   P    pp@ @(0@-@PPM 0SLD00Ѝ000 0@P0 0 (O-Pp`HM 0S4;$ , P 0S GߍP? 0Q 0S @q  R R@  R@[T WpU: 0S  @9/PV?`0(/EUf@-匧0S S S8 4 ЍS$ ЍiCk7@-lP$ R\Q;@ Hq$0S p (Q Q Ѝ0((ۊp@-@P 0Sp@凍0PS 0P000Sp:@-P@@ D`DHp0S!00 $ HH&C-P`PM 0S00(p/p0 IP" /Q0`@ p0@9P T0p /PH$0@@ 00Ѝ ((O-Ppr0en `$ TRP2!&$828B( $|$, x$0 t$8 p$4 l$#4尀DR D "b$ 4S [$ 4S T$ 4S hM$ 4S hLF$ P0S P0?$ T0S 88$,@8Y  ЍO\0S0 a`` 0$ 0 $0TS !S1d7  ` $0TS:3  0Th $# 0#@h&HXBBXh(G-Q| ,@QhP0QP 4QP<PQ(80S,00 80<0S804 <0P;PP;P1 QB"8`8X0apSp R p <0RXP 00< S4P0S9`(Q (Q @P0S0 BS `a 0h0S  0 S* 0Q*da 8Zꁍƍ%(g59fO-;$M p*~bP 0$S  ߍS IP@0T[D@P 00뉔 40ਛR YSA ("$0f0Qjf/ 3,2!S1Q% RR  0ܡ!,21S 1b"!b$!R! R,"b"!4b4# 0C?o2S  0 |pp`1R8 R,2 @P0 000(4"48#8 R* 0S 0p P 0S 0 p1So   @!1S  f/ ΰ01T T%H ((VEW}}WEVۏDot(&A-P@`#Pp %R 0R000005S P vL $0f0Q ,N( (((p@-0@tP  P$p@@L0@-0S ,(@-P + (O-@:`MЪM 00@ 0PG  P00 0S`p :bPP(T @00400SPP(P@P+U0P (P X p9 0,09P,0S  ,02P P pGGqrlPd,- XPPyR H, $\P0R,0S  S;ʑ 0;l(p|P,00 uP ,00,0PU 0S,00edP,00   @ 00,0P, 1\  88 s@2P(U@ 0SX;U0PW(P (-⚞P ( ⑞ P0(P0,0P,0S ++RP0 0 D-v P0(0,0}P,0T0 0 ;` P 0(0,0gP,0`0 LO P 0(0,0VP,0X0 \> P 0(0,0EP,0\0 f-P t(P 0 (P0,0.P,0d0 P  (Pd50,0P,07  P (P 50,0 P,07 v, P(P40,0P,07u 0 w@y4 ۝ P (P40,0P,07^ 4ɝ P 0(P0,0P,0x0L H4"ⷝ P 0(P0,0P,0|0: PaE0 S0S  XL0Y:3 QYڤ0 q&0H 062|sT(0S1  -(PG 2X( H3"00(00SH # 3  0 R L0( 2000"0,0 0 0,0aP H@, !X Ȁ˕O 10 ,00 (0 RS P  (0,S 喜@pݍЍ[ $0唛0 $0 QP P~P$01 0CH 2Ȁ|00S (0X H0S~81X{ 咬0S0 (0 RS Pf  (0,S = (0SUt x R(:Đɐѐ+(M\ (x((>(8̌T&Ȍ@-`0pCPU V  P;@P hF Ѝ`P!O 00ŏ0@V̌:$00S '@-200G&p@-@5S4 0PSP p@*Pp0S 5S 1S K|Pp5S T \Pp< HPp(( PpqK((hL"edArdA@7@-1AP(000(;_5 S* 5S( P̠0S Ƞ0S005S | PlQh0hPH5S Ѝ0< <mP0WEV(fdQmdbG&t[(gds@-@P f/㓟@( 0 LG&(md0S/!  -3@-P%T iP 0S S@@ ^P@Ѝ0@ Ѝ/&@-0@Q7@`b _ @G&@-t@t0MQ C  P0cS CS SS ,sS00ۍ0((0@-MM@` PP 00YSP ,ۍЍ0qPQas 0 6t(&@-@M0 yP ۍ聜@-@ 0@ t(&t(@-YMM@p p\?YލЍ<0< S <fGP10YS<0<0rdAڜ@-PM`pN@(NNNN`8 NZON GЍ@-P0@ 0$S0S2 0`Sp( TQBQC0AQN410S 8@0  000! S0c0A Rjh Ѝ8M 0P 0P`(pM 0MQ \0P P0 <0P 00 $0P 0(̛@@-\@\0MQ C  P 0nS00 yS 0*تۍ(\P `00CS`0p S00 P0S X0X /X(&C-` 0pP0 9@P aIpG劘T@ U @ 0@FHcPFdp 0l Q V gPU PP pX Ѝ蕝<^&O-PM Mpe$u咯0@S0#1! p+ P 岙P4 qC4q`C6P%`0 dp  P  ^((p P  DVP 3\[᮰P-08( p P  DVP t3A:0(0d3[`C, Tp P  DmVP ~$0,00 p P  DYVP 20008 zp P  DDVP t2A0804 hep P 4 D/VP 2A040< Ppq P  DVP 1~0<0$;p\ P  DVP 04$'pH P < DUP P04@$4p3 P  DUP 04P p P  DUP 0P0T P P DUP |m0T0ۍ Ѝ襝t(&)Vi@#gҟ4TtԠO-MM@У p PS `V2!0S 0`S3 P`P 8aEbXp`0Ep8ġP_00 "S0#1l%Bp P( B1P0 "  ᨖ P0S  3/ PB 0 P 0'`0Rx%d.BSp P !4SE 4`SBs3 4`P=2a0C" 20< S :B0"SBx5`|%.B$pj P* x5<  BB0qptB Y0x5< 0RDB 0BQ<0P Bx| xP 0 000S- P0`p(V& R s S 0 0p0 0`P TUލЍ.@AG&).e ͢vt(&( - BR0 R Up@-P@a R! hr 00 2X0 x,X0 d&X0 P  k( <, 0,a0 $8 4 < $#$,$<$K|P ]xT }t0p 2Q0S*X`?\PQ PbV@ոp@苍ꨥ$0=DOT]o]aO-pᔀ 2MSR R@`aK 8QH ,[E 0嵖0 ᯖ  0@`"  8 堖,  ᙖ `@0"   0 !R!!' 0S 0C R^!S[0    0A€8QI ǕP <0P+8RQ* 8 0A0௕ @2<0P+88Q *ЍO&0 0 0 0l `8 7 ЍOWЍdm {8w9J]A-@T`Pp(z`8SA行 0`ꌨ 0`( "4`#/A-P@ 4"40 4"40 ◙ ⓙ((,,004488<$<4"44$D4"44$D4"44$P4"44$`4"44$p4"44PTTXlXQl`pW(4"48(4"48P`0@`V@  |0TP0A0T0A T4"40A(@-@l40Pm08f/WEV@-@LP TP8#!00Q@mWEV(80@-0@S B08f/l( 0\ P0//@-魙D0 <440@ R~ 0y4H&k8H&P7@-@ PTP0 08P8 0( p0 !D Ѝ0苪(vd0@?o2P0S@- p`P弔@P 巔P 岔P 孔P@V@l夔PH@T@T p0 4C@@ Ѝ蘪(ud0@-PM zdP@` p DC 0 4O00+ +GЍ0(zd@Ȫs@-Q p C0  +0 %@0`D   _0   0  0  0   Ѝp(td@-( p@-@PM`P㑗 Zp  ( V V dPЍp (ՃH( ?p ,8C 0(}d(@-~d(5G0@-PM @ 崃P 8C4P 0p0 CЍ0U({dЀA-`0@Pp!匁0M00x!ep0SP@XBT p  8BeP qP p`(,0Q 0$0S* @P BQVUW V 0嵆0( e_PR0cBt00(0S0Ѝ00* *  1`@-H&(|dɬ(v@-P$M 9@P p pBO-PMM @ P4J0?}=@?hPpd, GIp L-0G_o0V ?/0??SڍЍ!!G Ё!N! (P`FВP Bp B@PhRPpGppV j?`: S TT 320?}=?,0GOOO0 p   X.? 0??SpP(  0`Q0@@^|p |UT ! h M` !R0#@(=P(pA (GH@ @ ؀0\  ` 4 ;$Ԍ0sp 0|s`l, PTTĢP݈i(wdnxd ǭ̭H&7Pj&A-PM  @P X P 8AA  0`0PS 0"S U1r0%*V  0p0S wx00 "R00S p APdPd `尀pp0 8A0Ѝ蛮î 'AY(ydsC-p`@P Q |@ᒑPd@ R; E2p 0@03/ ЍCW8H&( 0@- @(P7@- ^P@X`P H0ZP400 p Ѝ0褯(wdP7@- <4P@, p Ѝ0(d@@-ؕ(0   뷰H&O-` ,M@PpP噔0T 0$0X,Ѝ  UpP@$ P  Fp $0 S T@0,0 0$0S xtYV   pW 0  @D|p@-@P0P& 0P+ 8>0P  ?0P 0P!P0@p@7p@ 0tr@`lp@U@< Pptcidyaraұrbmngnts±ȱ˱0D S/ 3C5C$1 4! 8<0/(0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@( 213/P/(A-PT0p(,`@,0T@@DA?@?@@(?0@-0@0 (20,2010P!P30(> 0R//G-`0(,Bp P Eď@PPW ,20CS(20CS G0(p@-@`42SM%^ w E 82<"@p 0(2,"iЍp@db<"82Ep`@hT,"(20IX"\mЍp@C(I& "Bs@-P`   0SЍp00S@0"S1Ds@-$M@ṍ80́k $0 0뤳H&A-`P 0p @Tʬ_> /,s 0d  ? ࢉqp  RЍAL`0S`@D@, ЍI&(A-@0@ @`pPpd1ČL0\ D0d^\^ 0)U(Gp@-4@P0S( 60B1p(O-PTM0x 00$03p  @8 到A ⌠e00,< (0,0S9 3,(23`AX 0$4 0Ԍ40D@ ?ʌ 0Č  0p 弌@ D00 Cd#%P 2= $00<p /( ` RL` $R0 S 200#1-R0% XLL`P@L>y,0P00S (2 yP! 2 yP 1  yP' (徝0L00 SE a⊌0g2(08 hE%KU`1W?D!C$5\"0?P@1\"R@ x @XRx  X20P@x0 0X20UP@x0 0X20UP@`L` 0U$0000[ 00S  0(0$0 00 /P @TЍ P @{(I&(&ԸT&-7@-@q00CS0 JP Pp pp<0 P00CS08J0 Y@o Ѝ0@Ѝ/&3ܸO-a0 p<Pp/B$0e@O 0qp Ѝ  R ЍOt`0S 0 ʇqp `BE, 0S I&9(p@-@P2S 0p`n/(2ߐ1!41#41U &"U 80U p@@PC @‐@Tp((((G-r@,+`P 7<` VPmYTLE J$w,TU 0V!U ! [E@s_Ps ⎐X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@s000(QA-\P@PAds 2F1 t B B$=w00C0(O-Q40 ЍQ^H DaXR XD 00!R 0:80Ԣ #ZppWPPUJ U @DQ ČUȌ̌X L X0P0Z 80S yq \(O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y P:Y200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$v00C0@@PAy`d1S  P0 148<   00P2S. Y  a14a8a<0#d1a#h# Ѝ0P0!!1 I&(md(ѻ((O-MH`LPrQPߍOo AʁDHLQP0@0Pd5 0X0 0HP28! 0 0@.J 0) 5RS 0?8o 4"RNX2 PDT- X )  0Q Q5HL $  2S !1?  !< $0 7 !1?  !< #0*  1SQ" R@ʉߍ@ x QS.82SbV<#  8pp  000"  0p `!V0 002Rڐ"  p"h2R Ci0.I 벍9 0 0b1 RS  0Q1R 0.J  6 2S0[ 0"P- x1R Ci0.J ?X0 2S2S0  Q20S*F0)S  q b0)S  i 0#R00S ] ꠠ0 %d0--C B O   0S;'!@P@7($(I& U&C-M4RUP@P@\Ѝ(0PPB1P@P`a`aTS HЍC  0 S 0(00 ,00(  ,  0 0- 0@PT0P`  0W0S ,8p@00W(0pS,0@0 n 000 W 0S7X\"0SR ㈀ 00RX0p@0 0@p4` 0S 00 0 00p4$WP2 S2S0  5  @ `( (0 S 6! R0U0@`^1S  0R01A!D1H1L1@4!8!<@l21S  "/0.0010T0 3`2044`5 8<0 T @`@ H2(0L2,00800 S- 1S* ( U000P,  00SU0!14!8!<!14!8!<U(P,`)(,00L000D(p0 S( 21S$ / .0,40 81 <U ( S  PU 32 $45(, U\(00,0p@ `0 0 000pS0 S00 000p =P  `V[7 0pp  0S (0S 0s X2 0 RS   0g04o$$00D#$0 #(#< 0'4 0'80'< 0 0` p?0 @92Sg BT0hP_ 00 q01<A 0@@Gp,2`0C 0@0@ e(2 00 0? @0@X00`Fa ?0?` 1`<A` 0@@+A,2`0C 0@0@;6(2 00 @0@? G*`Fa?`?``0SU 802S,P@O @TMJ041SO(o(C-DBp42MfS,DP42S 0PHU42S 0S -P10C0 42RSfvP:42S]1!$1(1,ЍCP0S` SLF` d0 4r兄W2S 4`p` ؀0_P$"PR S0SЍCє@ D0ЍCSP 0Ѝ(q(%>HA-@T2 @PP P P@ `p@T 00S p`V@PD00S @@ڃ@P()$I&A-Pp`@000 0@@@A-@pT` 63PP 0@ #@@C-M M04((P@  ThT 參P'PLD(∃000,4P@(@P 0UL4 4sH` PF4 4@P4S@@04@4T@0F0!p|`P;$P$ $0 1 <30 P<(00S#|0 `C60p0U9  p@9 PB 4 R 4Q\N<(00PS<(0 0@܍ Ѝ0HSʈtP0S -Sq@`a= xP00@@4P14 R 4$A0!DQP ܂@800  0 R00S& (@10HQ4A<00C04!4 :C$ |1낇0S0S{0S 0S C  0S C C C  ,'ZPl4#i P PSd   85()(I&  (0/)0/)0/)-@-   H&G-P`p@0S " 0S X| U TY0S 0S͆@ )-3-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  v@-@M Mq` @ PxPݍ Ѝ\!r p@P=0D@rO P0: S0RP00 0A#PP  P81: S P% S  R  rS#PPl+PPPU rPP$0@P)cet,)@-<0P  0 00$Ѝ  ,)0@-4S 3/ )@-0 @(  0$姅@)@- @]㚅㗅@@-p PL`@@0 7/P0 S Ѝ ]00)O- MM0|6@  @  @ 0p$000 (0#+P=,@  ܍Ѝ 03/0P00   PP- @$0PS (0S W0SU SU ppV000,0;!p` ,0 p  750@0Y0C @4 `V+` 0  0 000l4   ` `  Y!  00 0 ,0cP,0 0S `dP8 pW `V|,p@P ZC Wp` Y40S5 #  @ 0 0 %00Q00R00S  000 x 0 S   Z0% 000 0@@0 00R0C0r V B G SE SB `V` 0S 0S_ *@U 000 @`PP\; K/T=xbPP05?P$, 5P0h00h00U U0@IP0U*0RPd0x1ST0x!<P %4xQP0%8%\0 P0PEd0U03:T@Rt%P Pt!dx1Zb" :0 0t12P0P0$00`P P014 (40PI 02S0P0 S0 $ U 00 ` 0J000 000 000 (@ D00S8 0(00_n800 QP40(R(0 aPI ))3\y1VUN5G- p@r W pPe\aPP \Pp $PK/vD08QP0Q:" 0PS00  Q pzxPh`P 80"8 R 00 05 !$w)t6 dp@-@5%SQ%5 %SPQ %UU=;QQp  0 0Q0 Q 0)A-lP`5p@ @ 0% Ņs@ŕ\)O-POMprP b5S5圢@TEOߍt rP@ ET PT 5d 50 ! S$5"R$%P0S4duP  RR @`0d B2" 0m JQP d =d0P Eh0K/0h0 u0 000310 00 000T0 Cl(%,5QP Dd d0Pa)$)@-@ P =0 5)0/$)0/$)0/$)-@-  9  FH&G-P`pv@0S  0S X| XU )TY0S i0Sqv@ I$)$*-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!r;p@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPl#PPPU r PP$0@P$)Z\k $){@-[,0P  0 00$Ѝ   ()0@-4S 3/ X$)@-u0 @( 0$Kuu@$)@-u@M>u;uu@O-`M$MpP`P"NX1 b: S/h0P  rR u00pPP W UP 0C P"V#R V  VpPN P P W\1` 0`PIX1: S<V2"DrPpUPV9 KPW002`` 0!$ $"PPx P5u0S-3]`P S R SpP`-pP ``!\1 S R U>Pk`x!|0#S,PaY $[PtbpUd( F\PP 0X ND% ܍$ЍI!/F F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0PU $(0 $(s XXsddhhllppttp p@-4"4 04"4P0 @ {UxUuUDDoU@@iUHHcULLPPTTXX\|`\ `8sp` p4s p@/sp@-`@"QUpf@p@-@P6U3U0U-UpA-P@M4Q->CU->CBX?X\<\99> U9>:>CU?n:>CFU 0? AC>T}C>GTmFTEnFTE~GT 0X J~XpV  $$((,S>,T}S>GTmFTHHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,RYzTvT`XrX\n\`k`dhdhehplalp^pt[txXx-T0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P"9<Q008u@5pp0L0p $(0Ss| l0  0S l < 000 S{:0 02P0 @S,00; ` 9: \08%@5  L0 $(0Sf St C$l20SV `ey0 0 0 00@00$? 0| 60 P 0 QU`  01S0 ,(00(!($ z(q?mhpn$ h(j$ C  ZS 0 t+0P000 R0T A'' 0'A P>;P88  P2 t0 l1( @( ( P%h(@&h ))\+)8+)()4I&()t))O-M`@ ) P0H: 0 0@40P$? 0 &62쒟2Q{ p q B("(sQ0< ,42嘢# 0JR vXpQ 04  0R  @PЍ( 0R1  0 4 Y: 10S<000D0`2 `0 (0R 1 010S 10S 0Y` `$110010S Mp1p1000 < 88C80`()l))4I&8+)`+)dI&\+)O-P`FM M X j@: 0 5 RC@p"0pSE P50S00  000S Fލ Ѝw00 o1000D0|4 H0T00X0400 4QpQ\t` $ 0XXS"04Y.P 84 0R"0S# L000 0 HP #0000S Zw0  0n.P0K 0 6 @ ~8C80  0 0S 0k  P1 !!A.P Рᴒ L000N0 H X y 0;0X0t2  0G0  000B00S h2jp0!0G 0Gh [ Y0# 00C 4 S 0040@pPA!)vl1p 0ptO 0pO0  kw000C0 0 S 0q   0xs00 p    8C80M0000 0 ^!0xs  p000S x()\+)()4I&L<t))+)1*eT ))C-@PM`HXpaY 10S t10S 00 0T P< ЍC(`@DT> 1 RP1H h 0A P PN H]0S$00S T  0S v0S G A@ ЍCgT-P D0 ЍT()())) ()4I&4JVt)) 0`( "4`#/p@-LP@08200@ 00 /0@0 hp()00S4  /l)) 00S/l)) 00S/Jl))P000R0SO-p42@ RPMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0)c\5p!`S 0 000 ?@U (  R8 R  00\ P `0/0/0 0 xЍ  [ T R  P0f0 0<00_/())()()hTP0O-@P:1 R0* 0됑吱0 `SxP p* 0 T C:\500 M00,"1p R 0 0 !Ž p 0yM`0 C c00p0S   0 -0xp 0]M T0  0UM400,00S Ѝ ))()()T+)\+)O-0p#M PQ P* PPW0k:8 `\5 00 M 00O,"2@ R 0 0 !Ž @x 0 M`0 C c00 d0@T CC cA30B$ 0Q,040(0PÏP0 8!,10S 1 PpBU809 ԱPWE0 8x,80<01|!0<S0<0<0Ѝ U9  P\E?IEEP*D 00 0ˏ (0X0 ◽00T @ 0`; " !000700S 0C600*P( 0ˏ d c 0T0 C c; 뫴 h+) ))()x))T+)H+)l))U @))h))\+)))`+)O-2@ 0lMp`4FP!\P  ? 園 ? u&0 `t"t2 0R S \0 S 3 S @1@X :`(20p`= 2QpQ\tQ`Xd~   X 1 R, ]`&00X0S  0 0 `0\ *L!00ST06 0 S0\ 0㵯 E0 20 00 04$04L3 2$ @  *1G0'h00S P8 P|& PlЍSq  ol()+)T+)H+)l))U T\+)))*)))@))h))O-`2|2PU@Pp 00U000  Z0 Ѝ0c ?˿R0 0g4GC WV@Q TVg0U A0 %00100 @ M[ @T`T0p0T S @`B 0S@   T 0`9 0 U2 0 %P 0 Z0 Y`0@S 0 000T000 `%[P000d`()\+).O-8Pp4MW! XDW0 Oa P0 c0 C003 X 6(P  4Ѝh.+a p00p0S )A 400 0? 083@430000T  1 @ @XT00T S @w0S @ & T 0 m 0t)0`00WCc 1 Pf (pP 20020SV 뉑  400 0? 0б 0 ,Y0 !YY@ $0H  10J(Ph 00 400 0? 0 10S4 A0 0000 p0 @0S$0Yd0000uoq W o V$p b0 \Z00000 @$pLh@\+)()Ii@-_ H&s@-@P `⺻0S 0S 0  ЍpnO-pEM` MPV0S 0S @Qp P 0Sލ Ѝ000S  ;P L0S 0S w0S r{0SuU 0Spoi 0S\i@0SHc0S 0S(Zp 08Sd s/2#' 00 " "F 0D@?!? 00? 0X 0Xd!! 0 X0 dpP0SQ "04 0 R0  0"= 0 , R*( ,4ï0AA#8 ?S%78P0<P0Q R0" tT0S dOPUs @0S @E@PUn $=0SP@PPDPBH0S  `嚹Cn* l-Dxl$|0S ll0p00S0P0$ 0,0UA:Z000S 0S H @1 H0S 0S$0S 4P  r'P   00(0P 0Sq P PP P():^|h}T0)6V\O-H0PSp`M W0R0: P p`$"3 "0 S 10SQ >iЍ@ 0ȱȡ 0 000CSY?00 1> R. Pt!P!0  S D  ZP   . 80< 0 @80< `0P0 P 0 #0 S00@ ` R Q\Q\}H,)()<+)4))))t))))00S4  /l))00S0`( "4`#/l)) 00S/=l))O-M,M@R"\:[$0 : S`D[ ` p+9P$ %9P 0 00 0؍,Ѝ0 `(9P  LX 9P h0S  0 ! oP =0S, w[ : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S H:0S7  04 S2,:* 0S R %P0@4`PƟ S9U)Q900[0 B?@pQP"|90S  0|  0p 0 ( 0P080S, Z/T  Z9Pp⬸ U0 00(p UxPP0X ZP (000@0PлP 8L[HP"q$0 S7Q:80S6  V0;R01*h0S. 7('d0 ( #0 ]P h70S  0` B@ (A60Sh0 0!60(%R/V+: <V3#\Q RmP   gPpQ^q U  #p# PE"\:U PpWh RTPp%Q_'qP tPE! p 10S0AR 0 6 Z: 0S 1000S x50S 0S 0)  t ?T 0S 1000S 40S 0S    10S0ꊡ  0000 04 $0 S0 0  00 0 0D$000$0 #600S440S L4 PP g@pt|3S000Q 0pQLtQPXd00H00S1 0S \30S? \P  0KP 2 0 \00&&p2 0@S0:000S0840/<0a0#PQ8`

hO=\KP 0H0EP0`0ATPp`1PU 0\485  @5D0L 0T b32 R (@ `0 Q%Ϡ<#\ ğ Q  0  D ?0 X#3 0R< S< `3ē0S0x0@S @d0, S 0 ll`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  ,W0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0<. ᚸ0P0 %A 9W000Y 0;* 0 0VT0Q@` @ T\@@`R0@3T5Q`1:@Q`$ 0@0墺 00  P h00VT 1PS 娹P   0R`* A V+)()T<+)Hg))))D+)+)H+)l))\+)0+)H&()))U x))H,)5O-` @ 0Mp̰̐ 0 0  BRЍ PPU  RQ l @ p R RP Q @p`,)4))b 0`( "4`#/O-lMX gV0PpX0L1L0H1H D1 0,0SlЍ0S @d0,`7R0 `G00@ܰ 0D RpT0#:<`P 00ASpQ 0 0S\tQ `0S @P}()))0+)`,)fH&l))\+) 0000@/00S4  /l))00S0`( "4`#/l)) 00S/I8l))O-T:M`PV`@@ M4:0S 0P *S *`0080< 0/[ y :RP X P ) P9`0S 0S d)T P00 <9 #R0 p00S0100,0A(0 0 4"400< 000800$l 0P @ a ]`+0 @0C0O KU000S0{ QP0uF0 S$ 0S '00eP7`} /00S0100,H0xAH'0 0 4"400'pg 0pp00ppP*0S  /P_ 0 0P<`W#PS @  ` =< 6<80< 0 80< 0@0C0$ 0 00 0Q.*0SI  IP  0"pWWލ Ѝ0S 80< 080t5 0< S `a0 00$000 ;^IP 0S 80< 0804 0< S 4a`0 00$`S  B("( p ; ᴠ;P@080< 0 80< )00C0 80R<.PSR$ .R $PPnP3P`080<4t3 R0* 000>TP. 0 0p(Z P0SLp0AS0Ss p02G0S40000%P 2 @#R0؀R 00 0E#R0vQ& h20S\20SP 0 ,P    P000 0 0 #R0 R  0ttR> +w 810S' 5`#R0 !0S  0R ؀xP0 000p0P``0P00C0Z>#IP7Z \+)d+) ))`+)t))bl))e/;}()()))SbO-WM M'0ASy0G PP d7 8PG BP ,7 00N@  6$-P 60S 60ІF6 BX R0p`06堶0qY0:6 R W7`PaVsPVyWލ Ѝ8F DP P   -E 0S 9 P` IL 0 `00P(0S Sxxep%`O@`F(`P- 4 6  B2 !  ]a5( 0S X 00]/ E 4 R r_( `A`N4`F0(`SF T0`(0W0S,p;R\40x`S@09Z(0F0 A,0 S1 # (R! S000000Z!"!"Zdxhp20]/  ,0 ^1 #(00 S ^),)-*- 00 xP 0E0Z*( R `,Q2",0Y(0!Q@E 0 aV!Y"YdxhZQ@E0 `aV P0 (0S $ Q P00r|0SZ! $`l\ \T10!00C04P0 700000C0!" p'0S@0 0 0C0z 00@u{t))`+)|+)+)p0+)@+)H&\+)8+)<))O()l))()b00S0`( "4`#/l))O-̢̒0`1CMa@Tߍ0S Pdp@FDAG@D+0 ddp00@00C0 00 R2PU 20S 200S0R0S P0:000RP p 1Q RP@h1 R 00"P <1w00C$ P X PP0P0!!0p 0`0L00QpcQTt^X&Z`00!Pa l0 0q 6000|+)+)0+)H&()()))4+)()xL\+)PMO-p3张P M`@? K \P  ? 匣 ? G0 nPd#d3 0RT ST 0H#S 3S 0@ 00000CSFTYr P 80R000303L32   ?J` a2! Q,S Q0tB*>7d2D20S  P P 2 PЍS  z %Pj?00 1>!  R1\ 10SK0T!  0d!S@1`0 ? dJ00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 Pp?()+)T+)H+)l))U H@))h))<+)))))00S0`( "4`#/l))O-`lMX .Ol2ll00,0SlЍ0S @d0,PK0 P000Pp1@ 01  0D R`T04:1AXpX\tX`Xd  X P @RE X %P 10S  0%@P7P 00S  0mQ SR  00N |GX!   T  L 0<1T()0+)kH&x))\+)B()0))O-dM`M@PM0!n0 pN0t0$?0SX0S $5S0SVPWX0S $Yk S Y R㸮d>pW\ 0P%T਀X僀 H\;N00!` 1B`01$dQd0,P0C00h01`l0R!B1d0-0CW P0=SLq QT00H   0S 0 $5> *Z5==0S %0 08S0 $5B111`R B- 10 0S  $~ꤜ0S%  0帐- 00$%BR0ө`S<B11@%L0 pPP 0 C, PP 0S  x<P` *堐4L<@<0S 0 02d0pA?P0x;3A?`0 =<0T0.L0qM \;0WHQ RX0>F@ @0[M8 84<ϠQ bz S R㴪,0 S[?^ @ +P= :0S @0 # "@0A!" !@0 ! @ @0X ! AP: @ @fM0009\J*r4P: D:0S =30 0؍ߍ0<00

! A"$5S8G(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0K0#ST0< TK#2!S\0P }KV=SL5s\35 `!~?X00S-[" !>R\ /   B  R\ ?0  020C02`H0T SD0\ 0 2!΍0h0H0DlE "0AS0000 04"0C 00S\0X00!!!`V0: 0LphppPp P`lXX ুX姁0 8PP~,2!~00<0S. dF0 ST0Tpp101"P Rh"!>2 ԐXdQGpMG0 0 GGF000$5S `0|63! 03080H ` H D /D V()+)))()0#\+)))U G*ayd+)<+)c0+)H&TH+)))))L+)+)'Q+)8 X+)u()@))()h))l))h+)t))))H+) )Q 42!.0$00` S`0?00S00\04 <$5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0'P3 !T0 R H  2 00000 D0`FP1  Y1r2*S1,2820S 0 0`20S QL 'P 0< ST0T STT'P FUP2 L 10< ST0T STT1l0 # 0030Sy0 S\0P S\c'P tBF'P 0P S\0 S\00D0# 07 ppS $S00S0`" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8!!H &H Xp?!D0Y8 0 S\0D000S8d!!H H XA-P`@P000T:Ѝ4`ppZX @A-A0 5 P0#R%(r`! 10" q0SR 180aa0  a*00t1h10S 0 00SP03Q0S4 U@ 5*< 5 0000S 0 0@TP.UA)t0UC P`0 0S H P80 0S ()()I&@))h))l))t))0/d,)0/d,)0/d,)-@-   XH&G-P`pI@0S  0S X| 1U TY0S B0SJI@ {"d,)DIW]-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rOvP0: S0RP00 0PP ZP81: S P% S  R  rPPlPPPU rfPP$0@Pd,)t,)@-40P  0 00g$Ѝ  ^t0)0@-4S 3/ 1d,)@-H0 @(q 0$$HH@d,)@-H@s HHH@P/00@-0@S @ ()PU1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT8 ))l))@+)D+)H+)T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/X+)))T8 T 8))p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0-H3H3L3u/L3P3P3T3T3- -h p@9$p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0-H3H3L3u/L3P3P3T3T3- -EEP  -4K44K44h 4- 5 5d0d00000P5P5H5H5 @ A S>S>h p@#0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//\+)O-|4MX hDhhdhP@quP:0 0p 0<&0|&0P47p0p 60pw>p0 P0p 2S # *@P * @P *.mVXZ hY 4[ 0SV?관X V. 0C  O? <0\;P$V$ Q4C ?>|PPe 2S|3%8 S20#"20$#20PB 2SAt000000' 0@az`02P$V20A\2@02 >2C`? `Fb> 0| =H  ?`0P,Tt#0`P\`Q=S/0P 5` ( 2RV0 SS!c 5*< 5*h3 \30S 0 0`20S 0d3 0 S` V 10S0DS@ 0(y2= C ,0"000 0t00C`r'? `0(" r0S10Sʸ10S0=S0S PB܁q000F ` 0L%000P%X30,:Bda *)- D10S ^T0 0T+)|)) ))C  ))p,)V f 8))()+)  x l+)p+)     : f   T   T  ()B  N s    @   ))()e))=h+)    q   `+)d+)\+)))@))h))l))L+)!f+)()())<+)x))+) ))+)|+)+)+)+)t))P+)H+)=S$0S,  0`<<00P%X30*)0 00S 0 00S? 0 >0S a{&PDa 5*N> 0:#: 5(h1 t10S 0 000S$b V1P0a0*(1^ 10S 0 00<cQ6dP 0\b<0*(l2> x20S oe0 0r0S0L%r0L%r0H00q" T 000cH00STPP$c*r(43 @30S =30X# 0 00L40q#  c400cL00S 'Pc*I(330S  0# 0 0x4 R.0E q\ `PVR d0SPt4d*(440S 0$ 0 0$d0Q,%R0%45 S R! t0040SPTu*'d5p50S 0% 0 00u(0S xQ$ ]0S< x 0(%0Sv8Pv*'6S$60S z0<& 0 08%<5HSR$ / H00850<SNiPv*'6%60S VL0& 0 0v@%D5LSR$  L00@50DS%:P|w*\'770S '0' 0 0 7 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*'880S 0) 0 0h P^x P8YQڨ0QTڠ r 0 0S Pi*&9k90S 0) 0 00S/ 2( tL0S0QQ&d @0 0S }Ppj*&:9:0S j`0* 0 0 EL0S ?L0S EF9L0S-(Q\KQK RP+00S  E~0 ppV aF!` . R  ` L0S72  L0Sb]<Q| L0S K0S K0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4* &<<0S 0, 0 0(=0S 4=0S(@M*%P=\=0S 0lmh %= PA P<= 0S= @ᶤPL Y p X>@TW.  @?00@1>0A@O@@ᕤX.Pd7  7>,@ᤠ>P* ^ P;0.00 0 S 1 >5> > 僠>p}WP?ppY (? "00@DT@8 H4L0d Lc B b"30@`P Y) ?0S  8 H4L0d @ B b"30D60S  6p00^Pt6尹@ X6PL 0Z0<& 5000,60S 1S  :P 6 5 @\Q U @ 0`P@@  04 8 <%c#!$c4"x%S X50S `C\P 0 0 R ``0  0 04 8 # $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT()H+)l))0 \P/Q/ 0   Lq,PŒPŃ ,:TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S 0P 0T`dSTS1Ps+PUU00Q AP 0S ??@;2  P`"hR0"00S8 lr003Pb0S* x?0S* 0R0E>0*X4 2p610S g]0 00S?DYP10S 3D 1TQ `1*pX1` H10S :00 0H10S <D (1P 0*N0`00S 0t 000S d0P` 0'Y 0%G"d+)t))L+)P+)@))T+)))()()p+)\+)h))l))+)+) ,); +)+)Rm))X+)))()2)O-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\  \P  ?` T ? v0 6,",2 0Ri Si r0S 3S '0? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*[0`00S %` ` `Ѝ 0_S  $  B$ $ R$  B  ()())<+)T+)+)H+)l))U ))@))h))A-Pph0``ATR @P<M0S @ 51p0At+) <0 0 1S01/ 0S00/t+)`0 5 /H0P 3S P 3S P///()^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 ))2)x+)Q 0`( "4`#/O-`@8 0P1 008Q ЍS@pd8Q Q 00$ 0pሀቐp0` RP/! 0 P  C1  1 @- <L0` xRo/ 10#/C!000P/ @-A@t0` |R  /  /C! C!/! !/ @-,AD0` |R  /  /C! C!/! !/ @-9A\HO-$5SX@  lPphU00 `1X 0000$ p  @R ![ 10 <T+EP 1C0 2 @ @Dό R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RM@Xr PP dP`T `lP P9  ,劻p 50S  pߍ<0H(00,0 00004008004004 04$0D0(0P ]W[  `pU lZp* `T\嫆` 8 3 8l ,+m  'm #m m 0,0m0 m `[3 p 0`?`a8SڮPb 0  0**0P0  0* d@edA#zd@;DUasA-@Mp`;@@ Wp@ݍ P@00@iT00 ## O-`M$MpP`嬺P"NX1 b: S//'0P  rR ,400pPP W 债UP 0C P"Vǰ,R V  V?/PN fP P W\1` 0W`PIX1: S<V2"困rPpUaPV9 PW002`` 0!$~ $ƸPPx HP530SѸ3]`P S R S嫸pP`-壸pP ``!\1 S R U.Pk`x!|0#PaY $PtpUd( FPP ԕX ND% ܍$ЍးIF F F@00S0`( "4`#/l))G-pT1P0@0ʟ 0  X 3#15`05à121 R0` Ppp0a0!R00S! >% 0%# 0!ZXl000Z T00!ǁ8P,0()v+)3)'()`t+)=it)) 00S/ l))O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S k?B,00 0 PTQ(0P0<Ѝ()`it))A-)@`qP0S<00a 00 0.P000P 0S SЍ0@000 ? 0  r@ A @`P@*D00S ܽ0 0l))()v+)@))h))G-`pM0110S PP@i1@91001000/0 0  0    0P@,P@00 ?U0p15:0 0000 Pp0S 7Ѝ?pp%&` 0 Xd00 0a'%w 0S    \+)t))l))()t+)O-P8f868F04M0`00`X prP rᅑU 0ş@ Q50S <X 1e0!4l\ѫD0 R$#48#8 Q 1   (0 0000 P( P- .0! 10 t40SI < 0Q(00 0`00PP(0 R7 $bP \ Q \ ("(P"$("(Q ! L( 000lPn 3 4ЍtP`30S. 0⃑?  ፐP$3 3 ,PQ0 C,0(@,0h ~PW,,?00IJ ,0R0( 000U 0A+s T2 Q,PP (@,0!EP,PS @p! 刁0  B !#  U8 !!R!' 0S& ;, R*0( $ 00,0 00( 0Q `@PpP0,00|d000$00?@000P$ 0S k3*()v+)!@()cl)),^FF^t))%\+)3)DK`icG-QP a3AS0@`` M` 1P11r00`S00 0000P0PU 4;py@p@YU 0002 0zP@  Ѝ0尐ATP  0S x ;  aP@D/P80()3*v+)))x+),()~t))p@-P0 % .  @Q 0S p# #3 0# #:>0 T0SpP8P㷩p()^F()R/G-P `$ 0pa@V` 0Z@`` V`@&!D( `G-@0 4Ppt- X00000`0 8#8$#48#8X00P a 00 "% ?Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1A Q+ `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 ЍJ 0A-1àQ`P x0xo Q+0Sp@@ P$` pFQL @ @PQ0࠱@} p@-@P40S:a80Sh0h 1Cz+0C800S   000PP80Sp0 C[C, 2 ,0S/`0@-0@  LV9,0,0080S 0 0 [CE+0@я3) ,0@-S ,0, C5+@TP @輏 O-dMPpU`@@ U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00PI U0#03?d[[U`8@D `0P00X5Q P-O000 tD 0XR @5"!$"!L0<p(08p$0 0H(0 0 `,0`4  0 4 KB@%HP 00 l&Ph40  (00d"P  0,05S00SUSP3S` ($(0 B@*`UQΌ 0t+ 008D040003)@-,P ,\  E Ѝ3)p@-@PWp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp\+)l))()27@-0S S+,Ô2 R0 ELh `Q tpKPCaQ* Q( H<>P 4,B 5*< 50d30a3W210S "0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d3"01$10S 0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*|0p00S 0 0@S Ѝ04()3)() @))h))l))3)* L d  @- 0o\`O-0`pM@  @bcc 0$0(c #凕pPc0S@P7# 00" qp$3$݋AtUhUaU bU T[P4i0E S00p$ @ P80 ( 0 @0S ,00(# `! P P0V |ЍVp F pxP` 0 piP `P0V:P0V ZP p0[0T$$0 "! Pp  @'0 00$ 0S Z(0,  $ 8Bp p @'0 00$ 0S Z(0,  $ 8%yp  @0Pl  p P0 Pq 0 ! P4\`  H&    !!!!Z!G-p@P` 0P V  \00 000G P00`000O-0 mM$0P@@`004080 0bW, AW- LW% E8幊4巊cW iW0 p X$8ppH40S ,(mߍ8 4f0H4: S@ @0(008`,0000400P dP 0 0! Tp ⏮p 0Q= 0! $∡匱@P1 0V$0 0/S `<<Y4`=`"0 <3P0<0$߇`P ɬP< hy ׬w <V<H9p n/B  n?< n/ ឬ0Pp < !$&$0 @#0P!S 0`pSpVxp 0S `0S  R  R 0S( m0$H 8H"P`pF0$pM 0$ pF ;p>  T 0S ,( PQ S RPQs!!H&"zd@."S"C"v"""""#%#B#O-P@p`,M$P"p)$0S0$020S($2pN P V 00D 0P0P 0 0M fP AP PP XpP$p,Ѝ`P 0`P ,{% ?o  0w0 00  0 ` p| 0Pqp Ip UNp`#H&####U#G-@pPT!mp`:D10S:  p o09 6X $$ %Ap+ P%W00S $$ %1p YPPU `fV rV GT!P$$ $ p$@$H&C$`$|$$,$$ @- o\`A-@P`pP 4%\ XǣT  @@ 0sU  A嶣 Axe$H&$ ,P/00#01 0"$#$O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-0P$`L@P 0㘹z'0 0Q P ᎇ@ Ѝ P-@-0  Ѝ Ѝ/4A-0 P@$ 咁p'`0 0QP Ѝ өP404(A- R0Ѝ耟P@ cP0`p 0S 0SS0S$$7# BS 0S $ M `  HP`$0 9 `-)-@-00@$, 0 Ѝ@ Ѝ/-@-P 4(妡 A ^Ѝ Ѝ/$O-MPp`7@PЍ P yP 4S  0PT0P$Q$ P 0S 4S $OX 4P S $ ᖆSGڔ!0  p`000 0 0  @ 03P 000 00 0 0 "P 2 T`嘖&P%(0,p 0p$S4pS 0  p" |0 J0 `0p"P` 00P0S7)C)L)p))()))O-$M@ХpxPP? 2R 4S  0 $Ѝ0 mQ Q0   RSRQ"  "S 0$c000 00 P 0Pׅ4S 0S,  0B0 000 P0 s0P0 <00SS PẐX   0 0`S4S 0$R V P0 RS 0  0001P\ H0H 0000 0   H;pF7)U)*5*H*w*e**O-P$M`ppHL@PL\~@P0C$4d%t(, 0840; Ǿpd`"0 S; `巾p 4044s p + pp &p@ H4* R9 : S$$4SB. p $4Sc(d,T0 B. p (d,T0 $$0 P0p % 0l?$tW|(d,T04$t0dT 0 (d,T  0p"4S   0  0p4 $  | J-p J\mk 0P PFp  0Pp P LP' 0" RpP5:$Ѝ0 S0gp 000$0. !0S*+ i/`ئ "** ++!+d@<+S+d@j+++++, ,E,j, @-@P 4B BRP 9p 84   Ѝ@躦Ѝd@,,@-@Pp P Pi4PS 4 ,-6-A- PpP0T@ `{0X0 u4 Fp( @pP-f-$$@-#~-$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /G-`P@Pp 1 P=P` A0 `A00 00ⴞPU:Ѝ 1 00L0@0`⣞P1 00 嚞PU--H&-C$$0A@-WP@- x`R@dЍpP P 4 R 0 --- .O-Pp_o!R0`@tMR(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 P m0 $8P  gP P  P .A-@pP`P 5/p 4 5/p 4 l-.C-(00pS4P Ѝ$d@ 0 w  0d` 0i0  0 `WP 7.K..O- 0 0pP@ጐT`  P `V H<  0 ك@-..P/.p@-P@`0 妜@Tp.l/O-P`,M p@FE 0     R  0V  R  0 pl PU0 (P p0 SE;  7 ,Ѝ.-P/O-PQ@04p 00` ЍP P0S*  E `P0       04 p p#p p04pp  c////0s@-S`@ Px\0 KRP: pЍp%   iQ000 BR00P0S -/-s@-`V@P`l` B\0 ?o2R0S 0S00 Ѝp--@- iR sR aR p` 0p@-P@^P (`Pp Op-*0p@-@T 40`P߹Ppp-E0iR@-- 0 aR bR LR( sR% tR@#P 0gP0S`00ap`(a0 /i0-W0 p@-M`@P`%P0 0͵0,0S  ӚЍp-00G-Q@`M QP  ЍAP $pP l2B00 0 p`P &0000O-$M@`HP ,`$ЍPP 0 0 0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0ppp $ ~P 000 00 pqP 4  P\$  0V,S( 0 `$4 80p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 0 PM 4$$   4  !4 "4 $@p7 0'1B1`1z11C)100S 0@-@C^M E$E$$0U 0(P(Ѝ0 @x("(!˙"`#XT 80 ` @彙P8庙H&2 33(3:3O3f3333330$ 8O-`LMPp4 @1D0J00 np  0S& ! R"|!LЍLRR a0BSS0D1 0S  0P *@P   8 ~@ V|Pట  ~ T 00 o0@  T @ 0  @ d P@ p33H&Hk- 4 44X4&404A-p`(P@*}P0 p!`P @00 0$0@-@P$0S J~@G~O-@`;0S؀@ `@` 0@ `'  0 T0YX@`" R   0 R 0 0  0 00 0S 00 000Sp0Ѝ   @ ` 0@T` T'U@ ` Q  R0P MUpP0 0S 00 0 0 RU Q T0Px n P0 @  T 00S0p@ `5556576[66P/0S//P/0P/C-@ P Pp ` R Q @Y R0Up@-(M@`PiP<(Ѝp ( `PP0  456@-8T@L0P 6S< 446@,P(@0Tp7t7H&77<8R R R @-@R R/////8 Rp@-0@P S  \ ppB \"S@p p嵕h0 `pppppp, !$0pp8893)98O- 0`@P+P Ѝ0!S R '{0Pp0(P\4S 0D0$$7 0PJK8 S { R RP304S ڠ0"S1$0@ @0   403/p 8 H06 0($P  P 0$ 0 0S (0, Pp9WEV9:$:93)&:O-0P`p,M$0 #@p@20S$`pP 0 0!  pT AT fT @,ЍsT00$[p0 0 00@ 0Oqp 4 `00p x0804S 0Q1!1 X R- R02U1 0S.` R@H!H勔@1R R8 H0 0 pppW$00(p,0` 0S0 00` 0`Z]p ep{ 0oo`@ Z 0Z p@i@e\:H&b:H:|:8$@X8=@9\3)xyY@A-@ĔQP MP 匀 An`` p pHP L?ЍEp ( 0 HPRPZPuPPG-@PNp% U4 d$! ᴀA~ p $$ =0 P ! `" $`9p  D 4`B~0 H0 yHPPRPPQ pO-M@/PpKPDEA =9$R 4SЍ4 R $ RQ  S P $ 4RS  0I  U08pP  0S5 P; 0  0T`P ,N ?o  0J0 00 `gp X 0&p,PQQNQQQQUQQp@-@M@P`4 t0<000 Bp L00S 08 p'@Ѝp,RH&Ą4R @-7\`O-0p TM#$$0@`40#pP>20SK@0SD00e@ DP 0SD0SA \^<40$ 400#qpp, 804<0QP$ 0I,0 ( dP bU@ qU PH04 80pPTЍ0$$ G$(`Vp0Y`0X0 0000 WX0 0 0S$ (0  [ Pk$0 0(000qpp 0 QP Р 0Z!p , C$p p  $ RH&\`RRRS#SO-CLM` I@$P0$0\%8pP50S @)LЍqP sP @0p0$  0!qpp PP`0$0I$$0P00P 0 0 0 00`0K0P(0  0 0(0 040;P 4P 4  0,0$000' # 4PS,00 VU$0StP0T ᒃ!088 X : U S  0  <0'P<0 (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S  4pW4 P4\ ` 4 "$P0 0S 004 b8 4  !4 "$0 S40H0L p 401ST>0 S 0P 0T 00S!Q` S$NP$ a@ P PT{pT T  0$ЍP`UUH&UUO-P$4TM⓲(0@xp  @"`B @| 0P|`TЍ X 0 ^`ꀠ @000 0 01R0 0|JP @P0| 0C`l1  00B0 @P0@0$ 00S+0"+ /0YQ Y 0  0$ 崏0P|  V# `F0,0( v,0 Z 0( 00S$EK%U /0a@P0@YT Y 0VBV,VC-\MP0  Rpx`| )X%0˦P00͵@ @    0 08@P 0 ,嶏0S 小 l\ЍBVKVTV@-0@ n00 0 0 :ЍZVP `00CS`0p S00 P0S X0X /X⨐&3S @-xMm0 $8|@v@ T vxЍ/]VC-p2M`PqP0HЍCR0 0M(Jp XV p?N;I !80pp0 0 $!P  @08 0@XWF QX9T  3S   PPIt8m0 $ P 0p UU Ѝ00  ppP܎1S1SӎtЍC͎2XQ' @ iĎVsVzVVVVZVVVVVVVVVViVVp@-@`MMPᨎ 奎 墎4S x圎0S h嗎  . 00CS 0,!80% ₎܍Ѝp A!0v0 0 D i P a0 z P tT# BPK@P 8DsWW(W3WAWZVKWHWVnW}WWO-YMp MPm @`  H'  # Y?H0C[?H@0 00 0剐0 `0T     p n Q    _ 0g J.J0 BFF P <#0bۍ0Sq3#Fs#fF?͍"袟jF?ƍn 0$ 0!  <#ತPq ⬍$ĕ 0S,T UV:#@坍[ 0000p P 反 m0$( 8u/J(0 B⁍0z/C|#$ f2@^  @TYލ ЍP!fF?`S1># r  SP P `@(VL?X?#P?U`1?`#X3V`3!Y⸋!VⳋoYPWU (00  P x型00  P L哋 Q: ,劋   P  P X1  P UP1`P00 ]   PUMHO3)VXX&ht@X3) H&XWWWYYYYp@-PM@P`4    1L0$00 zp T  P 00S  0WiR TR LR a0BST plRs0BHPЍpTRp\`XYH&hhYeY 0@-$M` 0 0@P!!؀C$dP W h[ЍPP W00  zP\0P 0S t?[P0$$uPP/ d -[PP )[P (0PPd0 AP $0  pjQ4 pCP 4PK0P 4 Pyk  P000 00[00000 0S$000,0ZP xZ0P(0 AcPP e`P e$jPP0,=$4 BP 4` P `YP @ APt H APn @0 SD00H0$ RL0, 0` 0qph R$4,, 0rqp$0$` t$4P `$$i$4P` V eZ`P% aZP! ]&~WZP bP d`P dd&? ` 01qpz80p @Pp6o  @P 5  @P 5 @P 5  #@P 5  C@P h5  2@P H5q ;~@P (5  Fv@P q/  t@P r m@P 01S 0r/S㲰s?+(Ѳ Ѱ  W@P s/| P@Pt$$彌$4P}(%bP} <480C(0dd`P dd$$`0 qp\& p0z< APp3C<pP H3< 5C(< AP <P3 @P 2 @P  @P 2< SpAP $ <8 ?P" 8 Y* 0PW$ Bp p$ APp$4`  0'qp<$ +W$4 (0 H8\008$0 0(0$0 00,0 40P0,` 0$00P00T0(01 X-`0$$qpDu$$$4P0 00H00L0`$4+` 0qpT$$ˋ$4P`bbH&b-bcbFccccc dc\`ccc8d^dPdpdtdydUeddddec[e'e7eweeee0@-@M P s  ɝ .p@ 0 0-p (0Ѝ0e'if@-SM@P, F0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0|00t0`*h 6XB00DL`|`p D Sߍi@ei!i@-@    O0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01FP A!@Ax9P 0`0?oS c` 06P ``($0 0A. 00P0P A A v0 0A. 00Pl0P AX XA\0P 000B4ލЍp/4)p9)FfGfPfTf[fhfvffs@-1PP  =P 6 `@TKЍpP  00SUV  e@ff0 R !O-M@ Ptpp" `P"    GWP? Z@WPL;WpP Zpl4WP Z P+=P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, # =P_ 0S\hQY @ 國pNl lGZZ L凯X (t0~W 0k0S, @ hyP@ `spd HQ L 40R !01Sp0S 3/p\ |] 8 XTp \ [ 6@ `Gp Ѝffggg gpgg4gTggA-p V@P@SVPPV/a`P WV P VP`@ aT @- p>P ЍgA-MP p<@P00p`ЍpP   v0 p !0  ,>gi@-@p @A-P`%VpPB00iYP@9?0lY 5 FA-P`VpP$00KYP@:?0NY  F@-( @<P00 Ѝgp@-8M@ P/<P1 UP "Y0 Q0s0S00XPP   V@J_Dh =  X4 PU`3_V8Ѝpgggi@-@BMM ^ p 0S 7  /  0((@0S700$0/ 0d ((@0S BލЍ<吀1@ 刀)@ih:hOhp@-xM`EUPP XP@ T0V" C+X  X $pѭЍpg_hih@-@M   pЍi@-M @f;P0C t p  1Q0r R08C8, 1p`Ѝiiiis@-`Pp@ @@1;P0\ -@P`qW PL ! @UP, Ca9eЍpii ji6j7@- P@HpX KHT P<0<( CC,0 T@ Ѝ0Zjxjj6j7@- P@$pl #B'0PHxT P808 30C) BB@_T@ Ѝ0jjj@-`Mp^TP{0P0ЍWP@U }b@P0 H8p7ެ0 P@ PPNdjji@-$Mp+TPH00$ЍnW`Nb@Px0 0 ` pP0⯬P< P`@ p06㨬dki@-,B % ЍXk]k@-000 0  Pᇈp ` b@P|| ` @vpl P0 R00bS ~@d|U ~~Pxi ikkkks@-@`@PP  Cp Fx0w|kp@-` MP@SP V Ѝp P    mV  PS@ ]Dkvi 0@-,M@ P9P0 - N p,Ѝ0 0R0s0S 0 $05VPP   S@\Dkifkp@-P@p@d@@'SPL0L. CuVQv P庫cpkj j7@-X@ P^9P$00 Ѝ0  p ;D\k@- l@-M X@>9PH0H+. 00 0o pj\ЍKlii^l@-M X@9PH0H-. 00 0O pJ\Ѝlliiyl0-M $00; P  FЍi k@-@4R P(0(, CR@xjj6j00@ P/a CRWC/A CR=C/@-00@- M@ E0( 0 p ЍiMk0@-PM  \P@@⃔Fm 80哚P , x}Ѝ0@@Xk?ll@-5@QPP Ӫm`PR?0L`0P.C B00 0}t0@`Vm`rl0PR/C B0\ L@ @@@@}[z03/`lHJ&ZkllH&lzm////0 L0L0/HJ&0 T0T0/HJ&0 \0\0/HJ&0 D0D0/HJ&0 d00d0/HJ&p@-@pP 00p00D S 0A0CS0$Pz>P 0@pHJ&@-p03) 0`P/ R/HJ&0 O-4M@@!2T0(  DЅpď P(0$`!pSp D@T PoS@ڐAP`@ ptpP`[T000 [  z R  P Q R. 0S $P\(P  1/P ;@0S  lp "SR(0 SL妩\ 2/P W03)nɚ;6eo oO-M Mp@p U pP< ォ( I`P  0Y000 rZr/{  b[>Jp0JZ  Sp Q h{ {@ p 0 Q ({%_X[ ⼕`00@0 0'P{: 0I 0夕 48<p 8^0Pt0r 0` <04pLh <D{`8H0S 'P01t{{H0S>I0S;X`PU 0 3/P:㸲 "r⺗0r00S:00r% ⬗r0S XI{  A{ 03/q 0I0.pNI0S㓨QP E"%J` 1 `E PIEP @0 l1 LAp 1 LJA@!1 ,z `` #%J_!1 IA @@ |1 A!1 MA@ zPPU_ 03/P 03/ݍ Ѝ(oHoi~iooHJ&ipippp3)oqpppio1qBqMqeq8qpqO-@PpP  p  T N@NPT! N `P XPLU @1O0S 6zXX xW P.Z  P' C7P! K0S 0 L0S 0M0S 0 N0SO0`S PPV yPkzqo3)q&@-,MP@pP NP`(  up0S h| H4P00@ p0  b,Ѝ~~t9)8i(~~~@-P@U0 PO G-@NPP0 `@ Y㌀QpQPP  ːpp @ H@@@_@#-2t9)s@-@~pN@P00ЍpQPQӗ@P <` ͐P^u t9)s@-@TFN@P0{ 0QPQ᪗@P L` 夐P^u kЍp-t9)A-@'NPP0 |`@fQXQ{PPp [p4 BFJN@-t9)@-@ \?4PP0P CD 0 S8800 >00Ѝt9)H&0@-M@MPMP MPpMP d0P P P P~ 4P6p AЍ0#t9)7i.7@-@Hdx pP HxDP~ P! (x Ѝ0x @E=@HNIA-M`@PK vpp"P  (  1  ᇒ p' (#( pt"<@T d8Pox\2PLhx RU TЍ0 P1:g\@P㾥 $@幁p 孎Q?x t 0R 6x k)w wPp L`)x X`Q$R@x wmLP:ЍA`]P\ 0P R   1 x 0 RS^ww $ w0` R P U 0pD` PH~48i(i]\gn~IPp@-P`@KP V  L`P V`V 00pKTp VA-@T 00`PpQ0 p @-MPPn00Ѝ`0 00p0@ 0 P .O0PV 0 p 0 `P0G-@(PB00`( L P1r0Pp*0X!U0"R0 %"0"0"SЍ>0P 0 , \p 0 @0@-@P U@ O-`@pP,(0V0S 8YP$P$P 40S 04S 0S(0p(`8P0S$0(P$\O-M00q W$000Ѝ`QB QE 00 1PP0P XZU =0P ,,R6,p4@[T /@P00 D<0800X5T (U( R R[;"00[P 000 ↱Ps0"CQn BQj Qf^ 4!<5Xpp!YPPX Ჰ  $P Mp`[WF 0  Ep? 0STt -PPX!0 n8!100#R0S 0m8\@  0YPpG@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S 0@0@D@ T030ZgM@ZTl +  JPTU< E0 0 0`0궃ÃA-X Pp@`Pc00 90PZ 0 p 0 `P0O-P`$M@ HpX) P W0  ~Pp` 0p0  0O@)0#30 Sd0 00#00pH0pM/P41S (0Y CM/Z q8ip9)3p@-`M@jp 0+SЍpfP     R # <Szp 01S 0/S 6Oꕆ i 00S/@-@p/4)A-P@`TpP @ 0SP H&A-P@p B`PW\ TPH0 000  (p`T&:i@- M @ph ߝ T+PR00 Ѝ0( 1p ǝ  9i(@-(M @p  ⷝ -P*00(Ѝ 900S D P+P02 ( p呝4J 9i(@- pp 0QSЍS   pQX/ 04 8 <` S $S HH @S/8 S $, @$/ //PPPP 04 8 lP %֛ X $p9ћ4Ѝ0ixH&A@-@CM`(  TpP 0 P P PP  8 ! ll pz l R叛#nlmU#0P 6yp 6S30S x n0\P 6gp 6SL<30S 8m 0P 6Up 3Q?mI0P 6Gp 2Q8m8 ~ 7p 0S0 m8 ,pt &p l p 0@ P"Po@2Q 8mCߍ10S m10S mm0  `0000pmPU0``0` Rڬt1000 0:S R D:P4hm`pPQ `mV pW ,PmFRmH0S LLm mGmj>m`0Q 8m l8i(ii!(4)+4>) IWi8iiiQ`goT&uy0@-@Pp@kl-il݋p@-P M@` CQP0 aPp@@J Ѝpi@-< @Q'P(0/< Ѝ؈@-@ @='P,03. ' Ѝ؈0@-MP "Mu@PۍЍ0@J P P+-tP@JۍЍ0@Bt0S0S1iS/@-X @E'PD0D/ I zp叙Ѝ>؈AM@-X @('PD0M/   ]prЍi؈vO-`MM@ <0P0< lPgE7EJPN7U'S(0`0@$0 0 @`F( 0R|'P~$0S0'V$0ʨ).0030070 0;00@00E000$ k(@!!0 X Yi0 /C BRY  0  00=C$0Cȟ"!0``F ^u E0Ĉ800IcCP S@BA`pP8$ 0X00p` ek!0@"0,0,0SD k0( P0B'S(0؍Ѝ 0$0'S   BS>C0C'S Q:ǟ"!! CR   ##9C0C"!% X'S8ǟ"!2.B$ǟ>C"" ǟ"!/B Q 0*Sz S &S  2S% S`r 0S R )Sx&0C'S000S 0 |Dd |0j0, 0 B, @ R `(vSGj X>j 0R 0j`0S j0S pe0  j00C!&⩐`YP0  @jp j0S VE 04 8 <$S9tG@j0S 0 {juvj 0  G0cGA00pGY#q0p`FL`[! i a`V1ׇ!}OjxV-0S]  }X 4=4 0=jI    #P# $P# #ß P #j|3Kl#S0S XcF @j0S$   jS sj0S i뭏 `p0VVČ   "0`i V/A@i0S 0|HiHi 0p t H~0H≏HA00HZ0  `F[0 pg&V 1 !^ 44 0iJ    !PT! $PH! D!l P 8i41KD  @S0 ,Sx0 i]x̼9)Í $(4)08݋lj5P8ÌVʎPQPX܋Ȍώ͌I֌ی"'09@T0@-M TPp@@}GЍ01 ~@iԎ 0 / S&/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  mPiP ЍЍ/@-@VPNrx 0S/@-:)-@-  MPIP ЍЍ/-@-  ?P;P ЍЍ/@-\00S 0  0000 0 dOpЍ:)@-@pHwpqpp0q~p갓ғp@-pMPP2 P0S 0@P 0 0 00 0X#Op DlP@@ ((@,P0P4P8PS00!031 0@-Mt 0[N@P \ JLPP @ (@@ 0HNP 020Ѝ0S& :)"@-;@4P ,h$PA  h eH&~P@-d0 !X !T@0 60\ (0000/DYnPh0h@-`  !TD0 60\ ,00 00/DYnP-P040#^4<\$0000/DYnPD0 40#\00Q 00/00DYnP-H 0:# ^4 0Q$0000/DYnP-H 09# ^4 0Q$0000/DYnP 4 <# \,4Q00/00DYnP@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00DYn@- 0 00KdP Ѝx4S&A-PNp`@WЍ \P V3MP@ p7@-P@U0  (nK Ѝ0L,A-0@nS0oSp@ p>P`\.MPRK0nS0oSLPPLPP'2@-0 fc4H&O-M MBUZS&z&O-@M}MȐ⨀p 0  cR`-EOhV 2U[ZrC0F!0!Pc0S Zc7@P1cQ0SR '|aZ|c0SK \c& X%c& H%c0S;00(! P   P00@P  0S P@ ucލЍO. 0 0S 00S 00h0Zo  ]c0 0` PZX T,ލЍONcʚšĚ}:)ԜȚŚp@-PQ@@pQ(0opNP0p:)PA- 0nS0oS 0 ~@P0DttAP,WpWFPP`8dAMHp@,)@P@:)ov@- c`될H&O-@PM p0`<"P04"4 P0("Qp/ 2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z kpH `rPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00  0ozP؏`z 00 0< 0ft[,0t0Z00x0V 0;;0|0Ѝ-H&-ܠ|-BMMI^@0 P@M00 \ 0jp0 @圏0 0/ 0 }_랢7@-@P A0Lo SϜ 0 o Ѝ0蛣@-@<0P@譣@-@H>0P@賣@-@ kA0S 00S0?  CЍ踣p@-@PĤP (=0/Sp#p@#Σ@- ab`_H&O-`@ Pp(,N000 唐唰00 yPp0@DTq oP0 PyP<y8 O3-H&-ӥ8ȥ@-M@A>0 0D@00 h0jpR0S SD KH0 $Ž 0^,֥3p@-@P:P (峎0/Sp#p@#@- a^(H&O-`@ Pp(,000 唐唰00 Op0@DTq oP0 PyP<qx8 O3-H&-;P0@-M@A>0 0D@00 h0ip0S SD HH0 $8 0p^딩>eOp@-@PᰣP ()0/Sp"p@"p@-  N^H&G-`0@P $p堐0 qOp00@DT oP0 dxPP{x  $^A+yG-H&@@-M0A~H` 0P0 @ip Ǎ]p@-@PAP (庍0/Sp"p@"ꆬ@- `]جH&O-P@M P0`TrP"Np)@20 R. +x   &  x `!p0 *00)0 &0_ EipM buPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x0 wPwPZ,0p0Y00t0V 0;;0x0U>Z$00|00|000Ѝ-H&Ȭ@-MMJNP0 @PG00 |0hp0 `݌0 0N/0 4 }0@000W_\륮7@-@P >0Lo SϜ 0 姌 Ѝ0ӯ@-@:0P@@-@;0P@@-@ >0S 00S0?  {Ѝp@-@PP (u0/Sp p@ 4@-]ذ@-8 l0 0}0000000R_\ذH&7@-P @^>P00S\ 0 4 Ѝ0ٱp@-@ PX0 a0(p}PP($PV\p@C;)O-@H `p0@H PLLD%mMp850`FVQ8 52@FP50S  4 40S 4 0<0074a08:$0000000d4Dt0@90;84giP04P 04I_0(80@008 01vPP嚋0       +  @   ' B D# R4#  $# R # , @ ( "  )            u20  u0$000 p~u0 000 Ltu0$800 (ju0<:00 `u08:00 Vu0@900 pLu0,000 Bu000000u0909 1R@11r0$0000 00t0,00w0 00x~00007000+ P4 ~ ЍS&S&H&H,<)$<)-0<)(<)ɴӴݴS&A-RMMIN@XPpD`p`00EL y눁H00p$xL0ep0KS 04  R< pL04@0 sp? 04n/`  0R{HP  0 ,PEP.0D P! D4\ 4$04 0404040 40$4 0(40,4`044<$@\RݍЍ}$gZ$<)"+ p@-@P᤟P (0/Spp@~꒷ R R @-/Է0@-@MP`p 0d000 ePPЍ0P0 0 0e0 jd0P zs@-`/P0@00 >dP0 OЍp 0`( "4`#/s@-@P`-0 0Pd00SPPP @@ 0 \Ѝp;)(002P0/0@-@CMP( P41010 0000000 0P eC< [H00Cߍ0Cߍ0@o꠆G-0@`p8Pp6 8Ġ#̌ Ƞ,Ƞ Dl4$03 00p4<40 8j0g,d<0(000pE040p<0< Dp PH00ЍpJPF PG  [;)_`,O-$M@0 9`Pp0 @T .V0]<00$Ѝ 03/ Z0p 9P P @0 ` y0P":@ 0 `  p00P LH0@3/p'P9 0P 0T@Pp 0 0 &[꠆EC-MM`p/  P@1L#Pd8$#4d4# N41D0@@ 0@00 0|@pߍPHڀ@Td8$#Td%4;)C-P[ 4M@@0P` :0P`PY d 00h 0 P p H0< 0``00S0 V0S`0000 pp  iPPQ8#0!D0D00V 0 000  P0b"!4b4#P0P4Ѝ 000<0;)k;)0@-M 00@08 JP  彇Mኌ멌Ѝиݸ@-  ZWH&O-`@M$  00p 0@"@0"@0 "Hp20Q0CS |2g@xP0p00@0p g! 0 qPZqP PP⩻0S R  ; ᜌP  x2 pg!! HPP⃻0S R  xP   qP ⴉp n+bp t 0[4S08pS @p @Ѝ-H&-_|Ǻ̺&+YB0@-M MCN@80P0 0E@(00 0ap 弆 0 @DY AY >Y(50P( 07Y,(40P , H0Y0@-Yލ Ѝ0@&Y"YĻʻԻ"@27@-@P 80Lo SϜ 0 q Ѝ0м@-@30P@@-@J50P@@-@ m80S 00S0?  EЍp@-@PƛP (?0/Spp@1 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0Pᬼ $(0 $(~ XXzddhhllppttp p@-4"4 04"4P0 @ kheDD_@@YHHSLLPPTTXX\|`\ `(p` p$ p@p@-`@"QUpf@p@-@P&# pA-P@M4Q->C->CBX?X\<\99>9>:>C?n:>CF 0? AC>}C>GmFEnFݻE~Gٻ 0X J~XpV  $$((,S>,ᶻ}S>GᱻmF᭻HHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,BzTvT`XrX\n\`k`dhdhehplalp^pt[txXx0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 PbQ BQGAU Q  @ @ @ @gA \0 dU@T0 0D dS2Q "P  T8 DR0UQUDTP 0 @@@0 X R   0P\[0 |00S P  \M,Ѝ0 000P΂0 ̽T8<)/_@-!@ PU xxUppl0h@S``^P0SR@00 U  U@8<)tH&߿ 0`( "4`#/00S/@-R8<)p@-Pp`0@S     D00Sp 4"400S 4"40pS&D@)s@-@00S 00S Ѝp@0001!Ѝp@Pl0`0 ,P08V H< 0$T"vRЍp<<)H@)P@)@)@)@R/ȸs@-P00S"0@00S |000 Ѝp@貽 ?,4P0`8V < 0$T$ARЍpH@)P@)<<)@)@)fC-Pot10MSP#` 1R  0  ?<#΋ 0`x 0`0 C c00 d0`c C ca0b0 0 0 x \41P0p$Ss $$TGQT`P@UѪl  00 ЍO KSt hhȀV XȐPOUP,-@)D@)U TTt0p@-0`S[\@ L00S000000B0E0p@)S&|0P000/000/B10B1/101/ S8H&O-TUM p dϠ 0@ `Ì0 150S  C0 R0S@`Ѝ 0 R` ` b42 R ( @)D@)U 7<S&]H&zO-MMO⾟D`, &%5_Q0uPSi`50ZZt%?D0Shh,/nD? 0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#80Z0`p 0 40S7{ 3 0 000p0  8`  Z X &Z0 ``ao,Fy Ϡ ß\ ^/F222902?"""0Pa 2@őD L 00 /4;2$ZY 0d0"0 0 o 0p,2 0r 0` 0W8 Yp`xSi`10YY `&!""#0ODD@HL05? 0 04s0hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0@ 0@Dő L0 0/4;$0 Y0Y 0ldh 0@ `Ì0 1mS&<<)@)AHU&XW&o|@)D@)TO-)MM00=0?0,8(0/Y| t<pW:h< 0 ; M+ 0P@P`P  <ո P@ 0  ;ɸpY 0  ;E⺸p@ ;T@  7[P@ *K 7P (B\0S0,5 Sx0<0(500; 0,%S00T:P:Q04< OU 0Q wOMz* 0 04 0A iO? 040A `O6 0 4Q WO- 00 Q* NO$ 00Q(t EO 004 QT C0P4p3x00084%$0<0D0t@卖0|00匐XL5P5G   ?8`F  ?  ?n p m 8pG!PE0/0!"0 p p4%p8$``05<4RpD`rNH466 84<00x$0$ 08pS_PS @`@0 ?@`0彵PP* ?@P`(6#R0:`@0- 00 0$5SPQ0&" 0P0 ?00 1>00S`0 c2# S,Z Q Z3?00 1>!00 ^  BB0bPp0/2"0$ 0$ ?NWp1Wp#T0p10G 0FK  ?@PPB@TP` 0P.똀 00B1  B1 R ` U"B !!0 R0CQE0E ?P0 p똀 0 1 B0S0`0US0  B110S MVb @P`x1 G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 000020S|0p ?HL404P@0 @t11po'FzVq@00" Q4zH1\5?>C0P奁%4tx0]0(0#T a2!, A3 31 0 l@`0@)S&T&\@)h@)*V`@)-p@)nl@)T&X@)d@)x@)|@)^F><<)~H@)@)P@)@)&ht@&@)HS&@)D@)TT@@)U 04 p [ 0H$4  E$ ( B, @%LV.  R*h r <  X  \ ! ?.@Xt@+@B@A.@B,-8 Hu p @40K pV0 ,p B8d i A YZQ 0 ;0 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S;} Z} Y~~ 3[ 00 d0 AQ\ a6Pa`,PL `4>}뼠@ :}9~} 3;<000@0P 8“ 0,K 00 SP0\#P !0@P` @(4`ʴp0 Q0P}&\^0S:pD RK TP0 뤤@t j0JF 0jK0`0S 40S< 0 # (9 X(0+V. g050S  [ 0=S, 0S10$05H@ p TPP04SP0 0R0 S00C0> S< 0,00P0F 0,0S9H p开8嘥ȿ+" < Q \%``R 0  ᐡ, 400@(0 0 @DU, @4A6, @R40 `0```0T0(( g 0 p(7 I `0 P$5\'S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R' R0C00h0$l`0 R#00B1d0 R*<v%<U` p 0 0 0 (0 0C 0(0(0 S x8`R`  $%R0 l ! `8 p  R2d 9RT T  9P%QXԐ R, d0 0   ,   8 @ h`Q +H0BH ,nP+H  H0T 0S ,00C."p\ ^  00 0?d B2 b<10 *I$01=S,00CU yh010T0010X0 00@+DS\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST00C@ p` 48 QT* B!44 T: $5Sl0 @0h pp^:S $%S0! !L`$p$p(0W|0S ,4 Q d,04  0,4 $ 00`  VjX0S   0帀0 X#` x0} X\># P 0?d @ `0 <s 4>\%R @>0SPX Q``ƌ` $$S >`R`  $%R0l ! ` p   R2d ?RT T  4?P%QXԐ R( d0 0   ( `  8 @  |5R` /  `@$  $ ppS $S00S0@Pl倐HFP00@k8p`0x1ᔤpYU0IX!@@l00@0T: 5@$\8Q 0@08(0  (0d0O@ 0NN nC 01p0Sڠ30S0 000S.G08C0`SL3 %>#\Ő0\   0d ? @0 `>B2< $ H0000P20Sʜ2 0,00C0S0 20S H0S G\20S 0ɏ G00@Pl:h*0EUP 20S EA C 10S303040404 0#pCVW*-uV.PaV.GV^0S  d10 PST1\5=S,J41?^ E?0 0S 04 d dLĒH 0@ `Ì014 ,$0S0S 04 L d ,04 0P 04P)ݍЍSngU @)TH@)`@@)<<)tS&D@)L@)8 P@)G-`RM@Xr uPP dtP`T `P P9  ,Pp 0S  %ߍ<0H(00,0 00004008004004 04$0D0(0P z%W[  }PpU lwPp* `qt\` 8  8 ,H  D @ < 0,060 2 `x Pp 0`?`a8SfPb 0  0**0P0 b ⷴ 0* d@edAzd@V 2GA-@Mp`;@@ tep@ݍ P@00@NT00 ## p@-@PhP (s0/SpFp@BR/fG-P `$ 0p@V` 0㺭@`` V`@&!D( `G-@0 4Pp X00000`0 8#8$#48#8X00P a 00 "% ?Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@O-4MX0p0\00``P0 0,f, 0S P 0 rmS2aSMS ASB0C0`b0CX S0SSU0@0 0DT dS$ 09R ^"P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p Pr0S00 0 004 00P4Ѝ@_@-,@ $EBA?B@H&0@- @    G-@0Pv t``PE0 00000BoH0UB?E ᴀE)LK)P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@pE)0P  C @-r co`/s@-@PH` 008(V  @qЍpD)E)s@-PX00S@H0`ă5#040<p(V @qЍpD)D)E) h10 PS/C-TQ@@MPM`6`@f$a 1p P09 0 T:@6S0O@ c DD6ۍЍC+ 0P \ 010 S a8!#4a4# 0^ P;0T 0+ۍЍD)E)D)D)D)4G-DB` p&PP$"aq 0F040( \06# R 0 !)Kq0 80 0 !R:q0006&0?06 0  B 00C0( 6V0:!`p`Vp 0$&0? 0(0 6 C c0 0 &$&?x0`L0V&S %t0: S 0d  &ЍG(< ((aE)hY&A-Xa00S FT:p\&PP  0 0A1S0S( P @D A01 S p0S @2106&0o(0& 00C00&101 00C 00E)O-P`CM(HDL?O8fK  0Df?o2U+u(&0#"6` c2H弻 H0 HDsGCߍXAG-`RM@Xr kPP dwkP`T `P P9  ,nGp 0S  Tߍ<0H(00,0 00004008004004 04$0D0(0P AW[  DGpU l>Gp* `8k\` 8 c 8 ,      0,00  `? Fp 0`?`a8Sڒ]Pb 0  0**0P0X ~ 0* d@edAzd@,5FRdxA-@Mp`;@@ ;\p@ݍ P@00@MET00 ## @-`p(  @P 00S0?0\ 0S 0 jS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 lw@-¿H D=<<P4@0 ,P=U@:H&A-p`P@ÿP V0 3jlG-`RM@Xr yjPP d"jP`T `EP P9  ,Fp 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  EpU lEp* `i\:` 8  8 ,     0,00  ` Ep 0`?`a8S=\Pb 0  0**0P0~W ) 0* d@edAzd@;,A-@Mp`;@@ Zp@ݍ P@00@CT00 ## 0-<\   RS  0 SL& 0 /LK*Q@-$ Q:|O-@M Mh ⩽0Pd00h00\00|00p000 0L0$0l0(0t02000040<080H030<00404040F00G00H0040P0050%+<0p 0S00|0000000S00\?00H R00S <Jt0S  Pt?|0p 0l0- Sd0h 0>i/0;CpD @|0@ Sp00 DCP p 0D@q9`@P\#CpD rDP (Tl0S 1 : S  R 5   "`P`0z W`r`Foobr PV   P  P@DH 3}pTrd0h 0 0d 0Dh0匳d0h QP  h0@ i0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100} S0T00RS00 R0 R0S0T0z /q0P00a+a` pR  W 000 TW 0`S`SV Z T @0S X0S2|0p 0?0 D0p| pcT *ppv @@0S ?X01?0#*@0bph X0S|*Yp_ XpZ 0dh営[J U  U* >05[R[:L0Sd `!0SV 4PX` VU L0 0` V `DIJP04!,A$ 8!00 0P V0 0  PP G趢pP`0' 0Pb0S 4 b0 劶V PK*-6s@-pP@ 0  4X 0TT#4LЍp iP `40 4PK*P`K*S@- 04$#$04GQ   Y4 Ѝ[cA- M`  < P1@ 00P 0! 0>4))841 (34A4:.4<4A)4pQ`F@UWPE: Ѝ4gp@-8A0MP`   0 0 010R  4    "!0Ѝp@3R  $    "!R ϵ0S1$#$ 0("( 18#! 0Ѝp@30ЍpPK*1F @-;p)axL*WP@- 0 R * 0 #  @0pW*P `00CS`0p S00 P0S X0X /X4&p@-`p@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h>d<`0IPp <10C <1$0 810S81PK*_&&H&L*O-@3BR`93d63hQ 113`RU dUt)3 2d[~ PX2z h2L d 0hPP[`p 0 Og 0Lg 0J;g 1 5g 0g 17g 12g  l1*g \1 PP!g#P42 0* $p` 0O P 0`pOP̀̐`0d 0gd)d 0g 02<ЍEd x0f`pd 0g 0H2fL*qPK*M*?_&@@M*M*-C6?<Y@3@--0d2S0PK*@0@-0S0@d2S`2"R2_&PK*@-@ Ѐ8!<qЀH 8!5P P0`p]P 4 40]PЀ(00ЀX@PK*?333333?_&O-Dd`"a2^4M"P40pRP=p3 2042 0@0ЍPK* N*O-ЃP`@p(' 0 0 0T x0 p0 0h   X0 ``d 0<0 0@$COPK*#@@+H&80@- 00RPC@@A0 1.4W+H&@-5`@ X1L0 PX@1 01 A 1 0-ZH&p@-0@ R R 0 RS000p\RP 0SP0PPS'R"R `0S S0P0H&Ru@-@q P l00S\ 0@ !0R3 @00SP $P990TW+W+hW+p@-P0@000`?0 Q!00B 000S 0 0C!0R3^0 P 0 0*0 00 0R0 R  C=00pTT\0 0#0%0 P/0@0T&hW+TW+W+H&劑A-@P`p% P0 SR 0S0B0Q3 04@ 000  {hW+TW+W+\+P 00CS0 S00 P0S 0 /0&A-Pl@puP  PcPD``V :^,0/S= 0Q@0R/SB0S 0`/SS  FR0.S`@/Q00/P R8P T0t/SH&0O-cMM00@00<+0< 0<0<00 =P #=R0,3,00,30SP0Pl|plO hhh h/` 嗣 00 3 S T@@ 0T S S00 K#]`E0Q`0S+K [OE0S3/S;+K .K @0 M@PX[K> T 0"/tD t4 t$0#-S88<8xS`S)?S DS .  <(8( Ny*@0C -K+ C 0BK+ B00CS00ND*a0CS00 Ϊ  ;PK 0@P< 0@0 9 90S9 00K +K # ⨪hI  PK 0  PK.  K   ⍪   PK P 0K. ~.80  q  ޫ@Pjkk 80S H8  Y d ƫPR_?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?0-I?V&.  x ⊫`PK PP H70SD'0 0C!0R3 $70S0Sy K  @PPPh Vpt0@Pp n pt@@hP0X"T  0T\  XpW pHS  0QSL0Q㭪0P@t0 X\ D`X0D S@0S( @DU2 PP PP<K 0P@0 K. -K>< 0/ },@@jpP @v XI >0S$0 0C!0R3 40S0S 0P`0ӪP `0zͪP c=0,C0 0 S;.000 B-+ c0  d0d0@ 3FS p 1 01 Q 1 \R \>?p@1cD0DH`X(D# R  D-  Z   qY   \0T0S lD00D0, L0 SH00H0H P0S  ͨA  8P0S>$ = ⶨ  #PcݍЍ ⩨  ⣨Ta ? PP|A80S  0 P  ⋨ ` P ~ 0 Pwy r` B  ݩPPi@t0SC 000+ ⵙK+b P0 P<ęP@O 0 c0O0?+b  P<P P a0?0H @P _P%PD   M%L P _PGPt]ߍhW+& W+@W+XW+ _& 4+ c&  .  [+0C 0  R+h X h$0 ⊑ 0 D h 4+ ,  H&/ X A-MMpG 00 0/R @`㜀G>PP 0S P@ۍЍ D 8#`D @P 0S ≡P`4+. p@-0@ @P P @p@-@\+@O-3tM0 S m댣00RS|3 p3p#0l"hC4#S\C3TtЍOSDc #8PL   #+#)F0@`00+Aoز`L<` 3#L\0@ g$XK= hpWW#XA@P L<0@(e0PxSiSfP 0)0@& 000 "L<0@ Q)  AddXDL ]tЍ0 0C0H10S 0pS&0` S\*X*h0SS   1810d0S X00`0\ K0P!xp`p 08#*hW+&u XW+W+@W+ c&_& H& 4+\W+  ; _ W+`W+  A-MpM`@PP 0pp@d!d+*@P TT"L# < 0"ۍЍ aD D< r*pPU!** U`k )p0P "|  x"0S )p T0TP 8 "ܤc 8 [E H&4+\W+[++V`@-2P@-L@4#S 0  +0#S 0 @ +_&0A-@P` 0 P0: 0lhp ?0@$a@00S$`V SRW+kv+TW+ 0S 0 0/ R  /0S0 `0p@- P0@P*D` ?߈0Pp UTp$/pW+v+0p@-P@ 0 P0: 0|Ox` ?Ỉ01S 0p@D? $ P\@P@ p$0W+v+@-MPM@T 0``p/VVP   :P @T@ۍЍVP @p@-/P@P@p00/00@P 0S A-P/p\0@oC 0T@@DZU pDP@Dz+G-pPo`04PSp@P`0PP0C0 T`4 $TD@v+pW+$G-頡FPTp A`Pt&0@(0C0V$Q@$0( 6)00v`PPEPP o @$@@(`/H 0`0 @ `P`I0P p0@0 P $9 v+pW+?az@-@Ԝ00$D v+0@-S@ 0S 0S y 0S s0 Pjg T` R 8dD0&F$ ЀP 0S00v+p@-@`PP|80S ? 0P0 @/ᴕPgm0P 0 00pO-2p0SlM Ϳ|20SHld PP T PE H0`000@,Q 0*` R 0@*@aQg %1@ $10 %1 08`008<ʒ0@ WA p  ]AZlЍ 0`0V@ 0 0/⤒ 0` @T`$ >000 0 0($00S0,00S0(0 0S000$0S0400w@0 1S0 00k@hW+&#\W+>@H&KW+v+xW+W+HW+wC-20MS Yr 0\P0 00;000Ѝ &PP Gd `w X87(P 84 $h $@0@D`P &P  O &1RQ rQS $0!SP P0h60 m&P \1L ! "H D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", tA R" hW+&W+v+H&AisXW+xW+[+W+DW+ 0`( "4`#//$,%O$#m긪Ꝫ0@-0@MT[0Q@X0T L0LP H  Ѝ0@Q@}+I[+H&0@-P [+*H&0@-Q 0@T0 R |||0AS@ ЍH0 D5'P3( c_&W+}+H&Qg&m{A-D@p 0 0SP( ` `आ `}+L0@-  Q0 0P ,065 Ѝ}+[+H&@-0xP 00S@%*S` nP@` 40P , 0  Ѝp}+[+H&0@-0@S 0$P B5/x00SP`P qpH0P@`* 0((@ ЍPW+}+\W+[+H&p@-hPh@4S 0SPP *D0P00040 4Sp5,}+[+PW++0s@-0@SP  40B3/p00S\0 $pH0P`@ן^ 0((`ЍpPW+}+\W+[+H&p@-P,@P@pP @p@-X0XP0SpH`@P P  Լ[@pHW+g&}+H&A-P1a051q0S :pƏ@P 00PCP)7嬚P!DPm 0B@ !4P] 0 000@A HW+}+W+DW+&79;+G-pa! U` \ 0 00D! U 4q4$83(S$1$A?@" 0 Q I!Z/ , U,  0 00`2 D |U 83Sx00"@0Ap !-#00@ JmIЍ([+w&bW+`Z+mH&`W+Z+LZ+O-Tp0EMSP8a  ,, @$3po0C 0T*0 ?o2W03S 20S " T  j0S *Eߍ0S3 000 |"M0S 0t"! 0dDKV V V- e  B B B 0 0C$"p+ 10S +0@  B B B 0 0!$   B B B 0 0$X![ HyP 8tP# 0S k V    V  p0S    V     V l p T ~D hW+&TW+Dg&Rr ! 0P/00S O"g&}+P O-6M M)$ PR P  50S@ލ Ѝ90嬕e@T {500RSQ 50SM\5pE9S)0D0e0000EH0D# `8պ0@$к减B 00 (4 S B@P%庺DⶺB89S; B. 0 /4B( [T U@ 40T 949 dj #ⅺ3NY0 043B <300 00zBwlPp`g(4 S B0305 3 R s 0#p   "00K "b(@62B0 050Ƞ30s33P03Ƞs0 20S )Tx0040 S X(L#R Q0cÝ\V I $ ?SB 8S z 1 )a#0)90S 0)g(PU @10S1$10Sh 0 X `y 0W090C/W pC0S 1W 0 ;pWJB:B6`FVU 4S 04(0 ZBJ}+4W+TXW+[+4H&W+[;tg&HW+TW+&"9W+xW+tFW++O-dCd5)SW0pW_`R00yu0SW  0PS9 S00P0S 0S D09 R ?oV20SJUMU5D R4 pGW`pVp``'\2 RD R: R; 4<820S>,P: %+ 909909 Ѝ0 +"+R ! R  xxEUY0+5p`PlP d<gX (b`e W0S R P L00 ?Tqp V00S |尸0S 906;#;S T%xO+X{}+HW+g&TW+&H&=[+TlW+hW+kW++0O-'BM @R MxWtPP 'P P Bލ ЍDW0S870S ,,]00 P 70Si  "4h"42|h|004488<<HHLL|{{xx|]|{9^E{E{:^E{E"4"42"4"42T%0A Z 0 0 8""P30S` P V0A 0 ,#0 0 020S   20S620S P@ 0 Z 0 0 8""20S 0  m "`b0 0 08y10S 403/ WW !P@Z00 0T10S00S 0 0 8/,00S 0 4\  03/Z 4   00s[+=H&hW+&dW+\W+}+3X_&k4Z,[[}+`W+8lY.PW+ +\]]OA-1( 0  S !@ 1 1R 4S8 !4q04~@0n`P1 PP0S  R-* SR/ A P/ $!0 010000 QP 0PU 0$N ^!P Ѝ0PB0P;C0d0P70S050 000 @ 0@0 0W+[+T}+W+@-cM0S tt4pCpS0S YLPx8#044 R0 3s 0500L Pr5"0C590C990C9000oPpp 0S d2l"h2Q090 9 k hW+ &p@-@Q @ : 4P * , P  $P  p$P ~d P0T S0BP ,  %p@T H&   ! 0@-@MPPPP8 ,0P Ѝ0PP!`!+@-0@ M \0 005 K( ۍp!p@-0@S mt0P0SdXP 0@00p p@044000Sp p@!\W+!H&hW+!&A-/`@Pp/@DЍ/SpPP (0 00%P0000S@-0@S  0S 0 000h0@0S FP @044E000S @<!!\W+!H&hW+!&@-0@S 0 000d0@0S Pa @000,00S @  "\W+!H&hW+!"&@-0@S 0 000_d0@0S _P3 @000,00S @1"\W+I"H&hW+q"&C-0M.SPp4`8A0/SS  >0  0PV ! ,-  4'          l  X N00@ 0J;Ѝ`W+""""""""""@-2; #A-@P`App` P L!;0 S000ЍU00긒+ #+#T#p@-BMP` 0 @E CR V  uvP0FS \0 BލpAS P0P S00@ Z:Ģi#+p# #A-P@`<0 "pW :A긒+ #@-+AP:  0S P  P:0+PP `@TPL 00p1 F0S6 0 00@1@00q`XV105 S:; S0*PP 00P  0 0 P 0 Ѝp_S-S p `0T 0D0P0;C긒+#Ě###T&#+HW+#0@-CM@P0, Q  0  DCߍ0#+@- @ R800踒+$@-$M0h ` 1  P'@PPDp$ЍPU De0P 9$$+ #@-d`$MC/0P@   8p , ($Ѝ #+@-0@XM0F/P  XЍ #Q@-8@BM0    Bߍ//$ 0`( "4`#/A-pPᄡ0`V  @  0!S l d9 庍 0T`0  0 d0 DoВ+f&@&p@-P@U U t 0<   $ p@À  &t&&&P 7P P N/ //&&&-M M? %*ۍ Ѝ&4`00CS`0 X X0 X /&C-pQDMDЍC聀@p `dP !W200 u00@020PS00C00@ Rp@T3 W+X( U U      ]| 0.       M.0T rHHV p8(N p W&&&В+'ؒ+'0@-P83TM<0S @Q TЍ0@4 0!Qy+ ( 0"0CS0"P FTЍ0@a  !0S SL03  ` X"d0AS!0@  0S(TЍ0@誙       00P1P2P3P4P5P廌0hP1 20345PfP# TЍ0@{ j@P=P(<P$; :9876 , 1jS$ $ PP  Q Q  P ~ (y   x\TЍ0В+'@&)(/(%8(('E'(%(K))))-)2)8)@)G){))X)))$**O-@`pR,/,%f&p@-P(@P ႆPp@g&0S R  R Rp0@- \0(+@- ,*0 0000 0 4Ѝ\0P P P$00000-L ,M0#Q S3#: ,Ѝ 0\17@-P  Q ,XuP Ѝ0 @P .{PP Pd1(+(+0@-@QPM (1a! 4aDaS@$0d@Oo@@e% e4eT! 0S01 P Q T%<  @O,uЍ0%(T h \>%T @ 03P" $ @ *l1(+d1r1{11 Q@-.@h0 \!:@:@QR  0(+\0(+0s@- @R`  &P.}zP ,Mu0S ,Fu|Ѝp l0!PU U 0< 4Ѝp@#Ѝp@i&(+d1(+1@-@T T 0( ( ЍЍ@/Ѝ@1(+"!Q p@-@P T p@<  p@0 p@111O-0TM@0"0 0 p @@0@$(@PP PP 34 @@0P``rU\TЍ`P0  EX y R@x   ;y0P fyS  ,\100 0S00C00  Q,P p0 4p0 0pj R lt`00CS`0 X0@T:TЍOX0 X @1112&i&2@-00= Ѝ@-0  5 ЍO-@p P4 aT00SP Ѝ -QP  P P ADPP@D`FRPP2@-0@ 00 Ѝ@?@- H2H&@-2@-QAMp M0W@`0l$q`Q`\0j rp0P 0\0 roAލ Ѝq0R S 0P01 b?t0? Y!R  0Gy@P!X6 T6<T0 <jM<@D@ D Z0R02`G +H24+ 3@-4+0@-6S +3p@-P݇xڇm/lA @Pp"  P>  2  ,$  p@A 3(+4+@- 6H&0@-h@  0@ 0\Q0CS @CT&p@-@Pp00Sp8PU``p840#U :PJX0Pp4P8P P AXPp`P -7@- 0@P0s 0P0S0! B Ѝ0@Ѝ/O-`dM@P rP谟 U0E 0 S ၓdЍp | J ]  ^Q!0 p G@   ⒆0  .0`  Y0BTP 6T&~7t7y7@-@`Pp@"!0# U 0 x'ph 1 XP@TP("P  Ѝ7777-,M! L 0$000000 00 ;0[t7H&-7@-`P @XT@ R 0@  000 Ѝ0@Ѝ/i&R8+W8p@-PP@ 0S 0CS 23 0 0p|p@ TT 0 0 p, ,Up0Sp++`88A- `(p 0pЍ P F1@P  PP 0pЍA p01Sd0 \ 0T2 0`p 0S l` F$P `8+i&878C-q@1MS0`q1SP1SgV1 묁XV @ЍCVU 1S  L1ЍCvV8mp0S* S S  OX HDH WV)ЍCQ  M 2X   ( X A`1 TT, ЍCVЍ+i&8&R8888888884 0Q 000/ +i&8G-AJM1MSp="v`0 Pᒄ c4F0 0 Fmppp 0 S JލЍ;X P0sA7J.H0 0G1$HL  $`000P Pp) Lq0S8j1!0 +969S98A-XQp1`S1S@1SFV1 1SV =AV1S A 0uVlS D@d0S VA_0  pX1S XQQ 1S<I AV+i&8&R88t9y7l9A-a0 MSP@>>p@-`@0M 0(`` 0 )p<Ѝp R  ,|P10 01SL0 D@1S*^KP !3<+i&8'>G-@M`Yp2 0S 0 000 (bP (P (0%"P`(` P@P@Ѝ`(P$PPv (  PP$0 p@ЍG<(` 0v ( 0C$ S  N,v%Pp㠡v00Y0S Y 0I00l!,k,pH1! < 0( (`(Pv ( \ (V((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! y+/><i&7>R8>>C-M⬀p`` (VW0P0 0000 SaPPQ ЍPK@P. PP  PP 0 p ЍC 0R  +0W400(00 P( 0SQP v0 Pp0!00(kP0Slp1SX`D0S U 0 $P/><+7>i&R88~>@-P@0,M0@PP0 p,Ѝ R  5+0 01Sx$5/@PQ/ 02` pJ/ 02D/ 02 0<+R8>O-xrMM00`S@ ]TPO P, H*J@  Y:0@@ 0E2p.oDٍЍJ  Ͻp  Y  * 9 "QPR !,%*1 21 ^0T 1S1!T0 0*T 1!0 0*wPy0 D rW z@y 0 D aF+>>>O-{JM M`P@y03~<0y0`400pc?c8000S0P0S@pTlK+!W 0 0T+4@pW8pr4S U08pA/0 :<0 Ur> r.0 014@:@#TRT 1S-  IR:1t Y00 ! ` \z@0,3p0wG, AEj,Aj|pG y, 7j, 3j뀀pG  y, *j , &jpG  y, j,x jpG  `y,T j ,D jpG  0y, j, ipG  x,i,ipG  x,i,ipG  x,i,tipG  hx,Pi,@ipG 4x,i, ipGX 0 (,i,i 'HwQ (  Y\'0Q00S? 0YS; XQ;X PD0]}4EH01HpL001`00pD0 spMpL0X10@sXp&4 0#Q0X00Cs 1SPdX0@sEYG4 0BeYPE pW.- 0// i4epS u,+i,갠Z 0 R(0 R FpP 6} 0 0 0P3A7/%00D0 Jލ ЍY@ 脟 RH 1 H0pH0S# 0 0 @3SH  [e8p$W"RZ 0 00@0P0@3A4/d4IpY 0 0 @3S$1R 0) 403001P  0p 0040 [*  Y }0 S P40Sr0 00   $ $  0`p`08ᛣ#0S P   B ( P R0X0,( q0P$0 ,( _|$0H0pp 1p0p?  H0pp !p0p.;㨀H0 H0pp.}0 Sp H7pP  H0pW w0 0H0pH0pp Hp0pH @P0P p ppH0p 0H W+j&>7i&+R8t7>? ?$?D?+T?d?t???????>?(+?,7?i& @O-`qM=P`l@P U#*0T?SD00pnhP.0p0\809p R  `1`S,mTP`  J{00 14PC{0 ,&@PwCj&1CCCCC(+C8C @+0 &p000&00' T00.T0hp0x0SR@@T T TJ0P 000@L <@' 0@0& 000.000h 00lP,4- \00p XA qߍOFx0S \0P0 0 0000( 0, 0H0s@-x@ 0 P= ^p }` P @ 0  C HH&t0p@-@PT`%s P  wp@0Wp@w 긤+III@-M @ ` P  M" PۍJp@-IMM @`H P%IލЍp  P0 咶0 l匶hP 0S 0S0 L0S  PJ J/J+@-M @ PDۍ00 R   PJ+H- p3MM'PPYW@DrP 03|rP@ P 04jrP00 S 5P ܰP00 S ) ҰP2  x Ȱ`Pa `2P XBrP ,IgPP0 0{U,00P`x!0SRX QJ0 P J P е1J@ Pp10S d 0r 0dqPPPUX$ PvU 0 V, )PmP`ZZE_oR 0\PPwvU  4S J P pxp* 0XH<PTJJWJZJ+dJnJrJJJJJJKH&&KnKFKO-pM M`;pj/ Sp P@@p p p0Wp10Z?:0S Vލ Ѝ00W@P @Pxq(0IT*20Sa00 0Z0@17 0V98 Z RP u1Z. @9qPZ 0p V㧉 0Z 3P uZ. pZeP uZ. _KZZP u 0Z. _C|dKedA+K0p@-M`0 0UPP0@P\ UP Ѝp@8P  0 0P : ЍpK0 S C/p@-@PJoP`FoV pp@ppO-Md `P\0`VV@ʌ DЍJN`y0PhH0  H0PD0D D0S  (:DHcU U U;0980@n6091090S9U@800\ 0S0R0SX0 0P409 PH0`p 0D40Xn*0SP ?n(9S00 P 9S00 P9S0P P0SP0 0000000 0% @04P P@ @ H0Tp,0PD00CsD0:\0S ,0勄T0[S00Dt  (h 0`p  @;p HB00780@dcn40J~S01404Pod0S 0` Se 0`<04L0<0?h0?l0L0?x0X0S> <00SQ ? n 04뀐?ɏ 0m0|0"<" 0y& 6%<0C 0mL@ 0Pm0| 4aP00 0P0<0 0h00`@, 00l00,0L0T 0x00T0J~P 5 00=p%?4 $;/p L@H% $p <0 %C?4 ;$p 0 400 00"<" 0 % 4E%00000P ꀠʟ 0^m` 0Xm 80@0SS00勄T0[S,0僔'  pc 0p`p $;p , 00@[04$;pu I0 ꀠ 0m `0m80, 000@[P 0m80008 P0S00@ t4D00{ST080U  xb0`$np0 ,04@$;dp& @08 ?#"0@p*@0Up , 00[04ᠠ$; @Gp ,! 0! 0 5% 1}$n F`000040Pp PP$V`?,<0! 0! 0 % 0X$00, [ ?xl@08?!@0  ?Pll,0 ? Pcl <0DP\ld 04%$M?MFM, LMML Tɚ;vMLMY@MMMM NONN@-r onNH&A-@p4S`  PT0DPEE$UX  mPV00mP V0-04 P $3MDPE@D+N Np@-P@Q0  0 pmP@ R 0S L~#Pp 8a]00 0, 0p$p#`j&H+4O,GOTx,Px,Lx,RO@- 3800S ,0 0$p  Ah+H+ZO+G-XM0MS0 DpW,Q`@`$$Q0 c+0A<P 0 0 ۍЍ0 000nS ?S aS ppS qS x0  0 d00L00 8+p+\OH+jO&+{OP&OOOOA-X`0S L00S 08P8@p0Pp00+h++p+@-@L0@n2@00S~&,0, 0S00v&x+L+l+,+C-RP`tM  4ş4@ !Q RP ğE R`S k0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ Lo 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+[`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 坍00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =T&P&t,,t|,tx,H+PPA-@@P@T 0- @P`p0Sd@ \0 @ FP ,04 0 0@AP`j&H+P,Tx,PA-@P@p0S0P0`x0 R `X R0T @ 0S 4 P@` Lx,++`j&Pw,GOROP@-, 0 Fꘀ,QP@-, 0 :ꘀ,QP@-, 0 .ꘀ, QP@- , 0 0 Iꘀ,H+w,QP@- , 0 0 7ꘀ,H+x,4QP@- , 0 0 %ꘀ,H+,x,WQp@-PAM C0@ 000 0S0! C:P7 0S40=PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0 Q000S0&{AލpP/, H0 P @0  9PQQ,}Q,,,QO-1M MP, p4 1ݍ ЍPX$9P @@4@@/ ,P_ 40S d_P 5pPV / 3Ps垏0S30S 3Y30S7 0a@P0 |30 0l3 0# T30S0%Q03@OoB0B &Q 30S  2` 0dP0002`P0 0R " R `2 T" R E@P L2\"00<2 0H (20S%W 2@OoB0A% Qo10Sk 1pP0001p^, l 0 PA0S0 ,`V 咟Q 10S 00S2 0@P- 0! 0 000| 00S% Q0@OoB0`@{%Qx00S  `0 0P00080`ꘀ,Q+ +L+4Ol++,,,+h+,G-JMMPp 70@ 000 0S" 8P+ 0S(0'<PP# T0  1 1 R0 0S0QW`3 t1 0Sh1h徊P* L1 @JލЍP @$! g8PJW$Pim0S @'00 R000S00 -'|0p0P04qp P0ST00@Q,,,w,H+Q,QQ, R 0 0 0 0X,R 0 0 0 0N,RRC-KM MP&* 2 Kލ ЍP"7P @`2`R@\2000/'hP 82 0S@(2- P0 Qo` 0S 10S 1 1  3@P -p1@d10S x5PT1 l0pP 818!00,1 00S P- 0 0 0.>?0T p or_&t0h@Q00S x0p0NP0 00P0pHꘀ,R+4O,w,H+ +l+L+s,,,,+h+QA-PAM f) 0 $P`P0 0ꌀp @G MWx @0 0\0@@H;@C0+6P$Aލ0S 0 pOꘀ,PRH+,P0@/tRP@-#)0$ 00 0ꘀ,xRH+Pp@-o@P P `hP XP (pU ,0Q0  C0 pqRtRH+R0@- 0Rt+,P@-( $0 00S/0ꘀ,+H+R0@- 0R+,Pp@-0o @PP0B T0S 0 L0S P (0 0pP@tBP<;P 4P(00 ,#관,tRH++(S>S+,qRR0@- [ 0AS+,0@- Q 0NS$+,@-(@(0 F 00S 0 +dS,,0@- 6 0qS+,P00P0SA- <(0 !0ЍPAaq0S000+0S 0S1>000PPP00P ,V7`0H 0QD084 ꘀ,++H+SqRtR++SS0@- 0S+,0@- 0S+,P00P0Sp@- '0 0pP`P@lP# g0P 30P xRl00?o2`SP@8 8 <0@0S000ꘀ,H+qRtRT++"TP00P0@-S ' 0 ЍP  P5P 0Pd00}S`00S T0T0HuP 40 0, 0( 0ꘀ,10S|1ЍG^T`pE8=& P1 Ѝ@5V@ 0 001"T9pX G(`P 0S bP_5|0@0 T `T A%dPppTT TV@T Z7@P <P 0 ЍG0Uw,H+,DURSUA- MP% 2 ЍPR0S"3P 0 1CAcP 00|S 7P wP 0|c@p1l@q) XP#@HQo`010S 00CS 10S X) 0 0 S  V3P0 T.>00R   ]tp!+"Ql00S  \0 00P0040@ꘀ,QDUiU+ +4Ol+Rh++@-PPM M>%@p1@ۍ Ѝ)`?L@PC@@+T(  Qa@P@F/[P+S00S p.00CS0 .U0000 0 Y l0 0 0GP(t@<ꘀ,uUtU+H+\+U00@-MP 0$ `1 Ѝ0P H!200CS0,P@/0S0P PP P@Ia FfT0S0 @ʴ0y @P @P3a 0fU x0x妄T0S 0H @a f (0 ,ꘀ,UUUUUH+Ul+0p@-p@P0 p@c$\0\`0XPS 0SX/0S0p@n $00p蘀,o,o,H+U#V0p@-`@P0 p@=$L`LP0S-/0Sp@(L 00p蘀,s,H+T9VP00P0@-S $ 0 ЍP | 1P 0hPL00}SH00S <0<00 P 0ꘀ,NV]V+H+dVVw,P00P0@-S # 0 ЍP  1P 0l@PL00}SH00S <0 ڃ0,P 0ꘀ,NVV+H+Vw,p@-MP`+ Q@T \P?+ bQ0ES+ [Q@ 0 ۍpVPw,@-P# <0 ЍP $ N1P  ꘀ,VV@-Pe# <0 ЍP $ 31P  ꘀ,VW@-PJ# p0 ЍP 0S L 1P 0S0,I  1Pꘀ,Q WWPp@-## <0 p00@PP0 -Pp(ꘀ,+W)W0@Sp@-# @0 p04@PP,0Pp ꘀ,+4WPp@-" @0 p04@PP,0 Ppꘀ,+DWoQP@- " $0 00S@[+ꘀ,l+[WoQP@- " D0 <@0S 0S J똀,l+@-B0@-P000P0S " L0 ЍP@ 4e@P@$ _ dꘀ,`WUp@- M Pr" 1 ЍpP! @0P 0"p`1`w0S@1D0 0S 1(IP&P0 0S 0@T 0P%`VK@P ^ d@  K0@ P0 @ 0@3/H0T 00S00%ꘀ,iWH+qWWW+, l+W/,W,0@- 0W,,0@- 0W +,PA-PPPPU㈀ !00P@lph0hP00`0 @00OT,0P AOꘀ,,H+W,t,7@-PA 0P00ā00 Ѝ0P!0P%0S0P 00T0@0S 0 S  @T@00+T~O0 S +<wO 0 L/Pꘀ,,WH+\+L+t|,tx,XP@-00?o2 P [!0 0@0P 0P pP 0H@XR0 L< B S00Y0 +,qRtR X+H+000 0@-S0 00 +@X+,+000 0@-S0 00 +RX+,+p@-@Pp@0@- 0dX,,0@- 0qX,,PG-uR@`p]P\T- ,PPgT`( ,@P`_$$V; W P10S- D1D!@1B0S 0(T`PKV1P1@W 00S 0 0B0S 5 Y$ V$t0Pp0@PPl+P X&P H!P n Ѝ+H+tR++X++XXmRX @-s0蘀,P@-T x0 pdP \00}ST00S H0H\@TP 00 0( 0$ 0蘀,Y+H+Y0Yw,o,o,P00P0Ss@- ! 0 Ѝp0` 0S P@P ͡0Q R   L 0Ѝp@$Ѝp@ꘀ,w,H+Q,5YSYnYPp@- $0 p0@P0Pp蘀,+YA-P0 "0Ѝr0S2P70S10S 1@a0 ` M0封S Cb"c! !    c#A P0U0C00CS0<\ P?00CS0@8 P7 (!a-PS0p00 P 0b" R  c&0P UR PE 00P0 0 Sp(0L0 0 Sꘀ,8+H+Y+YD+D+D+&YZ;ZP00P00@-SM  00 0Ѝ0Pl  ,P 0)qpP@ 0 $0$U@00ꘀ,QH+gZP00P00@-SM 0 0Ѝ0P | ,P 0#)qp L0@0P) 0,0S 0000ꘀ,QH+pZP@- $0 Pꘀ,tZ@- (0@P0 @URH+ZP00P0A-S쀟 00ЍP  q,P 0/`P PPP 0S0P%[@"[@@-p zL DBL >Lk00ꘀ,QMUUPP00P0O-SM  Y 0 ЍP  ',P o @P@ 0S0@Z`-|0P 07L0hph`h@Ѐ0000 0@0C eꘀ,QMUU,,+RPp@- 0 0p`@PP |@P P@*p @ @000 (0@ꘀ,Z++H+ZA-p`P@Pd0 A\vP 00X-4 0 RU AaH+Z+ [@- PP   R Ѝ@P   HR  D@0S00 Ѝ@`pꘀ,"[j&H+V0A-p`P0 AP@PLp @A P 00 00蘀,H+Z+[Pp@-g H0 p@00Sp@000v}0$@$P0jPp蘀,w,H+<[+i[0@Sp@-G d0 p\00Sp@L0LV}0@@PP80GPp Bꘀ,w,H+n[+[ @Rp@-  l0 pd Rp@T0T/} H@P0P8 Pp ꘀ,w,H+[+[O-MMPPQ  3 ٍЍPʴ#EE*P c@3pY 3 y ZP`@)LJ0p㓄( @0S (30@ @c0S0000*p`J2|2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )bvJ0 Y`0S@iR0@S 0 F)bbJ0X`P1s| d1 0S x10SL1h`10S ,0\|00CS0. \ E 2J0 03/00S 0S 000CS0 S0  )tJ00000h0 'Y 0pS7 ꘀ,^D+8+H+^/,T&`+^^l+^+d+t+@-@P ,00P &00P 00 -h0lM X00S ^H 0d_ P000p }x+h+ _H++-lMmT00S p^D 0d? P,00p ] h+#_H++A-@P p0 0C0S13!X `FEP@ 0 B RQ@  0 0C0S13p@-`@P:NP , 0S!PR x,p@l,*`(P %gNP00 0,|S!0R=_Q_U_F_p@-@P j00PU W \Pp[00p@-`Pp@0P< 0Y.0Sp h0 S˜ Ѝ00S 0C @P2+X_P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  BT&G-pP(P SR@ _DPP0   VDPN0 0010S / MPe *`@MP 0PS $2` P):`MP P)P :MPP000S`UK ⿚0S 00S1 @RđR0 d TDP0 0 U ))) 0 011 .Ѝ @P) `H 0S000) 0S S St0 0S 0`S@)H0PU {),Pt___+___+s_|+q_ - BR0 R  P R O-@M M tPE$@CP0DHLP0(,$04D (0p0,0DHL` 0 0S 0S X 0Sn@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;`O@P d'P T"P DP8B (=000S V PU@ /9OV@0S  JGP @0U0C?o20S b4pWp 00C00p0Tp pW HGpPpUP 0S G0P00 $ 0R 0900[E+ GZ0<03 0 048)3 x30S7tZ  v(@L0P0 $3@@k(:L0P@ 0 @_(0`0 @h0 `0PPx P00@sPS Q(P Y0@ 0'T00SPeU 0S} W +XF+XcF+X_FXP+ F0!0 4Pp80L YA+ P0|FE>0000HP1@@DcT@@/K0P  00+L 0\F 08 04@ 0R 0S00}Scx0S @0S 0S@0P/NP0Y8<00 @_____``;`r_+[`l+++_w,a++aa,`H&`+O-kMMP|dUZύLHD`\X1 !0PX0C6|Q0 B?(p8 DAX'XHU'La\Q'PQ尡V?Ⱑ0E?oT20S`dQ 0S _PVV 0S#UU>0Sl|0s0s0s0s0S0s ~ ' >0S0 /VMP&&=0S 00SU  0n 0 /=0S !~P' Uu8MH-6>O00R)0SO !N6)P$/ > N0 0 &)00 OQ 4x=0S2@=P R( @@X,0 Rh@l UPD<0_ 00|S[ >T0#0S;0KT0BPK\ < < ?:uk,Dt;`0S00\  UP k$;/ 0S 00S 0P 0S} 7&DSo`аCpPp 0S :zL0PU1SY :IT@pPX ̻p0SU 0S_ h+0 04 P$P %IP  0ix!C_/0t1p1l10E?[/ p x10l1S 0S tAT# 0S icTP h [S K d0娖d00S 00S P po%tQ7Qύ[000D!0 H!i4 P!0R PP000W840010i/10X`P VXk04 0DΗPP0S4 0$ŗWXU`P@Tv  p 0q_0pP7/MP\80S  PPq/#@'C pC00S DTq?/V70S00?o 2#PP0 P60S P 1S% P 1S%6vF VSP@3 )hsC`60X6pP 00@T R VP 00@T Q VP 00PP XN` UEP< \'(P<50S2P@T4dL! &QQ &R &pSn `40 WE:e0 0- 4Dtuu & U@45 4@T Q?10/N00 @$L!e&Vu 40SlS`V @ PY= 0 P&0!J&p0S0AA&W<&1p<00S`a`ST0EP<0S 30S 3 0>@<  &V T30S 3 .@ &T ,BL &&paԲ420S (3t`xR&0P0`0#@ P0DHP> ~GpPP`@PPj dz08 R 1000@ #@pP`萟@b>0@`0! P0P B@ pP `@@0S Pp@PP.ࠝZ  0`0qPd l1Q00S + _+b,b+,b&4++w,bbb cLc+eccc_~cq_+8+cD+/,`+d+8c +c+d+aaddddeq&T&Tee"ff_f:fgf1fff+>gLgugtb)g b +wggg2hg,+@B+g _++|H+?hȀ,+,+cP> PF 0*S0 KQ;0-S7 ?QP/0P0+0 /R' *R0 +0Q@0000S!0 0035gP 0, y\0T\yP 020SyP "` P `P t2m Pn000P {P P Q "qmP80S S WO D80K/CR032 V 0S|"0 0 $W5V6ZB Z4 0p#2Sm#83Q0SQ?0<0!3 (XSQZ3 TL`H0SH40A {u00P 00S0xsl4 r|00 P 00S& 50S004 r0st4 @ 0QP `sh0S050n5|2S % R 5 P 5P P P E! 55`0Əs 00@T@ @V  %P|~T0 0 厱 2 @R T0"0C?o2? T"0 "0ASa0 S ;S0 VLPP 0 R RT L0SF0S(0?d'"( ,0< R /$ $ T @ "<<P s@"RD 0 #PP#Pp0S0S{P80S#@P x\(X000 R0HL0$  0 pwx'xl h4phl t pRTpPt #P U @ w RX90S P90ST9LyP $F0S @DTʰ90S Y~o 0 0S$8 (PZ0S= S E#F: :`00S0T0S; rpqdJ   $P Z L#OP  W` b:0Sb: Q ]* Q0: R:# E ;R/sr  / 0A3/@<pt;@ e; R0 ;Q;8+0 0 S |n j f b "0S,L< 0R.QVBZEX0S ĵ000S 彵000S 嶵000S 寵00kލЍ0S 03/0S 坵00@-P @:P  :P0P 6 Ѝp Ԍ`P G A9P 0 FUhLP  Ѝ@Z 0S S0S   90PP__Yhb_00@-Mh 00P P10S 0S00 0 Ѝ0  @T0 S 00S 0s 0 :BP 0B0P R  0 o@ T dMP 0|S 00 0S00 00004+l+( +++'gA-` M@p =000@00P,L0P/S:S X#L@ȴP y= <A=p$ (o=/@PE@P/:KEpP :@ᦴP  Ѝ@/000p0 @@PW@p00l0@@DcT@@00@0CcS1S@hr_h_,PP00/@-R (0@  000Q@x++@-Q t0@ d00S X0 0Pp <0000S Q@x+h+H+h+@-Q@`00S T0 0Lp 8 10 10S Q@h+H+h+ h0@- xX00S L0 0Dp o00 101000x+h+H+h++ -X0lM@ Sd @<80 0p Ji x+hH++@-0lM@60 0 00 0rS sS ld dd<d X,<P0 0p ,Yd $x+++,hhhH++h@-`PP@ @0@s8#80U 0s8#8000@(B(2b! !2P VU 0A0T0Ѝp00CS0 S0 S 0 /,O-TMxp|W00ʿ? p00p 0(P0P`0V0W B@0 @040SD H 8PZ0S= S Dg0 S00 @P(P0S P0#S P|0pS `1 R R 0Ha# |BPtp uTЍ ? 000 $@0 NPPpP0S lP0#S@DT|0S ld@"\DB$0V 0 `{#M"00 "@B+H+O-PBM MdEdP$P QL?0a>0 PPP0p`5(p 5 P<$@ P@+40S5V $ 0D  A0XD S00H00S+(; 0S 0 S     R  T!$ PP$p 0 A@P$p 0tp9# ap0tSS 00   00Bލ Ѝ@H3@ 30S VW@@cA UA2 0w tW T 20S 5V  R x" R " R W WSh2h <2'02eW @2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F3+ܕ x ,+@++ +H+D+<+i+h,w,TiT&+-A-` @T 帍 0 ЍAЍ/0p0$ P &xk@ h0h Ioa0@S P 5/~<+Xi,+ܕ zi+}iO-@FMs M` ( @;M 7M 3M0$0h30(0$ 0H,@cN0P SjN0  T 3 Fލ Ѝ*N0 @,Q(i92@@в@aGT  6 2 N 0 PD0P2d KCP h"hdF9 TB90S 00S 4 00d  qPP d∩@0S00?o2 7P M0@6M6 D01@0p  l` 81 D0(66S0d00 0d0 A0aPS 0ⷌP P 00S x0 0|0olP@0H x@00,X@0=++i,w,+iiH+ii(+i*j@+,j<+0O-GJMMsn0p얟VXv600S00p  9PۨX |6  t60 9PLɨJލЍ860 0 0 0y97S 60SZ6pj50S# 䵟0S5 Q U 5R "P 0S 500CS\5|Gj00l=0S P97S( 5D 58%80SX0$000(00000 CPL 40000Z40܀C XSX P4`0(  $   dT CP 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 4008'P30S@97S00000 0S   0pקw008'PP2 0 00 40I} 0 J pd 087SPD婧 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S,0 00 0<0 x1, AP!1 R  @ 0 0ZP 0S 0097S|0 0S [[}X  S[00000IQ+++$+(+Tj++H+j+l++++|j,jjjD+jk +kjk.kdk +kkkl4lKl@-2Bp`WLM LЍ@ pP=  p7 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/p \K0S XK0#S ȦP?c00+0(60 8[pp =K0S 9K0#S I p;p 90S0 00 0 0R%LЍ+++Mb[l|l+l0A-H`D0 82Vp  R`RBR RB`2b  Q  ,600EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPv40S4Ofk 3 3K f Ѝp30SCP PpuPHd< \3 4LS {P@04!2000 3 )bQ gP@$R000 0R0 0|IP  AP L'@P  0 2$@5D2P0 S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S 0 0S PU P 0S 0S T01Sl $0 h,Px,w,w,Lx,l+H+,+m ,mm+ GmL++@+mmA-M  @P0 8 4 t(t@@Ph(h@d( $ T( RS D8Q  Ѝ 00-S0S 8 7 770SN0<00@0D07 0=PPGE  G@Wn JCPZx7,0<7P3D"PPL7`@0 0wK2CP [-CP6Qx AQ ,0 p,0000=Qq T 0S 6 @0szD0s{xFP00<0Su40Sy6$ 0 0  n 00|S  0fpD,,0S5P5<0f k,,0S    5P<0,0p,0 PX0: S 5 L:4 i0 0,0D4Q PU>0 00S,  P 4 440S!@@5\4@@0Sh4@s `TPZ@40S 43040 4 (a 41S $ R 4P 3P P P C D0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c 48 8pcU|,00@ F00 0Q400@ F80030CS,0"p,040q402P001!P X/<0S <0,3/0,0@44@f1 R0PF0 SBT1#80 ? 0!$$P400@0 0 0 48 p 400@0 0 0 o$P0 ^w0#Y̡@9D 5,0S <0,3/4;++mȀ,,++L+H+mPx,Lx,,j++  h&,En,+4+|)nmw,`n++,cn+pn@-GM , 0 0@_$(000E@P˟_. +,0@@P40L0;K@;0 0;000AoDD0S>;0SV 080< @ t+ RD00S0X H0PLKNH<41<S$$AP $00|S $P/$8@E0SR E0 SN $ +): 01RS 41S $00-S0S |: x]d:$ dWD0S $ GߍJ0S : <0s^@0s_JP0080SY00S]9 9 h9T00$0S  T$ GT/00Ph90S TE0 S$P$JE0 S$P$ 90SD8Q0SPIPP?D0S!0S' S+80S -(P  8d(880sS<8  01Pw00S  &PlGfQ000S|P 7 H7 R0WBT41SWn$ @P_x74!(07 6 (0p(0Ip 0: S 0&0&071S ' R 6P 6P P P F-60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p(G:Q*$$00|S S@$g((0S$ @54! 85 580$ )((0S5$ß_00\%p00(0q(0P5P001!KPL8D0 SE4&80S 80(3/0(000L0S04 SDQ  40S 8 4R[ qp~ `R%'0$`x0pr3X@$P   0f bP$\D0S s0 0 @ 0(@dP`\ T0(0 00WPP sZ,pJ P @`@#50 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ C400C0 SE1(00@N C,00(00@T!000t 04p@ TL0Da0L0 TUA @(, p%P1 G1#BX嵞@PbL fi`00S 0 =< @ (0S 80(3/0 +h,+Ȁ,++L+ +++  nl+H+mm,+ll,nLx,`nPx,,mm&++,En4+|n+onn /0`H+HooQP@-X@ L0  P =@ 0 @+,Uo@-@B0 sЍlpQ p@-P,@P@plP @j&p@-T@P HPP  0R 9 p@+4r0rD+p@-T@P HPP  0R  p@+\r]rH+0P @- Pp@T Wp`W VL\ P  R/k&G-@p`xMp=T oTP ЍGFT8,,a,1  CQ@ ܿ QP ЍG} 8S 0S P pP  0 庿@DTЍP 0 hX0   - 03/ (  㛿r@+rk&rrr8 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/@+q&p@-H0H@8D0 (8080$8P  Up$80/,@++@-A(8S z^0 S )30) P p p $8S 80pP\ UP 0S ,8S0I^ (8S 00CS0 Cz0 0` 08, 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝp @+s/,& s*s?sRs ( P/@-@P$:P  37v^v@-@@0s,00p 0Coq&H+O-4$0 MM00/ t 0 `$`V (0PZ`V=  4@PH 00 !X4`X0 0 PP@ 0!nP@0H044P@30#0  0#` `뼳 P ) 3Z C00 0f `Z 0f 00#ϼ`< < 0f0 "徼0` U  S  RS0"1D0 0;f#;Z0S;#;0d("?;#;0 #5;0?;#;0@#5;DE,"匼0@S0Pa 1@V0\ 0oPV 1QR!0 P JP ! 0 !h`4\!dRY` f 0!J`<<@f 0  : 0$ @0S (P0S S d &@ d!0 S00p <Mߍ%U[0DEP++؀,.A+vv,vQvvvȀ,,vvwwH+@-D?X0@ R0D00S 80 00p  .?@+h+H+w-$M?0 0 $Ѝ0-4M 00 000>P4ЍO-pQMFV(L "0`Ch&0 0P00000 PU008 0R0PU00 6"R u0*P\0P 00$00S+ (0s0S  pP @p50S` l%A_``5[06 <5 l 0 QdXd@0f$>4`4Z-JP 88JZښ$$壢J f2 "`0xğ Q  # 3S  RS0D$1D0@0m/f00` `V480PZ`V=  3S  0 z0 "d3PT0@` 0P u"5=@`$5 T;&` # 3W  R@pd KqD $K "% 0-@0  j⳺2 @ЀX0M|2|d0Z,0@0`,00  0P0X00.*d"1\ ?\0=08"P@⇺,2 0@p (0S!0 J0U0!`@(0@PSd!W@h1 0p uQߍ 0 Xd ,_" 0 "@0PPj0P  *`P<\@0p<@f0 @.؀,,+++, Fw,HwȀ,Y@KwЀ,Qv.AfxwH+4+sxw@~x@-?=@3;=@p@-Bd00` pd00CS00jp ,P P00 @R0S"P7d`Qd00CS0*Tp "P \Pd00CS0Gp000S8A PA p0 0 `V{p0 c`Pd00CS0p 0@S P,P \Pd00CS0 p `V0 0 7Pp@,q&x,A-pp@`pP@ .,PP f@P PE y#P@OoB@,O-(U0mMS pTEPd |<0S mߍ80P.0͵1,4PPd(0P/S SUpF Pd4P PP P4$0CS0p- P P P0 PsdL`7P P X7P d0p P 0? l{h{dp P 0S d0p |P0? zp P 0S0S dg0 P P d00CS0p`2`X P Q82<0 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 P`, ^0!S^0C0 h7zP\\ +x,xxD+w,xxx y?yH+pyyyT&D+D+ zyL+8+@-0 @0SP  !P  0 00@ x0 lϞP T0 LƞP 00 ,彞P 0 T&iznzw,szzz00CS0 S0 S0 /1A-0aS0P0P3U  !P 00.S Pl`1hu \H!T1P@  D(!P00T,!,!,0 $1$ %U 0!T0@p000 00000P0 0p0S000P0T h0h0 @U t05P$0`W++zzH+D+H+zzL+zw,w,zPx,Tx,zw,+ ={zzp@-@P ?0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p<+l+w,w,o,++++L+8+ L0@- <00S 00 0(p %x+h+H+B{4+A-@:Qp0S `0S p 00`P00000S t`0S p 000080uT  >9pl+<++,D{O-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ $B>4P/S + a$+ ]$  P ꇾpVp刑0儁00g00000000 0S P1oE@19 -70@ R 100CcSppW00 0S 0o&000 000 ⍿$RVx@xPPT{ Y)P00++h,l++b{d{r{+,+L+^{,D+{{A-Q0qS0`00@S Q`Ѝ0VP ")P w0 R 0000@ Pl00}S0s00T 0S$@,U ++w,H+{{D+T&,O-a0AS04M00qSP Q 1U4ЍPH (P0.0t(P00`82P$ PH3P@1(,!/2 (A 1 0  ? %@, 72P 0 @ .P 0$0徱qp00P0}S0s00U 0S(@<hU F++w,,H+{|H+ |!|D+s||@-,@02$ ؞P|p,A-`P㾛dp㹛 @P  @P 9@㥛|@-@Ps, 0A- 0p0@S0`P0P㬀" (P 0S 0"S x0S R00`P"S0"S0 00o,++,,}o,D+0@-M M P " s@2Pۍ Ѝ0Ph4/S<1 @ 2P;0@TP/P0}2}O-@pP`V1@@P`3:2`E20P԰ Y/  01T@1PSZ 0 10S 0nT0 R H00S*00 0;0 ЍЀ,H+@-7P0@0 @p pP0 0SP0 0 7@ЍH+ht@Ѐ,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C++X}++@-0 000 e0S R 0Sh0000S b0C("( R@ S0 Ѝ T&P&]z7@-@P0S 0t 0p0ʼp\X@0S 00@ 0,庼p( Ѝ0@ Ѝ0+}+}C-@\ᄐpA`\P ^T1:00"\ \ L 9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!l+}w,o,}o,o,/A-p`P @FtP0  T  `00T  .0@ R   `FVp`00CS0 Xe PpTD000`000 T00}}&}G-̀P`.@0崠T2Rp ⴲ 00@)ax0@P 0⣲~D00< P 0 Ѝ/,?H+}~&d+`+O-M M@ P" 0<`0  <3P`\ )P # \  30S) P Q PUP Ѻp40@00002F.)P |"|F4F@lލ Ѝ Ꮉpp08\  ၹp \020(PS @ ᯺(0, 0/(0, jpQS40$S,F␡0I00S 咺0h$Q000SZ=9Q =*/?@#b!"/E *p5+40S '40#S [ 40AS  \0 0 PE0 P0Cp 0S 404 0  psP0\ {A|P3<003~(+5~H~z~+Mb~~p@-@P<p@׸p@-@`00CS0pP0 @ 30S0`0030#S V 300p0 PA-p@`pP0 @ 30S0`0030#S V 300A-@XP`p.P  .P0S ~@-@ဓP ~@-nP@-@op HP@-Pi0A-PhMQ@00 00 T  40S P 00 P 0 0a 0 PtCcXY 3c0S ,@,@@p   P Wp!P@ 0S @P@ , 1  P@, 1T0S @P@p~, {10SIHq0 S9 ,q0P 00YP12 qCAb 1 PP 00 @T N, K1 P 0 0@T ?, <1P ߔhЍT7[8P@&, #1T 11@T 0P 0`V-PP)e000bT0 0 0P@T{Q DdP+0+H++ &,!o,L+l+D+8+)./,`+d+o,o,7@-P* 1 Ѝ0Q0S 1 1忯P !0 CRxA R Sh10R P1P 0S4`S,1 0JP 0S 10S 0 0刯@@P 0 @0@0 @0 $@0 )@ 0 00S 0Sꘀ,l+w,4H+_+++b|++Tx,Px,Lx,x,x,w,w,,x,(x,w,w,+00S%@-@0M, 00 0P0S8[pJ@0Ѝ0@@+Ā-A-P ..D:8#1S0!$R< 03/3CPQ@RTA 00@S@b+Bb廬PP:*P @00S 00,S 00S0 @10 3/P00000S0S 11 03/0S+000`0 P0 0 SWy000 )PB0h P00 S{@^0000S 00,S 00 S00S 0 ` 103/P U4000(0 [ ,000@p` EmP;,,,d ,ut&,q&,b ,ҁd,0-d,@-- 0 $ \,@- 0U`,,P `00CS`0p S00 P0S X0X /X?&C-Pp@  l18C8S `l 0S w 0`V   Ѝd,t&\, ,@-9_-\- p( P@ 5P 9K-H-ЍC-@-X0/LA P 00J,!J &t&H&+.:0s@-@ c1`8C8S P0S 4' S HO@0 h0nS ~Ѝp@,t&EH,GP,I@-PMP Tb P H00S@0\A PЍ @3P]9[,t&au@-@80?T H93 X,x}D0@-|AT 0S & 0 t&d,@07@-LAP/ 0P00 6 Ѝ0t& @-@0S S S 0 \R0 R \ @ RC-P@ M?]&  ?X& p ?R&p` @٩QT@D0 @ЍC8s0 ,ɩ@T*Qs00!r&&G-AMMP`PX&B  l2l h2 n\2 X凱 0 0t&ow@-  D|H&O-P4M$`4~`=@PȔtȴ`0 `4$$p0Z$ dQ Y  Q|x$0l "P0\$\40X4L'@'4'( ' 0$%!PS pP [U Ut @DOo0B#10<13 B0lS010S P   RpprD tS`S FS4 9S/S0Su(#a0CS00yES2 PPS2PF"Pu A"PZ x<"PP[ W|2 @|$"P[  d"PW %"@PD D(2!00=2 1 0 060S1/ P* T2%,00!0 0 㐡0,P $ D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/SPk0SPP54Ѝ蠑,,,؋, s&H&,ɉ,,h,L ,&t&\,H&Q-҈0MU&@-䊲,@-@M h% \0P0 0D0@10S % 10S0S@ЍPP  00S 0@P勁 0 00S+0S 00XP0P@0 S090w ,y%PD ,,h,d,u t A-U`V7P@@PtXp0Ph% /Q4 ty LU{pP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,P004@Ѝ0400/S@zP w w w EPudHrd@ 0S{Qt0S q|p=0#j|p;#s00S: >y`P`|` R  V \3Q 30S t: h#yPX3c0S 2Q P d o2: @yP 2 : yP 2l!: xP 2 : xP 2 : xP t2!: xP T2h,!: xP 42L\,At&DGJMPSVY\_bh,ep,t&|,t&,hx,kl,nt,qh,twd,z`,@-!$@  0 %롋H& @-0S 岪㽪,tT@-00CS0`p0 00S00&,P@-@#P/ >, }, x0,0@-M0Q00@ 0~#z#  P 0 @P00CS0p 0 ]# Z#h00S0@oЍ00 0 P 0S*000,dM &0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?\,PP 80 dÅe"Å^ P?d" @ef"/,\,p@-tfp@pP 0TSp 0T X0h2Sl@U T 0T * 0K @@r&t&,0@-P@4Ml}  0<, p"lR < 0 2  8-   C8S" 0!8( 0B(0R><r> 0{4Ѝ0,t&@-`0S@ ʧP"0S 0000q20\ @Q~,$s@-0Pl00@0`h R R  l R  R8ϟ03/@ЍpQ Pt&4r&,A-$q`AQT 0SP @P00000P P0 P0 tP  dd-\\0H@H  "  \ t&,*/38<AH&s&i,00@-18C8S 0P >t&p,(0@- @0 1P,,H,p@-`BM P&@0 S0`018C8ST01y0 0Pn00x0 BߍpB/ BR 000P y0001H,t&6p,P, 0?o2 0/t&H-AM My!v!0r0r! o!00000P0000@0 ƦPڶ0 ȑ 幦P0SS WS BS 0 +婦P  'Tcp!0S   10 S0Y` f18C8S ؠ0S Q     |P Y 0@^S00CS00 S00 P0S@,PT d,,,t&p,p@-PH@P@pxP P qP @t& 0/@-魦o/A-@PP p 00CS0 `V GPPkႼP0 P00XA, 0S P0000 !0S0R 00 H8WA-A`P0E!S qp0!0P0CPSJ0`00CS`0p S X0 X 0P"SP, 0SP`0P0CS`0p SX0 X ! 弝X!崝0 0P0 PN000P lP堝0"S0T0AV,8啝0 0P0 t,&@&dgks@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 uA-x@gP0 =`P`iPP2 00pPF 0P 2V @P  @0S@0Sؼ+00@/PP?1P PPP P 0!SPꀍt,st&p@-@MPP\1 u 咝@P`u00u0ۍp0 P 0@ 0000S T幜  P00 f (^Pt&,p@-`@;PP 0 1Up$P\@p脍7@-@P DT  R  ޥ@T|i Ѝ0(R( dE0PP O<P K(P d,7f@xt yt ;x,0@-@M@0(@,0 0 H@P Ѝ00,x0  PPPP0S 00@SPa x,t&d,@-  (,+^x,@-@ n humP m 宣0P3P xtߛh J X団Q =̣Ѝd,xt yt {f@֏p@-0M`5PPT 1<18C8S |屛xAx 0 9 0" <c4R,P( [,0F R1 P L;P 71P` 0(0S q=Ro 00FS0xfhdP0Ѝp\XTP DTt&܏d,&x,1 -@-0 @6d,-@-{٘-@-{{0 R   ЍЍ/ᤓ,-@-m]0 R   ЍЍ/ᤓ,A-ARp`P@1T ǢpPM`@DO-dM @P$}0P 0}0P0 0 880 0(P400Pp`,@@0,@ T R3 U&T  (0 (d(0堢p ` Z0 000_o 0,@ @,@0RT ZPPU <v 04 JR (0 R 0S0b  0S dЍT 3 ` 0@D(0,@uI00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80"(!.PP (. R 8 %Q  R P`(5c8@Ht  H  $P T0`000S(4( 08 40TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@To}Lʐ,[5GYoБO-lM($g|`d|PVPP*8@ 0 xH 0<0d2d@0`2 @0P 009F@P 8%@P LHpP@0S($"P @ v~t~ [lЍH<`@40S( ( Px  , Hp, 0P¯4 0@P00@P<  B,$( p( ,0RQ @(S<`@ 0EP%<0%800%4000 0'<0'800'40\ 00e $P$@o-w&7KQVewC-阑p0MS@0P xd'`0` 00Vqp@  z?sp$_@`0 P 剘00: pppppW0@ @ Q@Op`6t0` }>?@h@ 00 S @.  C8 ЍCK0w&Ւ&A-Mp᫡P`ЍA}0@: SPPT@${`P00S 0 00iQTP1 p P PU0DsLS<(    , O-0]M-SP MPP50S ]ލ ЍOv/g]ލ Ѝ@p  P$ 00S0W0S 0Sf` zpP  @pt{0* R\ D RP ᇟPP,gu ᖟ`P ᎟X0v: S+ p 3 P@`P|3~  KNP pd ` 0 0L:0 00  0S0S`- 3P``Dv `0S 0 4,P |V $P `z{ R a8MRK pP Z tP w!1Z[  0 ?.<Yמp`l: 0S'HQv00 0l!z P: b  0S- 嶞pP  W ]ލ ЍO|P-CḞ 0S᳞p|P P : R S00 R0S ᅞPPdST}ꤓ,w&<K]ky Г 0jo&0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@ bP 5FP00S D00S  40 -F!SOXݓ븓,,<,&@-H@- 0S;  RP2 @@?T/  P `00@ C @ F00 *S 0 000?0`?3XP10EE>fP d `Ѝp,$ 0@-p098p QP@Aqp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@@,|,@-P X00S S 9(,0 @ T @,p0@-@TI0 qp0@ @}01p@,|,p0@-^ 9 @ 0@&)60 P@ ^@T@,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/@,P0001S0 0/Lw&7@-P R I00 0# Ѝ00R 0@!"0@@qp Ѝ0@Z?@,0@- 00qp Ѝ80098<@ q|/ 00\ /@,G-pP` @P"9  `0  P09   ] 09 rPG,@,@@A-p`VY@  @ @ 0 qP0 0z0 儔T 0 0q0@A' @,,0P /@,\ -P0S0@  / P2:1S0BS /C-@4QM@`@|0S1UA:ЍbS9 .S8 00C S 0  ?OP >cS@U:{>0@0CS000 000C/  0?NP @@@L,L,p@-@P 0S`PpPQ  P@dPQVL<>~ P0S  p PTw&x&͘A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o2L,@-XMrL#@DN@M<M8MTr,3,!4!!!8!!P0P0 0! P 5+P P !R0100zc>Pu0P0 0!Pj !R00@00`0,0,,|,,,,(Ġl,+Ǡ.ߠȓ,(,̉&Hw&>N ,h,8, ,,, Љ&%/=E`ԓ,ˡ,ס,C ē,܉&E ,d,x,8,,0P0 0!=`P RPZ=qp 0 d0P0 0!=`P0P0 0!P$ /81`P&P 0`0,`BPM(P 00,00  10SV_@! 0 gPP U U ?Vj!0> LT PP U U |!0 DPP U U =!~20S %0PPq U U.P1!0Pj#% (P0 0S ,#00S<30գ?00T ϠR0  B  3 B0 S #00S30գ?0/0  00 3 330S080>00S/L,@-@0 S!0O-S`PpM`^`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0780  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 x  80 `P ` [0J0CL,O-pZX& RP X`P|` P [ ``F 0R@ 0R U *0@S0S  Pp-p@-`R P@ (^0P @@@ 0ppG-@P `pM@00C  RT0Ѝ ` ?<P ?0 ?<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 <,0,,p@-P\dpHPV@^8^LP gP @P%9 @@76@T AT T ep00SCBp00SBCp0!@00CQ#o 0 DPp@{T ^gP 0S0^  PA0dP fP pip<,0,,@- @ @|, @-p@+|,/ @-p@t+ꀫ,O2G-pWPP{ P0`pЍ ]@P 0pqp5^ ɀ?SZ '^0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*pē,,tp@-p@`PP;O,;0XV@` `;D Op *p|,t 0 |, 0 |,7@-dP@ P2P 0S  P Ѝ0|,Po/@- * Ѝ䱢A-`QpP P P@P%U0P 0 P l @M]T @P 6/P<]괢Ģɢ@-~|0p pl 0hP X 0D H 08 P0 0@&&Ѣ   3C-P1M0SL @10SH 410SF Pp` Ji0@?oPU20S@ UPQe@ONЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P `PEU@@<,8,@,G-@`M0PSS00/ @ R S"\R" :R R DZ Pp MP 0H3/0S@00ЍDP/@-pp S' })b\Ѝ00S @  dl)\0PT T O' 8?qp \c,fO-@`fPPPPpᔠ唰0SWpV  S P0Fp@ U0 PPUP@ RpP SpP؉&ى&p@-@QP N0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`; PPp@pWp@. 0@-M * srp@  + PP  000Ѝ0,Ы,400S/@-$@P P@,,@-@P  ,P/ @-p@&&0@-M@% ~P!~00S@(aP DP OP AP dP oPiᜨ|0t00SЍ0 }0LP 00qp}00@K(,ף(w&YO-8M0S 0S `0@S T y P 4X ЍP @n Pp 00r pPPP`dP\$ P  pPPP(d0S P``40SWPTPQ ((@'#PP3`00FP0`0 P0`0 +P X ' Z0 d;}P% 20SP `DP  @' YP 5}Y |2 p` P2 ?@2p<20WF,b(2P 0S $P (L~P# " 1P %0S (. 1X P P Ph1 ZP10S Z 410 (0 qp 000Sp 0 O1P N- 0 R  [ R 0 0P: p X ,,,nl,ˤЫ,c,,,,̓,, ,8,Љ& ,|,Č&P@- 0@,00@-P & @Ы,A-P`XpVUPU@JTVgP0|, 0 ,@-xP@ @0 , 0 , 0 ,p@-P@@P Pp@2pp@-@`P%PpVU p@ Pp PpA-@Q`Pp \.Y*YUG-@@` PР @PUЍppPX7AP X8p0ShЍG,@-T0@0S @y,0 R/%R %R0 sR0/p@-(PPp@P@p,?G-`d:d@p00CS0ᅮPu U   0DIS  !YXp@P0 P00@-@,P*?A-@0 0pR`@0S00 R0R@@0`P0S U  P@00؉&ى&O-MpG`@ P!Q[ Z@P[@P) 00p00 0orЍPP P K PT VPAP YYP00pWp؉&ى&zA-@MphPPPЍA͇8@5@@c`H0 HP#rW Hᶇ@WЍ聥A-PPЍ0S `p @ @@wVPP D 0 ` BqW >zPWPzꜥ@-@@ ꞥA-p@`P@0S  P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0X@,,C-EMPPEߍ@ 0@qp `,yPڬ嬐P ` P:T0S EP @  ^0pS `P  LP@L,,C-MjX1@0SGp0@QSP? HcP <p9p6p``c0000 0p0 0qV+0`@0PU f`VV Pᵇ0SVЍ OV@ē,ى&؉&֥0A-0S@`@P0L p@ pZ`PV@}V{Vē,ܥ@-@@IP ,DP ?o裥@-M@P Pۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` dP TP @>#@ ЍtP qPP  0bp V ` VV @T P uX%XxP @T@P@T 000d0|@`<P-@0SU\,ē,0A-`V8@P|&pP0 PЍA"vPs`@ @@@50 `oUU@UT ЍA虆Ѝē,GQ-M yP  @oЍ0@-@P0MSP @V,W myPQ @Ѝ0@T@0: S *@V,،&&@-M@kyP͡0 00Ѝ0@-M0P@ 6yPh0 R\P0 R\ tu p0St00Ѝ0,ث,Ы,/ᒥ@-@dP P0@/R@-@ (0@0T`#@,@-40 R\00S@#@,,h00S /pp@-qp 8#qpP@ QPppD,@-P$#P3#0 R/  ,O-q$M0S@vP`0S\0SO@jP`@@100CS kDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000h 0 0000000P0 000`0HP$Ѝ,,x,0,,8,O-M<`p@P8@V t30Sh30`So`V D3``F`V`utV-$0S 300CS QP ""Tq"QP ""0S6 F`+20"`Pp0X 0SJY/Y @ Pg"V<"0 40 ut  20S1"0 000 _0 0 10S*P10S o)*qp@PZ "P|"P41Au"P  "qp ,10S J"P ЍO0G0 0 ЍO,V utS 00St001 ?Q*)@P9ut`d0,,,`,&ȓ,,,,Hw&,D,,,H00S <0P/000S $0@///,,,0,'G-(pP@,`qP"V 410S(1`V``ut 10S100T T0 003*`#*00oᨂY J}) qp00S@P W ЍGv!Vo V '0,,,,`,O-M`hP P @0P! ЍO!qp@PV00SЍO0Ax!P0 00@YЍ~!pP@PT p 0Z qp0 @PD,0,|,A-p` qpP@VЍAw   0@2Ѝp@-@4P0SPpUqp @0,0P  P/&0P  P/&@-P@p@-@PptP0S 0 0HS @ 00C0RRp@R  B 0,&,0/,G-`@ qPU  P9N JY* Q|QU&8o@q|0 "0XPP00040000 (@0@000S < 0P00SP   0&,P/P // / /00//000////0/0/p@-@4PPP Q4Pp4/O-M cD[ {rPX 000 0  0(GP 0000 0(XQXQ> 00  0 'P*Ѝ=ЍO" <O-P@4M(0X0 ,0ut@@ P4Ѝ40SU400 ?QO('@PPp8d00 0bp P7ic  ` 賟V0,? Yp` P P@Pᨣv V}, `5V@P,0S1 h3Z1 @P'L30pW0+ 0$ `P" R $0 S S` P P  `VʏZ:P `@T_@P[ |20S  P0 X (0 S  $PO 20S 0 @ 1 R00 SA> P Pe p 4ЍO V  P0# 0PB R \A0 Pp``@P41`!Z 0 0@P_ V V@P P P P P~@Put 0t 0@P_|l00S V V0 0 0S `@Pm`0 ,,D,|,8,`,x,h,,,7@-P@P ,0 R  000 Ѝ08,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = Z* P+R( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP P P 0S 0P X&,&&slQ$0 RP  / ,0 14/ ,0 Q/P/&@-o04 ,    00Ȝ,,М,,G-P㌐剀"I@IPT`ppP KJT GJ  !  :J 8J @`匀 ,A-8p@0PS` 0P0aP ,@-@$ 0 @z ,P 0 R   /$,p00S/p@-`@mPPPpP 0S8@pPp  , ,@-4@NP00,GPl0 0Q  M;D0&<&8&4&0&00 ,,Ȭ,Ԭ,,,P/0/ ,0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00 ,,Ȭ,Ԭ,,,C-餁P0@SpM`$p`xx!0 0 0S]0@ 0 - @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP,`,,0, ,8w&0w&,,,0P$0 00S000/`,,,,0,p@-H@P0S0000p01S 0>&P ,,Pp@-`0 p@X10S P@@p(1@0PSP5P/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P| 1CP L, ,̜,Ĝ,Ԝ,,O-`CM00dwvP1S0& 1S8 ~ 0C# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S \ 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[0 `0S% U % 0R 0Q0tP 0C001萄 S vI  0 ,,0,,x,,D,A-p00PS` HP ` P 80@0@D@ 0@0TЍ, ,x,p@-P@ 0p@2A-`p@@PGE$1S 0P $@@<,7@-8PPU Ѝ0@@ @ Ѝ0,0 (! ,!/ ,0(! ,! / ,P 0@-P/ ,P @-@P$0P/ ,P @-0000/0@-S@ Q+ 0S \Q@AOoB@0Sp IQ S Q0 0I0S0000Pp@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010S00# pP0oF0q# 0d` F$ F# 1R P@#1 PR0(d0 d0 0  0U*P0C0#0;F001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0JP 0S0C 0@` 100P0C000jPPUF` 0Q 00}0 PQ_VP P0SPPA0SV_0Sh QPd v 0 ЍG(_V` P V10S t! RS 0  m_PP  P P0 6PPP0  B01S0R4AB~@D pP@DT0CR0S*A8A@DP  0 )0S pA, ,Ȭ,Ԭ,,,8,,,L,,&T,;EA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S G00S$1R0$aʈPPt` F F)00x$<0s0$10P0 0S $ ,,,`,L,<,@-(@0S =Z00 ,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Ո0 0C0S Y10S0 0S L G5 EhY 0 0R  5x00S U d00SX00S D00SX     ,x,H,D,,,,,<-0 R!  ^ !0 ,04/ ,0 R 00S P@0~0/0P 0/\!4 0 / B  0/ ,l, 0 / ,qp/G-p`@P?pP 儐u U 0 " 0W 00V@00CSaP P 0P@P ,|,PG-P0P`SPpЀ@ 0@D P V 000U00C0C0y Tʌ%P 0 BJ 0 Q@ @D 0@DSB ,|,G-p`P@0@@0W  S #R0C00C0Ѝ PP   GC 0 ppGA-0PP@q1`EP q 0P 10 ,G-1@l`Pp0XXqp00 R00STDP0pT@x,0, ,p@-@ppPN P0S0FDp 9P&@-p 0&80P/ R/0 0S 0 /h,00 0S/$0$ R h,, ,A-X@ 0S0dS 0p(0,`P` p U` 0h,8X0QH0H 0.4 00/ 0 0ꨯ,h,,A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0h,qpO-PP10SPU @PP0⼡p`@` V  RXWA 0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@PPAp ` W0 0K0  0`qp @TP,h,|,P0G-`p|PU0  SXW@ U W0S P)BP @P P`@V0 0 0 0@00qp0SP`Ph`@W 00 0@00qp0SP`V@h,|,G-`P@Apတtu00V00S 0SP@`P@tu TUP0,G-@Pk0p`Ptt80@ p 00 0`Pqp080Qh,|,800S/,00/PP//,,00CS0 S0 S\0 /O-0P-SP | z x 5] fcpjcPc@ P0S,5@ 0S 0S%,@T JC@JccFc;XX = ;  h 0  ЍO/`P @@ @T 0A $ Z_@lnp,vG-@P $`P( 2ppP[ `d   c@yz  0Z Pp@ ;p Tt |p@q D 40 { pln,C-`Hqp pXqp@@PPP.Y T0 0 Ѝqpp 0  0a0@S@-TA0@S<0'@ Ѝ'P( #P   ,H,(,.Pp@-9 $P" 'P= P !srp p^P 0 &- &P ?06 pPtd0`@P\0 L0Af&P,@m^006p,,0,H,G-@`pdP4T#0 5T Ta0'0000aP0 I?@6T P'0,@-o0@-MPh@P  ! sroЍ08!P !?0 00&,,@-HP!sr@Q 0! 0&,@-G sr @@@60P&6 >0606Ѝ,,G-6@PP`j>T6k.sq 00P6 >06PU p>P0PPЁ  G P ,,,@-P ,0 0R  ,l0@-0`  ^ @^TSa04S '005S #,,0@- @P 0QA 6R 00,G-pP@P P4`PY>`V>p6W @,00S/A- M`pY@qpp6W @ Ѝ 0 PU~P4P P0 Y4,,"$@-  0mS Ѝ 0 Q0 ?@P 0 S# : PPP0`0 S  Q0 R pV`PPp =pv000,17@-PU0P( P@ PZ0 Ѝ000S@PP =P5=5 Ѝ0@iH00S< Ѝ0@ 0 0$0 ē,,(w& 0 ,<07@- R P(0(@?@0 Ѝ0訝&0,@B,@-P M# @0.S 00S Ѝ 0S 00 00S000\ @ ` WP0@ 0R 00@0@$&,#EL<07@- R P(0(@?@(0 Ѝ0褝&x,@Bd,@-P M# @0.S v00S Ѝ 0S 00 00S000 @ ` (W+P0@ 0R 00@0@$r&td,E@-@P[P  @ Ѝ@-@PP  @ Ѝ0Sp@- Sp00S p@t l0p`pP p@"qpP@ 0p@ ē,#,,P07@- S Sl0 Ѝ0XP@T0PP W<X@ Ѝ0@N<0 00a &&AP/L0@-0@S 00 $0$ @, ,,PP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P< Ѝ04@P,0  0 10 Н&̝&,ԝ&,R0/0o,P/SP @P/5p@-@PJ9  !#P0UxSJ{yw0@0tr6pknp@T&l0@--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @bP @3$,#>JO-P8M`00P@*0 S  0  ? 0p00C/  0?pT*000C SX E0!R1PT*0@ S 0,S U<04 P0EPE1!0C 0UЍT,@&D&@-PMP M 0@Oݍ Ѝ@` @G<0Sp>0  x@ݍ ЍU X<+ HxP0S!(!<@&dT,D&RoqtP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000ى&؉&@-PM 0  0 |0 j @pLh P 0S>000H ;0Ѝ004@P vH,D,P @P/h 0 /ؓ,P/00S<,0/@-@0SD8,0/@-,@0S0 0B00Ѝ0,0/@-,@0S0 0000Ѝ,,0/400S/(00S/@-qp@ ,,P@- 00@ ^S00S00 Ѝ0 ꠝ&H@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S\ 4Ѝ80D@0P0 00 TP,,\b0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  bp~,800S ,00S 0P//|,,,$0P/0 0 0C/,0,,A-PU  @Ѝ`p@GwP|`V 00S0\V0S 0S`@W P `@$V00L,@-0S0*00 0S( Ѝ *  S,@-Q00P 0R C Ѝ@@- C\,P/0S/P 0  //`oP@-/b 0LP/, 0@-L   Ѝ,A-`@P᛼0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @Pp88 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 7↼79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PcO   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0fP.00S ,, ,v@-@PM @PU`p0@ uTЍU  j  B U R{  0L"00CS0U0S U3/U@`y 0 KV00SYS_U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 0P W 0  0S00S000ESU U U I 0S0mPS000 00SD000V S3,Nzp@-P`@Ẻ000C S0 ` 0 B ^ ST00p pS 00 000S/P/,,@-XP H0H@ 0S0S  0  03/$@,H& 80S/S/ 0CS/$H&O-@pM,Q0S [; 0S0 0 Ѝ`V$P  B0P  AAQ-P $YQY0 C0@@Oop B0 0S `0 0S Wp0pH&@-'PP0T &/@-0M@20S4P 2     -X2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  X2 P!2 R@ z$10P@ 000 0 R  RW0 @000S T0 0S T \0!PL 1 10S 1㑹0Ss 0#So @,,,|,,T,&D,&,@-l,@- 7. Ѝ@-P87`d@a@@ᏹp0 `QO Ѝd @-@+7P  嚜k ,G- @$p`P 0(S%0  P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 GWЍMb@B40@-0@@T WP  0 谝&,,@-@0@谝&0$R/ $妾,p@-20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@PP@ 0S 00SL YJhG qp QP 0S 00S3 (,t U ,`,,0,, @-($ 00000S@\ |,,@-($ 00000S@K< |,,ê@-馯8, 000O00S@4 |,,@-@P x0x0SxdurP@nkheb ē,< 1A-@TPP0 O@빮wGD;JH>ի 0@ P`p 0RW 0` ?00f 80 ,00SA?|,< ,x,0,,X,G-pl0P` * @ ᗾP 0S 0S S,A-` pP>@8'0Up0P )&p@-HP@T 80   p 0 %%%؝&,O-0bAM M@pu%W 0A 0ļ PP z0S0000Aލ Ѝ0!S  PA>004S S S }0PS  0 QP04 j0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 C؝& ,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c mPU Y< 3T U ;PA tPpp @  @@5 0 p$MW $l T@ $T<"0S000P ;04P S@ 1 Pp 0S 1T xUP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S ( P $? U0`00002,؝&&|,T& 0@-@ҼP˼P |ƼP lP \弼P FPF؝&     @-@PDP P@  O-x1M0S" @`0 ЍOjPp000 0 Ppxy@`Ѝ00S 000S  0P @`KP 0 00Q0 \# Z# 0S,|, ,,0@- LLPR^0S @T 0 B,؝&0@- LLPR^0S @T 0L B,؝&0/,0/,00S J/,@-MP EPEP+ @-0,//@-L@M +p0 P@S0PЍ,\ QR0* /QS QQ*/0000/@-@P "000000/0S0C 0//0@-  0#3@PP @0@0@- 0@SPR? P `Q  p"` PЍpA-`pP@T@  G-P`"F$@p(, kQP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0 PЍp  000@@0 0 0 0 0 04 A-^\^ ^Q[\9[^V ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00d   p@- Pd00@S S R 4!@D@QV p@0 @ T& 1C-p`Qp?V@P0\`0Y 0 ,PA \Y R T R 0 0P@0   [R .0B0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@ 0 R Ѝ, ,00@-M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00@  O-@T0tS bS rS aS @{S000pW` Gp 0S0QU 0V@P 0 0 PUP(b`PX ,X,- O-pM>4Mn0  PIW ܍4Ѝ000Q 00  R Q  R  R  R @    0S 00@0p00pS 0S @P#S ;S T0@0 P00 ŭ0P TP  0S @,SP0S 00@TP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q T ,MP  <,0 \\^ ^00\ APP00T0I S TP0S 00@:0S00)Ap Sg 0S 00@0S 00@00P0S 00@T0S P @0S( X S 1@( RP0U0 帷P  P\XX $S I0Px $^P I0~0 , 8 SR0 (  S 7哎00H00 PP R00C0 0C S000SW,X, `P0pL\RC [D Qx␸0S <,00S ,, E 7P00A S 0(0 [^ 0  0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00AR0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y} Ev0"S YK  0S 00@<,0 [  RR , S 8x V3 0S #D@p p  U@P IW[ 0SD @;S> BR0110P\SSpE ND  PP< , @P 0S 00@00 Hp{e0H p Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 0u qp000 XH 0S  p Ue   pYP 9)0     囱!$R1 ! 0偹0 $(y9 09909 00,T&,B L m &~  _    % W , s a v   ,    ,,W  +  P u & A-D@`@PU@Tp00S QX0T0QD0 0pS0(FrP,X, , ,, p@-P @kQ000P @pL&@-@]Q 0  @0L&0p@-PPUph7@P 00CS0rp Sqp0 q, A-p`dB R3 RQ R P$0SV0(  R R |7$0P ,'dP0 P0!K6PQM$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0cq( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0,  , @-|@X0  0S 0S00CS0Oqp X刉0  ,G- D`X0pSM00S 0S mc#3X 00X 90C\ `00d0弃XP 00CS0 qp XSX &pP0 W0 XPލP3 pp0S $?0=P 0=P "p4S ?d30p0p4S \2PP pP  00\0=P|p0`0d0S00d0000S 0@S0k >P0  b0   0@ @b00S +y+A P0 b+0k+0Jg#eP>Je0l!P4 P@Q*>\ PP -p86P\a ( p$ =\0p !}= 0`PS(005PX1000*0\`0P l000S SP@  0  lC(00(01, &8 ,,> ,&G  p  --AMM@A> 0$ 0z40 @0 Ob,, --M MA>$00d4( (  0ۍ ЍЍ/,, @-T`@PP  0'p O0 ' Ѝ,@-`MQqM0S000@03 0@剷0S   0a 0 0S S ` 0ܧl<5@P *0 4 PTo 0ȧ00ڍЍ ,,,4 2 @-@P  Pta `p\0 P `P 40P S x a Ѝ ,; U G-pA嘁0 0`PU , R:(,N0(0 &U# \U   0 R`Z &R\RP` , R:(,N0(0P    "pr P qu PE ,  R:(,aN0(0   ՜ 0 ,T&A-@P p0R`*ANW00 ᵜ 0P P 0O-x/MtO00hPЍ080L?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0  P0 R p>0R*ST>0@oP0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S@=0@oP 0 -=0C>S00L0 R: L M `0p唯00c0800400S<x<8 00 `\04 01<0S ? +H0SP80S4PU 0`  EP0800A E4 嶛0T P !0  004 0| 0 hh 0L; 404{ 0 8;0R0 <0p l0P 0S P 0( ;P2S 0` H :0C0 0S0`V: |$ 00@ \:@:0S 5 00_  H0$ P y0 H$0س$ [0`V: I$ ` 0 0C 0 P o0`V:T / `  0c[ p ,0P `V:`:00(CE 20 aV : ` 0 020 SH88 00 0h04 0%<0S 3Pf/0800 0 P%80S!g04 0<0S  80S04p  G☦`P <0 00Fpp40<  0ߤ<0S V 0400<068 00 V04 0Ǥ<0S L0 R: L K `0p]00p[  R  Q 58 H4000  P 04`Z Z Z000 G 0X0 00 V~ Z0 0RP  0\ >0   PQC p0V `XOdH0p0<Hp<(0000S \t04 00<0S >p P[ 80SX0sFD$D8p@0 (,^Q0 0  0p V0`0  `=0P  0 RS0 0 p0V R`0 0 PP04 0@84 0P 88P"0 000S 00P80S0s"D8p 4 0840P (8P P R0Dt0`pL<0p<80S4X ! 0`Rl0004 0V*0000pW(p0 1(W0 \90H ! R 0bP 0 pW*0$ ( 1 0X`xpH0`0h<Hh`<x0h0E0| 0q0>, ,<,, ,,b \,&T&d ht@ l ,4 o 2 $,  &t, <0 0R0((Q 0{Q  , \,p@-@P`Tp0wS {S sS 0p 7P 0 D\0`@p y7P ` G-`pMP_PU00\01@ R  PVAGWp0!p!Q <0A\S00 0  \0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: 0pP 000BS R , p@-P0`@T P P, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@, - 0@-MMP6@P  P\ i6p4\+ ~6 P6ۍЍ0 H0  BR R R/ /&H&@00CS0 S0 / /&@-,Aᣥ0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@g,0-01S ^00oS^ P0\ S0S Q0S R P0S0S0 00Q R   -,0@-  `Ğ\ @ T\    %R    , -p@-TA0 5S <0S -00$!<աPa0U&!0! R8  (P  ¡0  ,P  幡0  4PP Rp@N00\P RP @ 坡00, 嗡P$$Sp - ,,H& p@-@0` *T  -td l%P`PT p aP000STI @&H& , @-@P PV=@P @0?SP@ ⷪp Ѝ/P@TOP 0S SD4կ0Sѯ00RZ, $ 1 N @-饯 -~* H&@-0@<TQ T0B0 j-0001S R0Sd0d@TPT T@0$ @<,M-T ,  @ D-, H& -    @-\ 6-5* H&7@-@Pq  o0S 0@T c00 Ѝ0]0"S sr@-@1P  p YЍ& <0A-@X`c# ^p "RG ^<0c#N R 2h& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,[0P01pb-U-01//00/00/00/00/00/ 0  /(G-" 0  /(G-( 00/, 00/4 00/= 00/F 00/L 00/[ @-@⠩TM-00/@-@⒩|]- 0  /T\-, 0  /T\-4 0  /T\-= /00/00/00/^ 00/f 00/n 00/w 00/ 00/ 00/ 00/ 00/ 00/ 00/ 00/ 00/ 00/ 00/ 00/ 00/( 00/ sO/gb@-0  0Ѝ@-@ +@-  c-r0@-%R  +@-  c-k @- 0y`-|]- @-|S-(0@-% R |]-  @-  @- 0QP-TM- M@-SL- @-  RO- (0@-% R yTM- < @-  p4\-< @-  g1J- < C@-^TK-< @-  V3H-  @-  M3H-  q@-D\\- e@-<U- e@-4U- e@-,U- @-  $4G-  @-  z\-  @-  2I- @- 0X-U- @-  4\- @-  1J-  C@-TK- @-  W- 0$S00 @-U- @-@ḐP d 0     0@-0 |1b- p@-P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`O^}k1SR !0C B/!?1jD]1NSAPN P 0^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0P$XvP tpP1aC P v{1S'ʰ1 C P v{P 00P1 RE40S 3/Pg PP g P,ЍPR0v ] 0SpW 0j 3/pd P 0`C P v f `I{f00x00AJ!0 b02P [00P000Ma){f ,  H&E u -T& - SP&R   001/,P0 R0//,O-p`*@PP [ ! 60P @ Ѝ0b00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @, P/D0 R/0@-A1 P (f@< ,O-hBp0 W`D5h0p 000圃 Ѝ0P@P 0S 00@ ['0 0 poP wX0S qX000 00 `[0S VoP ]X000 [0S GoP NX KX0 00U P0IS0SPP,o0 007o0S 2ot ?C S &XPU  k0Y!0C0S( 23PP PEX ,T&VUUU @O-$MH0[S0P 0L`Dp? F0Y0 0S 0g ᯋ%hJPnn n@` 0p@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0ghnX 2 )h 0  B&夂U P0{ P>  PN P P!VUA`E DP@DP`4g g g@`"PD P AP;  KR !   ` D0(0@0!P`1 V0p00@  `z`V[z`F`FV0p00@  DPE@DU`E¨` Y @ ዙ@T`— R   BW00000S 000 0 0ˊ$ЍO0Y S  ,    T&H&A-pP`Pp `m@m@0T `P@ P P0000 ,@-P@p 0%0T0* l$p@Ѝp0 00/ 0l` 0@ mk$@t 0儚P ⴱ & , h0p@-P@XP0Ps H` R :P 0S@@Q@pu& ,@-@@0000 ,0Xk ,0lk ,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@ @-@ @-pP@`M,0 0( 0 00`Ѝ@- Ѝ! O- M P`@pm@lUjT0 0`P 0=D0PSY 0SV L00SRDFPPL00PT^y@DO@W ;p 㼎PSWpV`KЦo`0 S`K0 r@PE@0 ;PT0 0Pd00L0D 0H0T ?Z  r c}wccЍ00D R00S 0S L0X3#PpЍ Ѝ/! p@-Pk@kp ,@-G7@- @偆h#}A$XPU % 2agU00h@PU %T "QWU00000S$$卺 Ѝ0,G-, 1 U-C 0,H&Z O-TCM@0PD0`@ N&@ pPP  #PUCߍPpW Ӗ @ ypPY Z  `  @ =R@8@0A p Ԋ ؊ ֊ H&ڊ t 1@-l0C-MM 0p@}`P0 ᵂPP* P UyP 0S0 0   FPPP 0 Q0040P{ۍЍ0(0P 0 80 08 ,00S/ 0P -L@-FU-[-@-T偅P f"P <b"w@(!Pq@, C-@M @0S0y$P,  0S#{P  d0Sl Y0] !)PeA@PaCP'C;*A^&'ЍP@R=~P'P'20S @`P~'.@p 0$!Ps=~ X  w$P 0)AT PWP @P pPP 0@+Q !Sp 07'SpT+pAW34pp0W3:X# @PQ  R@4Q p0Q  R@|@P`Vp003/P,00  h0S  R l 410!8fpU-b-tS- @-MM+@(~+(FB+(uB+<(?PލЍB?P 0 T @@@@@ @@@@,&B({>꜏ -MM+ A+L + 9+0 i?P  ]>ۍЍ䜏 0@-@M Ù1@@ #P @  P A0$*!PRU)QX`&Ѝ0RL00S 3/P 0$003/0$(*H:@P3P/[P+W@P',@P# 0P} 厇B< }  0S 0_ Z'P @P4o0m%(*00U-b-b ʏ --@-@M A0@@>#P* :@  6P 00*!R00$Q )g@P  }0S 0` :'Pn%[()ЍU-b-O-`M  0 0X#*0S ` 0 SS 0p0 S00C `@ۓ0 S:FPP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ J T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 灄T&7@-@ PU  0 FLQ00 Ѝ0l!P T H  .>$ 0 [&U-Տ " p@-@Q`T8080P00S0S   0p@6U-,G-3 7@-@ PU  P00 Ѝ0PP x ߊ`00S rH 0EB[i( $,G-: L _ |T-s | H&s@-8Q`@X:j"XY{ {`d{?`dw p`d 6d1`6={f 0 A8l@PxxеW5P @@r_u_ \zЍp- H& O-Mp@` Ȍ 0$ p 5U  0S  $P R&  0S  x$tP 'dP "X|pPU PfDB (&S 80B? $0N$t+P OPP O000Pt+P: @  P: :0S :IP :4 Qm 3 iz3$"0ߍ3_=3 p3<x 0~"!031<0`0<0&2  00 \<0(    \00P,00  Ȳ@~?"!!0#  PN  XT $ |{X2P |.|Al0S$@0 AU0 ,"QS o$m1P ? 1 SU0W$2q1@T = @~?0XC 0@0S@ @  0R0SQ A0S  1P 0 ^Myt0 | PS $2U-&ptbt f@,G-U-    2I-Ӑ * [-s 4 X _ x 00@-,M 0000P00 000 0 00\PPP@P DD@0Q ,g,Ѝ0@.x &H&{ ,G- -O-iMs?!05ZP 00iߍOЍ/\AxS`PD1P 0 3A(`P z[p vP@' [PpT00Z&JNU0P 0 "0GSW 010#S 00PpP@ P)ꙑ ,G-<-O-p0MT@X   p$pġ `V  @Q'U` QPPP@P @븤H E0ᷡPU m0'SP0U*S / P0 0vX/0 0P Ꮟ0@ 0 0H0 {PX1Z * .t婠p`PUQS( @2S022SP0220C2  S xS`` yw$00 00( 0`,VPMUSS PPV  @ 0%S @S B* B0 0.S 0 0嗐P1Zp@P] 0A0 0@ R6gTw00 (s@0 0 (kPzc{cq0S  \V0A 0E?oX20S `\6a$\QacwV @ x 60S. Tc@ⷁ\w00CS0000;MS0S Y$0S  `z6GTg{wWU `d\aX L^\lwl5G0ЍO Ѝ/Α  ht@-&  0@-CMl0PP 0S .Q@P 4Cߍ0 P 4,3,G-p@ 圀PB`AT:00Y W ,/Y 000 ȄP EQ 0 -@T& A-`Pp p@   ,pz Pr@2,A-P @opl b0S DQ0Q.SP @$ $ 4, 3,p@-M 48PLP F  5 8PLP 8 ' cp@ ( ⽒  PU |@ 'tP  00 ` '@PЍp ~ ~P!i2,%iP,2,8i(d, O-NMX6Q >M||v`ێ,Pz0尪S c W:-8 4e0 w=C$ C/ y J00y=0ܽpQ>e0 ~P40070 ᤎP40  U Ur0YR?$ ;/ 0isp @*<: R0 :P'P P 0X60,0:mP<FI0.̟   0/P `h< B 0 0u`````[Pp,00ۮtl= 2D00lq0k,ݍ<Ѝ>0a X~ $`P  P `;{ 1sS1lS<+2 0P%QPL x\P<;`Pp},}*0x*0wnP\8 0\8VW*0yU *0z*0}\8t*0|~\:U :L*P0Q8 8* Q9ʟP \ʟW^ |9   +9 @H- A)!0p 0HAvrp p=Sr9<)a0hh KP 0H0 H0A^rp , AIY`P( 0Vi (PSUp`jvK ! JH p00n`<X(0~Ld@LP T,GP @AP <P }JA6P 1P ,Pg0:4LP '0\6S '0/`P 4| pld('[7S0 'It& P\6 AYAy0\8fP P &6 jP `(c:4S ( 5YP 0: APڴ  VF\80%8\8nP䥟` {|  ⠁P0%08P $i|  厁P0040\%S\880\8P Q| 0S %8P xB|  dgP000S\80\8,P0S\80\8`:|4S4P l 0@?S \@P H3| 0{C:$P0R#R#t$ßRp#lW%RP# 2M  * 0S2 P 2@T }P H7HL* 0G0S x"d0S l"xu㋂H3S6 U] "R?0⸂0N?C0C `.B`0  0F0`tPx:A?F/ێ80I,07>E`I00x 0,%P"H pX0S !WW5S '!#porXv1X60S`0 <IW4 D œ 0, -I d / P 01/ C-pP@,MP3S0 ` 0`:00 0`@0`00n/00 Pp 0P/S/00 0 /S 0/0 0%R  @ 0 `@ 7 ߍ謘 A-`BM|@᫊PlP3Sp (pE < X800`0 0  2PBߍ謘 Ę 0K-4\- |]-@-@ @U-@-0  0\ P @0@ 18 0/P $  Ѝ0\-T 2I-T- @-0@XPK0  0@5 P | |0|` x0Et@1P0/Q   P 1 0/R@0@ Ѝp4,d 0\- U-2I-0[-tR-@-M@DXPP  y y0 D00Sލ\0\ \P L0 (0< p 0, k TK- 0[-1J-tR-4G-z\- X\- C-bCMX6S P \8BPBwt2tB0S 1\6S T1L2L"9  2PP4 91,B 0 OL:4S / "DA\@gU 10 6:4!SU *00 0 B+(qgGA1@P@+ 1 aGAcGaGA0S  !( !0S   F BP\6S @#U FCߍ 0p Bd@ 4,$ b-4  2,? 0,D œ P D,p 3,2,ԙ -  @-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%hЍ0L0 3/@P 0 @P  Q 1/P @ @@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-ap$MPA@T  \P00 ` 0S 0S0S$ЍP P00 S HS, R ,0S R : 8 80R:P3#///A-@M`Mp" *0P p Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTT 0 A-`QM p@ }P PP PЍPTP0 puP@$U@@T @ @VM0 @f P> L P \ G-Pp 0@0M'"pPP 0*`0 R PЍ 0L03/P 0 ݅놁0 ׅD @SV$0S P @'w @#w`U-_ p@-P`o0@0S 0p@)t A-0Mq!P0`L0 3/P< 0t@T 4/@0@P0 ᑅ 0ጅ 0$0S v$0 vT \v vច0S0C, I)ЍU-{ 0S/p@-P@I 0000p@FO-p@P|M Y0P,0+`,P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U00 0P1 00 0<00000pP ,0<<0@D}@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 L @-Y P 0P 0Pp PQ` QTPQH "P <0P/(/$/ / p@-8@Q0@P@DPp 2Pp@&p@-P@P  u u00pp8 @-  T&@- x `&G-@PMP N/e u0 0 0S1 0S XP a,P ލ芊0S 0S1S P ⮅P @l0 1h0$1d0(1`0,1% 1S nP >D%0`> @$QpԠ+ xpvd Q M +v $0HY 4p <O0S 3Sj `t Ո ш0`0? (`p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(P~ 0C QY > 00B,0! c4吀@<#0p ^IP\P fP ,04! k`~<#``NL2P  @000@A0"p80N?P0S J` ( $KR 0`0K?(081l1~$10 100 P@a C 01/@P00pЍpP@00003/003/$Am1 O-`UM MM.x0Pe. Qi\,FiLFsU@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯N⌗ 54, Q~W <S X7h4F>D0C287\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @t00, n3E "q5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$"@p0 ,0mS` Eh40S N?,$"@h4PU\4 0}108A $$ŸP  ^|Xz !ԢH#2P0$100$4; |2P X2l >ؠC U$10Q0$10KP00: 0 a0H55S Pe $003/$pᢀPM pQD!> ,! 5$H0@:S 1 HPfP= U;;S9 $10>C418<100S- @` 0bWQ!!10<b/0,1014181>C0(1}1S0}1$1S p E@U--&l Z h&b- [-PK-U- ,G-y _PP$030/0@o//BO-P@ MMAT0*!Rp0)A`T0 $0   P V Pp ,5*'0t$0 t`$]A(pP H4\,) ܍Ѝp 4)s0Spp0 P0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0S "S S/ Pp  R <#pWP00P0)|2YP0 T P' 'pP 0s Y&P }d0S "88 ݏO@d0S !8\0 @S !8$`0S !8X0St! p!S0 80` DⱏL0@ O@\0S ` R !8A8 ⚏D@D~┏@x@⍏D@Dq@↏D@DjX0S0A|@`^pQWppc  ^b-H L fR k 0  U-| Ğ ؞ ӝ 8 O-uM0M*QU$e Uj&&@8&h O Z /&0 0 6,T Q 因ލЍ2 )qW nP7 FP ' P  @kP' @ pH0X p40n~P40 ] P U Z@D`@ 5 p PU   c0SHS   : 0S #S 0P000P FcP14s10d#5:`#`S /%5%;%0@`S D% % :tspp`0 0 ,0S T0 S00 P0p0SS0 4 0  0xP;8.5/P>0400S8RT0RP S@" SA00 80}P80P QL ,0@8aa<th<0X !L! 080$ 0  40d( `3 S/  S" 8Q0PEs $PF_ }P005S0+4^Sm04  u0 S r0 j%똰0b-\ ,G- ɟ  ) . U-ܠ Q e \    % * 2 9 B I U ]  L  L f  O-@BMTM) Pp ` K@PpTp$;KPpppPP@BލЍ D FM0j@0@ ;M>0 $04@(8 1M>0@00P@<DT@0 KP pK\0A00@3 0 !K, A0 $03(408@00S0ؒ; K{P |K oꪢ 0@o/b0 !!/ -10/yp@-@4P0 `i1111p -O-P@p`ԐԠ԰0/ C !  !0  PV}00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ -8  0@-P@M/.#}1, 00 0d0@00 0T0@@@@1 0 000@P,gߍ0 -O-Pp@`4M 0SpaP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   Q 0S  i P00P0 $04@H008p0`S,000TT0 0X0$0\0(0`0,0d0pA- 0R 0  DQHa@1QRpB   !LAPAP0 \A30Q     TTAU @@ - O-PBpXQMU<2PX\1S2\U \QUЍ0C`1`1S?^`?w001PS \1 X9X1! 0`1Vle.0X`0 T1kX " |\P6 \ ! |000: S.X1 2 \1`00X1`cP 0 S 0.S Lhhp ` XXP[ SX1, 2 $ eg - &@ | p@-MM` fPoۍЍpxP@P+ h P*+hg P*+g P*P@ ♹P7 p@-&M@(zYK`P6 i <0 0iev P (Z6(Z vi^ <@P nލp a b|T-= @ O-@MP! c0  F 0Fp`娢Y kpP 0 0P0StߍP W%]P0|wP0 a0CS0S p `VVp08Sڠ0S`p R SX0  0 a00.F  p 0X1U0ů0 0s [+ , p Y 0 F @0F0t00 00S 0 nXP0[h!R@PO O0㏐ 0S* ?0!CVa0 ,EL W d@edA -e j _ -@- D@01SP@ 0S 0    - @- @-G- T1  D1D1G.01K<0P@T 6Y Ѝ -( &@-@<S%0@- 0 Ѝ0@- 0 Ѝ@-0@M*0&0 0000 0zЍp@-P<@0/SpQ rPp@$&@-0P  0K-4\-C-$M@`pPK 0, DP) 0 PP0P00P l @`0PP0L`ySa00ͅ0݅000͕0ͅ$Ѝ7 5 ¤ (G-U-X\-2I-X 2 O-4MP p$'g@apTPk $gp`V50S` pppG WV ``0 (t0,  ` ($0(x, 0VRR  S  R$0 0\p(0@C@J$f@,0!00 0 @  ((R,0 VSS00P0#02S `F u 0p Q1,p(Pp$f`4Ѝ耧  G-p`@PPU  fPP 7/G11PG- M$fAP`pP Ѝ0 0 @`0 VSSXP$ ff-@- 00Ѝ Ѝ/b -@- 00Ѝ Ѝ/8b C-@`PM MP`' @@EpD F@83V44C V]DAD Vc&  0So 0CS+PCS0)  0 0S8 0S r0S 0S QN@xwP$ 0 X?0 H@o@2P 0,b0C?o270 姟0(H0Sލ Ѝ !7qS pP5S/G B !F? K@F,o@1P0  0L q' z 0S 0S| q0Sx 0Su QN@QP  0K?0 @P_F?  Q. QFNnF oq8 U ( c-U-\\-} - &m X ¤ z\-4G- -MM P  P  ۍЍب -MM P  P  ۍЍ @-iP( `eP! %  ` 0 S0 @XP00JP L@TTЍp |0|+R/ @-h@|+\0 P0D080",0& 0 - c-g-c-g-c-g-P@-@ ]@0V|T-p@-@PM H(@+s000H ,0@@04P,PF4hPp0: S HoP l_ h_܍p,s 8rQ @P=@Pڤad <4PT8|1| Bqp8-<DQi> H1 088078PP  QP00S nz < R t00 00000 00l0"p@ m(gt(0Q!TK-D 0[-1J-tR-- G ' U-X\-(-l O- 0CMSP0q `@o0!`c40`SPW!000\ @@3/@P CߍW! 000vZ 0SRX 0 K@XT W  00 0 T 30S l00S \ ' P0W0 ! !  0000\-2I-j c-r é [- -7@-PQ@0 SS <4 000] Ѝ0 2S<0  O-8UMP00 $4Q E  q$ğ0/ScP3s0܃C0`/Ve3 P Q JU@c A@ pPKUP HDC;@1 U  `$PP$ 0RP 2P 2`.|$o^ 0 10S 0S6 0 1S20S KPpG $1D1T  00a Z!  R R` 10 1000pZR `01S RB  0 P a0S  /SPR  Uߍ` 1 02UV U@P@T T` U- c-$& -' ` ߪ  -- 0\- p@-Ph`@TUdpUP`P  p& G-pMMdpp@ P D}D2PPC P1P  /PڍЍ Do}P Dg}PFAP n`P ;AP)(PP00~) 0 ,qa|2k lP 0=Sp  A cPY)W)W  P P P\hP Z PPץ 3y 20p@-4 P@o0 Pp@@-G-P@p4 o0pS R p2"4p0QSP p*P`p 0S!40Sp  o`/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ P`oP  p@Y@-@ (@A-P@p`p0S 0pp RA05#h00P200#X0S'0Q #"h0Php P#"4`V000S 3/0Q #"40P4C- 4Ip Ѝ`nPl Ap q  #h /b 0p4W@둴 d@T  L6kPMP `P @걫 }D¤ & p@-PMM`; p  @np oPoPۍЍpp@-@P n` DP  0QpDPp|d zd@@-PM Mp;P ` p  @0PGQPUoPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPfn00/00/4\80S0 S001/\80S  00@-\\@"SR0(SS QU S!0$0S\  0x 1Sp@- l@$\ 0P"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/, H0, 4 T 8 X x 40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 BRp01 408 00803/P,000403/, H0, 4 T 8 X x 000/O-0@p 4MPPp`314ЍO$0 L03/P% Ѐ0 \ p* D@ Z["H* 0*P T P , [p Sm8``pp 0S0P 004Ѝ0$[-O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R?!S,0S 0S00 0S p  0!"0 0  SPH P00P00 0 K`03/P L Q Q  Q R S1 ,^ 6   H3  d O-0c(0M<00PSp@np`00 # 80s 3 0(gh0@l0 S@3`T 0X@  "<0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D002 p0 0fHL048  f0(0,(, 00 0fP23U 40p0P<0SPP0 M T00SI0Sj00p0q  0 0 000000  \0 0 00000PX 00808/f0 PpQXQ Q(00,0p 04 80R \`\p a X0S l^ 0$0p0 0(00,0  04 800p/ 90X-U- \-G  _ G-tF`0pSPhM^Xh`f0S `Xf0 SXPf0SQIf0SkJBf0SGC;f0SH<4f0SI5-f0SJ.&f0S`'f0Sa f0S,f0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 ehЍG ( e0SWCL4W@048P Q Q0 =3003 0e0 f hЍ3003 0ve0300 0$p3 0fe0 0TS(0p`@ 0 7 SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@S0 # =8F P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 tH0L0  \H0L0@ DH0L0E ,hЍG!耟SH0000 #0PpG0  d :/ 000(00X-1 6 ,^ d  p  xS-U-    J J x4  Ȯ Ԯ ܮ H3 C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/0@-EM0@P 03/P 08 00 @@003/Eߍ0@-`,MHP U@0 0 0PP@00 RS THP pW eP00H P00P0,Ѝ @T@0/W  /0 0HhUH P00T& p@- MP@D0 L ` 0  040PP`HH0Dd Ѝp觮 G-%(MP@PV X PDP`8 ,VV !R "2 Vr PpP`"pVp$UpWb$U  0 g0 00% 00 0 0000M0ppppPP Z-(Ѝ! x  @ C-40PS,MJ S S S ,!S SB @P? `q``X 0VSP eM000 00 000 0 00 0 0M`P 80S>,Ѝ " 4 $" O-P@0p (AMP U  !b p<#`Z0!(@ <#OU`P $P HT00 P P  T00P0Z@! 0 A@BA0  0t!C @0  L!- P0  $!D`pbP@!@3@b`0 -Pg @D@0 - U! @ P }.㨰嬠P00 @p `Dm/Aߍ!0P0RPV  xS-D X-<-L O-X5M0<p@$P dP,0 `P%Q4  0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ Q`42PP00(4 0 4P00 0A000 00PPPyW0S8@[P <0P40 0H03/0S,0P p p0C @P0D P000`@0SOP p1(0(1{PP ! B B2P"Q% ,0N ,0R BM" f, f  P8pPp .0 R#01(10ഁ000BЍ<0X ∑0L0 3/ 00X0 ,b0  * 0 P  1@0 B )R R?PQ0R r Q0CFS0TR000US0a0Ѝ@0  ll>PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V [ @>P0 /S`Sp`` [XtT00U0,`0( -P -T - T8 Td- 8T"-G-# O-0MS@pأЍ`  EW0@ 0 P0S% cS2 %MS) CS, GS R 0v[P PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-OMM400 00 P00 <0 0PP0@@00P(0 P 0H03/00040 00!6 0R 0  0(3/ 0P`` S08 \&a0P&P.UTa`0$08000,00 $0 &'p(`DpWP0`05R0dh0` h `pV S` _`U T` WPU` QVU 00 0DPLlP4@ 0\PX000S400O>C<0000D040 40Z$pUL0 R  Hl0 00H0 F0 HL0S Up(\P 0S80Q00`Q0S 0L0 aA3/P 0P0P 0%003/X`\0F0 [8#p@P0?FZUP 0 [0 0 Z0R0 P<0 S@00D00S8 P_' a`0 "$0N$0,0, P0,0$0%$0匒 X* 0Z0 p*0  0Z 0|* 0Y 0 r*p0`00d010` Dl0hm+X900p3/ 0pXc0%WQXc0pE0 Z0 0噳+Dyp WpW000 0Cpÿ D0WpWP0W000 000W 000$0=U-v ] b xS- g 0@-@M0@L0 3/P" ! !WQ 0 0 SS@Ѝp@-`MMMP;` @P \  I wMލЍp{dЀ@-@P HYP 8YP (Yo該 p@-0@ 8M! 0`P@@ 0 P8ЍpXPUJ0 00  0 P@oC-X1M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPP@pG 0S0 L03/P ,0X0uP  0  x;H 8/P H{@b->-@-0P   G-@-0 /PR ЍP/R0 R/R  0Ʋ >-@-@@@-@@ ̲ @-PP@]@`P  Np0S  NT t㦽 T @LP  08\@ Ѝ,G-ݲ U- H&@-@ @0 @-@P@@-M@  G  G <{܍ 0@-MP@~  Gx  G y0TsP -p@-@P4Sp@Tp$ @Pp奾Dp>-, G-pt`DTP hWPP@ 0 0PP$0R04>-< A-TP4SA p`4:@ 4 0"G G D>-p@-@4S04pTU TU Tp`040 4I0 4A>-< p@-@P0 p@4N p@-@P@ opQ    @- @- @-  0P/>-0@-PM  0xPP| 媻@  0PPPr@DP,>P0Ѝ0@ꈳ B-@-@A-aJ?pW;$AT"0 PPЍ @> C  01/@P  0Q$AHL Q>0 R 0S tP P 0$003/$qb-#0pQ@-sCA #"T R0//s@-(@T@ЍpH̻0PȻ0 w003/@P/@-tM_`P @0P p@@(P  90@Tp@tЍT0@ Tx0 Cdd0d po `P D 8̻ʵ걳 0\- ˳ B- G-  /@-@{@xꈳ ///@-0@Q s㣻@o?0 \ 0P000@-@4M0  %YP0PU U0 00U00 0  04Ѝ0B-//A-pP@`VT0S0S XwUPH0P$1UT0U00 0X0`p@ B-0SR00/p@-@PS<0P4`" 6D0# A@$!ϺpU-xS-A-<`P@=UPp( E AB-@-Z K @- p@-M  X0 h&0S YXPL@L`@U 0 0 ܍pcY T\- 1G-1MP`@1P!t1t1t0ppl`PBL@Y1D0 [㒺ߍ ᕘ@P xdIS T@P 0=S=S?A@0  /@oT@  RP 0 l(WKP P NK@ UA9: ȴ ʴ ϴ Ҵ ,G-  1A-1@P`p1P!P0P0P`P`P0  @#K4 ng,G-9:  5 H p@-0M002 00`P 0@P @T 1T 1TO/11 ,{PO/11 Ѝps ;R 0@- P ?-@-CMp P@W P .`0 0p0SO/11 Cߍ5S| |p pPd`X 60S  S(1 1TM- SL-h- ϵ M;嶹Jp@-P@j71 1  pc-1p@-P`E@PA0 p@C p@-P@ᒹP FPN/1 1 pO Vp@-P@1z1(1 .P1 1 p^ V@-g@O C-@aM.pVTV PS2P1PG aߍP P D"080E0("ytP  ",q2X , Q 0, Q ^XN?1L0 0!,QP P|1|10 tAPplaU U U}P10$0PU@8!88`A,ppP0S S  @{V 0` 0P@?P0@ : D:: 0 0 & F 0  000 p ӵ@,ⱲcU-5p ,G-L = 9:\&B-c-SL-TM-h---l{ K,{ A-`$XH@P Qq-@T M %GزP( 0 :P  0=I P tR@᧹oЍX0bst D.0 0P ꓷ ,G- x  ^ h//O-0p4@T Ѝ@T@T( ^& @` PT[Z [СQ UZ@P@ @T@D @B@PB0"/i-O-P  0V @P 03P@TPT0@P0 0000000 T0$000R0#02S<Ѝ0 0(00,0; 0(0, 0S  R# S   @ 0  00PV@00V @P 0O@TPT0@P RK RH RE 0 4 ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0O@TPT0@P0T000T Q Q0   $0@-4MP!! 0  P PP@4Ѝ0@/@-@ 㹿@@ꐸ p@-`@/HPP  EHP0P  `Ra BQQ pQQ 0@S:p @-H0RH #@-@0@-P@04MSR!1PP Q*   P +U 0@S Q 0S4Ѝ0i-0p@-@ ^T00PUPU( \%ST p 2@Q.^U@P@@ $ $ 0 00C 0p0 ꠸ ~p@-,@PS0P ;pA-@D`DPp0ST00ԗ@"T 0 B- 00S@- /B-PC-C-麋X@(p,P0`$ 0АYĐY T  T:\0WaU U VP P 0U Ѝ ?V0  ꕹ @-@P$$0 R@괹 0@-0@S0d T0"S  @0<00R( T40 B-i-i-G-lP0`S7p@;S S 2@1+1:X 2p  QBp\T.@T&RQ0000(Q $N Q 0S T vZ? 0@1 00 0TRT0R"1i-{p@-P@u@op1O-0@SpP`0 PRQQT RL0VȰСr0 $P 0 0"00=0(Q $N0, 1X#Q  F vQ 0>0   R pR d0L 8CQ R [ R# Ѝ  W1Q:`0B- p@-P@P0S!U 0E p(0"PE0U055403 0(2#pB-i-i-40@-0@ShDP0@0ӕB- C-AP0`SV!U 0E p0쀟@SV  Ѝ 4 U(@0`P `4p00 0@0 RPp\0 H p `0P 0'p(0,0`B-i-i-p sh1A-0PSp@` 0 PQQA S90 Q 2r 0 !Rv?000 V ! (0$0X3,00S0001RPp0S0 00 0W1S` B-P@- @\00S T ]㈳Ѝ=O-X0MSM  0 @P\0@S0 @@`0Sb0/ @@d0S0G @C@h0S0c @J@H =0S \A80S 8D SRT80S $奵7, 0HPASTPPLPq @n@5`P)~G3 @ 0, ,\00`0d % 00h X Ÿ;S"D/ 4!,00@0P@_oRݍЍ 0:S 000a 1\0 00  0 0 0C0 ;0CSLLP|  ĺ ܺ   T& ǻ ̻ » Ż O-0TM$00 (00 40 0800p000@,0 0@<00$$ 0!$0 0(000 P 0ST`@`DPQ 0[ [ !1R  +K [`RP`XP` P40(S80 00 $ 48R0$0 (P 0XX0S$ +$ `P;S S2P11: 0S D$ 00PA`^U:PU2QP0 Đ(Q $K,0S ! 0S E ,vN<<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQU0B"1i-{p@-XP@0S!R+)r00 S @ 0N Dpi-O-BM MPtT0@P 0P(` ; Pp<Bލ ЍD0 [P1 Q 0  0 \0 :pP0 00!$0X4X00 0Fv0`F;S P |yPY +RQ 0P \Q SF0Rpʪ0S R0 S + S- S0S0000000`0 0 P 0S  {; 0 R$ ?!z 0$ S 0"P00S 0$ iedA O-DMhPl`PDЍ\@P >$6#Sp 0 IP` ;#S0Ip0 d00到`0\ h0X P$`P`t0 (0KH%000 00 00p; @-`X0Sg0'. CM\0@S0h - C`0S0i/ Cd0Sjp0!. 2Bh0ST0k}/ pP S 0&â Ѝ} ƺ ޺ O-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0 @0R0 0p1/P @j- A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-v6@P`p1S 3/`V@Td0@@!T0P0S@000S4000S(0000A] j-j- p@-@4`4P0Sp@M10S 3/@j-j-0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 00//00/00/00/10/Q@-@@@ 0A0003/P@ ! @% C-B`0SPEM;0 H0pSG0 St G0S G0S@G0S(G0SkG0S00$ R!000 % 0 F   0  0d 0qϥp`@I0,E0B? `t80|$4`@ p!0@ pd40 000 f0,0 :d⁨0$100\$10\0d00h00`@ pl0E00S< p0 PÁh ,`3 000000 000 0 0,0pVp` F3d,0.ᛥl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV $YP2Q dЍUP;00SZ 3/@@OoBS R@0&0010@!Rl!@!x@|@pPpt@廡t0S|0X*@0P PQ 0!t@x 0T:x0S@ Ҩt@OoB@|0xT:ƨ@b-9 U-pD-< T RA 08  j- uF ,G-c >O-UM8 ST44@`[D f0P(0 `pP(咨 UߍU0P,0jᆨ30 40S 0RD 80S:(1SK 1<00J ,HLAP4#0A 4 P#H@; $嶦㳦 00@PPf@T ( (0B"2 ,0!P0S 3/P20 SU@0%0cD0`| p2R倦:1@82PU?000X N ol,H! L䱟H@@<#`P`T@XP ` L?@ I?0F?000 0040喥 @? :?   0 4 /?0 +Χ$?40P1:> 4C @0 000000 0000 0(0㌣p` DhD0S#, 5Q7ZTX ᜧᚧ(嘧,喧v ὣ䏧j-j-A noG-/0@JMM`0PP+,0P& 0S" 0`"`!p/7P T` H 0@T* /R  PD@m+/ P:D?0 `HJP+0: S pWD>00ꨠ t!PJ>0@0/Sz0@!m+ / SP`+/ P*P 0/S`0oo`bS O>pL>0&000 SV+tl/ P*+f/ P*P{D@wD@`JލЍǿ ɿ Ͽ Կ @-"*@-M @PЍ(0  R@P G P a_0S:$c(#"c  8#8S G-`$PPp X`p*@P"Ѝ0S @ pF?P0 \ OpL冟 P Xp0 @٭ aֿ ɿ ڿ A-tM `PXP HP4+.O@P@0 ᬭ@ 7-@P+J.J.0㏭z+J.xsJ.0L〭LkP yPP|<b, pPPsw+J.S0J.`PPcg+J.C JB`; IPPLP+J.l,pd0\!0J>P 0.,P UT ލP@[+JV.JPPp0J.@+B. P h J>PT   ' a i u d&ɿ +1 6 ? I /00/00/00/00/0@-0@4M#|0$P 0m<P\ ᒿP0T0670 P啣 @P --4Ѝ0U- xS-E-O-AMAd2 ,000PB,0 00000 80s0`0Q, p $  ?(0 $0L 0s$00 0$l5 h%T` @@`寝@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&T"@(⵽@@,0S:0幡(0$"P⩽P@0@00 +0@080s=0 0@( OY =W|Ѝ#㓡!@&(⁽00\1 0M:`!00 XT埵@!0(Pi R P@ j0! 0 h0 @`0 400t0S00XTv00P0 HP@ 0(l 6@h> @8q 3/PU- g  0@-)M@{0p \*4 +@,P0 Z*P .S- 0 F  . 0 BЍ0!0P80 S+P ,٠P /+ xS-  E-A-@  "(0M>( 0PlQ2d2 5  L! D!@` Q 0S  *008,04p $0T0 0X05p0 P,[.[ P Q  0:P0 8q84pT Q[$00 0  Q QPPZ 00 00 ЍO-h2M04p@$P `IPP 0  Sz22@|1 01x00 0A000 000@ll{Nx0SS(hPPL p(P01ᚡ!P]0PA x 0`(R b ",0$x  B$ y= u= 0 8ƞPh l~,0( 040x0?o21000Ѝ0KHb-\ u O-p@㠑報,M0S0 /00  勠0S,Ѝ/S  $/00`p0PU1(`P p噑!ݟPP PP%0(` 1`= =0`400,00T00 X08`k0100& e9Pp0 _ 6P,Ⴀ`U-WO-Pp@\M4 `儰<0 SU 0 Q$0S   $ pPh9\ЍO*.T< P0#p #%L*09 0`0000YF(0S` ` 0 Rp`H03/0`0[ 80s ȟ0Q 0 0 0X  BR0S0pS 0[p08 r  *   * PU0'0U " [P R 0S  06 p0 .0PP  P 0$ PU$0[0 0 [tp0 PU[n0[( 3!P$:p0 0 00$0 0$0 0pS 0pW 6pWZ 0 p 0P Z$0 0 S*0 0S 06 00#0 P4S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S 0 R 0 0! 00 00000000 \Ѝ,`VT` V 0 S 0 p0  ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P a0 0 , 0R 0R  `xR  z7P` s7P 0 Q ``T R T  R X `( 0SY0L0( 3/P <00S D0SS000(( oA L0( 3/P 80<00S (0, S004 Q 0 `( L0Q =0G0[^80s[ 0*0 PQ 0N[pq! 0 QQ 80s 0  00UPppy0  R 0S  0-5 p0.  0@ $[-X b-U- O-`M,p@0 40PVZ pࣜpPU Pp0Z:`PU`Jl?ERUB \\03 D2900#h R 0  80s0`F`pHU p P:h0S 00  80spHY pPp =:h0l0 0L03/, 00Y:pPp傝p0H0P804>ЍOp0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (0c4PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`/p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (03`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  S3 V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (02 W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0Sv ,0Ss P0 P  R0P0k 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s0 00- Q ( 0 S% 0 Si$ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sy 3/p]p0`0W:0p Sm:Pp`,0 0Ul:8ɚP  0$ 0S0p0$ p  Spၙ`P 80 p0R:pYP Y:PpW00 U0#S p`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pe00   8 rp0ip` p!8p 40U 00 0S 0P*p ` 6`80s0 L0 3/P 08400H0, 00,0+$0T00X0pPGm۶ ]$[- 00 80sh p 6P:p@-@P(M(0S◘(`,`X0 00P0F0 P P`0(P␕P,(尙(P(Ѝp000d,ѕ(夙0,`(P- RE-O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X: @1XS<1@1\1(HL1X\1Pp ,P!#0@ 0 '8 0 ' 0 W %&, 劗0冗80000, 0 0x0t80000  0'cΗ0d0H`H0P00T00LP (X0P5W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000㙔pp 85P,0qޔXpW* 0GS(> $P A$ 00S H @3/4pGWp@ 0L0 3/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0KQ  01/ 0S 2 ;C3$Є  0<P 0{ Hp0  @D@0 ᄀX60X< Pl㯖,0S0pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000yb-U- p408 j- uF  0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002j3  Ԡ`0SQ,  R) 0 0#Q! Q0 2J3<{# 8 0 r  1# 000 S   F$ 1 SR08C81/F-!0 /F-p@-@$P x1SP 003/p@赖x1粖P$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,02 ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0IGpK܍ЍIጒ+R*<o=(02#8 ;c&@@l u-O-`0@PMM,0h1h0p 0S (0 S> 9 H2 00 0 <0.%"@~40kP`0V,p0U 0000000 0 00000000p 0p`ލЍGŎ2,0S*< !,00+C#X0S000C0C0000S0 0,0B$PF-l u@-@->20  !<$10(10,1P001.@-@*20 0! 0O-4M\T`Xhp(0P  啒"\ @,@;/,P R7P pPpK 1p WpF2 1 0" 00 0(0 0 0Z`8ᥑx(04ЍO/Pㅾ4Ѝ[;0p@-@Q*P当 0 P㶓40 Pp尓 <0dp@ZPT姓80 P@塓,0 P㛓00 p ' )* *+p@-PBM `@ቓ 2 V`P| 0'Ps Bߍp`hP00Sb0`]40Pp`W80PS<80  4X0S0!;@$C 0 P;\0 `0S % @`*d0Ph0S @l0S  @p0SH @T`t0P^ 94 :> ;=J >?N X A\ BCEp@-`M<P@  @ 1U%P0DPK0 @0S    8PU@ʒ 0 #P’ 0m܍p(0S p 婮@h,0S H 埮@D00S , 啮@$^ _ /4 \ 12X 30p@-M01P@Q#ㅒ   0`N 0S (0S l   ,`V D܍p4b   0`N 0S (0S  t  p,`VPC $0P: 0 P40 Pt.0 P`(0 PL"0 P 0 a _ d g    C-`RGMP@8 0n w <0C-P80Dş0C@MS001S|1S  Ƒ0" ߍCo`0xpW*Ⳕ0pL0 3/x1S 1S 0S~壑8@4ĥ00`S h$@F⊭00 F/'0 00 000/7/P P     > C"Y0S0 `F` x0p⇞ 0S w Ls`,p WV o$ $`> ⍹0`0"  #Ғߍ@+ 0  0S  g `PV 1 `S p 0  0N 0S @0S @ ߍC<0040!00@0Fo$ 0DL03/00 M0S !0Ǭ{D` 0S  (8`Y0,p x Q0X 8 < RFO    ᘬ 0@ /5@噐 0  l R0^| 0     _  &d w . @-x @b.+0 @0p0奘d1 @ @-D @O.000(0,0000吘d @ꐯ @-hQ`0@sKMP!   0⩍1!S=0Kߍ0 00@ @@0gP(@UTpp (`0 0  0`0`pNAPAD00H0P30L00@P00000T0D0 30S D00D0 p@ 2W*"b"`"0  L*}/T2 0"S0C 1šWߍ ;*0 p2 0@00 0)1S080.0$X80p$P! 0 S L0X 3/P h W pW 00$%1/pt0S _PWC0A00M  000) 0" $!  8 0L0X 3/P ht0S 0_Sʚ  0) 0" 0 0p@080 0S [-F-8 g-y-PK- 8@ Fc-H \ y-c- 1PB K 60S/O-@pM MUPm 00x R p#R0`]adD80  @Q D0 hP㎔ X PF D%D ,%`V800(0S$L$By00,0S$?$Bl0000S$2$B_0+ 0 l0B/GP`᭠Px 00 0; Q <0Sn0y0!$ #B700 0=,0#Sn0y0#B'0 00;80#S3 0u0C\#Bx 006#=<0X#Sn0y0ئ#B( J 0 R #ɦ"B 0 R "⻦"Bx 06#0= 0S"⫦d"Bx 00 0=$0Sd"⚦ "B0 00=(0S,"⋦!Bx 06#0=00S!{!Bx 00 0=40S!j`!B0 00=80Sx![$!Bx 0X6#0;!  K Bx000B/ c`VxX 00  @8 PQ+< 0 \x S|0L@T܍ Ѝg-y-w     " ) 0 < C J Q X \ 0C-pP@㰐,M0T寴 0^ ^ 0S 0L @֥`T$P aV@,Ѝ@ [-| C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"Tz- 30S/O-@SMP 000#it3Ⅶ`PX3X@ fH3P  _s 3p  0B00 gXdf00,pP0S* XZ'0 F8PP Tq 0 x0F/0I1P/S L(`0(0 00`0SvU (  0S `P0 100!15:%  P p Q 0, ($!` $ ؐP^ 00 8a4Q101Tg-4z- [-@  0S@0@-S@00 0S/8z- O-P2EM 2@T P0 |2P p|1S$ $P| 003/P 02P ( h Eߍ$0 R P 01/0P 003/P A10SX PaPE  <0 040000,00800 PpP@3@0S. $P+ 0 x0D 0@(y-4 tz-#X( @-M@P `#00T20S'  DP P!4 00 B\ \"00P0<  4 0 ! ЍHPH010S/  $ PP)a 00 BQ Q"041$0 000xpP0` 87/0P0 00!`0⇡] U=00S0  P* 00APU PU000 !̓P^ X^, Rh P$0U ".R>c- z- g- 4z- c- pz-C A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0c-z-c-pz-g-y-\0p@-T00P DPPp0AS@  1SAyPK-b- [-0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"j-l0\ Q0/\P ^U Q0000@-j-0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@E◁p@a< ("(G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C  01/P ,00 H$L Q>b-80S @- 0 p/0 m G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $Q$00S U 0 |1 08ЍpP _P P Q _ P K ᔮ P F-A-M`}P8 U`ЍGP $A003/0 R   01/pP 003/@P$q0H03/0 pVEL2 `0803/PD@ 0!! 8# p 0  3/P"#"#00 03/p p0` L03/9T⋭ ߺ` 0SWp`@`C88 0U x0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv ߿ 0 |1 0> 0  F-G-`RM@Xr  PP dP`T `UP P9  ,p 70S  yߍ<0H(00,0 00004008004004 04$0D0(0P yW[  喤pU l吤p* `\o` 8  8/V ,aV  ]V YV UV 0,0OV0 KV ` 8p 0`?`a8SPb 0  0**0P0%  0* d@edA zd@E  ! 6 A-@Mp`;@@ ፹p@ݍ P@00@២T00 ##  /O-4MFpT(t$ ,`&X\pAT  0YY 0 0<R. R 0Xpp @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0?pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-`P 9P @P@-  R0 >t!ɖ000㛓#000X    ,↠( [: Z|T  'P ؀!\R 0 0 B@0St 0 0@ H0 0S4 4 0 yd|dT& {dЀ * 2 ; 0$\ (00t S S  S00/Q 0P/0S 0S P//!R80@-4 :CRR )r0@/?  80R*@-0M@"P0 0! 0! P0Ѝ/00S/ F-op@-,P@0S0S< 04 pF-@-@0SF-A-pP@0ST 0S` @ YP<0@P`V@F-s@-S@P ' dCP xЍp<8P m.`P (5 PP )1 P` P P(  ` P` D PdUPP 0SL` P P @0`0@0k r x ~  p@-M  P ڔ| @P"` zЍpNU0S 0 (q P|Pz O-@QMM@P;.,@bpP}0` Fpw py00p$@ @Q&D0S8 CR0 Y 0 !P[0D04@T.4@0@T50@`T$00 0G p P P    00wP  p$ pp00#؀lz@0V  00# l#Ӂ000G `#APQލЍ04 040RP8< 8<0RP{00 S 00#壁PD tP #x啁P@p Y #YL刁P@k P # xP0'% D00S00 D أ0 S 0 0 0 `U@0x0#Q@#000@10 4>d@ x  0 J g 0@-M 08w 0@S( eyP\xx0P @88 P$0$  B@Ѝ s @-*x0SЍ@-@M wT0  CR$00S ЍwA-pP@0ST 0S` @*PPT\0(Ѝ!SQ0P a`1/T 00ܼ( O-DM  0000 00 0 zp  00 4`Ro04`800,00  (0$ fp ,08<\@?! ( _5#ZP0$P00p/2#<*_.0 RP80 \X R PTuU G" ?N P1 0@LH0 R p ? ; 0 8 /G$'@ T R`@`000 00  0 p 0S #"01# 0?04 SQYL0 V`00P0pYkXUDЍb-/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    pЍO-X @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0pF-z-08S^:/ᨊ-- p@-@ 0(  P0R0PS 00Sk pppG-P`NM@< Ѐuᠠ`0|  ` 000 ;(PP <崐pANލ= : ydG-xM` @pᜐ堠XP" !0 @P 0S PU 0 R=H!H0 bB00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZD   YZ  bꘚ O-p@PBM M`/0T;P( ⊥0P@0P0iP) Y  $;$  j P!14"S5 0Sᆎto@ !U01U01Bލ Ѝ mi0P0  gj?XY$0 0I0,Kk?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P#j@@Q Q' Q0PUTi 0"0S0S0@0iP P `@@=02s 2 02@F @DURX A- 0MHL`Pp l1lR/ fC|Pi@P( T00 0R`0 !?020 2002p#04 pj0Ѝ 0S" $0Q00 L03/P Q 0D Q 0 SD S003/ >z-P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P Ojp`T8{BuP08} ^\ 0Sp`82S04@11111111108 l2~` "#(P0WT fP @0D000 S,0H00H02o,0LpP8 <0 02 R02 0S PP g 嫠40S4 0!80S`1$0U0q? r?08 R o 0( "QR 0S0,"~?0,Ȍ008 0S Hಀ(ᰀW(0z-i   T|lO-@MP0Y00000 Rl8h(h0/C R;  XD00P}/ $00800 0 U"oࠓ^PRQ"~@,4B 8($ 0S40$ 00SR 0XSY l70XYX7$004 0Z00/$ 00(0800,0(0, Z00"0 <0 0@0<0 000@00400 (0S,04 08B4Y6u?v/0808 S 0 S4 1YP6BT@q?r/`0sh2`0 (  R   T R00S4000D0S@ P0W~ P0c 0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝ b-G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/b->0@-@0M 410810!b0 P0u0 0Hb0 I0PU ! 5/:Ѝ0b- @- H놇@ @-@ 0]  ~{ H&@-@@0s1,00p Tc0Co&ľ--$M?0 0 l$Ѝ0-4M 00 000P4ЍO-pQMFv$ "0P5 `0000 00 0`R08 (00R0V`(00(0"R 0*`Pş(`0 0 0$08U0S $0s 0SQߍ$0S zpP @d40SP $A}P4[06 嚮 4失  0 OdXd@0eL$|H4P(4Z-JP JZښ$$壢J e2 B|P0 ß Q  # 3S  RS0#1 1@0 e|00P PU480PZPU= } 83 ᶮ 0 "0 !2@T0@P 0vP !ݱ@P$5 T;%P # 3W  R@pdHKq !$K @"% 0J/j \|2 @ U0)1p R0, d  09P0U 00 *!!0 o(0V0!-|@$0@PSdd!$|@\1 0p B 0 U2 ,.!l 0h!ᤰ0PP:0P  {`ӚP<,<p˚@f0| {@(0W/{ؾ-о----T8 -: -Y@= Ⱦ-QN .Au ľ-@~ @-@[ @SRG-@  700pP ąP:`X:00X0 {P @-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  Q[PT&p@-@Pᬃp  `᠃@ểU700@pp@-P 4`ᕃp@  kPᤃ@p@-M@ p $ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ p@-P R`@0 @ X0 00S sUP3PE ЍpA-@Pp op` j 0W0 xW0X U` 0X P 0 h0@ zЍU  0 P @-`0tM0F?oP2p @|p! pЂ@p X2Sԃp L0V"4 - }tЍ(X"pp@-P@@pPppp@-@0  呂0 S ! 0PUPUp@_0S   0 0S __0S   0 0S __A-p@PMU `0S@PE7  S0P800ۍX.700#S @ Q@BPE@C0 00 pL0S 0#S @UX5 @-M@ H p8}oۍP  > p@-d1`0SM LЍp@l@>  <P  0 !   ⛁p0 S 09S ?1Ѝp0 S   000 00P0 PS @ \0 b p@  Ѝp@ pR p@-@$`P\Pp0 @ `P0 001 0pp@-SP@`xM  OAj0 0vp@) dp$  ^p Xp  Rp  P  D0  p(AxЍpt @ 0 0 s@->@P`Dp @ p0 p`$A L01p @ 00 p$AЍp p@-@PqP  0}1LpP`qpR 0"18pp@-pM0 p @t ̀pˀ@pЍO-QMMڪ700ۍЍ Y  Z  @`V m@pP` @-`R00 ЍPp@0ST\@PT  Q*R@00 S   0 0S0 S *\P `]] O 00000`0 @@P0   @-@@ L1p@-S@T1S"d1S,tRU6\RUp`bV7\x]\bp1Cs]L10CL1SPl]0P11Cf]T10CT1SX_]0X11CY]d10Cd1ShR]0h14x2,P0Cx2xbVtD]tb'`2,P0C`27@-@0 PP$ H1 0D1<1@8 0@    (    )      C A Ѝ0@c Ѝ0Q@-@  6 bP p 00\Ѝ@ Q @ ,0N p-Ѝ@ Ѝ Q@-@  0A iP p k00 Ѝ@ 1S^70|\gZP| 01@ 00 pAЍ@ ЍD X@-t0M0@Q0$*p Ѝ  U g 081/@-@d'P0S P 0800L0S S@B' @-p@\M Q t0 ` lp\Ѝ 0@-800@@tAcP@-@ep ?U @0 Q7@-@  ,A^ _ B~p I P~ Ѝ0@ P 11P,|1@ R  |&AQP x`00CS`0 Xw@ P0V p ,A Ѝ0@ X0 X Ѝ0 &&p@-PDv~p4p@ @Qp p@}~ p@-@4P   0F8 p@,  ? p@-P`8Q & P X  h|080P040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :0H@ PpP  Pp%pp@-8a~81981s@-81m @ (!x1P PR0!  Ѝp@ %P 0  !aЍp@ PU%P 0 Ѝp@x 0 [ 0iP90 ,1 0,`嶓p( , }0,1Ѝp@  p@-@d <= x1P %p@  0S b%PUp@@ 0S/8p@- 0p\p P@U  <B%<1 x1pQp@ 0Sp @-t0@SPLM 0$Q0@p(p2 00 p0 `P  LЍUP @  P AU` H10D1r O-@PP 0p4` R ( 0 08   L0 0 XU HP  *= 0S 08   Ѝ @-| R xDH!0 ЍA-@x0P P ЍA E 0 `  0  p 0x1PU 0" 0SHP ЍAKET 0S 800 eP P r ЍQ i u A- M@`Q p,0PSL`$& 800 A PJ 0Sz PPUv 0 `8PU,P  OEJ ЍA$0<1 xQ EA$EK<080SK $0P    p0S  U8 A ЍA W0 0S V  P0S t`QP  f8,t R P 0S X< 0S 04# ЍA Ѝ  J  0@-@x P $ LT@C L0p@-S@P` 08PU $00P  n 81 0800S>? $0080S  p, AR p p@) @-@@O-M`80pRP@T-Ѝ P X  R$ R#W 080 C >#0   F0800 @8 !H@X 0 00  (|WUP0| 0|x0cB N A-`Ha0@ CPPj p0 ,Up 0 pЍP. P P0 P6 lP@ PTQ IE@O p(P  08*0 1 P #P @` )@JD!\10B0H1x0h 9@x Pʞ 0P X p @-@  A@ ,yp wHP<1 u,,y0,1ЍPH0/d<1 P6"  q Q/@-@ | 0S@C-q`@ x @P00@ 0S  20 Sx   0@ Ѝ<1  0` pPp @P w0@0PEV @ x PP 0S  $0$0> R>  **ZX  0S  @0 S   000x1  @  0SP L 00 S   0< 0A-M P0 0E0@!0EGzp00`+x`p9Quw07S 0 S X \f0E 0\!`1  `Px1 ,dލ % R Pp3 P0 S   x0 & pP 0PPUVx}x 6 x |x1p  P  0S 0^ 0P  C Q@-@  p A@3+p07S@Zx0 S t0VSp0S@X A-`R@p@M P?P U Z700 "@ЍAP"R 0S 0 r>XU%  *P 0S <0 *&h p   <0 &V>P  *@ЍA@Ѝ\ O-P@$$M`pAP   :P 00A $ЍOm+Px &P000 PPPXRP    0PEPE 00X  J* SU 003#\pPs 8118100x1`V+ zwPx1`G 81181kP NP 6P4PUPpP xP 0: 0 0nP00P 0S 0 0`  P XX p 000 0S 0 0`V81181$Ѝ  ~P XX  ]p0 500V0 0 0 :0F VYx1<1 :<1 0Px R @ [DP V @(0Ȁ0 00  YB Y 0HȀ0YB 7 X V xx@0P 0S PPVPP0 xv  ) H& =  @->@T( 4"4p P`0"@4"4 0W  ML L0 b"!4b4# 0@> *>0@D Ѝ耼p@-p1PSM"`! #%@P T 0p1! V S o0S X.vQP <@tAtЍpp>0S 0x1@T l1S   @>0S@ `l1S   {0 @ %P 0  @  B.(0$pl1S  \ 5 p@-M@0`) \/@` @@PA 0H $ ^ @ P@`@@@ A00\  L00`B#upЍp\ ` @@^ @@``PP@ A0p@-@Pp0@0D0X0\0PP `S0 0P ` S000r0p0P PR00840P PR08<0pp@-h@`T@@@0St#dPP}T00pQP dh@pC-@RD@T@P ЍP@`Vt#``\T00@ePpP 0 P@P\B<84`(``` 0`Fu@R/qA- 81`0SPp@+000S= @T@T2 0 S   00S0@0 @@00000pp10  0PppW 0 S   00000@@0aq0O@Ppq0@-PM@ 00Ѝ00S @T00 0  0! 0!  @H0 @ 000`tpR000q0C0p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M@`up p P 0p``F\ Ѝ0S *p0 0 0CR00B *S0C00ʚ;G-P`p $0@T 0 S0 R  S 4  0pT@QT 8@T 0 S <  00` pQ 400@4@O@P0S 0S0 @@@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p,p0 000"#} ЍMb@B0@-0\0Q@ PUPUR PU PTP4PP@PPS?00@"!030@-@Pi`p AsdP@P@-xKO@P  UtpxP@0 0  0  004  800< l0@tp`pp0@- O0S 0      Ѝ0G-@ap(Mp0p0S r 0PRr00q0U0Sl7J 0R Q00 S 4  003/00<00P ЍЍ/-@-  ЍЍ/-@-  ( ЍЍ/0/& 0p/P&@-M MP@`@ 0 00  $ 00` P 0,00@ $00'q0S@PP\MUgV0P0\ЍU^700@ p`Rп0 PU B0>000 <07  ,>  PP> *9 @-@T>@Q/@-@T>@0P/- R 0 R00^ PG-`P M0(0S @ P P P:,`P 0!00 0   08S0 00 Ѝ080 00S # `pP `P0P 0iS.S  `P04S 040:ST&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   B=@P @-J000Q/Px1P/$0/@-@M    C0 ppЍ~iO-YM `F/@H9X0"JpPpYߍ02p`L 0S 0S PP@ Y "P @T0SL0P 0@S0@S@@T1S X1 ⛑PAT1S@\1S`1 ⍑P5\1 S S R@L1SP1 |P&L1PC_oSRPU@P04S 0s0P?AB@@$P00SLQU JPPdh1 <P Pd1UP H@ ` o 0[$0D  Hf `0 S K9X001H \0op X0 PB000S0 15S4 S  CR.T X L@@6S! y R02 > 0*81 000S  p S 0 S D@@0?H0p 0P0H0}>H0 @000L0PPP  iB @h A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @n$n-Ȁ 5S @00 50A % 1@ A  + A+": A !9 R50,@-`p߃@P@ Ѝ 0PXJJp Q,%P PP @-`RpP$M 0S0U00$Ѝ/l@P 0 00 0  0S dU 7PMP, T/00DU 7 O-`@0p"S0W"SpG` Y PP u700 ЍTUYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  D0 `P0A\0SP0S  CT PT0Pt T&P /0 S S /S/P0/S S S/0/O-M 垂PPЍO=_`P ЍOsI@Y@S   pWeI|PP  ⻞P 0QA00Ѝ=20@S. P( 0S Z@Pf:I@`@OH0P 0 @ 0 0 @ @ p@-@P I` 0SP I$` PP(0S $I0(0$0p,` P,` PO-@/4M10C`pXPS00pHU- :`Pp $=P@ 2P7 7  '$ !0P`0@T\0@T U0 @4 0H050U* H0tp>0P H0 F@PA t01L4ЍCFP 0 2pA 0S ZPH01@U  CUH070 0  px P! .R@ y 0R77@0U   0pP  H RU H0@1SS@H000|U P0H0r ,0 00 0 M,0S< a J|U ,0!00 0 ,0 S L Ux <1F80w40xbt000 0 P#PP00 0 P  p@0  @P 4 UJ <180w40xbt0p00 0 PP00 0 P  0@H0:0H P 0<0UH# 0S /w`P /r`P00 V /0P0 Q00<0000H060U ,0 00 0 L,0HST  Ah 0A  ap$  P 4@AK0  U \U ,`P 0SU0 pH0 50h x050,0 % 00 0 ,00,Y `$ UPPeUʘ700 50 $ 5'@ 0 ,  0 p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 L,0HS U H0P SPH0;00H090U ` k`,apP 'D`P 0%` CkFH0Q7;0UlQ 3P0l1 t,P0l1 \%P0l1 P pfE0Ptp1tH000U10H 2yP0H 2q P 0H 2i P PH| [ H000UH020PU @ 0pP$` H0 S;70=H0208H0603H0;0.H080)UV <1$8xb0w4t00 0 P000 0 P0P0P@U2 <18x04gtr000 0 P00 0 PP00 0 Pp@0  @U =fPD 8p DPWH0p000 SP0<00 )P WH p P  PWHp   X P  DP  0P  PWH\  BmzP;  ($wpZ 00w & 6 S a d   Q m { ~    4 P j s   / ? e   6 < v | @= X s @@  R \ , ,p 00XpP $o (l H,8h  P B  L^P*WH B $p )pP ((> (; H$87  P  B  -P   'PW ,0 00 0D I,0HSx -  P% /o"B ($P/P0H (0P 7$ ! (0'0b ($vPy/P0H  (0dPi 7$ ! (0 '0DUq H0>X U$X8H0203H0 000-GH000%H000 H0 00H0 00(07600R 2  *450S00T01=5 =50H0U$ <10(@0P@47x0'tP :0S(|U H$C|P$U 81 800 (0 00 0 H(0`S, 5`( "4`4# ,,0H0800 PP0 0 P 0 0@4H010H010H000H050H050}H000xH,';,rUpH090jAK3O0\ U0` 0 YWAKοOAK OAKҿOX"U| \0@T$t(@ S`P  ,00NH,0 SGPP  4`P0:0pP! ,0!00 0  +H,XTX&DPdxP`Pp =Ppp"DPpP`Px DPP`P z CPP`P< v HCPFP`Pl | |CPpQ CPyJ CP9|   9 s|?o2= lV 0 :0S ` YP0, ☗PP< _4BLCPP`Pqx BCPr CP p0S  100uCPs (oCP .jCPp 3dCPp :^CPp DXCP p X;QCP@p t; JCPx ;CCPtx ; E ^ x O-pУ@`Pr8P !P `nV<1T ЍOrR('RZ4 07840 ЍO7 Ѝ !O-S@M5 P 0Q  8p`tj⬰<1 0  0@0Fp0@   p   P@ X 8 *  ЍH&!! -G-@`pPU T =PPP)@@P  T?0S DD0 !*@D@DYT 0: @/@L! ! A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90?8g<7S:8?@gD7S;@z?HgL7S<Ht?(r?Ao?n? 1`Pg?e?1`P^?X  FP T0 ST347,`0C47,<7,`0C<7%D7,`0CD7L7,`0CL7O-MLM`p$ 0=P\MdxP E3&7 E000 0000 0P70P7+ H0E00 0:00 30000% p a +8 0 E 0d0 E+ 0 P#Z 1H@[0X,=P0047(|P @5: ؍LЍDP PA0 D  D 0 0G<DP078t2470x24,0<'哸 R38>@,0D'哸 R-@>0H'87\"L'<7@7D7`"H7L708 p0  +@0S R R P\R @A>0@ R (#P0 00 ?op2 000S002p0p@p(0 DDVP 0 0# 00tDP P0( & D P;P5 Z$d hfpP#22C,(,X ,0@0S 0 S S0P\S  @ :0p  TPphqdvPd p(0 P$0S P $1 P 0S P Ppp} 0 0# 0 Pp Xn0D00D00 0  0@b 0 S E:$ E000X! !-@ !!!!!0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HGU( IGA-TpW0 %T`@V0? C.CL0LS @sP X X| |00 S HH0P 0RS  ! !p@-P @Pp<@-p@-@Pp PPpT Pp@1@-0@1T O0@0T0S0@- eB@ , !T0A-p `R0080810@: PP?W0A U t0  t0 8p@0S d,p0S <!p? @U4 hJ.P P @$T T0Rt0t 0SnPt0 t0 88cPT0$0x x0R Pg@OP0S >@S !d !s !\ ! !A-`P Pc_@T T0pS @p@-Q Mz 0 zBZT0S0e PUx x0 BPc_`@P 0 8 U   Ѝp !, ! ! !G-} G*:SR0M" P0 (   FP  @0A0 0(P  0Ѝ lB w@T|   pT0 R0 0800, P T8p(0SS90SSPT0c }| `P 7 R|0   P @T T0R88oPY0Sx x0R E' @T 00 LXXNPR <P T T0R88=Pk0  :p0VS p#c_ @TG 0`SS-90SS)PT00S8 00 G*: S R   p e0S a0S @/T O00, @P ! ! ! ! ! ! !Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-40; 0S /000 !P@-40QD 0S /000 !P@-L0}O 0S So/000 !P@-H0a 0S Sp/000 !P@-L0o 0S S$0@o/000 ! hp@-@Q0 eCmRP0_ C|C0`S0 SQ 0X 8Sp@p0 p@m`0 p@! !{ ! !0P@-|0| C7Qh0i CC P R !P BR #@˲@ ! !p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S (0@0 Ѝp!/0d`Q 0000P 0 CC0 !- !'A-0S00@Pd` pW /0000Pp 0 C- !nP@-<0<.Q(0v CB!>0000 !K !@-@QRX ! !C-`TM@ P `Bgp) 0 jg ````yg1pWp0`V& eg 0 0 [@ %gT  @TЍ00C>S}00`"P!@03@000C>Sl00p"P!@03@0 -3@- P gp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  pp !A-0Pp`@S:0SS 0? C/C  RS* R0 $`V1S* njP a 0@DpR: Q  ! !O-A 0MTP` 0 vuVB@PAHl@081 0S  wp 00PЀ P P P P P P pPp 0S h Cp X61T!R D9p 0;1#3K00&&*pа L0S% %S  p H p P p $  p , pw P0S t0$0Q0p P pe 0Sz 811K10x1ZsQp M Pw p@ lYP0hd p1  tp+ \%P |%P0 x1`@ $p X00SXppW0h 1SPJp@Hl޼sP  >|p bZF upp%` lp~ 0S P oQ Z T  hQp  r"B_Qp4P{ $Pv Pq xPl Pg P P X00S 0Sa Ta FQp\%P `V%RY pTr0S]   pg 08!lpM^pJ0SL   < pQ 08!p<HpPB 1 R6 0S  P4 Ѝ 0Sp pl!O!J!Y!a!i!s!!!!!X !!!! !+!&!!!!!!! !1!L!U!~!6! !&!B!E!G!`!p!!!p@-P@pp p@SRRA-P`@@pL0s  S$0 U@ p@@@dW0S R H R U pi!a!Q p@-P0U@S 00p @P@hK@T:{p/!&@-P`1pSMAT  p@xЍ `PЍ@!R 00 0 0 p@ @aV 0 !p@{`P p 40S |00#40  L< SP 6,0 %!!!!!!!!A-PP 0S @0p 0S @@00 S U   ^ @ .S0.S0_S-S```&00  @R"0T0 0D0T& @- @0P PT00Q    DP `00CS`0p S00 P0S X0X /XO&p@-h1@SP=mPPE @p ⃼0.SSPP XP HP 4P 0  .PP!!!p@-@P'Uh 0 RN0 MN0 xHN0  hCN0\/T,L)D& <#@4 , $      N0  N0  N0 M0 M0 M Ip@x DP!!!!!!!!!!!"!.!4!>!F!M!T!Y!a!i!n!w!!!!& 0(HLǒ -\ \` Q^ ,\ ,@-QMM@pP]p  0B BAMQލЍA> 0!>0 0B 4Mp`0SPE@E& p 0S:0@0D!O-,MTPpP+ k`   @P20S  wP@ qP@,P$ X P$0X42700,Ѝ P,P, R ]P,PE0S X R0 6y20 0 0 7$ R, R 8P 0 0 7$ R R ,PX!@P !!!!!! P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-P@`MpUQ:T 0T00D0S00V`F@@V00ЍPW~"0$?S 0[ PW RPPUT  P_70 0 ].0 I@0 0IU:D XL0 0 `TT  DSPO-Pp0` 2" Y*Q@ U V&700 Ѝ$@@P`Fp  00U V 00  P     @3 \Do   ' T/T$\T0 U V@@U V\$0@00@@`FPpU V @`Fp~T&!O-SM MPdp``p< @(=pF $RLp V=p (y=4 @LpTN    0 Mp PB MbP M/    2Sލ Ѝ   430TV003 0@M p  @`p1P $Kp @T* pP0P 0S4  `@TT*T  4Kp @ pz   0$#$("( Kpe @  0$#$(B(   0Tc(#"$ c$" KpF @@   1b"!4b$#  J  %  l FR .0M/P M/_Kp 0S @00Sh%@PKp00!!  !!!!A- @pTPM 吸ЍR` R n00P0S 0 -0 0t0#0Q0 $ V0B  00 0J!O-4MX@p 0S\`d` (0S<0 p40 4ЍO 0  ,   p0,0 ,0SPFX ,HKp 0 00 ),a/4ЍP V0 00 0U0   0,p4p0`0 0` `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  05,P(!C!*!K!p@-P@`P 0S P$`(0Sp,` P,` P  0R0@-MMP+ p P0@ۍЍ0;0 C\@P O,P T@- PΠ R100\L  ^@-Q00P`PV0 V=`V xЍp@@T   0x@ `DaPЍp`Vx1@P 0>0S *fP PU@P PP`/0P@-404 Q 0 9 C/C @!!A-` (M00>0@SP  0'0x B0epp R0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 x#PT (Ѝ0 8 0>0S X0xPT !A-`lVPPFPPp2X@p`Eh,P hpl"h20 5V0  l20l2@-`@MpP!  ( ((X( 8pQPU@ T700@Ѝ i///0@-M @ *PPЍ0 3"QIp 000)00QpW0000@ 0Ppl I 00 " 0Pp<> p 32 !!p@-QUp@p O,0h1p@,@->`GMV 0P0Gߍ@PF/ <9  0啵l0 p 1`x0 DF?PP> *k0 F?P ii@-@MQP4@ $P P@Ѝ`!Q@0@-< C0SSP`///!$0 /Lp/@-Q @ ?t0@0Q00@-P@,M(    ' PPp 0 00S p,Ѝ08i(p@-@MP  `    (PgPPЍp:iO-PQMMD3D CT0S,3 CCpW3 CC@H`"s0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0 0FT0T(@)@@F@  弱c T0R  B  @ Y@ L1F0FᶰF @T0  EYI @T0 0F0FᶰF @T0  XP *UPPEPP@ D$("(Mp`ݍЍ  ?  YI @!!! C-`p"0M` 0$`  0,pP @T@+Ѝ`Z*PPA   0,p0 S '+@ ``T*x0V*00+T00V:0 (P|P@+ ( xY 0@P!@-`@DM pP@  @  ᛳ!> U 134  R2$ $@0 DЍUi@i@-l@QM  00 p l2 0"h2NЍ@-]MM`@FP#=Mp PP VR 8000S0S S SS wR0S HcpVPS CQRS 0  Vxp@P V$0 Bp 0S$H`   hoNp 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0y HԲ!>50H \0:Np\0S 01S h0Qc0 0 000 0 0pURZ1S SN F F]ލЍRIx0@P= F@2 3P0 0- H)@MTY$0S! HcM PPN0 0~Qii@!@-40 000 0+Ѝ!2S/2S00/@-@@,V002@-S0@0 @@V0002S 呣/,!A-PM`p (PP*(@P. 0LL`0Kp0 ,!CKpP0Sp eMp PU0S ip K/)@! (( KMp | PDMp 7/PP 9Mp &P Ѝ@2!;!qB@F!lBpBfB@O-@p`0M00PU  K0S2P    P崡 00S U 1!Z0P00 0 oP0 PPP0PU:000000x Ѝ@-  L ЍgBp@-0M2S`P@x (@VP@0 \(L'00ލp@ h!B@-P`2@Sp0$M  0*004%40 0 0p`J$Ѝ@-@K J(@G(@-@pp ]Lp`~B 0`( "4`#/R0@-00@ ^ 0 # R0 0P0p@-^@P T00p``0@D^"000txœ\p@Tp0,QRO-M@@0|0`1Q tV00ЍP0p Q :8Q@SI a넂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 B0 $ 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S Ѝ@-@ 000YP  R  Ѝ@-@\0S \0\0@-@`q0`I0`0@-@08$@~0p@-800@P >Q &T0x1 RpR 0S TT0Q  T0800 >0S  p@H!A-p`KP%P@00<000S@ (0? d@0K0cScO-@IM`Аp< Iߍ0RS*R?  0 000KC^%PP d R 0FSV (0Q 0S 8Qh00 00> 0200BS *0 360 RS00 T+ $0K0pC70`$pQ0@ DPV VdP h  Q 2  $  X7@$Q DQV R <0S 0GS60 0 <@V 0GS80 0 @ 0F2!31 0 k %R  GR0+  %A C %0 @V 00  0GS}20 0 @8 R  GRn3   m0GS_ 700 0 0t2@,0 x" R 07 ,04'R SH ~I F P41(1"<1815%#8107 dSV (1S 0 G0S#=00(  &(100@0S W0 2S 0 GS <0 0 "  20@V081 0 Z00 GR P0@  p 2S P 0 GSQ0Y0 0 2 0000Y00 @  @V 00  ^00GSt0`0`@h 6S 0pGS^00 &A  60@{V(9(, "  P V: ART ,0,,S P R:(, "   PV: ART`  ,0  00D0C0W00GSP90 00 0C4 <1M@ 4S Y 0 GS8M00 $A : 40@B?S6; B?S6o 00PD0 KS:KUKe 0 S0P0"1L ϻ0G R 0    @< 04 `$S W`!n!cSc5!!7@-P\ R&@P\0S x0xv08  Ѝ0P _@ 00pR&!!A-PR1 ⋿@ `P0 pC R0 00 R0 6 30 0 0P0 0:0 00P00;0 00P0060 00}P00Ѝ P 0000000 00ap0 00Up0 00!C-@PTM j"P@, 000`0001iH00 P00 x0`  (#0(10< P &!P( # @B  ) 0ta!P( ``(1 ( 0(t!p0+"70 (P 0 2>``` P( `"(1* (> >Qߍ 0*  D !v !L !b !0@-p M$M0i0PS` 1 !p Ep@0S i $p ۍ$Ѝi@ 0 "Pp  8QQ050 00hpP P( o !&$! ! !@- 0080@P PU@ 0S@ b `P@Ѝp N00O-IMPptPHLL `PR < @P0IߍO"0,0}"600 0400` 0 p00,0 PS2 V30$a2@0 0 !,0T=0 ` P  =`[@PIߍOj@=0 P 'V`` 0\`0T<0 8`<0 P ! ! !@ ! !! !G-@pPQP,tb,`x2S#PU`,@ ,x<OP`<, Q 0S ,9$< :P,`0!!8!!0!!RG-x00!`p@1PT:p T  X ⢑00U *Z"0 pЍ0R0  L @j<0 D<p  >]<  <p@@!!p@-RMM)000PS`B S@ 00 0ipۍЍpp p p `F D<, <p VqJ!!@- 81S Q S0 00 0PPЍ R н0# DPD3O-04MS@ h@@ `0P 0_0 o0 00 0 "P 3 00 y0 P3 0 0S0@0k00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  ,t$(,8P`@ X0⣡  Q*U"00pP 0$00S $H0 hn   ,(<xt$X(U,8RP@ 0 Sh0` 0h0  i0304Ѝ 00 !0 pPz @ uZt $ ,,0pS 6P@,0$S  S St 0P !R "Rp( $(,8tP@ N!!M!!R!!O-P0M040@`0 `2##`pp#`W9 pW6l0S,0S`,0tr0v x2S`,080w0v 847S`,0\r0v `"Rtr0,p80x2 Sp0,0g47S : 0t pߍ0$000 `2$Tp$`  `$n: 0  p $` 0 p 00 `2(4p Q: 0 p(E: 0t p#0z0,L04l0 440pl#0k@0"04,0 40p]r`]o`dl`k,0 !P !904ǜ R6, `"R`P, 00`1,0,0G0 ` 0 vX00, }R0S 000P 0H ` `  0,W,p1S  ,0 !P !`" P ,0 0H0`0  04p,`v!!!!!!!!!!!!@!!p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@BpoA@ Ѝp ` 0Bp )X` 0yBp  00; U100eBp@-p@`PZ8!(0.080000'0S  0R  Odp`L Ѝ@@ 00pA@ Ѝ@ Ѝ!!O-`@p 0SP$H` G000 0 0 `00`0 0 Р0 `  $8; 0/0003H081{ H3 ЍO<0 $8딳 000H@00Sd3H0p84$8 @P0 080S$p_ bpX 0 0{PPN  O0h 0|1&h00(4"<8#8 10 kE004.@0`08d#l `ZP00 0\ 0 `zv 04S 1S0810 <p  [X @0 \Ѝ7S 0$!#!6$!zDS$!CDC$!$!$!$! @-`@pP`)0  h0X $7S R @`00 < ` 5 0 Ѝ@$0  $!0$!$!$!p@-P@ $ 0 00L0p@ %! Pp@-PUp00CSp@0@ $5  (000L0p@`)%! }A-`P@ p_ 800 a B000@ 0<0L00A8 % H!P QA-P`@ 0h 0R0P5  081HAp` P!08!(0 AP     Pp p 0 ]B@ȵ 0d 0 vP>0 $#A%!%!%!%! h00h0 C-p@ PR0  R $ RP508Ȁ `4  Qi\@0S ]PP N P0  lH81 0S; 0 S<$+3  jS0 <`30  @ R 0P ЍG 0PS 0 PD0A 50 00 0SЍGЍf&!r&!cSc&!&!&!&!$0p@-800@P  H1h00h00L0p@$` <F]iD&!'!\/0S/0> d0S  0R/C. / &!O-0M0 0PS000p,`8 0S@TQ 0 ЍO> R*ّP7S Ǚ ǙY  Sk2  H!  Q 0 S:500 0!p00 00  ЍOv Y 0 0Cs0&0S0 S0L0 dp    0rP 0 0 E0SY0@60@ 600 0p0 0  g`P  D$0 S 081PriY@86P P0S0 0<S<0P0Ѝ0    0P 0Y6S700S0 l00 0P Rh532Y@0KSK?3<%05#10 "Y0S0   P   [ i0 ~t4 @Y0S Y0 % 2)  Br  Br0 3 $ 0P 0   0 Y 1 0 A x3@S R@00 $0DY<0<0818 ? < 0 P0_P5 0000  000 0P00S* -P *   pƲ @ 0ЍO2600 0<P0 (_0S * P # p嗲`81 000H 0 000 `0`0\0S   0X!YP 0 8 R @1zЍOKY 0 aY 0 20Sg0 00 P0PY0 '[0 x ЍO(!*'!T'!k'!'!'!'!'! !'!'!,'!'! &!(!((!(!C(!K(!.#![(!m(!~(!(!p@-@l PT10 0 Lp@`D N\P d  p@p`$(!O-,M@`P Q0 ,ЍOt`F VWP0@SS 0SP0t#tx'xVI:PQUE0VB:  ±"4"48#8S50V2:1 S/ 0 0P!' ৱ0S 0`00a0<10  &  !P /  ,,Ѝ G 0  Bc)!A)!p@-` MQP\@M  0000x p 0S T A @ ۍЍp 0V`V \@TX)!$^)!G-`hPp 0x1@TT 0S R T0S> R*⠎P  m 0 @)!A- p`D@PpAPU)/ 0 HA0S 0A\0S 0A)!)!G-0 ;M0MNp`p Dd`8啰0 P480EL80H8$0ED80@X@8<8 ` m@[W0|` 0E 06p$Cݍ0Ѝ`)!)!  7@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@h}mP_@-an` 00 @ 0 Ѝ0zD)!xp@-@P0( Uph0Spp@xO-P`@T Q Pd0S r 0 0d0G  ЍP0AQ 0S 0P >.  g08p|0#  81- 8 0 $ 0R0hd`h08 R0, 00C0 0800<0  P`00 40 0T0S $0 pWp:#<0 2 0 0 R0H0@S 00ppWX0H0GHt   p⚯00*!,*!#"!,0`( "4`4#S /0 @Rp@-}00p0`PQPE@ `' @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScG-` x1PM@T+ 0S pW$ P  PP@h0 d0S4 Rxd0 0S PPPЍ|0d 0|00 00d0 00090 ⨛P p8YPQP F m | ⅛PP$0 00 lPP 00HEd8AdX=' ^PPp ||0x 0|0h0d|00|0X ՚U K0S P 8 P  MU` mP < 0$Q S "  Q  Pp h  5< 0   `4pP; t0<0t00 00 80dxQY X P  B U= ԚpP АY $0% h  5< 0   0<0| !*!*+!*!p@-PP1 yC% p`H01S D0S @0S <0S  (0 @T 0Q0 PSP 0|U d0S0h0d0p@C+!]+!P+!p@-@T PP@0p+!G-Pp`Pz@Ѝ0E @P00 4 @P 0P000000 000*90  w*$0 P pEp*0 !p0S <30 EP  0@R 0 0000@@+!+!+!@-@T PQ0 8 00*:SR h0S dP H` Ѝ$`  Pdp (0Q,0Q   `P 800000( ,0BP;0S  0h dW $0Q 0h0d`0SHô+!,!0S/0S/   O-MPH0<`R8 0@xP00Ѝ_pP P0 U@ UP R R R0 P 0S8Y0000000Cs z@UЍO4 @PЍO< p    @@0 0)0 M) S#,!+!0S/G-P@M T 0p `x 300 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000pY PF 00p0000 S0 @00:S 0S @\S000@:S @-T&0@-P:P@A0 P\:R \:\P@\\ @R0/& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PP 00pCލ Ѝ@@g;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S 0 p PP ;000P p 0S#0 0 0*p8`@Z + 8J00P R 0`00SF E@ A@ ;00P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D m 0SQ 0Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0B P0@DJ`F  0S / 밪 002  @ ` P D,0幐  ᵐ,0@PE P0S /$ D0A00T* PP 0P:SVr-&^,!@-0  0 Ѝ@-(@ P ]b0 0-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ M{0Pv Ps @ (b Q0'P ލЍ 2{0P P 0@P b0 PP U L'P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  -T&a,!p@-@PDp@NG-`= @P@ d Pi 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0Pd 0:SS0AR0@A P Pd pK,!8,!A-p= `P@ d8 PPd0`F# 00@0S @Ad Ps Pd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P q&P(-d,!G-A0SRPp`ʏ PU00Ѝ P00CS0` Pp0 LY( ΰP B, >P P00SW  R00S 047σ,P R   S@T PR   R (-P-q,!0-@0@-0S |P dP(-P-@-@[P08G(-p@-P@PPp`Pp(-@-@FP Q 0@87ST (-P-p@-@ PS P@p p@-@P * 0@87ST (-P-O-pWP`@P @ ЍZ K P PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  ˗P00CS0_ Pp0 0 + h-Z ᠢPD #8 P P00SX00 S  P P00S  P P xP \P DP ,P$ :\Ph-t,!w,!0@-4@0P $Ph-y,!X0@-0S ;@@0@00DJP0DЍPh--@-@`0P0`Sp 0/P PP Ѝh-@-@P08Dh-p@-P@PPp^Pph-A- P@`pPЍ0 (0P84SUP @h-@-$ 000B;P Ѝ-A- P@`pmPЍ0 (0P84SUP @h-@-$ 000B;P Ѝ-@    /0A-P<<`0@ A0p0D0& SQ,! 0@/0PA/A/O-@PDҠpDpG``b0Y:0z  Z# 0@@D⸠ 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Ppᣟ *᝟ *ᗟ *ᑟA *0@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pᯋp TT0 +p@ -<0@f40 4/(00S \0TЍ&,!-A-`@ 0s P0m+0p0pGWp0Pd+P @P @pT 0@@PP @-p@-@P?@0 ?@0R:@@pP p-@-aM$0Sj Q1@ 4/1@A C"+4/%0AS&0  S00PpDU7/'0pS(0  S)0S*0  S007/ ,p0# Dn7/ p0# Du7/ 0p0# D7/ 4p0# D7/ p0 7/ `w0 6/0 P5/Ѝ-&-!,!O-Q<08@0(00iPS @t)`,@48pT:(㔉)<0( T:(㔉)p@0(pT!: Ѝ  030IP@`(4008p D!0? `@4<08p4  b "0 0+ `0@80@600 4/0SD0 +--!-!&-!p@-@0`,0DPSp1S@-0D0P/-G-4DAMHPMU(0`00000P0P, p0,0t0@00`o`SLXp Xx +(po A>004@ptpG0SkX$0`S D* 0ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00(\\1)`D| <(.,`ZPPDpAލЍ啌pP )P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0h0 :/1, !kP 0H0-&.!,!Hr.!|.!-(-*.!9.!0H0S/-0P /-@-DAP|0`SDM)0S&(0S S f(0P 0P@ DЍ )pW*P 0 000屎0p4)pˢ@ j`0p壢X0 7/0S 0SP 0 P0DЍ@茎-(-&,!G-\qPL @0P12C001b5R 0 0&0S  (h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rގ00C0S0PS ώ&0S,P P,@GJ--!\  0L0#0-@-p0M  L0@31 ^AP 0C! 0Ѝl⥍- @-L 0 0@11D ^Q       -A-Db@0Mu L0 @2# p PW%cP_  Bc p\  Zᒠ$0 HD@,X#1010 2R01   000 S" V00 S & ЍA X 1(410~X1威42 ASV Q`ЍQ0S fЍA``\c  Z5 l@l%0S Z # c0@0-,!A-Q`0MS 00S` @P9 0s$@Ѝ ᕍpW   @卍嬍0p0|0S0S @Pp*'p00FV@@!'P 00T l@屌p`W 0S:S* 0U t0p0pp-(-O-`LqL1P0SU$,@T,P@P6 h0d 0B1 `P 1⯌h L0C R P!050%Pd @T: 0 喌0 p[L0CY1T*Q@@-G-qT0So:\0`S&7 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  *0B408@S 1:X 0@D8C 003 c0?o< @@D@  ᡌPP  ῌPNPP 0 @ S :    b01"!00000P00,0P-&A-p0@@ `P PP0`0P P@l%Q *0S  ᷞ-$00S:@-@@R-@-PP` U(0SP@P )@T \0@幟T0 4/ԟ 00'0S 0 $( @$Ѝp-&-!r.!O-$MPpPeE00U0SXc )Z@ D3@刟<3 4/W(0Sp0eWD@XU0XW5 0PPW00 # 30+*[@C@dQS: ?LzP5 KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@*1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   ׊%Q   ᬝ0@P0'0S 0 H0p$$Ѝ*0S  -&-!-r.!@-M@pP0aE(0SWTP )@T; 0@坞0 4/0#880 VP0Ur@P  \'0S 0 x( @#Ѝr@P %Q|0S0S Pꄞ 00-&-!r.!O-@QpP$M(0S@ P xP'0S  p@P#$ЍW "0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*?A4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp{<c`0<0 0 #pP 徉PP% 0   D  嬉%T#2QZ J*0T00S  DvUKP )PU @0@吝<0 ;4/PP꧝ 004-r.!&--!@-L0@'0S 0 00 0"T Ѝ@Ѝ-r.!J////&/&000/T&000/T&000 /T&000/T&000/T&000/T&000/T&000 /T&000 /T&000@/T&000/T&000 /T&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/&] V0 0CS0 S P0 /p@-P@,`Pp@ Tp0!0A S010//0!0P/!R/P/P/Qa/P/0000 /T&P/ 0S S//0R/0000/P&000/L&7@-@P@@P 04PSPE[0  Ѝ01!1!1!H&PQ 0S///L&03P 0 />!0 ACP 0AB0P CoSPS//O-MX@ @ЍO"SQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!`PE`0r>T 04SJ:`\H㌱  ᑚT  QX ( Q    ~ Z P   ῚT0`[?oT20S@ @ @0R @T`0-@0S S @0V @ X 1@@V X* 00`00P 0>!F!00S00/"H&YG!00S00/,<"&nG!///@-@H-@ P R(   @4H&G!G!-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P ۚ@p@-0P `| @P  \*. Q  Rp R  (  p 0 B T&<-qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00`y Ѝ0S/1>3 !/0S 000/<-0S*p@- @PQ P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!0`A-PRp `@{P 0!000A-@P`p쁟0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPAG!A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (P0PA , (0 ,P&P&L&A-`P P0PS\ ]\ xp@BX T 0| P|Ppl&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00<-< 08 C800/`Q'Q!//T&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0W<-p@-P@0`P@@p TpG!Q 010//G!,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`&P&L&O-P 0R@pM Xo P&  <h P 000Ѝ 0@  NPP ЍO 0 PS@ ֕ 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000 |0 hS ,FhVKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0 @`F p@ ZUh 00C0c-R [RS :R =R} 0S: N .S0,S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``E0 B0I{P  0 (S0<B(R$ MP    tP  $0  0$ 峠S0tS0`0`0-S]S0`S0`0=  0 S:0`S0`00S0 -RZ QW]QT -Z00  YI 0S. Y0`S 0`00S0<Y00 Z0S  Z4 0sMP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P pH00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001H!H!&<-T&P&L&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@T&P&L&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0PS;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+<-)>{^ ]T&@-0@``P?Q $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0<20to kmi0V:0aS0`000<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 `S0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00G!<-T&^ ]0S G- `M pQpG ދpL2@P 6W:} ЍP=PP P $PPxP @弐P 0uPP6|    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0IP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S*P8I@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U!  R0>P P PS 00 00H0@0 @000 0 R00d0006J 80S@ 0Q10CRZ/TUUĉu8u<-Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0wP`&P&L&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@&P&L&O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  kP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ T&XK!O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0, 0(0 000@$002   0 X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _U_V QO  X 0FPyu  p $ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  `X M 0P#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2T&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 YS  D>31># R 0800@ 0 ~Y_  DS S- S* S( @` PS 0 b800@ 0 YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0,VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  lfP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ T&XK!O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  3P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E0  ?oR20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!T&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-u!T&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  n_P!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ T&XK!O-lM`-PQ0n @-Qi   e        Q 0#R`S- 0pp WG,[ 4\ 8^| <HZ01S 0s x[BoPR 0C1!S 0{0p [Z 0000 ,@4H80: 0; $ $ 20f\cbQ0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&0@-(M B (@{Ѝ0Q0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`&p0O-M@0p`W PV P'Z P2Y PyX PV P:$  gW Pr xg  rgV1  jg dgZ  \g VgY;X% h JgT 4DgЍZY!X3  2g ,,g  "g <gЍ g $ gXVZ  PЍOp`<```____<_$_^^^^O-@Q0M0R0`0P|$0x 0 p᰸P R nRk a BR $  , wP Q D wPL Ѝ3 00wP~Y U000T0003 0$0vPNY U070T070H vPY} U000T000 PvPY U000T000YW U080T080 oR 0vPT000U000v ~0 XvP 0 4vP 0 `vPjYL U080T080U0 t}vPz 0 wvP 0 |qvPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t &vPYv Y0 hvP 0 vP ]]x]4]\\T\Y 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 zp@ zp@  p@@@dz0 P|zzPz0 PpzP`Ѝz00@O-1M M(@PDhPp \"(` lp (-pp^z @D;@h@ 0R 0Sr pءp 100 0`00p@, ` )@-0@p t0)0 PP E0S R'z001ݍ Ѝ z0S 0F\ RG P p @0`!@DD4 [@ 0 0 0V   0o0 0p,R 4n1ݍ ЍdppXFtH XWWgt0@-P@M 0  PJp ]p@ P % Ѝ00 0Ѝ0@A-@@0s/ :PP0P 01p` ``0`0yppX`p y``0`0~y 00pC-@PCM1 /iP3 kpPA ` ^@cy000ut1 @ @P0F0 @F3n0S VS00 SCލpp@@0Sy@X00P0@  P@1:/y?00@)y00@Sp@-QMP4@SMZ TF /ViPC QP0s, >tP!QaP 0`e0pO @ 0@nqpF @ p> ۍЍp-0si/0p0 +cx@0P0@ y P@1:x?00@p 04x0#S7p@ x00x@x@p8 R%@\H$R@-sP`O-$(X,p.S`P@+Wu00Sb [0 0\P: $" 2Q > !4"0x"3S20*rW00Sa [0 0\ P : )" 2Q >@AQ!Ou0 {0Qq w{` \ P : 4#0"Q . ![0 0\P:t' 00{S' w{Q e 0\P:  4#0"Q .@AQ!O[0 0l\ P :[y'@w{ 0\\Py:0 )Z@0S20n2" U%> "Ww{T ?\ P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ P, `~0P 0PQ![Q00<0S 0S 0$>S 0S1h! R 0SP[F 8<0P>!01P?, S(00c!1$0 %>A03Q F< @@zP ( 01CAF,  /PV$ 0P  [ `0% [ P$0SP J0HЍ00Z`F* 0C!< R Q!h! R4 @Rt000Dp|0x `x0p40|0pt00G <`00W1000QP0Q% [ yQ4, ^4 S*P00<$ 01P `% <+Q+ !hQ0Wt000Dpx |0@x p4 | pt0@0 P0@ $000J A!h! R04 SQ:t000Dpx |0`x0p40|0pt 00 00W\0P0%Q `30LQ0 0,^0F <P0A  0=R@<%0@Dh0(00(0000,00,0  F 8<P! Q F"x000 P 0S  F%0S   Q\8s< F`%d  0 Q0*0^*r@s!FP&T8@<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS (R" :"  R#Ό01"?!x"0u$00$0q 00 0m000i0S <\ } H@NTLX \ h@0DhR 0RkLQh$hB` &0Ph 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dS<0 `0d $F%#F#"F$!F$ %(0S  R $ R %R  :6$4&60%E!$0/!!> |5 Ã111N`ş P ?$LUE ?H /$ R  " RL@\P E%/L@< 0H 08#1 _LA%:6$4&60$$$0$΃4HP#111L4 U >.0tT0.ό#! 0 0PL0LHP 00UP00 0T 0#0l{ #v$0S"xl$0S"xc0$0` Pl3@h0P t:($^0o<P0j 0=RH dH %0h00c @D00k"%:600$$0Ϡ! $>0H!!!0C" RH 0H  Ό l" U`? PŸ 0/  "1? A  L L H0U 0\ 004 P1@0P :P0 0<R$0h00c 00hkL!%:600$$0Ϡ! ($>0H!!!0C" RH 0H  Ό " U?  0/  "1? A  L L H U0 \0#DDDq(DCcXBaAA@""""l'.%Q(\)\²0  0C0  BQ $0 h00$%c 0dR@  Tw \PPQk&P@T8<G  \0` Q00000STPT8< 1 F , 0 F!& 0 ! 0S(0S8 P1@0P .:c 0j00%:6  00$ 0Ϡ! "$>0!!!0C 0 \ H @"UL? ,d 0/  "1? A  L L 0UH  R0# F# #$02p rp t t   0 RN  0 & F%F000 P 0S %F000 P 0S!F% &( $@R00<\=QHPNUL0X\m@ D@hj0 000$0c0$0` Py#Rs Rp  \Qd% 8&<@0dP(00 00@ % :60 0!$Ϡ0! !>H%0!!!0C h% Pp5!" ?.Q!QT$ @00 #0BL00 h00%H00 B00 00S ^0  $0h0 C0000S ^ 0@D h0 B\0 $0h0 ps; 0B &R" 5O-Mp@$o0Hl0o0W`0 T) 0 2c1  ?<0PP/ 0v> 0`0?d000P0?T0 080?4 <0 00$$%"\˟$@ 0000  000T ;0h0PJ 0TP dP; P< $`Pm0Sj Rgʰ R cʸ R _ 0 0c 0S0`@dp?O$@T'pET0}Np0`@dp005o00@D 00000 0H0X PQ h 8 v^D Pt PE PQPHJ004 嘐lpx|PVtRSY Y  h@p| Ux Zt 0Sp0Xl0[h0 Rwt XX8P0:=Cȸ0p00@t0p`VPu x0S n0pt0 0800@4p0 h00 0P  ' < PZv> 00! 0#/!! !./ B 0S!?.P  PɊ 00#1?lv.C BAQS| \xt Ptpn 0 4qp  A 0qp `pV@P0 ?oR20SNn00ߍ 0En0h0Wqp@p0 Z Q#! !pY@2NRp/ h0 P0,Pe000 `0  ZR 0`S 00@ n0h@ m0S0 !0V0ZS 0#0dh` {0hP0? T0r0h80? <0i0h@0? D0`0hH0? L0WX$`\SZP L`mT00m0S@Tpm0S9 )ß䓟園"b^2":##c2S \TP(d<PP 0 lß0dT0BP30@p=xm000h0 `0@4pP8P ? /( Rß&0Q 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 Epqp> @p(pJm#00l0S @㼀p h @pl00@pߍ輀X) XXʎ 0l0Q  s!P lT00l0S10(` #ΌQ0"c01 2c1@T_lT00|lJ)\P(\ ףvɻ %I$@-@0 LprolTat X00 R 0 R 0Q/  /  66  DQ 0@-0P S@@H  ^0 S  Q 0#0S0(0/ᘨ55H  Q j.0 0#  Q/ܧ00Ɠ\ 0@-pPo> 0@" \ 0 /ᄧA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PP脦A-\@`@DP pH@P0& ~P @PPO-@ M `P< p p$0n@0PP P p $ QP pP0S  Ѝz T0 0V (e  Q0`0Sꈥh3A-pPQ `@Q P 0@DDB(000S  $<@- M`qPPp* 4k 0 0@0S (k0"S# 0p000S0 07/ Ѝk0"S1Ds`0pX000S @ Ѝ1Ds( vp ;4 t;@-@L J@GO-PMU@`  PP2SPS LPW Pp B `Xa `L`@ P) 0nS: P= ZP0 0Q Q nP P 0 IB"S0 000P Ѝt0 00 S Ѝ0oSP  :(L9O-BMM@pej0d0`  0?QP:ZPP  82QPn00dWP PC @P`JT' 0 PPp B0P0 0 PPp t\@P" 0 t0dSPkPU0 Pp` pw   0PM 0 A PЍ00@-@?PM 0 A PЍ00-,M 0 IPЍ4--0$ S   0/ 00Ȣp@-PTU@ph? $0$`0 6/pd4p@-PSU@ph? ((0`0 46/p3@-2@P 000l3/d3@-@P 000l3/ 3lp@-P?oU20S@p 0 0 P5/2p@-P`UV00P00S@p$$ 0P5/T2p@-P?oU20S@p 0 0 P5/1<p@-`Ps@PpEh(0(@0 p@/1p@-P@P p$$00 0B3/pL1-@- M  sp@,,000G3/ Ѝ@ Ѝ/0<@-sp@  000G3/0O-`,M$ ХP @\$0Sp,ЍgХL0L00$00 MP@ $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@XPDM@p, f7e@ [a P @: [ [|7$0P$  0@X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S>3 57,05  50Q,0R 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0DR#00C R700C 1L5$0qS<3 57,058`0,0 ?R0@SKe,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQ `0p@ FQ)Q* AR bQY fQ ?R0@SP  b8@S B;; C c3<2080 S ,0 S,3 5407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS=3 57,05 0 ,0 0bw@0fp`F2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P [P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`W  R `S` 0P0`S<3 57,05 50,0080:Q,3 547,5 5,@p`0%#jo%#jx*%ju00@-MB0@Ѝ0p@-`PM0@ 0 4/ЍpO-PRM^  `WpP+/a@TP L0  D pp Ѝ@0S 0  D pp@d0S Ѝ贠 5d0S(0D @p0D @ ppd0Sd00d00H%%$$@-$$@M ЍO-EM MaX@P+p `EO W0P@(T 0 W0P@T 0 0EAP N NUEލ Ѝc00Eލ Ѝc00#@-@`  pMP^P, /V 0R rR  P    P@0C BЍP  rR 0rSX 0 @, -0 Ѝ@vqc 0 "L"!A-`@ Xp 0P/S /TVP @0 Sp 0 S bI Ibp@-IMM@`PP p 0: S \0 040pp IލЍpcO00@IލЍpc00 p@-IMM@`PP ip 0: S \0 080Dp IލЍpbO00@IލЍpb000@-@PM 0 A PЍ0P 80Q 0 08080//p@-@P PP` b ,PP u TP  p@*PPp--00 M (0  ЍЍ/DP --M  Ѝ Ѝ// -@-M,O<@P@ 00  0Ѝ@Ѝ/D0-@- M@ F͌(1S cPl> C͌ X QP$> JB͌8W ?P= ̌V -P= ^B͌`d=@ 0S078H H0P `P P  P P Pt P T P0 Pp( qP P`P (aP Px PP'( tQ780D0x100C40S000C,0h0Hp0L`P$$0PQ ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @TT, V   @@dqXhP 0Z Piߍ P 1 S  ,00 0! 1S 0D 0| 0@p00P,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PپU, [000 P,0匠0Zp(0p1P0@`@PoP`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0嫿0P@@X1(@P0壿0P0$001T0圿0PPP1 PX0唿0P0000卿0P0, 0pBPBHPP@ 0T8`<@OH U,` p@PW 0g1pV@10P00 00Z00 KZ,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UT0@0p8`<T4 ! , <B B P $@0p8`0[T0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 P׽U,0 V0 @ PqY0P@ pPP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR ( `*Z( %Z( Z ( Z(  Z(( JZ5(  ZB( ^ZO,0$ 1@*,  BU00p@8`< ?,   , 0 H T0封.1D|Q0>p@T[1 0p8`< T P 10 0R_ (0Sk ,0P0 PXC h!(0SY L0!11 @ T p @T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@!(0R1P@PBs0P@ T  0PT0P0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @僼T,000 @,0,0Q@ 0@1>PpP` Pp- W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `7V,0 0@ 0 `Tq$0W1`V W  0 ̹0P`0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a PU,000 P,0|!0RP0P1`@|0P` V  0 @ 30 0R80000S &y 0p8`pP`<4lIhA-Z`pPp ZB2S @TcmGE000 R A= A 8|@-dQ+ P@E0`PM_  S- 41#0!!!!v : !' !_ !| !o ><^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0uEl0T0ЍTFįFhE<0l 0̃ S/DO-D@p`ጤM[ +T(p( $W0CS0S<3 ( P 40/$ % 0:ГxsȃH pß|8xh\`(TrLhÃPD弁<x40,($ @2101: R 0S 18p10S pWЍQ d2 0 0DLr'>ppGl`( R(@ T (0Ѝ>}rp<x^uvr8#o:l0'i#f0z# 0aH#^p-[-X`_U|RoOpLrIyFzC{@@|=h}:`aF|hF!C+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|C<hA C00p@-0['N( Q(0S(@p AO-8g887M`  `P `0ǟJҭp 7 000 S00U0S}`p  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0. $Q B q/ 0 ;0 p4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3#` pS 83003#`s p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#y p St p  0 s 00bR40 ; 0~p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 \p E  `Q q 4 00 0q0cR  0 ` Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 0A 4 00 40 s 00bR 44 `PTTSRA\RQQtPP(@p@-P@,0 0 PO TT Tp p`   pwY <0S pS 0S 3Wg R 0CQQ00AQ0S  B=LZ` 0*"R S 0"0W DЍw WW & p ḳpp 0@s`00 <0$DЍAPAPQ~ DЍP30:Qx !1 0!,0: 0 P @ 00Z 2  ! Jpo p W2 B#3!0 00S P0 @ w ! !pFP0S0:3S L00D00! 0*u0sꌠ <A00 00\Dp@-@P<ppp@p@-@80800P  @<ppp@D@- MP~IӯpP 0@T $T` @@TP  Ѝ<V>0?P0@P@P@p@-tQ@PJP JP KIP10S. (P: p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@Sp0@S mS 0C;S P   0@S;Co O-0pvSpP`MXf` `JP U0 `r(ʍ"(0/I"R` (0$00 03S8PK ᩫT$8P ៫ 0XSڈ%$ |T 0p50 h5"004S03P00S5 p0S2 4S, 4S 0t %W、匑Tp"2 0Pm 4p2Z& LQU# P P sP oH5S4S 4S0?o2 44Ytx2 PuX  IP3Zx2  IPx2?;~0x2W  IPx278x23X|2 PW x3|2fЍ0 D p$l h $ <%$(JXj IP Y IP! Z$ IPp2?;~0p2|20P?0 r("(0DH"R`p2ZIP|278|21S0 4SML%RCYZ8dh!x|"t2uZW"ZTW,  IP'x278x21|2\1Yp2yZ~8 x",|"t2'PPX*W  HPx2 78x2|"A0|2P 8ZZ8T x",|"t2P,40|2*ꄙd00 00JВ@-0 0`$pPpP `@`@TPxPX@l@ l` X 0 0ptx|" @Rꬒ0>8 80 00\ X 0//O-\ M`p0P@T \2 !0S S0SXT Ѝ 0 O-鈁\ Q |Plp@0`P Q0V0` PC 0, R0200pP00 eP 0P  Iⰰ帰 就帱 00Q0T `@0@0 0+=x LPr(A-@PaFPp p@Pp `E`PE0 ~2 U@0 q 2@ p@-`\@PT 0S1 RT0S@̮0@SƮp@îG-lp@`S0 ST0S"Q0S 0STA-@0M0`@GP- 0, @S 0p0pjp@†R~"  2 0QU E P*L )7 ]@Tۍ L➯:9\-P PM 0 R  *’0  ЍtX0 Q0L 00S P@-: #k/p@-0 0P0S$ :#`Ra# #p @30P:##C B10:#!Ba##p謋 -L0LM0 0\ 0ʌ   > Ѝ܊8 80 00\ T 0//ᄊp@-P|`p`@0@ _K0SP0P0:3S 8 80 0 L0:#p,0O-tt3 0lS0hh M*pB`P 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S p20h2#`pw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR  1  S7K @y ` 0  S q`R Q  1  ЍVp  B/oq`R"n000 ?c Ѝ 0`0`0 0R:&<  0 ꔉ5555Q43(x2G-8S83P`@PY 80$ RF U ʌ3S23pSnW " Rp{ A8C0 ` 0@B00kht@0DP@-,@@0SB00d@-$@@0SB00$@-X@M@ 0S Ѝ< 000 00B0 0Ѝ,@-h@M@ 0SЍ B 0R  (00 Ѝ B @@-LBL2@P$MQ :cVW0r3p p'70Scqp 0SQ1p0SB 20  B0*1`00|PN 1@ 300 R 8 D 300 X3040  :3,p 4 P`$Ѝ0`00|P @ ZB 0R` 00 `A00T @8 300 =B,hl 0pC- M P  "S L`6<0`00:3S V  Ѝp Te 0 000:3S/CeX0X 00:3S 03@-p W6P`/d@-@0@ 00 03, p jP`ld@-<0< 00034p ,6P`d0@-PPP M* 0Q0@00xP 00 03000*C3 Ѝ0|P H00 020000*3 Ѝ0cl/0@- 0 @P0:R M# P P&tP 000 20d3 Ѝ0`P D000,PP Ѝ0bl0 000:a!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@Tpj#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-Pp4S-`@PP3@ 0 00p) ,Ѣ4, [ 0  9 0 V lЍB0  /9lЍOZ0O-:$M$pdZ0  r$ 8PUw P0p 0 p 凢 Vp(:0PSH8 0  @P$Ѝ0SI S5 SpV  =p0004S$ЍOAp @0S S SpU 0 =p`Fp@0SF0Vᨀ *HVp P @FXp  v=p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ 08TP/ { @p ` 'PPE @0S 0  C`PЍ` D  P 4A " 2Ѝ @0 VP0  0 /404 000S :P /TU<0<0 0 0S :P /U404 000S :P /T<0<0 0 0S :P /T404 000S :P /4T-DD 0\ ʌP 0 S@-|0| 00@T 0J#4R B0pQ 7@.P z @S808 000S :P ]/SD0D 000SP:P4@//R000 000S :P /lRL0L 000S :P @-p @s/,RA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AB0tQ 7A:.Q-0    pP000 000S :P Z/PO-00 0 MX% p `P 0 p @P  0 Pp@ 0 5@ / Ѝ@tPP  P /p@-JP }3S P`4`30PV  0s3 S 0ƝP 2 $R 0X0S 0D3 20X #$04p03ppHp@-jP 93S @P4P̞30@Sp@ŞA-`Pf JSU?sW< D@P3$S3 SW*0N, SsH0S0 WP3PSSpP4Szpp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `NP LTL VW PT VW  P000S;0 90 0 L|O-($Z Ap`PP@8P ( L:T2P* T P 0 5: @00 -:0WXT P  RX8 @(  !f:@0$K|d @-?C0 @   @ (( E:  ITA- Q@PP% pW# 0 0S0剝,凝000 R   R   R  P rp4l`T `TX *P Q Sp  QW02QtIp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S bP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0phpFH0H 000S P@ ?# Q@ 080//DD(0( 00Q0/LDD(0( 00Q0t/DDp@-P0P0 0@R` Dp@-P@!2 p@)p@-l0l 00 Q@P00S ^ p@2 p@ >Dp@-D0@@ 00P  %pp1 p@=Dp@-P@$pp1 p@p@-P   ` @$ppT0\ ^ @ p@1@<Dp@-@`P$ppT\  R @ p@1@Rp@-P@00S ^ p@|1 p@O-ȟ P@ ,0H1`00 0 0 084U,00pW$  0$ 0 00 0(p PEU` 0 ?P@@p  p 4 Ѝ-,0 (0 M0 Ѝ1D- M0 ЍC-@P M(p, P00S 2`0 GR 0 O@0L"Lb ``8 } 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00&0   0T S00% , W10X0PXpC T0pGR Wڠ`P`W 0  pP Ѝ80  080 000 S0CpCnp@-`@PR!pp 0p@- M Ѝp@-@T T  M` @P1!p 0 Ѝp(.Dl l0 00S X  8Q Q @ ,@ /&R//-DH H0 00S 4  !R@ ,@ //D-D`0P0 T 0008!R !R @0<@0/6S//,<0P0 0 0001S@0<@0//x,l0l 000S X *" (Q Q @ ,@ /&R//,,D$0$ 000S @ /+DP X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` Pc  \ D000T $000S0+H0H 0 ?o20QQP T//P*D000 00 0RPT00/)DA-`@P`$ 80 ! QP}p~ P eS  800PU ~ 000S0)0 00(D?o20SRPT //0PPT00/,0, 0000P/P/|(,0, 0000P/P/@(O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!1pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!a1pW`YHp0Sa>0 S;,0 0D | 0 00P0qpI PX 00C  0HSP 1TX[00CS``[TY0IS`YPY0 0CPY(|0 00$Dp@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CQ#$#0 00!D\000S  Q R P (!00//( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝ 0(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0O-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dp1 `| p Ѝ@0 S RR Ѝ,៑P d,0嘑0P 00X p  ``F , B,(`aaA0  T p0D`4mP  Fp`,004@ 0T` p0Dt@U   PB  0SQ 0 0PC 0$ 0\R <@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP D0PQ8 0 /$ $\/ P/hPQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ESpL @10 0 QT$ D 0R U EAp: w0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0QD0PQp@-P0P`0*Â$ @P uT00PU pp 0Q0P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0l0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4|ڌ`d@Pu 0㈰(\Pp,q pPP0` Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 4!\08 `0d0h0l0p0 Ѝ?P4- P' 0*Q- Q80 SpG V P  PʪP Ѝ CA?=@ Ѝ5 A-0QM@PP(C p`QAR   B P1 \.X) P$,P@PP H0 DH00R00D p0$`P!b@0SЍPЍ@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI 2L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @ |$00@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0 D@-44@M00 MЍp QP-D00M  ( @05Ѝ P8 /00@-MN 0N00 P@ 0 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AAX O-PDMlP4 (0 X0,00S80 S 0( S@@S@00CS@@h T4 L,  p04@^00^0\00S@80<80808080PX8EXC8U\PEA8pp00 8 P(@T ^F00AQ< ,0 (0h&h08C8S1 ,, P (@^ @@P8Ph4P XEXJ^ Nh4P.P XEXJDN^( n@@D ^, 1 00UC@0<0ppp8`! 0!1` A S `1 0C8#820C8#8S弱 80tD 0S 1P 0xX0EX UJGx08`, 0(0\,0!0 8C8  S^LPIL00@  @HDHT,0Q0 (00S+L00S? ( R, LP S800,0 1/$00Q$0 0\ 0(0AQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00fp 0SL01H@804 0,0000\,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YqH @ R T0 00P P 00 SPS P*0 R00S 00P ɟ`V0 0CSp SqUp7 0 AS0 S P0P ` P R  0R  `:,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sl9, 0@000h0S(00S8000S3 80 :8, 0`V 00Pm0 0CS<0 HDD<0NN Œ Č Ȍ N LL\oɟ`VWY8 T0V T@00D R 0 R PPZ| ! YR  sY $Rh  0E0 p0`   0E  @000$R , 7@  `@000!R 7x9 8000Vu00C000C0'\6, 00S?0X *1h"0 @, D60H 0  8 0P4, e `p$t00S000 @0p 1P11qWd5d0 !@00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꌄ 10%0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0ᇧP0P0S^O L00S6(080 z 800  L,820 Wp`dЍ80?L008 0080@080( R d1SdЍ( 0 0< x \P1, `p0, Q0A0Ո8! ,\PY @@YP 3P0@, QcJ   8@,@ APX@T `P `p0 |&tHTlPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @p0 0 0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X0@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0|8 0+00@ 0C~(@ 0 0800  z 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pe d1Sb , 4@  TP:X X@ P T@DT H HH E@F0 0: 80R0,`0C 0B0X00@P `0 40 0E00 PU U R0 R  X R RR)0SC 0 R$  9, @` 0  `l@0 0p0 `_00P h 0@` 00 B0\ P0 PB00 p 0 P6+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`qUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` J0  `@0 0p=0 `00P  -0@` 00 B0 !P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 7@000A, ,>@ 0`C000` !@000tW ( u 0 U@`= 0 0LeP4Pj @00 pVU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`)UpH50S0X0S* 0 0 0 0, @p@0 0H` U~0 0 0 @000jP$pPdMlp@-P@PPM0 0`0 R    80x t00 0 000P 0 Ѝp80 D000 0 B/ 0C?0Ѝp,0 00<DC-鬐M@P 048! \` d0hlp`PpPg80  D000 0 B0C 0/? 0ЍЍ@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  40 00D 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `~Vp`|0P 0@PUpT` @~T @pp  ! !@-@P@~T R/A-p0,SP` @T @~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S P$00C$0K(O-:z0M*p$P( ,pP \*00\c S@@s  nRXan HR @@j`40IS0c0@T ^OoB@TP AA  RT0)\ 0  |  bR\ \)` R&L) R! CP'$I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPg S ^\ l( 00Q L80, 0@4(0RK0$$H 0@0( $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S 0P0$@P$T70 R(,Ѝ 470( V$(00 SBGg@`9 & (00 S4$&P0C (00xP0S  tP$00C$0(@p&  d60,@(@0 R 50,60, 40RofF`@ 0 0, $P,04 CS (@Rf 0 KRbڰ5%0  p p @p% 0(`Z  q`nR `F(%` V ,00P0S 0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z pH40,0@$!,1010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# E l# (@$@ ?#R W( , #\ $6 (@  P 00(@$ R j P $@@ lP " 20,  , l40 S \ ( H20$ ,B@0S ;0P0$ 0B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0%A@0S 0P0$ 0B$0 @,0ԃ@8hDԁH`P,$P,@~0t~p~4~}|||| |{ {zz@z$zzyO-lsl3phC@00 S M ᔴ400040,c`(,P Zm34@3`0T&#0C S402PK袟  <0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS oP 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 v@P,P  @1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004P0TxxwhwlTw$wv`vtuduPuu@- ,(4 00t@-  ,(4 00htO-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0갼0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/်G-MuPp/ 5` 80s2  S̠\D Pr HR!1S45@050 50 `\Pᴖ 40 00P 40 0z40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q `jS`" Q _SP Q kS` Q[PS 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  Y)PUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf STcD,qln Y 'tƒ A\ B\ ^tƒ    //p,lN1P0= 00` P7ʀ :l“3\0 /@ P0000CS000000000000000000/d>@-@P@M&\\ Y #3t P P 00 &000 0pЍбl`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 茰R,hg@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\  د R,Lg g0 000:h/ሮp@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &Ѝp\lx02C-00$RSP@ M "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20lL10 0J0剑Q:20h1=00Q!0S0`20 00 0*0剑Q:20t 00 00`0`U0!Q 00`I0!Q del0 000/Pp@-x0x 000@00CS0 S 0 S P00}pȑP0(0p@-0CS@0 S 0 S P00_p᪑P0p@-,0, 000Pv@Kp,p@-Pv@Ap0 000S  @-@J Q P\,Q    @/ЩD0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0PP`@ V ;vpP 0h#0C S-000$ЍpT0 S80  2 0@6 @D BT p`$ЍIɟ,0  1A!R 1A0 CQc(^01H1H1PWZ0!! ! :  lJ T0@ 0?Z 0q$P@ `^rP@+  T  @ PW(0p SCIWC00 (0C\00Cb$Ѝ\ X@ @  D0|0bp H0@D002 T `V `ZtV ``  @~0 00<Dp@-@Pppp@p@-@80800P  @ppp@DO-P6lM0@P,0 f Q 0p"u`P~] Pq0P0W W   0<0P 0R 080P 0@SF00800`P0S 0P 0 0PEPUR 080 00PS0P<0; 00 5 000p`P0 @R <0T R8 . 0<00800C?80tP0`FtPY00` t, d480pP pˬK 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!! B qH" RW`!: pGUH0< S8 8 (P4`< @p$0,0 1400H0@0 @0 0DPU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0C t2, 8 P 8I000 0P8p0m08 o800C?80sP0pGS00C0`FUsP00C00p000P0 0PS08 F!q Xj 0 0H000尡H XD0|0prlЍ80< p` 0<0T pR0`<0 yPo 0<rlЍ`rꔣZ0 00 [$Dp@-`@Ppp p@M K00 CĜDp@-@Pppp@ 6p@-@@ @  `  @Ppp p@ dDp@-@<0<00P  @ppp@ Dp@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``괛O-ܑMS D@HP 0T p `@ 0Z  A 4/ 0[ 8 $[0<SD0.S00#10>P0 0@0 0}00 P  0G8#8 S R0 0?"P4/ZXЍ0G\  8#8 S R@0p0pP4/pWꨚQ# @-@ RM !R "R pPĜ\  00@`Ѝ/0Q # @-  MS S PpP$R ,@6Ѝ/@-0@,M @Ѝ O@-@044M0 @ ЍN0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LB!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   괖QO-$M m/ 0 w0`f S` 0S0\S 0 Sa0 000괓d4Lp@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp,0PFEExEA-@0MS0D0@!0@P0S?  0 !~r!!`"bNL LL 0 0210B q6P `0 pW$P@WP 0fS"PЍЍ 0ЍLNPgA-@0MS0D0@!0@p0SE  0 /!^RRN  L !0 120B QP `0 pW$P@TP 0nSPЍ"0ЍЍԋkL>G-`0MS00! 0@0S[  0 `1` I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qqP P)0< X" pW $@r0sS\P @WXV @T nPPPЍЍX-?LX*S0 O-TMlkPPPR ,$  0 : 0 @P> 5e000` 0: @P 0S  R 0Z I #Z =Z = P  00pP0 p WmZp  g0 0X*S&l0P0 0S0, 0  ZP  JnY P l0q,0@:  0 p3$ 112cAT3112c B L0L,s0'pr!qpC 0P q 0 p@B `@, Hp@W 0S  m = 0PP  m @WP00TЍ   0  "$p΀‚ €衟‚ N G !1 qrpB 8PqK  @:p  0`d1$  0K $$N04!b1c$$!b1c 0N Kϊ 00  0ɉ)1i1c1⃐BP㉑ 0tS0cS0Spp~G@ < pPUY l00u|tNg,rkLL>-?Lx*SA-P`p0\ %\0@pS sS lS P0\UUW q 000@1CP0PCV` 1E!` 00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@jP 400@,%,d+P p` L˟,@ 0:ZAZ JQ 0JPPp0-00 >Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ  Rp PA0JlRpY PA0Ja0J Rr11OSu00qߍI@[/hP 00040hP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, U*R 0 p 40P040 P PPp1  \1SF 0C111SC Z0! J 2 ( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a h7@D!&J0AqVZ ຠ `OT` a 1l!01ATf @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RV 1h BY!r YP`!`1,` Q*P  0Dp^ 40040i10J Rd1lp1OS!!0l1PUAT @D`1AP #OT0a11@A?0Sl00l0 0St00t030S&   ?R ;R P0S %S0 01S3 0C11AT0 400 Q,,*P  4 @ , 40,0PPp1AA0JS30J1OS!l!011@00@`hPu 400`,Vp p2wh Pi 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT= `V Q```&``VP``P``ü`@oobP``V ``@Q ANQ AAT @D1!ZAo!᪢Vp p2hP 400p,PYy00!Jto0 0媢m0`0i001&J0GZ @pn[0`0U00Q00,L0 0|@V``pS@`V`pN@`fpJ@opF`@pBoo@bp='N 6 V8V-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/A-PQp@M 0S XD gP `V! 0v0+ V T 00 PP0T0n 00ЍT 8: 0 0 R T )T\"P0S T`P  4p 0S R 8(C8B((0 000ST00nP b 8 C8(0`P a 8 C80`ѯT}H,ʯ8ůXht@00R @-M<0@S  ЍA-pPXP U) @`TV 0PS |P@P0DV  P xoO-PRM pQ 00Ѝ@ `Pc % Pc Pd `%0 ES  IfP  P p  0PPP0PS  P  0PS  P  0Sq 0S 0PS 뼐Y$ P f$%eP !ePeP f뼰 0$[PP " [ $@P O 8C(CnR  sR fRR0S  V R00000@H$H TP 0:  '0S 0C8#80 P p0x   0 Y V P`Y 00pa 뼠PZi   㼰 8C8PR 0VJ *ZPK  PU; o`嫲    PEX%XU !  X `*  `0 00 R0V00i0S00   0/V  R000Ve  dP$' ~0(C-pQ@!P`M0  P c00`0S< @ЍPP   p 0Up  R 0S 0KP@ P@" @Ѝ . 0 P  LPP+2 P*PP0040"  O-M Mp:S$0S:S@ 0PS:S``E[ P!*  `0  kP 0P:S ۍ Ѝ@ۍ ЍC-8B82M@M0`PpP9 0/SH 1@P 0@eT PI heA@4P 0 ۍЍCD0P  L AP"0 @\ۍЍCx~0P 0S/S P t@dT0 ۍЍC0  PۍЍ p 0adYX H0H 0 (04ۍЍ,0, 0 04ꀾ`lG-p`@P  Y0@dT  OP @\PPIP P @T  @0G QPQ-@-@ M00 Ѝ@ Ѝ/TA Ѝ@ Ѝ/@-@DdBd@d@>d fU& L00L0 Ѝ @CP Ѝ@P ` 0S0080Y 08 H0@ HL00L008 (x400H0@ 40 0mH0@04 H00eH04 0H0L00L0 @H0R ,0 0QH00H000, R0 0EH00H0XO-0@M0`[  Z p p(080H0&`P; P  `0 0 0 ἀ[0   0 pZ0 0   0 0  0 @ 0@Ѝ0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00[A-`p PPU@M"R& aP !0P ᴀy00V0  pn   0 0 0ЍPЍh_ pX  O-`0@ 4M 0 "P papZ6 P P`0P  0+apP|b@P P@@`Ppa 4Ѝ  ea ca0, Y 0(0$0,0& PX@,p , PAR   0S00UPu Y  T㼂 P" 0a L@PX@ H D L F ,p P$fU6  0 P- X;  BHDXDnUDH sU  "0 S   ,@  P` 4Ѝ | B P$`,TYHY@PL8A-Pp ``V@M(R, _P$ A0` ඀H 000P?00 07 0 0 0ЍPЍ1^@-0P pW@` MR _P 0 ` 0  00P 00 0 ЍP Ѝ^0O-LM<  <|*, , 0@P |P0`|0PP p00 ZPdV PI9PdP^PP @ @P  W 0 V 0,P / p 0100#$0\90400 0Iye 0s 0P^ ,P 0S  $ .S  ROSF = P# @P[ }hFhv 0n  P DYD0 0SP P+ 0 ' 0S v0 ( 000  00 n0RP_TPLЍ0TS 0  0 000S (0(W8 (^8 0S! @0@S* Hx00 0 0f0 Pm[N (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0&0HS y  0iP (p20 FQ4E F/R)  p`V@ V,%`  @ ` @ T%,  / P P``P p`(\8 e@T@@B`  |4X Yq0 0IP%x0  80c80P p `P P P P P P P 0  80<80P P?U P#v 0 S00Pp@` 0AP<, ,0  80 W80V0@A T@@p`F 0 0 0000000s0P (pX@ Hx] hFhv9 @0n @PC 0S00 <P9qPVVp wP:p 00 F(p (P00gP hFhv0 0@s 0 P0PI 0  S0 x}< ]LЍ 0 Mp  i(00 ]h < `Vp  @T8lL P/Q$P00//0@-MP0  0^S!1l!1"b2cNL 0@@0$@B!A@C0>PЍ0赁Ntg P0`0K?//p@-MP0 Y 0nPcl b N00PEK 28@0$AB@C1dPЍpkL>$0P00?//p@-M`m0  P0ec`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$$C!d!b8A@C1PЍp-?Lt*S4p@-0P0M`2@P 0Ѝp], 0 0S Q20ЍpG- 1 !0 qP P@3 04 S0`0`2,0YPP00|Q``  GVPeȄ`EQ  <V|0`0ȇ`H00E@-@P n\l\j\ h\$f\,d\b\,00!R  !| 001/D 001P/ P/, @- M`p P0P0@0Ps 0P 0lP Ѝ 0@P ЍDpC-@P,MA!`n``HXp@\ X" $>$>"!00,ЍP P =00 00X0B; P P ~P =00 X 0"' P 0cP0d=00 00rXj  P[ 0cP0=00X 0 0"P<<"P 0cP0ʰ<00X 0 0"P 0cP0h<00X 0/ P cP   \=gX`p";" 0㠡PP _0cP0-ʠ;00X 0 |O0cP0.h;00X 0";"P <0cP0) ;00X 0":"zP$ )0cP0i:00X 0V":"gPC cPʐX  0"TPx 0cP0GH:0I? 001 PT;9X" :P 0cP0190E? 00ᅪX $Pf 0cP0kʐ90A? 00oX P" 0cP0<900X 0"8"P} 0cP080t0X 0"8"P 0cP0=ʬ80l0X 0-"<8"P 0cP0d8000X 0"8"P q0cP0800 00X"  P ^0cP070 00X": P L0cP0wʐ70W?X 0d"7"P 90cP0hH700xXB 0 xPw '0cP070S?X 0"6"ePI 0cP0ʼ60\0X 0"06"RPn 0cP0t60P0X 0"5"?P6 0cP0,60@0X 0"5",P 0cP0K50O? 00X" PS 0cP0&ʜ50M? 00X" P 0cP0T50I?U 0 01X"~ P 0cP050l0X 0 "\4"PW 0cP0ʸ40d0X 0"4"P y0cP0p40\0X 0"3"P f0cP0(40S?X 0"3"P S0cP030Q? 00X"$ P @0cP0ʘ30d0 00X" ~P  -0cP0P30E? 0 0ɨX hP 0cP0w20t0X 0g"T2"UPY cP!Arʬ X  @P 0cP0Ad20W?X 01"1"-P 0cP0H20P0X 0_ P  0cP0-10\0 00X"B P 0cP04ʌ10d0X 0$"0"Pf 0cP0D10l0 00X"[ P  L0X"!!0000`000p0HCph|,Gl P?x,x |0Lp$@Pl 0D`h$xhX p8(T пP@0 ؾ! @-DT`(?8( 0X"!00 10`0 d0X" "00410T0 0X"C"00h1004 0X"n|"001080_ 0ၧXk!0010Y?100 Ph1\1X"V"00(200420K?@20G? 1X" @"00t20|0200220N? 2X"*!0020h020= T2X"!00}30p0 30R?( 2X""00k@30U?LSX30C? 2X"!00U30p0300 L3X"-!00C30U? 3X"X"00540H0I 40K?~400 0ͦX!00X400 4X""004004006ᬦXf!00400W400f 0ᗦX!00ጦXv!00 5" 0P#Xkg"00N 0lXV!0050050h0y 5X"D"0060Y? 5X"6!00860|0D60`0P60G?h\60T0h( T6X"!00}60h0"00t !00o"00j[P1!_700w!00V"00Q<700V"00H!00C!00:"005"000"00+"00&"00!"00!00ὥ!00@PX BP  t8@P 0ẍP 8"0S!000Sv !000S w!000S o!000S g!000S _!000SK W!000S! O!000SE G"000S ?!000S 7"000S /!000S[ '!000S !00Pb ~0S !00v0S "00n0S !00f0Su !00^0S !00V0S "00N0S !00F0S3 !00>0S !0060S !00.0So !00&0S+ !000S !000S "000Sr "000S !000S !000S !00<00<00|"00w"00r"00m"00h"00c"00^"00Y"00T"00O"00J"00 0jP =" 0^P5">"1> 0 0u,> @@S< 0+ 5 0 0/|40 0r4 @@1 0d40 0Zqp40 0PoH4\0 0!Fm 480 0<k30 0k23 @@ 0$ 300 %!00`30 0 83 @@P 0U300 02 0 020 020 0[s`20 0z82|0 0O2X0 0G!001 0 010 0 L1 @@^ 0~L1 @@P 01p0 0uy>0L0 0o~0(0 0 ej00 0k[t00 02Q.L00 0 G$00 0e=:(ضtP(صtPܴh@ȳd(̲|T,ܱA-t ANL\0@Po\.DQ 00P \QHTL a`0 ʡ 0ԡ3\ \/ ANN1 0QU^46 0b0#6(7(0Ta` ᜡ 0ᦡ A0葡H/2G-0@P Q0BA N `@ƌό@0pG/p0PϠ B`@T 0 P\Q \2 0C@PU 0. R\B\A ! QI%RL:  H  b3Ό2@XX 0! 0勘P t` 0 0eP tP`P@P056 0  0 0 0ᷡYn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! nV @D 8g,0400G` ,04 00 @(0( 4/P840,0S00 40Q 0 @-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0>$ R&4000  0`@d>0U 0PEd@T$0S`0  0@`>0U 0PEd@T$0S  &$   0   0c 0@$ `R`t=0Ut 0PEd@Tf80070  Q 0SU 0PEd@T 0S 60> 00L70U 0PEd@T:0D10*D0 @D6adh0l[ X0P#$U 0PEd@ 0S\6c@D0l0[$\6 R] ?0S50>00(60QD[I U10[![h 0 PE C0 p 00D0 0CD00i`l Pv(T% UI 0PEd@00Rl @Da0^ T 0 $ R40,0000 400U"  PEd@T   !R 840d0U 0PEd@ T:H00*H0; @D 06l;  0$ R D #  $ R D # $ R$# 0+R D U1![ $Q ^ LQ0Q 0 ! B00  0D PE B pD R000 R=0W U 0PEd@T20F?o20X$0S 0   l"L2$&$B0#22cR0S 2000d20D10 PN;6cD@D10 Rp  B0 D  0h10)@`Uc 0PEd@T$0D`S`  0 #@D`+kUJ G$0S  $P (D0 S2D57[U0  0 $ $ [PEp'0? 00??6?7?8?=?>?N?P?5?J?M?8H?A?L?hȠ؟:?;?0,( 粰*@D6`%R p!B0$ P0l00X0S>0p0P0?0X00 p0tP 40> @{ 50>050f8 0X⽿p0P0tp0 (0$P$(0, 80> 0080 0c"80><SR: @3 0@l0$,9@0@@ ` \ p T d \ h |P 90>(w0S90;Gp@-@"PP80S ($03/$0(3/00pPA-@` PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  8 50S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04M0p0 p0 0 0 30 Ѝl0Spp l0@@@ ꮁS???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pW_P 0!(`3/@P\ 8X9  ( 0(3/PM 8 *8!&P S>0Rp*p  BS>00p0 (08#8@oRS B P T X B T p 0Bp8 p P S>0Rp*pS. 0A p oR$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰX 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00p<J\S20b608#8P0X 0 C∀0S 0X\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 240%R00S0000020(0@0,000@(,04@080 00 0 00C$0 B U@\ q W3> BJ  p Wۄ2  B37RN q`36 B Lq`36 BC@g  @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  \X8@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\j \b$`\``$(@$$, V,(`@  $$(@$$, VpLF$(0$00W\(0`@]m꼌Q???T-LD, qR0N80#8\0@qR0@80#8\0O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=ftPxl0PAPEN NxtP0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B06l0\000S l`IP0` R P lp#p  G R ` h0S:l R1#P0 6SH \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 Bl0\000SЍO-xj P,M`t \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ@30 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptR` l H 06#0H0Xl \0P8 B Fl0\000S,Ѝ806&6 &!9096tl L Qtl \e 1t0 S` R S; SY`l r *l `m 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 l0\0n0P,Ѝ\P80 B0 l0\0[00S,Ѝ$O- ,0IY!Q@o00`MPp ؄0 `C S 0U000u p 0 0 0B 00%C00 A #4 0BV U`1\08  \0 0  PE B    \0UWp$6 *0R1 B3:\0l``F0SP!P1UP! U:Spp  W  B0p  0 `VP ,8 ^K ƋA, l&\ `VPl& RƋ5X(0p'<` `FV*\,^zWp!Wf\, 6 Q* 0Ƌ51C(LS0!S 1 R4\  U  RqЍWD\\l <A Q  Bl b&R &l Q8&pG R&l, A Q l S`1 `!U00  SR#000僀8 0\00\08Ѝ<` `FV:8 i, lBP l\8 LNl \&lR && R, p`Ƌp  SR# S`1 `!P 0S $0S 0S P0*S9S/qSZSE0C0// [0C0 / S/@O-MPpQs@`Vo V\ t0Si0,0SC0p0t0S(Pl8P pLpXTD@4H0P  ;. 0`RH0`0t0l t0SPl  l \ 6tx`hp`ЍVL0D 0C`B ,0l`\`fpG0*S tX  0 ,00W:A-@P 0S $0S PfpP `l0t,@0S@1VTU@80C ,pp@-@P$ 0S! $0S A`PP`0 S0c``,0S `  *00 00(0Zp`p900p@-P@P pP,0L D0<00 B@C 0X 0 00 00l@00\@|0:t@ Fx`h@H@p@-@P 0S $0S P0 Rp@-@P 0S $0S PP Q000U0:60ppG-@P( 0S% $0S" PQP`0&0R:pk6 @cT@ĠL #0 6LPUXPPp@-@P P 0S $0S `P0`P|0pp01A-!4`TTpBCPE0 R R R0 PR\ \:0S@U!1!v!w|l R ^  RX  `\h$X  `\h, RO- M`,0P 0Qp 0@S QW0ϟ S  R| Ro  R( (pQyWd R B‡RP^.SnQXt0S 0Sr RV R <.0 103/0@SPn Pf Wo0S S00_0 00#400 03 0  0#400  0 ~0S0c0?o20 Ѝ0Sy<00000! S *SK0Sq00Q 0S0@SP Wm WxL0S0(0 Ѝ0 0&S+Bql0S<  B0#2 2c0# 0l0Sc q000 R09S ES IS [SH gS0, Z 0S0,W @; R.D0Sa ! P B X:H  PE[ 0 X0 9* PH 0 ,0 SR0 B00SS@ ӇS   00#  #800#"0    ,0 S R 0 0I000S&  0 0S0  0S,0SQ:z R-,0S  R0 0[00$0S,   0$ 0S0  0S,0SQ:M R X0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00L6P0t,0S*  R0 B000, g00R  0Q00SZ 000#400q000SB*0 B000 B00,R 50 00+Zt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SW :W㴖y 6S \0l S 8 B0 l0\0000S\ R8 C0p l0\000SꄣZt0(l 8`R B  ^H 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l SJt0 SW S Sl 8`g00&0 O W 0S~[0 B00O ^ ^  [ [  [ [ [ [ [ KoP᫲[@ `S`1`05:P0@&ƅ&0 !ƅ0 01I>  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0R00S8#  #800#"0 h`B 0 0 0 0 0 S0 S00ӈ R01q 00  R000 0 0%*W6: &R \ R80l0 C 0 B 0<L0DC0C yt0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC 060@D0 0!1 0Rpp@pp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000&l -M 0 0 AЍA-PBU_8 `3l! 0(3/@PR P!@( 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/QO-Q M Rp 0 R 0#01,#0Pp0` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%x 0S,!R4@0HSPS aS,d&P%PN&, QS,T% S%, QS,T% S%, QS,T% ^%,00B0 R | 0 0#01 R,# ЍL0#20S!B2PpvQUdP8P POOONA-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&N A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&(M p@-@P Pt`t`@P  !1Ē   0" C  @pPpPL p@-@P Pt`t`@P  !1Ē   0" C  @pPpK 0@-1@4P 0,C @$!0 G-Rx 'xh Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq'R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/ZU/0S0`0/ / PZ146@-S k>@@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pj P`50 0  0pk0S01YQ ⵏ 0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00U00S@ T R 802^02N00 R0@ T<ЍW@  |xP 01LY 1R 6 G2#6pP^p N00=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-鲠MZPPRt0+!  k ^pZ ἖` S 1>@i0nh S&hU0N P` `P`,ĠƘ lTLh&h἖0@0lih S&h 0P``0P`#406L0cTCh&hN\.ƈ0̆@ Ƞ,ȠPP0@#4PP 0Ƙ0l^h&hLW`ƈ7 W0@Q `W Q^kp`徐v0`i7W8`I#8 pp00p0#40v0gQ8#8p\0v`pV0@S `Vp0@T PpW Y0*`p ^F @0@Pc UYX%X@ 0P`P0CP`P%TPV0PeTEH$H S6L3@P8#8k`0`0@0P#4``06W@c\Ġ 0C6D0@Qi `V pm 0@P9`d8 V#8 @`0@D0`0#406@0cUS8#8 TFS LDPH$Hk>`@`@@P.``W@n\Ġ N 0@Q$ `W*0@S P palh&h`@ p0T0 V4 p@` 0@SЍ༖ N.CkΈ0W@6 N.4kΈ@W0Fv P p'0@S P p0@S  Pp0T 0W `@ 0 OO-ʀ6MS 4004`003k^0 0300300 A @b98 T#8@p000@p#406 B 0c^&6S0@ 编0$` pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>8Y#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&0Pn28R#8  P`0`00 @#4PP0&N0bQ8#8 k0&Ѝ 0&0p0v, tJdJTJHJ& 0  8#̠  4##<V0 0 ,000*60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@PP@ @"$PP Ɓ0O-0 QR@ M[, R 0,p&]&P+(+0N  q/ ! RH@P jƖ  \& R Q3 "[&kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦@ Ƞ,Ƞ!k>0#40缦0j\3! JDM⼦k> / ! Z! ! 缦jR!! J^ἦ 2 / Ml  \ P+R +R ,RE R  Q ,\3 "[R&k R0f 2 8#8000 #40&0bP8#8 Bdk0&N.V 0G. 0R0 0xS0   0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOj @!:!<18#8!28#8 A@?X=:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  `;0S A-P p@0 C`0@)PTUT @%P 2%/@- MP`p)@P @_   'Pp P + @P  Ѝ 0@0 Ѝ0@00@+T  Ѝp@-P(@P @.@pp 00p@-@(0P 0000_ 00\p@-MP`(@P @ @0 0Op +@ЍpA0@+T :@Ѝp0p@-S P@0 C`40@OT" 0 p6%0P@p$yara0p@-S P@0 C`0@fOT 0 p%0P@pk$tcid0S p@-`@0 CP0@AOT @pp/0S p@-P@0 C`0@&OT $,0P@p0$p/yara0S p@-P@0 C`0@OT $,0P@p $p/tcid0@- M@ Op  P Ѝ0{ Ѝ0w0 0 Ѝ00@- M@ Np  < P Ѝ0a Ѝ0]0 0 Ѝ0yara0@- M@ Np  < uP Ѝ0F Ѝ0B0 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@ PB$0PPptcidp@-@P6$$0P p00ploobp@-P`@P  =0@}#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@% @-@@B @-@@[ @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@{@,@-@u@C@-@o@Z@-@i@sp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P`T @P  0@"pp@-P`B @P  }0@"pp@-P0`P. @P  i0@"pp@-P` @P  W0@"pp@-P` @P  E0@"pp@-P` @P  30@s"pp@-P` @P  !0@a"pp@-P0`P @P   0@M"pp@-P` @P  0@;"pp@-P` @P  0@)"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P0`P @P  0@!pp@-P`| @P  0@!pp@-P`j @P  0@!pp@-P`X @P  {0@!pp@-P`F @P  i0@!pp@-P0`P2 @P  U0@!pp@-P@,"(0P p 0P 0pgntsp@-P`@P  20@r!pp@-P`@P  !0@a!pp@-`P@!<P p P U patadp@-P`@P  0@7!pp@-P`@P  0@%!pA-P@!X0P p%`P  P `'gntsp@-Pe@!(0P p0P 0pgntsp@-P` @P  0@ pp@-P`@P  0@ p@-@R 0@ p@-@P`!$0P p00ploobp@-P`@P  0@ pp@-P@P 0@ p@-@@ @-@|@ @-@v@ @-@p@ @-@j@1 @-@d@@ @-@^@] @-@X@v @-@R@ @-@L@ @-@F@ @-@@@ @-@:@ @-@4@ @-@.@ @-@(@. @-@"@G @-@@^ @-@@u @-@@ p@-P`@P  '0@ pp@-P@P Z0@pp@-P`q@P  0@pp@-P`@P 80@pp@-P`O@P  0@pp@-P>@P 0@pp@-P`-@P  0@pp@-P@P 0@pp@-P0`P @P  0@pp@-P0P@P 0@rpp@-P`@P  y0@`pp@-P@P 0@Ppp@-P`@P  W0@>pp@-P@P 0@.pp@-P`@P  50@pp@-P@P h0@ pp@-P`@P  0@pp@-Pn@P F0@pp@-P0`P[@P  0@pp@-P0PH@P  0@pp@-P`O@P  0@p p@-P=@P 0@pp@-P`,@P  0@p p@-P@P 0@~pp@-P` @P  0@lp p@-P@P 0@[pp@-P`@P  b0@Ip p@-P@P 0@8pp@-P0`P@P  =0@$pp@-P0P@P n0@pp@-P`@P  0@p p@-P@P K0@pp@-P`z@P  0@p p@-Ph@P (0@pp@-P`W@P  0@p p@-PE@P 0@pp@-P`4@P  0@p p@-P"@P 0@pp@-P0`P@P  0@rpp@-P0P@P 0@`pp@-PJ@(0P p0P 0pgntsp@-P`y@P  V0@=pp@-Pi@P 0@.pp@-P`_@P  60@pp@-PO@P j0@pp@-`P@<P pP U patadp@-P`F@P  0@pp@-P`U@P  0@pp@-P#@P 0@pp@-P4@P 0@pA-P@IX0P 2p3!`P  IP `x#gntsp@-P~@+(0P p0P 0pgntsp@-P`@P  0@qpp@-P@P 0@bpp@-P`@P  j0@Qpp@-P@P 0@Bp@-@Q 0@8@-@R G0@.p@-@0 P ##p@PP!0S !p!0@-$@@!pLP 0R @-P Q o//P ᓻt0, @-H&`@-P Q @聻0ft0 Hg0 H 0S p@-\@`@@ PGPpP p@ 0KJA-P`p'" @P  x`P pp5!۫P` k,!U @S"#!J"G"lJp@-P @`Pp7P p@-@- @P $ 30 0 0 IA-pP @P   0 0 0 dP`P  ᧾` P((0 Hi@4Ih/@-@P E@ k0E/HR }-A-M `V $P0 P<@P|pP  0P< EЍAЍ/ЍAЍ/>Q/H#PU,@-@P @ $0E/H }p@-@P x0 0 0R0 P80P Q " p@pp(GPp@-@P `0 0 0R P0P Q " p@pFP/0 0 0R /FP/<0 0 0R0/P///E\0P @-od  QP  QQ v"/EP/ 0 0 0R/E@-@P \0 0 0R  0P Q M"00D P/00 0 0RP///hDA-PPM /o00 0"P R Ѝ R0 0 pf`P 0 S  R L  Y/: P`   00D A-@PM 0 0 0R ЍQP 0 ط 0p*`P 0S `  PY/: pP` i (00 [?-HλCD ; P -/o<0"0 0^ R  Rp/ BP/D0 0 0R /@-P oA,P/D0 0 0R /@-P otAP /ol00 0"\ R RP Q Ӹ Q˸ /A\PfP 40 0 0RP ම/@fA-(0`SM.P@U Ѝ P0P rpP 00  0P+ S(P0S0"Q00+ S@P \ 0 0 0 @Ѝ, gP `?P 00#0 0 P 0S S R/P/ R0/@-@ 0d8 * @-0,MS/a @! S   P `9` `P )P /,ЍX  ,ЍD P ` t9$0\ x⊺<>$@-@  l @-(@@< = 00 S 0 P :\03#/S 0 P \0///A-P``@P (ipP  ӧ@P {W@o$$0 x` ;xM 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ |Ѝ00@- @PM  @ nЍ00@- @PM  @ `Ѝ0@-@P ,0 0 0R:9 /P/0 0 0R / 00 !S R!* R0*/-  ^0 : 0P0*  R*/@@/ / 9P $0 0 0R //8P $0 0 0R //h8P $0 0 0R //08P $0 0 0R //7P/h0 0 0R / 00 !R0* /  P 5*/7P/h0 0 0R / 00 ! R0* /  P 1*/D7P/x0 0 0R / 00 !R0* /-  ^ :6P/x0 0 0R / 00 !R0* /-  ^ :<6P/@0 0 0R / 0 0 S /5P/x0 0 0R / 00 !R0* /-  ^ :\5P/h0 0 0R / 00 !R0* /  P 5*/4P/h0 0 0R / 00 ! R0* /  P 1*/T4P/x0 0 0R / 00 !R0* /-  ^ :3P/@0 0 0R / 0 0 S /L3P/`0 0 0R / 00 ! R0* /  \ 5*/2P/`0 0 0R / 00 !R0* / \ 1*/2P/h0 0 0R / 00 0S00/ P %:/2P/h0 0 0R / 00 0S00/ P %:/1P/P0 0 0R / 00 R/! /1P/h0 0 0R / 00 0S00/ P %:/0P/`0 0 0R / 00 ! R0* /  \ 5*/80P/`0 0 0R / 00 !R0* / \ 1*//P/h0 0 0R / 00 0S00/ P %:/P/P/P0 0 0R / 00 R/! /. P -/o<0"0 0^ R  Rq/d.P/L \ /  JQ\/.P/L \ /  JQ\/-P/P \ / Q/S/Q\/T-P/P \ / Q/S/Q\/,0C-M`000 00Sp pP Ѝ(@YP+ A) 0Q xRK ^ 0P p'*0 00 0S  P Ѝ9  P p:,0"S'0"S# Zqp  0 00 S   0"SO-MM(@PqD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ PP 03/P 00  $ 0:/P 000 \PMߍH;0@-@@PAL70L.0Pa`L8 0LWL Vp 8 W8T#80O-3KM `0 0@R @@@$@@@(@0 0C0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RṒP0/S7 0(00>S: SA 0S p03  0B0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8ⶳ S =SB0"SQ0SN   0"R "R RAC$ >R<04 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pn \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R<\ BR  ;R<@{  @d0 8"R /R 0nP 0 +("( R:Y Y +     SP,0 Rg \Rd  uR` ?P Z +  PU6I0     0 # <  P,!*-"-  ƠP  * --  (  " "0  d 0 O-Ÿ M @ 0D0S<^QQ@`Q  0>S 0 T @P (0SP  R @ ЍT" T& @✐P0 S00qP @P T eP0S  0S HO-PM`@PM ,8pPD b:pF 0F fppSp>0 Pߙ0P08u%   `p :Ѝ00 P0๙p``:`Ѝ8`Ao/A-PP P`p @@P@@@P p40,p0P4080<0X@-l@  ,@-(@@o Ǟ ur@-@@O-4@T p`, _P @@D¤@`T P礀Qㅑ8080 0PZ PZ P  @-R 0P< P 4Q ,  4)`0 0⹰0 0Ⲱl P p@-@M4 00R1SP,0S@R 1`V, P` 0 08P 40, 0C40P" 5`ЍpS" R` ЍpЍphZ<.0nPPj?.0g<co?.0`$$N?.0Y@ $ y iA-P`,p@P W 0 !w,@0`,@0`C-`0@SPpMH  P 00Ѝ!0 .P ,0SW !0 v/P ,0S(0S00  0hP 0S?0S0"S_0:S V0}S "S000"S v\P  VP @X 0 @dP H$$w?{/0Ɐ 0 L 0p@-S X  Q P@0@{p`0!.0⏯, 0S ,0 00@-?%. 0} 4 @-R 0, B4 P @ 00'>/0fo?/0_  O-80M@ Ѝ@p`/ APP @ ` @ Ѝ娒 v PP0 004QY  4 ,R\ 牱Q1v  z P 0YIV  B B!N,0 P 04 `<0 04 <0 \ުP,UM<U7U+,Y& xx @ P @ ᐜPP( w 80,S<SS8 [tPp @ <0P0`<04 y< !,0P ḜYP  |,\0\02.0✮LW?/0╮4?/0⎮Lh<$ 2 p@-@PPb0S D  Q <0 0 p@S`0/0i , p@-@P 0`0VPP h h0 0  0@S0<  0pPp `0/0> < O-0@SP MT p}`40SP p `kP@ ЍNP P 00S 0r  A> 00,PY 10Z/ @0R+ P$ [] P 06P 0S P( Hqp0` ЍO L P 0  03/P  40R1# P P6>/0⫭j 00C 0 P l`*@yTT?/0┭@+? 0⌭8   4    \@-@0,S<SS?/0h( PG-V Pp0`WSW@6 404 S @ 3 1S3 E000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<<-B> 0$$-F> 0\ !p 7G-PS @- Y`' T 0p 0R q  004 00R$ uP y 0S 0 GQXXG>I.00⹬*0,S <2.0⪬4p 10 HGG-PP' 0 0R"pz4:`P 4 R @,0儡ᄑ1 ( & ,04 儑@ 0T:804 80\` 0P 0  Q@-P80080/Tp@-@P@80080p@9p@-@P 80 0R@ pP+4@(pp@-@P \0 0R@ pP`00S@#:p@p@-@P@pA-PP 0 0R4p`40S @40S ,0 P@ `A-@P 0`0VpP0S P @T <+? 0Ы@@D A-PP /o0`0"Q@@T @0R p @P @T @+? 0♫ 0P T@- ^ 400\@+/<2.0~ 0P o@-p@ T\ @\400\@/<2.0Yl @-PP M 81 0R Ѝ`@*80  Ѝ@# 5P 4 0R S *,\$0 B!p@n400C40<00<0``K.'> 0HHK.M> 0 00N>K.0 0 u v w P/?o0 2 R0S/0@ S/p0P -?o82 ^0S 0 S / P/0 0@0R/P/0 0@0R/ P -/o<0"0@0^ R  Rd /p A-`P @P?pP (0Sp 0P  pAQ4`  `O-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L d0X% XP0@#r 1`P 00C 0P  I@t `G sL?).t⧤f(?).t❤ht < 40S 0C40/ =/@-t≤\ 0p@-S T  Q P@^0@Xp00/.tm ip@-@P |0`0VP@0S R  <0 0 p@3,0,0/tJ00/tDX @ wG-S )X@ `V 0P 0R 00p {` V 0S  G883>/t {0,S@\ ?>A-PP 0 0R41pP 40S @,0a, 40a@T:8 408 pT@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@pHp@-@P \0 0R@ pP`y00S@#:sp@p@-@PfH@app@-@PZ80080p@Sp@-@PN8@@@Ipp@-@P x0 0RP`;40S ,0AT 2p@p@n?/tA8 aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@k@44?/t ?/tXP 4 p@-@P H0 0R@ pP`D@pPA-PP0 0R@`4P%80,0!qW# P P ,0P < 0@ 40< A]A4?;.t⧢n?;.t⠢м 0P -?o82 ^0S 0 SD/p@-`P pP@P (0S p@ 0  0 //@-JTP0p0 TP O-IMP  @T p `0 R 2/0CTX P Y  9/0  pPP @TL0P #003/Y@ 9/T TT T @T@" 000Q 1/0T# P/0S% 03/P& Y 9/S@TL0p d0P ܡIߍd0p ӡh0p ̡Y 9/Z 0 03/(0p ⻡됾 t P 4 P0/O-@MM(p IT 000 0\0+`P$  T%0 `eP4 0@ 4/@P`P@003/0 `JPMߍT00 0P 0 $ \00 Mߍ((0 K R000 # 0/0/@-@@A-pP`PM1 @T. 0@0W   WO 0 /R C 0CW /RW  W0 0 B/Q P!0C@T@! 70@ 0.0 0 0 S* %rp@  'U 0P)(p)@Pۍ ?00@ۍ S0 (p (P(HP(p '(p 0P@'Ժ  p@-R 0@S PR:   PpP0P  , 0T90( D␠<:p0( D≠$;0( D₠pT 8  p@-@Q PPpQpC-0 MS~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ&㼐Q P&㴐Q xPPU a/U`U"0E'S0rP\bP ]P PU /U\U fPnPtPbPUt 0  O/ PQQ 8P(0F/D댸 l 0S p@-P@ P@p 0Sp/p@-@QP Q  PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@>0Q/Dt #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@>Q0Y/D; 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P p@>90-D밲 cA-PPa Qpp0` XpWW@PS  PL <V`p p0 8/PPPM`<`nQ P P 0S 0P P 0SPT T /P P 0 P <D p@-P@PP Y 6Pᛠ0@떠@p yx011/A-\@`pP \1S 0 €  P 1P1 `p P 0,0A0 4/B`0 4(  @-@^ P ^%QRS  T00NQRS"  TŒ 00Z0 4 G-@R0(M0QP P 0 ` p Pt p `ཫ0T?o20S00(Ѝp`0 P p@- @PM`000 0ڞ0 0Ԟ0   Q Ѝp 0@-@P M0ᾞ ⹞ ⴞ0     P  Ѝ0p@-@ P0Ml,`.4l4#0嗞 4 40Ꮮ 4 40ᇞ0   Q Ѝp 0@-P@ M0pxl,.l! g 4!40`0  ,  P Ѝ0p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0vW P0V00(Ѝp@ R 0S V00 @-@ 㸝T00@-@$p00T0c$0d$0e$% %@-@T @-@T000 000S/@-㨞t000 000S/@-㘞t000 000S/@-㈞xt000 000S/@-x8t000 000S/@-ht000 000S/@-Xt000 000S/@-Hxt000 000S/@-88t000 000S/@-(t000 000S/@-t @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#h 0 01/001/0 01 /ܑ0S@-@1/00/p@-P0P0 0@0PS` "Pp͝p㢝t/F#000 000S-/@-㐝-t@-n000 000S/@-}LtAo//0@-p@P M , P$ Ѝ00;0 ⇛vt @-p@M D $P pЍ 0;0 nwt@̧ 0@-pP@ M T T T \ 0 Ѝ0, @# Ѝ00:0 Itx p@-@ @ #080 7^t l p@-@PP (P$Pp070 &d p@-@PP (Pp070 h p@-@PP $Pp070 p @-@P  Y.<+ < 00;0 L @-@P (070 (X @-@P $070 Ӛ$d R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@  P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pᕕ80 0 @  0""048# /UUUU3333  <p@-PQ@v : Sl G Sd0 c Sp0  S?0c0 r-w-!- R00M >Rx  -   r-w-T  Q7 &Qx-$1r-@w- T$ T T-x0   p Ss0  Sw0 S?0l0Q s! R0s  t0T0SS   S?0b0A0a0-0090 Bd O-0AP@:  pP? P?  :pP% 00` 0@T% BP0=S AP` AT BX ! ཙȄ<0>0  00t G-P2M0 DBD P @@0H PLj X`P ㌠吠唠嘠圠刀嶚pm pp 㯚pb  P p[ X0p 0S0R00000048<;,0w,y,0`,h01000 0@0 00 @u*,T  "ꊚ0S Smp@ c _ X Ѝ W oЍ @g0@ 0 F @ <d 8 O-PMp 0GW"S00`0v@P-TPg +T@`0@ ǿ 0  ~ 0 ~ P p  !ʎ @00D \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ə00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 ⠗UW p psW ꙙh 00 0M0Ѝ63O-PMp 0GW"S00`0v@BP-TPg +T@`0@ ǿ 0  } 0 } P p  !ʎ @00D \a0DSW0DA0DS"70DUr X : QP   S  R + "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $ԖUW p psW ꙙ 00 0M0Ѝ6꘿3O-M8@t 0 `PT uL 0 `PT j ̕ x p P ̓ d 8 @- M|id@` @0S H @0 0 |0 30ЍЀ  AR2\ ` 0@-M04B@ Ѝ0 0 0 9/|[mNA00/P[G-@SP, pE`Jq2Q# l2Q J[XP0 S0C0 PY 000 Ⳕԑ O-I,MQ@p 0N R` 0S 0) 09 P0S009`0S x) l)l  `)`    @yPT0+0CP I @p  q 0| 0  0C 0B0 0 S00Q?0 0X0-SQT0EP0-S 0 !000 ,Ѝ(8(H(0@00q p 70  ,Ѝ01 0 B0C0@崧 :Q 5 0+ B RGP 0( WY :R 0S00087@0| | -Q000 7$  0 0R& 0 `=Pt A 0Z @P @` Pp@T Pl P2N v `  Q Q 0@RTZ@Phv 0 Z Q! 500S 0:S   r0Sp5 00+ C :S:P ? ,Ѝ0JS0 S P0S,Ѝ@PTPX `0 OW 0S 0 ETPX` H0 ; 0S dH0 1,400S 0:S (   30 h0X r;R0S00%X03 00S 0:S W d30 0+ C}0{  0S /0:S  X 010300 0 0S000200S 0:S 20LQ 0N00P200S 0:S hRZ; 01 S0$0001100S 0:S I00C 00!S0 0 00+ C H0 | 0S lh0t|10 n4 h08h0 c88!0 00S 0:S B000+ CR@@q 0  10R th06HH@(Y$  YY`Yȏ `XdX0XWdW| W XP _ Ћ d a t S L x QPO-pQ ` V 20 R" P@T60崢 R01-[@P-T@PC T"hRPP  PA -@0P  :R9 20 0S " 000PP@:T0S! 000100S 0:S 1 0db?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S ]0 04P00P0 0 R0 `VWST0 WOQl0l 0 ĬP @T@܎َ,0,0 7*ԙhD| { A-!1 0!M@P0<80`d QPP 14PAp4t1 pރ0P5P  0$0(0,0000@ 0pp娎PP"@T Cn` 0P8T弃P։P @T@0S  TMk| d0 0 <8 30!ݍT00ZD<0<0D u)8Xz z Ė@W,Wy O-ğFM MPQdč@`ᐤt嘄 T V Z XX ( 0K0;d 0P0S  0KPW  0 P(00SrP @ $ Px Ps$4Wj ,Pj(+,)6rP $!W , ` #3 0 d4 30Fލ Ѝ|0P3Ԓ MPPi /ـP@@W  QR%E0Sk SIT" W?@Y/ 70 Z/K0 I&BPB70 ❋TF0 ┋V?0 ⋋Z8x_0 ₋0X!0 W/w70/$0S㈀j !P  0-c7  W?@. W7 @K(pE(w Xw w v v v Xv 8v yv zu {u u Xu (u t t t t @-XX1 0M`P000@P:  ɋT p T0U0P @W@P@ 0 0 0 30)Ѝ/000U00000}P 4"48#80H]?a/ ҊЌ0@ˌ@ ( | s @-@P @ ~]?f/ Ⳋr O-LLǟ M Mčĝ,(ĝP 48 $0 80S 0St $0S{ (0Sf IPD@PHh0  <0@dpI P`6&@06 0!>0t6@000}?, @p0 Fp! p rPjqY00S# U0=SPX PUPVPU 4dP@`B0#S< v@T <@00C@0-0 倀0 00 056P%000 @0 00 4"P 4  n,0$zw00$z w40S@00C@0  0p@D0 T !6*pmNSvmz靠e `c{&D`l̠daˌni "mn `ak  `H8古n` md d8@,b3De (nIp M@gy荠k{n`[n@`dk&@ lK@$@dJbhKPP%X @m3k`@ j+NNNbP[lT0Pick ci!0c0k @$ Pl @DPH`K `ˌ*d @Pꭠh jˌkg+" dP,i+0 iˌf;# 0͠T0+>C3C7Ch; . 0cPP T2gˌ a " 0g;a HPpᄢf b;,0 b;#f `@P娢makl; 0 l;#a 4PТab`;&0 `;#bLP n P*e Phe C3C7Cn;`+AmAhkAh*jhL堅b*l+`$l`.Xzmv逈eehPd" zTd,mXv\ȠP`ˌ`[Xg;n@0lb . b ` d 4@n[,`(@P%Pl@e\b[b+D@0#el@ 0+NDCDGDaK$@lK @$@MnK`+% " b*l+Lbˌ(e$, ˠ`ˌ<f;+@@@n a, j ` d" )i8e[eP0+H╃H⫇Hj0#0c9g;.Pdc`cb,* \ꭠ+K╳K⫷KgHp +~G芠sGfwGfk.c;ndKal%! h`abahk(e+$ " 0$0# 0Hpb-=l+`;d !l{ ``&` e `a{"p'd pyb ddK+ ja\0j`$ ! bbˌ a+h+  0q0pP-m )m` 0` (` m0PPoP#Pmm` 0`(`mP PP @ \lllЍlЍ'nS 0H0 Ap@B @- M`Ypqp1pP@P`@@T 0Q P Ѝ A @XP @ ЍP XP"0S, -S?@0 0000 P  U RP +R@@D!0DS  XP0S +S!@?@!@ `%< X ?P L0P00 1 R/@P/!R/#(0 @>R0 00//l#@-Mp @q`P`W P0D>S 0!3100 0rqЍ>SD 0!3100{q00wq00#/-p@-MLqP@U@0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, ,  <"P` ,  A-@PP`p; =U( X0ES  S0+0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0X0+00+0`0p@00(0]0 n00 < p@-PP@F 0a `0RuSpWS6X0CS0p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D n I@ O-0wSpTM 0@@ 0`004080<0e   ]0(0vp @( op@T%X7(P0p000000G @ @  0 a0GS00Op00Lp0@Gp@PTЍ+W = W0 -S0000 0` X B R = G/oS"!"   ( P:0,Pp ,> p R, ("@P0 @(偑  ( 0S# (p W:,Pop , o0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,Po` , o Rm, "@(`0`FP`(`   q`(=W +0G?o 2R0S$ Y,Po ` , o0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,Pvo ` , no0S,0(`""`FP` @(`傑0X0 0!0($ KR; I?I00 KR<I Eo0 @$$0`0S9o0"SB  V*(@ T:,P/o @,U (o0S(0,@0CP@(@Ty (2-+ 00 ` 0TЍ'pC  001]0 l1]0 loꔱ1Fsn00(0UpJ 0Xp+`-@ +B XR R  +B0 -R +R XR 0 -R  X@P`QpP0]0 l~80o0P l p T   @-@PPM 0` p P@`[p`Ѝ0:0 pl P 0 @-!m/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe``^P+\^U PU  0   P@P PPr`P `000p@8000m0PmPX   p@-0P@`T @T0rS Ppp@P0+Spp@00@-2$M000P0n 0Ss 0P 0N 1 00S$cXp@2 P! xX0rSB $0 P0p1 0  T1 P @00S5$Ѝ00P0T X@\5cm@EX0 00S  nlTm@PT$0 P0\pu 0P$Ѝ0T 0 5k8@0 -kXt Դ 0@-$M 00P0  d 0Si 0P0@ 1 00S<p@& P 0rS: $0 P0P10  41 P @00S-$Ѝ0ql0 @00S 4l@P#0 P0l0P$Ѝ0P 0d j4@0d jt @-TAPP@ MI D1p0S+41@T4 `0`S( @0Sv$0V0, 0S%Pvl0S   ??p  Ѝ0@T0S hVl00PD  088l0x DjtT@,4 G-`PPHM6 p 0 Jp@  p@ HЍ EP 0 3p p@ iHЍl0S @X@0>0 iM0P R@| O-P4M@P\pw WmX0S0 `00 S 5/040 00!S5+0$0 00!WaW0] Y[ X00Ud5S`50 0 0 0 0@0` P(0`0r5`0D0$0XQe 0S20`iW ,A 0`eVW@P ,(05#[0P` X $ 2P0 4%*&  # #. BPU 3ß2#0!/#1##* 0 #   `V4Ѝ3+00 00!n|3/00 00!f`30$0H\.d0La#0L0|2pST0, P `@!dP 0`V ^ @P,w ^[X"$:600%$0<"%>!!!0C$"0TP%"A0$AO#QX00 0 0$00?S%4P!( y`1T101! T$?01>! R01"_0`A(0l10X00`d(00@t`dP(0 Nd  R. AP5Q4 0A`X0 0A$0PE `0P 0  )`1`190T dkht8H0T dch`$ GzGH Q(\)\ SQ| ̸ p O-PP@` Mo Tu V| p0 (T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @@0 <0\; \ @ p R@p\ p W R:\#Yp 00 gT80 gVllD0 gzp,@ \?[*!]-  p@-@PP U p@HHT0` gU((h0` gp@H EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` jPP0 X= V  00S0 0 Q 0  ! 00S-*_oRe`V@P" U  !gxxt0 !gT\\0 gDG0 gi00P<   C-1 M0 M@P040`P$ Q? U5  00S0 0@ $03/!1 0 4 30<ۍ ЍDQpp 0fV U G0 f0 ftt0 f P0fD40 f C Eh D0 O-\\ƟMM PMPč pTDe0^ XA 0SH VO 㰰qhU[0U@@ R R 50B?o2 000RU$00 S0E0@c0S0000SgV (0+F0OS 0@ 03/[o 0@ 0000,00G(0 03/P     0S00 * z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ P (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  000S0 P@T  00S0g04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0J  2/0S0=  000.SP _ $P 0 @JP? @ d  2/0H(100+$0 00 `P0\\0C/Ber0?g R 0E00 0e0S0 &eV0 e0 e0$ 0QS g0/ 0 @0 03/0}bE`E0x;* ,P /x P ,  O-hhßKM MPčp`Pؔܤ; WB UI YP \U /\@ @ 0\/\0 V'"2 0 4 30KލЍRZ/\3/00P/\V\% pD0G/dW$$0G/dU0G/dY0G/xd@Pp PkP 0   R  Q 0T/S 0: S+ S 0 0 0 0 PX# +00S0 0@ (03/0S0: ST/03 301 1:l R0|P|P 0I/dG 0 dVf/0 0ᲰO$t m n o SO-şM5$M 0`P000P 4 QD @0~S<   pH 0S/S;RL 0B0 4ZS 0H*0; P4S 0 0CPR- IR*0S0;R# 0X @H p S    hhh*S1 00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+m@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S  000-S]Q 0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 kSY0 [0!^0  @E  p4` M0PP H *; @P 6010Q@@Kp0 bU 0M/b0K/b0M/b 0lb0TM/b@7@5x?**[-]$ ! 8  O-`QM@pM R W T   DfcI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(B 0SV 0F0C  0b0 0 @ ]RR ]RR xdd0R/aX Wf@FU?R/a\$$0R/aR  p@-@P`PM( V/ 0  0 S /0{S 0\ {\ P 0# Ѝp0}S0S Ѝp@T0.aV40.zaxc 0 A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ| \R@ @R@ )\ L 0 R+ލЍ0[/ a\@8 p@-`P Pp@0T1@D 0CPP k@T*g000p0]/` 0S$ -*S ?0C\S0P0S Q 0S 0 0/L 0p@-0@ TpP"TC ^ (a`00 0DS'000@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p @- ! a 1 `0 QM MR050  0 0 5 30-Qލ Ѝ ,p p@ P 0 !p @EO0  P@0, P 0jHtt  p5O-0$eP`M u500S E@ p#S"gb0 P$ 0S $%P @ 0Sa0SЍt `p  0@S0 0 40  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000 \P  00#3R0000 4\P 00#3R0 (# 000 \P( 00#3R04 " 000 0#S 20@ R@@QP00Ѝ0 S S D`\P 00#3R0 (" 0@00u LI\P  TA\P3 00#3R0* ! 0 00V 00#3R0 ! 000GlPT a0@S0 @  \\P =QQ 0P0 0 d[P=Q 0@0 0l⪟P 0P0 08Ph d ` ܶ|(дl  p @ p@-PP t[P d@PDPPP r00p I0 q^x ȱ  @-,@@PU00\O-ȟ MȟpP P`@ UVYT{ 4 TpJ09, ^W Y U} 0p00 2c110 0p 00S> A0$00 0 p P2`<000S[ ^U_ `'T7 0 0 30Ѝ `s?0l0` Ⰸ]pp  PWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S# I BQ #S& H BQ #S% G BQ #S> L BQ #SS M BQ #SI N BQ #S? O BQ #S8 D BQ #S E BQ #S F BQ #R 0S:U 0p0S8 Rh BD{P `0000  00  X$   840000   $   30000S0 @  # 00   pW p[ p^000 @^@W 0] ^000S ^0 0[^Y 0 ![ ^000@^@00f@p00,(@ ((@(@00,0rX X[  㵾Pk|0Sy[t+T]_0 \G^00c^  P\p~pc TRpt0`00U0`0 0SCN DqpLp <Y*0p0Z0 V^0SY00M pl0S0/ `00C0'  Lp8pPpMpJs[= 3pCkp-pk@tT   @ d $ ,  0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF?pP P ЍpA-P`? A@0S'A@Q0+pPpPP -3M@@׽P  p0 @BAQA p0 p0 $0<0 [t`D@ p@-p`pP`P@T T0T0 R@@p>P00᪾(v@$uA-P@P`@p᜾0S |@@W R"@`Y\@P00K]0@{uTu@- 00 @-B`@MP0FpP 0S|0A@@V ! @p UpЍ ⯹0P  R 0QTG B&R 8A@4PRS' Sp@ S'@z@ @S@u@@S 4ƛ@q0@@@4⼛q6@q4㴛@0P@@4⬛q; @ x `  h L 0   0O-HH% BM M $$ ,u,%,p     000 0000+0hP 4 @0 4>HP (`P,@\ oP 0S x400#S \ `P 0S @4@D0@8@\ QP 0S 4 D0@8@\ BP 0S 30   \ 30P 0S n30\ &0P 0S nl30d3dS`F0\P+ .G `< `P\  @P 0S UPPU PU 0WP20P0xS~ "p2 0 $4 30Bލ ЍP@\ P{ 0S `200#SJ \ P 0S (2(B0@@\ Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  1A0@ @\ 0P 0S m\10\ 0P 0S m,10 1P0P!0 $ 0 e0xS}0S y00  00 0000@VP(   d ( Xp PTp ܽ Ƚ p<(ܝ p@-`@@0S P Dp

02d Q@NS pP@J0V0  ! @T3 0 Pc/T @0 $ @@T S0T0g /H70]Sf /Sj \ST ܲ @0P@-@ P (X 0 Q 8Q?o2c԰ p@-p`@`P>SP 9SP T00pT 00pW 0 p脰 O-0Ÿ M pc P   5 310 230Zߍ ӷPT 0 p H  ŷP 7 R @; 0`  0P &P& PP 0 xpP 0 ]P0@T*p@ V 0 [pP xW - R  <ػO-0Ÿ M (pc P   孹 ᫹10 230Zߍ KPT 0 p H  =P 7 R @; 0`  0P ីP& PP 0 pP 0 P0@T*p@ V 0 pP V - R  ) O-0Ÿ M pc P   % #10 230Zߍ öPT 0 zp H  㵶P 7 R @; 0`  0P P& PP 0 bpP 0 GP0@T*p@ zU 0 EpP hV - R  p@-\@0@`P@ [P0S SP 0p褩 p@-\@0@`P@ P0S SP 0p8 p@-\@0@`P@ 5P0S SP 0p̨ 0 00 ꤴ-H- M 0 S 0  00\100M0 R0    R 8 00 0 0 30KH Ѝ/ pܳ-H- M 0 S 0  00\100M0 R0    R  8 00 0 0 30KH Ѝ/넳 -- M0 0&(--M  E--M  [A-pPPp` V Q @Q PD@h0 0000Ag@00 JS(80 BS0P 0P R   0//TO-H'H7 0?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo C-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0/// Q":::CA@- @@Q?Q$&3Q&40a0Aa223 C$LC>CC.#@C$#0c0## P ೠ;0 SJ?Q Qa01!/ B //-C C0c0,PP `]@-VP00p@-@PP  p@H010 CNL p@-P@` 7Ppp@-P@ 7Ppp@-P@`D 7Ppp@-@PP pAP <PppC-PMP`V '@T |00NЍp :  5p@`$ m~} 00 R 14T},@-P00 0S@0O}0#/"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`I@ A6P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍ PP @@ @x0(@$0KșO-tϟ 0 0XP(<Ѝ 0 P(000U00S  SG 0$`Ph08P p`C PHH Pm5P p W R0 0$`0P 0p`C P,H PQ5P pW R0 (000@ 000@(X(P(PzW0  GS(  +S{ -S 00 00$P P䅐ಐ/P:U X$P( 2c2c2,,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pPG0  P4P7 pGP  4PP+ 0(P 0  R9,0X0!0 B 1X/0 00; 0  0P(10 ,0 c0,? 0PS,0(111v>C 0C,0   /"b!!A0,0 X0 0000 0 L: ,0 @:,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(I 0 00X00 0090   0ZP(X|X80   0HP( =0 P( X 0P( `8 ,, ,0 0CXP0(m000y 0 P(_000k 0, {,0!/A!b!b0C P0( G 0 B0 S\0(0Q0X09@7 0 0P(@ c0 ,P 0PS(, ; 0@0?2c11!, 0 0 0000X60   0P(X ;0 lP 0 0 S0 (0X(P0 0 P(%(P000 c0 ,P(00000  R 0s @`0PPv0 P@ `@ @a0Ka1c B  B0   0002  /#b!!"A ğK/"bP 3 :bQ # 3,P b4p$ ,  Q000000&0@ 1?3c112B #K?###cR3:#cR#300#0010 !, 00C0 00@TP1 R0PR00D0PX$`p(P$0000PX$`p(P000,P  /#b!!0"A K/"bQ:2bS0#03|" 1 ,0 B00DRd , 40 00N(00 S!0r @WPO"  IPH 0 40N Q @(P0Pq 0(P00(PP @ ACLC  \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0 P ( 0$0:0ꌘ Qԋ l' n$Ih P)\(\ ף8 L ,Qw10PE0,P ( $P( Pd!/"b!C;R, a2ba12TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @\ 0 @V~XP( 000 SeXP( 0000@>0S; 00@70S 0@0 H,0 0P P(00, 0C$0(w,^2000c^\0M0c$P   0P  P(00 , 0C$00(0P @   0P ,  p#P ( (0 b$ 900 0M0ЍA-1@0QPHP P MS Q(h10d0 P1&PDp\@@ ",. R!  vΌ @p `U# Ѝ0 P0  $ Ba @L p ` xUIT 0 ЍL HHI00pf<} $} *| | | || gfffH| { d@-0M@ 0P ~00Ѝ@-0M@0P q00Ѝ@-P@edp@-@@1 00Mp0,00`@P< U2    P00Q Q Q  0 0 ,0 30 0Ѝp  pAI 0 P;@0 5G40:0 .Gp넂t,t,t,z z p@-@PP U 0DPp P @p8070 GU880 Gxz Xz G-pP`' X- Y BV @P0PES  R  D/0PEV R  RS0@0D@ 80H0 FXI@0 Fy y R@- 0BAs @Q 0CR iG@O-錡PP p MT WC R2@PH q3PH  2p`J HB(101S Yg3 Ѝ0p20P@W2P* 0 0P 520 0  iG= 0  bG`D<0 VF2RH00(0C0 HF*340x w RQ@-M d@PЍTT 1H@Ѝ㭩Ѝ(H 00O-]M 琡Mpō @pG h1PP pH @PAP`0 80xQ|Q!8O]80`TQ>C85 sA$`040Pm@P9P p0 0 5 30]ލЍT0D0 EG00@G00}|8{8v 0   M ЍT{--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-鈒@P p`M X X00?;7900P @ P ө00 00 P! !  D1XPF  9VP WT V[XPVppPpW` B 0`f`0 QpP `PED8 0 2EW`!00 ! 1 005; Ѝ倩0XP C0PP00  ; Ѝ 0 E`pPP V pP `P00?0 Dez\4t s @-@ M:(0S2 80 `0( `1/qpPp0)  0 0 PUR <0PU: ЍPPTp 0S  0CP:F00Pp:@-P M:(0S: O80 "p0( p1/qp@`0/  0 0 @ToR <0@To:1`V ЍP@T` 0S  0C@o^FT00g:VF00`:p@-PPD (A0S5 @Tp1 Rp00P0 P 0S P0吨 0c0(勨 0P0 冨0 S,P }4P y8P up@rHM@0  D0Sp 0K0 DeEo o p@-@$PP*Rp@# ,V@- @@R@Up@-,PP S@pU@-a@P`ME P 10p00S `  0 XR` ` 0@@S6  V8 CR 1!0A0 S0Q^(:ЍV   "Q @^ #R.S(@A a  00C0F0 ~C "^ #RN^^ N0 0Q@sn 4  R  *4 8/hS 0X\S 040:8 R РS /RuxB@-@`P ELpL0ppD尀 T   ➄׿Dq(l @-P`@E0 A-鈆pP`@P( T.  0 SSS8 S00 S 00500000050 BT40 B%0 0  00`50000  = 70L0 20-V00 ^V00;\ 40000 0K/l R000C000LS 0100C0 0?V`000 00000 \ \ 00y ,40000  70L0 0 h", 3010CP;\ cP3`b0D001dP0j R SXc\Q l301K00 M \; =\J \7 00C00 LR0e0 D100C07" 0 0  T 00L0a" 0W0C0Z2 F0nR \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pi 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP>cP%dP:00L000L0 0<00sP00npl l l j j 4j Th O-`RM@p , [3 X PE 0 0H P@0 `D/PBV0F3 `  [ 0U( 00?7.A[?7.A 0@SS0T 0 0@D0 T0 E0 ЍB00Ѝ S B00Rf e e 0  00  n A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@-0081003/0P !p0 $@ D0V0 00 R (㓢P000P3/0P! U  R  SV  0ST劣P000U I/>3ID lI  m HP $ =A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@*-00810 03/0P !p0 $@ ಾ0V0 00 R (P00 0P3/0P! U   R  SV  0SP00 0U GXG$G|Dk tFA-@P| Pl;`Px rpPh  00^c<!"#b!0CaqV8 X p<PXU $001p00S ,\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(_P` p  0000SthP0000H0003/P 0XE/>3DH\D,DDC=A-@P{ P:`Pw rp Pg  00^c<!#b!b0CaqV8 X p0<PXU $001p00S ,\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ƠP` p  000$0SϡP0 $000D0003/P 0BTBAAATTASR: G-P0`00Sp 3/0Y @IOP Ϣ T 00 00 Y @IOP T P00 D0D 0 p`P/Lt@@@0@??SR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP t T P00 D0D 0 p` P$/0X? ??>>tO-PPM M Q \ /\E P9P:p/\ p P/ `K`\n @ /RR.\)  B R/0  D0>  I *p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/Ra0W0]0娐 !uzP-W  69   RY  x>0/\0#p0 @/R0 X0/ ލ Ѝ @ ᱡލ Ѝ.00G? X 0/ ?    HPF3?00 -?>00(?00#?00??00?00A-@P Q P`\Pᇠp@P P`V >0"S V>00@p@-La P`M=  800QP0P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P  800  > 0 @ 00S00S\S00 RAPp 0S7\S5 00S1 :S000 0 S4Sl A 00S :S|S@0@ A@0S'!|1 0 8 30V ލ Ѝ  @P 00 C P10 Z P @P @@QP P @ 00   0zP 3~t0 80 80 0tP_ ~ @\JJ,,0Q p,H,+X++H)))$N M M p@-PP@ T `` P V0 0 `00p@   @0@0 N8T(t0 E8P(((L L A-@P`P V Ux = P d=@P 0:SS   4r`d p \S+  R0@ 0:SS ^S0S:S 0 R0@@Ad↛Pb 0`:SSd @0ARpA0,`0S:S 0C^BC2P 00@^1 0@P0 0 0 00:00@F`P ! 00 7~x0x0 7Vt``80 7lp pp9 00K dJ DJ $J A-@PP`G UM V; = PP] d㏙@P_ 0:SSpppdH0:SS   \0@@AdPA pd@ A\@ATp"՚Pp@᭛+0 E700 >7U80 57xF0 -7p嫚P @@ရ@9 00H $H "`H #@H p@-PP`@2 V8 T& # sP8 00S 00XS@<,00A  RaPAUA0AW0AS70A^p``F?C/6H0H0C/6V0080C/6pF sF qF rO- AM M`ß`3 0@P0(0 0`p 0S5 g20/44 (PP; P0D 8T  0宽800CS02 0x<4 i e<4 `0:S 84Sq~80Sz800X"D2 0 (0 30 K, pf!P) 0B.K:SS00 B0$ 8T S#䑟 0440<4 0 S BKI ; /04$ (4JE7 <4 0'$CPB>K0C04 8 0S:SYD H R0 0  Q!0A00M@04@@07 "0:S 8 00UePaE40D P5F0 :SS008$ 0:SS00.4 0?LG $G G l>dF F ,E D XD @-0 00 ;-H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 屼@ 00 0 0 30KH Ѝ/;; ;p@-0@@*H0PP0ypC O-@`,M$xxP~d20 R[ 00@`pR 0 cHP Z p P p J _) J PP0 S": @6$ U10 r 1$4S1!$6@ 000P$ ֳP0S "<100S (!1 0 $0 307 ,Ѝ U r ^pP Р ,P 5SX0(, VT00#    2PP !P0Sp:(xB <8+HA ˠ@-(@M@@0@PЍ@-Q@0M 0    ",  0$0(0T 6P0 0# 00Ѝ |60Ѝ0-$M  00 0kP$Ѝ0-$M  00 0[P$Ѝ0 -M 00 0 JЍ u |0tA-$$ rMPPp`, V2 @X0^00pAtAm0O⩗ `p00TAΌ 00`L PP¹0x @h0 0 1 30rߍL0F0  4V0G<0 4Y 6P5> = 0   M Ѝ4 -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/T4/O-44 sMPPp`0 V6 @X0^00pAtA0O( PP0P >TACr/0 0$00 @/t h0 0 1 30sߍL0G0 3V0H<0 34DD3X< 8< 0   M Ѝ2O-ϟp/  M # P 0_ We 000!R !X P  ..P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS 000P0C0 pXP l@0 0 -P 0C PSP =0 $ 3W H0 $3a`0`F p0p0S8@0 -P, 0P0CS0 0000偼0S0p0@0 0 -P0 0C P0 S5P 00 pj0p0S(P 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S` 0䪱P P` 00 000050p0S 00hʠ@0^T@pp,(0 3TIQ 0', 0$ 0 0$`-QV ]QP0 ` Q; @$00!0SVp!p3@`0 0X:P0X00 DP& 0  B00  `30 p PTPpG@0SW `P 0@0080偼0S WP -00SB0p00p0S00 3P 08pG0W^p8pFWp!> ᔈ m@(0H0p0+0AMS00 [m0H000CS0d000pWH R0XS 00 0 (* 0        0H 0 0(0 B0P0000F SK*N0 `p(@Օ0V'(0 `@C8@ 0p>(00S qP V ,$00SIV`@ T@0  R  R=  0 BV0 5 REP/0pH  R{ @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00p BH H HQF@|21 ; ; ; P8 6 5 4 4 4 @3 1 4- d) D( `pG00P0W0S`J 0000P T0$@p@00Lp0X0 0P00( z P6 0  B0 0  I0 0,p P p/ *p %0S $0 PS0pS`F V C P0 0@00]P ($@X T 0@0 0b0SqP [($@  0(u00Dj00?V~0$  ]R R@Pp00@0 0P00r$  ($ n4X  @P0 0P 00p,004@hP P P  P Pc P 0 $.000C,00V[ 0$@(k ` @vV @ ^(0R0BH0R 3P-@0 `$V`p ,X@0Vp@H0 )PH0 B   H `V  0SP H0 p H00CP`X0p0|5Lp0X@P0 00 (?oV20SX 00 0 0p B0V 0b RmP\0 (P U0  P 0  B0?0C  .. 0(  ǒp0 P s  PX P`Fp0S 0P [[ (0 {1(0 SA-@P`p#0 %0@#@-@`P MDp#@0p0 00 0@# ЍA-R/H,04! 00 0M0ЍO-MD`PpZ@@Z T6 0US``$ZC 0S@ [= 0 `;/0S) @$lV 0S H[ 0 ;/@PЍ-@Ѝ0$lV?%.H+0Hh[y?/^+0HJ>s/H+0$}>[/^+(   @-$$@M Ѝ@-0P$L`T M 0S 8pW  07/@P Ѝs-@ Ѝ ?/Hh+08p 0 00M 0Ѝ@-@`pP2-xx0p尀 T  ᵿ0 đ$  (! 0 O-ğ$M `H0  0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  0QP-0 S^^?0@0 0`0  NP 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0P0U 0 D RQ0\  @`b<T qA- Q@Pp`# P=0D?o! D2]R0S =p0$!0@<  14 40 0 V V 0 P0 Ax 4 A-P@p`kP.T T |0! D32 0 A_T %D0$!0@<  1x x0 (0D,TSI6 O-00ȟ SMDȟPP x`pt  ?o2V0S Y W w@Ō0P0  Ὄ0P0 [00 p1# 0 S@ P8*T- U T 0 1 #UP00? PPk@T`P @  *TP 0@T0P00HC1S@1@! <%`rpPD 0 (0)0S V <0 G0CPap1  * 50_?  Rp1  ' 50>  Rp1 00p1 00p1 00p1 "00p1@\00p100Mp1 L IP@T`|P$> (@MI? (  P( PzS? ( )TPS~0 (0 (YdE? (H T$ `p@T 0p 9/P*00#3 0 D1 30 Sߍ@@0`S$O 0S,0  3)VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^\*  P2 0*A5)q @. 00 (0<?p ᑍaP ~$0~s$@ 20 ,0(T 0 0S0"700 0Pywu{00, 0R 00$00S$0000P04p0S 0SV W``w? '4p)00J81 `@`,P(ό(0 [PY4*( ( $0@0S$0 EQ  ᴌP U@I) 00P0p0 d   @    p P , 4 L@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝ$p@-@QM`P0 "0 `sЍp0@-@RMP0 "0( P]Ѝ0@-@M 0 00 LЍ-M $=Ѝ-M $(/Ѝ@-@ M00000l0} @ D 80P @0 0 30 Ѝ, @-@ M (0}/ 0 0  @ D <0P @0 0 30 Ѝ( X0@-@QMP0 ?"0  }ό Ѝ0L 0@-@RMP0 ("0( }PЍ0 0p@-@QMP0`0 "0$ }ό`Ѝp -M00  }όyЍ8 -M, }gЍ -8M  $}όUЍ 0-$M  0 $Ѝp@`4Xh0T $> 0W0T $7  خ p@-PP@" T( Pp !`P 0S Su^P p@o^p0p@/80w0t $ Tx0t $  p@-@PP U p@ %`80g0 $ Uh0 $ ꤭ 0@-PP@ M T /^P Ѝ0_P 0SX00 `<00 $ T 0 $ Xܬ p@-PP@! T' 0 Q p]P _P ]P  ]P p@]800 $ T0 $v  ث G-PP@H T  R! R `V" V  0LXqXp$, 0V  R R2 0 00 0 `V000 0`V 0.4 0 F0R#  0 0I0,$  0\K/ `  00 00 0000 0L` % |  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0  0:0  ĩ C- MpPÍ`@PL TB A< WP8 7Y` 0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T  p0S S % 0p 0 D0 ? 00 8   T   RP  R0]P | ` O-|IMxğ4M IM,J͍,@@P p`WP W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l @ J- 岰p~ # 4+4J8 #8T  x {J- 0S UV0  SV S RNJ= 001:02 00d'$000H0 40SP @,VU  W3 0Sa0S  0S0s S0S RJ= 0 J= 00ZWJ O<  VP^ 0SI xge1a! 4a4#Q #< p0<0J8 0 J= 00 0$ X\0Pl J- 0SJ=  0FpS SuJ͍ 0 %! 00S`LP P P J= 00W0  *VPJ͍ YP 3Čd $ O-DDğ M@pQ `@$0 0CPS0#3 0 0 30Ѝ#3 0 0 300 HD@pЍOWXf t4"4 8 #8 UpPT0S RM 4"4$!$("( #8 #8 D;PT8VT00QWX00 R0SY 0Sf S4YP00SP"0 T T@@O 00QWX00VT<y!  0T X: OpYp  0PȠpY 0@D    ІT00? ,!0  ÆpiT 1i #Y4pܐP 0PȐp   ᧆT00?pW 0@D DP^T[pAL   ≆x(Т ć4 ġ  L O-p 0 IM8 P@`Tp/ P PW  PWD T0@S000h &h0a00  0 P 0 0 1 30!Iߍ Z q0VX 0S P 0 0꘤뤃A-@P`p  0 { 0P p@-MP`^P@@P@T 0S  R0S 4P @PЍpP PЍpp@-@P  PuX%Xp0@0 D 0S/. AA0C.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP0 PCE@0S0S 0S  Ѝ00n0 < @-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R# R!  `0S Ѝ Ѝ00S SD<0 >P 0  @($ p@-@PP` U V 0pḢPp``D0P 3UDD`0P *V((l0P !x T 0 O-ŸM2 J 1 #E 01p $0p8 `P P0 0 000000 8 P c\0 0,1040300؍<Ѝ0  R 4"48, #80,000(0PU,(Q Z Z Z/\ ``x0 nc갡"\00\00\00x @0wd  @-00AM M@P čP`p1 U P P0  P,@  0 0 4 30#AލЍ0SP 0@ .Rd P @ ̂HHx0 [00Nu lu @-X!X1 0$M0000@S`: S, V& p,0< S9* @\ 0S PU S  S0S \Rp`Vl d0 0 0 30$Ѝ n 0,1 tsG-@P`p W"  fPP   @ @ !<<D0 }W 0 tꠎ | O-Mɟ4M M,&̍tiQ,@`P(0 (0S 0S  @0 <0&<00!S8 &<00S &<00S @(8 0, 0 30'ݍ4ЍS80$000 S:0_>pC P 0 0`DZP00 $03/P 0P&<00&,SS00 80R0S^ 0S@p(p$&$(V"(H 0@@:D`04,Uq*0 C 0YpPg00  $03/P^ PZ}ZpzZW pN80S@&<00S ![@jZp gZdZ6Pz00 Y0P3   z PS P* `d0P& D&D04D0Q t $RhZ $Rc 4 40 [ &<00 Sl 0K'[SP@T4,Z0@M pW| 5000p0,0H00P0hP$0 fY: `p$``p ,055U0  `  FP $8$#,(@0"(@0S S000 0S }fY[w 0LE0S3 Y00Y00440$0&<00S1 @~PPX  (5$%0 5s~ ,0S #0S DfY00@ (0R [? [[a[ @_~PPXX,0S <0C 0D\D [<0 C00P; 0P00,00,000@@T@SY@@^@0P2z0 0XPP00 $03/P 9Z 00 S P@  0QRCPG.@oB&<00 (0%/+hll0,P(0SLLC?,F0S,,D0,< 0qRCpG.@7%@0/h X0@8 \D0OXPD0~4 4 R  Q QZ Q 0IP ee@|#t3 0 D1 30SߍY 00KX00 Q0 0 .Q0Q RS% d! St*+ 0 Pdd @S Rd! Sf*.[ 0 P< D Pdo 0 DDQ0000 0000 Px?0=S W0S# S S Q 0 Pc0s70SQ0S W000000  Q000S0000 P=ʻW00 0 P3ʱW0.[0 0 0sx W00tx0/I0 PʔW000 DDQW00W,dW00TPh(g@ O-`@VpPM 83 0 S_ `PL 00P0T0X0\0`0d0h00000 00000PSC S$ S0 0% 0#04pTp0  0Ppp0000 0000 d1S Ѝ 04p#ጀ9대XW00WP P P 04p#phP p08 P 0  d0 S㮟= 00<1 0T0 0 P  0 p P!004000 "0Prc0S 0 S00d1S.lXH   00S} @UL} O-Ÿ @00@$0` pY i:92 I520Y0 0 S   S  R  R Q\z  ^ \/oQ" S R0S  0PQ ,-0 0S Q0S %0P 0 弚P7  0 B   (LP(?Y 0( P p0`8P<p`P,@4Y 0S@TC 0SV 0S S 00S P(0 0< R=P R: R70S0S `;0S PU`;35 \ ^  (;00U Q  P \ ^  R R  p  Y ` P 0S   0?S C" 0c6#PY C ^h #\S㔐Q^'@ pTp0S 0`@ p$p T d:42 D52H 0SE0 S > S PR  PL 0@P0 0`P`&0 )0 e?0 @?/YP^(0@ S0`P@T $PP@P ``T$PY@T@ pTt W 000`P 0 `pVPUS 3_0P$0M PH0:L0 0``H`aPPP<$P`0S4 0S H` 0`@pp?3.QRSP㔐  P  P \?oR20S c R㔐Q OP\JR PMVs `$p(,PP00 00SrP@T0 @6$p0(,PpP S 00 0 P@T 0S00S`<`:  0 P pY 0峃P-o 0P R ,00S R00U  P3 0PW 00S*%S㔐R*0S  =6. 00q8P p<,@Pt_RSQ \`@ T& P@P ]_[_TS㔐e ``N_@ 0BP 0  0?P ` @P 8_6_Y@HH?/ ` `Sdb P_` 00\P  0 ```PPH [:P\P HHH HL0[`0L* ^P20;>(0$00PpU 0@Yᠰ @yHv대`pPUp`K|0` B  l` 0  0(TP`ph !ᤂP [P20K D Dp,0}P`K(,5H|,20[ Se S \` R` 003 Q  R0R`U`M '\[OMKIq q p p YE(m fk xj tIi $@0P0 0p0 a"0S0$0C^H@P P0U 0P8^P0U 0^0`$p(,P  Kb_.x> f8 <P1x00x0 ^w`@H`0V00L0`]Pb`O-PTMb Zi @` =1q0=>p0=~  PP` 80PE `0S S S T@)P `0S 0 0 0 0GP0 0 U  Y [ 00  [ YU,@TЍTDD?/#Z((D0/f f 8e k e l G-XMp@1|P `P@ 00  0 :|P 40S0. XЍ UP D] 0 |P 2]8 8<3P 4PPtP 0 d d O-ŸM2M 0`Q<000 Z 0Sq p@ lr < p A.=~ *u9PPh 0#S( M0P$  =E0P  @ PRP R R UP2P tP4 @ R0 @PtP $K(0K$ K$ ?P0(X PPU 00   P 0@PwP0 x0 0< 0 30ݍЍTTD0/i<<x0/_IXGc c Pa E`  `  0A-(M@ p`pPw .P @PP ϱ$0S0(ЍP` @-@ ZP 0  @0O-Ÿ 0 M* `@p1Rp! P PX  PPQ P Q0p!1 0 2 30`ߍ70@SPX /0@SZ00 0Ph c00 0 c P ZY0 Y  0P 0 Y:[ 0 0 X  R  XR P 0 ~eCBA-pP`P@ 0 I 0P 00 $b -0AL. R@O-0LMp  D@00`P840 <0T8 0 0'00# 0(<  .  " |b*. ,`Hǂ@# @!P(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0< <<8  00$00 Qꉫ#EgܺvT2hX G-PPp`4 W* 0!ᣑ000? 0"@@i>V0: 4A0iS@I"p ` *80V@@p`F G4\0P 00P  pW PW p@- ! 1 0MPP0 00@( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t T,00t 4V 4XV 4V C-<"<2 0 M000$2$"00 @00$ p P`0R   0XS 00 Q .. 0N l!\1 0 0 30 ЍQ  Aa 000C 80BS.R ^U* 00ꞐRP 0ES0 S S^*0W 0n(."4n4#00 00@^0 8< 4^*0 8<x3X32- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D 0t0|S 0 ` ` 0Gp@71@- P0 P  000<890 A><à 0 00 AЍ00 01 0 0 0@-S@ 3/@PO-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\|3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `  *  P% 0 p 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z" Z Z 0 0 0 0 0 p 0`\\ 1L0 10`ZZ- Z) Z+ 0  p 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7@: <8 7 @-@P @ %J0/0  7 p@-1!00 P@0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDL<7 ʚ;6 0  Ã0@-lPP B1!1 M@@XD0 #2 AD ( @iK  Ѝ0X6 Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2Sp 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`i(4 ;4 O-``!P@@R@@ǟ IMMčpǟT ด`D4T7NL0P@0 0 4p 0c'7 0x PT < 0P00U0<06080H060`0X06 0` 8 x@,0, 04P<0, R00S D0`1  P0 R 0 0 0R P Ti00S2x0S 468 0/Hp岀0p 0W9 X%U80 P?Ⱀ-겅  d2 02 2 |H1 \0 0 0 / hL/  x. @ . - - - - p, x+ O-lM8@p PP v0 0HjH` 0  0^`!0R(0ᴴẤ,  |&| p&M B.P  SD00 0Y0g`!R   ;`!R0  e`0  0Pa0  0 PM  P90  0P%0  0P0  0P0  0P0 0P`!RwXy PP Q< `0Y  0R  03g R 0 R  0Q(0s!g Rn 0 Ri  0Q,0sg RN RK 0 `SL 0sf`!R   80 P 0 P@0 P0 P(0, 000Z lЍ   X倂 O40@h" 40t e738" t 0e*/ &" t 0e/ 0! t e/ m ! 0t eŸMQMp SflЍ lЍ@0 o# $0 n 0 m0  0 k 0j0 i0 D* d) ) ' 4' H' ' & % H% % d% ,% $ $ $ l$ L$ ,$ $ # # @-@`00AMM0 400p00 Q=PP0S zD 80 0 4 30AލЍ.5x0,@-@ M pp P&=`PP 0SD 4 Ѝ00S.S 0S Ѝ" p@-|0|AMPt 0 ` $ 0 @P &8 00 0 4 30Aލp(Pp@-P@Q`  @Q cbPV 00pV00pp@-P@P P  ^U00p4  0t [dU00p` 0p@-S@P  \ \U00p4  0t 7dU00p  p@- P8@@T  UpT``0t dUvO"*(@0@ dp D Q@-@ ||  Q< 0 TPrH  0t ci  O 0 d   p@--@<Q  TpH\PP0t c?T"*00@ cp4  X P} @-@ P P= 2 @0R8  P@ &@Pm P.P]  P:  Pc  P P+ PH Pp P\ P HP4*$!3 (0/[c3'}{)t/h\%: $     x ` 4 $           t d @-@( P{  (0/b x x @-B.@MQ  T^4  0t bU D Mp@-8MD 0 I0P0400P@` 0 . -bT @D (I000` T0 0 40 30 8Ѝp@Ѝ/.0 L1PI$ hO-PM`@PP p0 ܣQ  ЍSq SRPP -R0  0+R0  0h30P0 00 B10 11 .R 000 @T@0✑)SQ 0R#300@0SQ #3 00R0#03!3 T$ +<0+80+40'<0'4 0)< 0)400 '( )( p 0R0p T000@0SP 0R#300@0SP #3 00R0#03!3 T   T000@0S\ 0Q#300@0S\ #3 00Q0#03 3 T h  00 Q 0N0000J00 0 0 >O-QlM@ 0 R  $ Č(Ȍ ,bH"̌ $DLbD$a!l(,2"$.,l$"a.T!20dRSN|B bD$ChbBdAAB aLƆb^fL` aBW E RnH %%SRr%/"bRlQQNT !C22c1LLJrg`\ X0Pp qN$  [X0 \ `E Z H Y K , T 0( d P0$ H 0 (!D0 0 0L0@Pp`/84`[ FZ FY }FlЍ00Cd~W㔀R@(H  @/`lЍ`Z -LY -Ό8- igMbQ      @-@P 0D .R S0@*ST .P@Q QA.@P@@?5. @-$MP`@P`\0pv> 00pp@ pp_p  /I`Pc$Ѝ C-AQ@P p` MO0P?͍0,0= 0080=͍p000\ @P48@LpHDp 0 PW )0@S2 P_P0⯭<0H0 0 0Ep 0(00H=`0= <<0@PV *0,. 0> 0;/0H=0`F$`` 0m x`d0 [ 0  p ( 0$p Y3 Y@ H= I0R# P0⯭<0H0 0 0p  R 0S .S 0S 0S00S.S=L@0@=00Sༀ@tL 0@d/ @@][ 0 p 0 D;S0f*2墏$0#8(08$0( 000@ C0 `CBZ 00P<0p0dd 5[U@ 80 pU Z8@P@0 Z}pI 0 0@pA 8;0 02,0#80B; B00a0.0 .0 V0$ V@ A80 Pp <0 0S 0D;:04H+B 0?R0S d d?/%#00<*: 0  0 30  ݍЍP0⯭<0H00 0 p@  0.p(ꠉ฀> P0⯭<0H0 0 0p0< 0@08 BP0H4 0R0IY0S ?/=00S3(@ 0dR/ pD{hZP 0 p < 0@8 BUPH=00Sc30<pd^/D{ @Z 0 pd =00`C 7x @P T T㐀 Pp` 0U0 0 FzpF 00e0T0PEo  0 lp7<0P@p8`@C 0PP( 0 Sp 0  P`=00S2@`20@DKx0df/ `Y 0 'p .P*=00CF@@LFd@R_ 0 Y 0 p  0D;d 0 Y 0 p 2 0d Y 0 p `0pVD{ -8P8 zO d0 ~Y 0  p 0SD[ =8803Y t 0p p 0DK`VD @0TF1!PDQp ` 0  PPr DD0p@D{ 0pe =00YU  0 PX=00@C+Y =00SCD`@R_d 0 Yp 0 mp9  d0 Y 0 ap- 0PU0D[q* p`zOUD[h  d0 X 0  GpD@ Pe @0TDKV:UP 0 fP=+L0T 10"3d" 01;L0==1;L020 201;L000301;L0<=1;L0L10 1;L 0  p 0D 0 S @10k`V! P  @$`U 0S @` 0V4 K 0d vX 0 p @T +A0T 10"3  01;A0==1;A020 1;A0;|P  L x 8 \ Y   p  .  * @    @  \  @ p | ====== h ` VUUU | d X p l   p  , < | =+L0T 10"3  01;L0==1;L020 201;L0L00 1 ;L>L CC+A0T !1 0014!;A>A C@1;3@ U 0 +p@ 0 < @8 BP0Dk 0PCU.ȁ@pQk@T# 1 W2 y 0d W 0 p=00S#0@0P0p"PP0p@ 2U/D{W` 0 p < @0@8 BoPH=00S}0@z0S0p@P2S/D{DpXW` 0 p{  @ ` 0Pr Pp 0 DpD{pf 0 P_ 0D0D;P 0pS 0 0PL $0D; 0tp@ < 0@8 B P60@0 0D 0d iU 0 p X <0`@8p@C 0`LPy,[ 0P pp 0 @;Ph 0 pa 0DK 0CY@J.0pD{` 0 pK 0dA/ U` 0 rp>  0 p6 0 Bcp/ .pP 0 DVp" =H{` 0 PPV *0,, 0< 09/=`F``pH{ 00 Qp } 0p E%p - P 0 D p =H`  0n PPV *0,- 0 08/=`F``H00 p ~ 0p p -P 0 Dp =H`  02 PPV *0,. 0 08/p`F=P`H0 0p n 0` Kpy i-@DK@ 0 pm =H{P 0@PcU *0,/ 0 08/=PEP_`P0 0pNH{ypE 0 p= 0 OjpT5=00S /0 S00=00S ?d0RO 0 SP 0 Fp `0 dD; 0S 0 7p  d0 S 0 +p > @0DKR .d $0w/ S 0 p'`< 0@8` BPd^ 0P p pDK, 0@,,d0v/ S 0 p H 0 PM=@0@=00S  d0]/ kS 0 p PUpDD7 1R@0`` $0@@@@=0Hp 0!Pl DW` *, <0@@ 04/D0$ pG0- p UD0HD; 0D S\ @ 0 upA 0~- <!?C0 S 0 o_pt*=00SK 0D @C@=00S 0 < @8 BP 0DK 0SQ`+C100 SrD 0 o+p@0Hk=P0 0T 0 Np "0 db/ P 0   p 0 p @RWT@ 0 p LT 2@$` 0`@T0DK: 0@ C` PP@U3U qpp@` 0T0 0 Fps 00d0U0@DF 0 pd 0 p] p_TUp 0p |pH pD@nȀ=0@帀  | ` VUUU 4 p p < 0 h , L *0 p L D x @ L P +E T0T! ##,00 !+E T--!+E TT" !" !+E TT  # !+E T,-!+E TT! " !+E T 01 ;E 0p `VDK@H@- R  MAP  ,@0@(@@; Ĝ0P Ѝ@ MM$000 1 2Ѝ/|RA-PS`/p@@W0 V:0 $4"48#80@PU 'P(0@0T0T0@DT0S$0l0 (P@ G-0pW9:P0 @4$#4T0/` 0 4$#40 @T"0 T4$#400S X0T0 $( ,0 P0@C(00A-QMp$0PS@` 0! $, (0v(`V|0Sx(0S0! , $P, (0V3100'Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$00Q (0, Ѝ 0F#P5, (` , Q/:04800XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQ 00000  0C Q700C20@?D0 %$0>0 t \ < A-Pp@HU`. T @0 x0W``W0 .pPEVp P7000 2000 S70Q00 V00gD0T 0 /$o/ ///ᨤ@-` @0 0DM p0<00 02dK0 RPd200000C0< 00 0 <0 30DЍi됗 O-d2drP0੒ 0 M 'r @rgqC8(0,B刀B$ C@$AR i!dP @`3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H{p# W0Y[0S    00000000SW 0 Xp@@ 0 DMp XW  0 M@p Y H_0$ 4 Ѝ @: %I$`T A-`pP0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 p@-M P@ ȍp k`\ p &Ho4 (0 0 8 30ލphDВPRp@- `@{PPP0 ?p@Sc00pPRp@- `@YPPP0 ?p@SA00pp@-@Q `9PPP0 ?p@jSo!00pp@-P@ZSP p@ p@ p@-@P 0PS <0S 1P B00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00pP @pP Qp@-@P PP  U 40,E0S 00p UPpp@-@P2 T 0 4. kl\ ʠ5 6} 0p0O-MP0@.p쮟#> 0S @P00 00. L0P-Q000Q0 0 00A SH ` @ a0`A L @00A S,TT Љ0A>01 0Q. pQ$ P  ( EQH 0 0@@0SЍ0S0 EQJ@(L0L00+S -Sp" 0 C R0SL(L00S 1 CR  R $^iSL +ISI NSLLP@,uP L00(S t00XS PLP0Q Q0 0q@gz T0Tpp(0$0<<01$C} Sz0 |0S%$0S| $0S~0$ %0cS0`S%0 $a@V@L| 0|e0$ pC 0pS R 0S00 0W0pMWW'r 0+  |0pWS \刁5A\ |:L*0Sh&BS5\l :%h PPP 0S T:%PRP NL J"00 RL000S 1Ѝ( T0K@Xpp$0y XRdLT 0Rs 00L0 0R 0l10BS ER. 0 ' L000L0Q P00p0L00@@ 0 0000 sP $0( S B  ?R    < (08m@P@07A0C3@0 U  0``R 0RK`FPES[\$0SVU NPV P塀PQ 0  0儀 0S P  s T7@PsPU&6AsP 0S \ (70jS k&0B0X!{[ 0> \PXq {Pq~o~ m~ k~~pP   ! 7l0d PP P d lR0(0`C 0(`S 0 B  B PPR6ag0@0ms0S 1%(0^ L 0C10 |L 0B QQL0{ (L00C Q2Q0k (pP(d Ta@`T Љ T\@}T ㉐0 CL00C [!L 00 B0C [@PX$W knS ~PU P~ P, v P}, P dpPpj(~pPPU  r\` 1@P,`'rPu [X0S46S l3rP! `3z0 !1040, Hc2`VC <0jV00S "2qP P3x[1@D0Dk6PCX 0z%z@28 0S  R yw 0|zX00 0@P!;1qP PK}I} G}E} C} 1!^z 1dz 0[!H1040 0R ER R 6p40 l@00 0lP0x LT n0@ S 0S{  0S 0% 00C?o20 0^ 1 0 zW X!#N h0#!I< ( |A5?  |P N?55?P9?L@LP@ qP L0$0CL0qPL00XL0b h0%P56BXE\0#y%y 0Q56Ut 0% 0# 1!LP00B(0 0@a`_ ER@(C`v 0@PbbP 00S0 Sv@PApg0GruW0j0 0H wypq p0S% D0$^L|R GQ@ `L` `@( 2pP"2pP 2%Sv,0Ss 0%P dPR 5"qP{0T X5F\@!$o 0@( #1 0 yW ~ 0S \3!:k cR R4R 76K0cXp\0\ 0aP 0Si0X0f0 `S80S 0SS V@TP{{ {{ { 0SK 4 x40SC>K 0 %Q6# 5# 45!l 0JlPvp0l 46%#p5\ [0n S ^X0 X 0gxVX0@SUN\ 46SI50jS\9k&PBX 0dxX00\ 46SX60kS0S0S |Ps |P\ w 0S60T kSR7SP { { {{ {p |P |P@ W 0S \ 070jSS7X0S ^5 G X% 0x 0% 0`P8 X02X0 0XS 70jS# k`Q ^! ge6C#: :X \0^X0 qH8R 006\00X0 (0 00M 0ЍDv Q":?C0CS S $4c&&0C0c2///A-P@U `0pS @ bP 0S U@Dp@-P@QPMP0 S :pSSp 0R:pp,0e0$ @fh0$ @똮 A-P`#@ T*P- P0 pPW 0P P B $$P W 0 P TC0 @<D0 @$E0 @茭 p T 0 0,@-@PDQO-^ `Pp  A@ 0S 00CS 0\V0 S  RYWppXpQpW\`\\U0 SP\pꄬ Q@-P0-r-w0-0x0005 000000S wS -S rS  0S /xS  / p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@ើ0@0T S R RT/ ?/PP/=?0PQ/?SQ 0p0@- 0/`  ??SS 0p0@- 0{/ ?S S S`/Q/AQ/Q Q/?0 @0p0@- 0YQ/?S0?/0?/ᘩ QP0 ?0/@-q 0  p@-x$P 0P0(@`` P^Y0SpS0@&N@`p@-@P`M P0ES  aЍp 8 P^^10S 0 0Z0  P p@-@PpP Q 0S Pp&0PSj&p@g&A-PPp X P@PEX `,P@`008 `p O-` MV " p@IV PP @0SV F!۩0 `F`1 Ѝ Ѝ &` - ^ x 010C. *  $    꼦 A-RP`p(M @x 0 @0@0 P0 P0` P@ 0 (Ѝ  T00 5CS /0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0p80L0  TMP0 갤 O-PM`p 0FV"S00 0\ Pѻ@P-UN +UP0+ 㙽p,"@0 P00E Qa0ESW0EA0ES70EVt PSQ @0U0 V)  `(q 0T00S0 S` 0J0 ЍS T 0P 00 0R0  Ѝr `00XS 0A0C0A PSVr `Pr `0?0 xiꙙp 00 0M0ЍX`fUO-PMp 0GW"S`@ +P-TPs +T [ ?0 0λ0 Ȼ00DP p P:Q PS \1 !ʎ\ @00D ^ a0D0SW0DA0D0S)70DS&| [YQ PS \!"00"00 0S \0F0 Ѝ[@`K ?0 0Z  0S0b 000D00 R0  Ѝ[@`f0TI W>0 p 000Dl0T00XS<@ 00DA B QR ap >` R0T1 W  0pt pp 0@`> p PPD1?0 t0p 0>00D-00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333 00 0M0Ѝ$a | 0 Q?0S @-X\-- Mo ЍЍ/G-PP`P VV 00 !PER !U6@  PG0 PU pWW@ByPp X1 00ڴ  @@pG  pÿ00ʴ  0@0 0ῴH0B0 ⧾V,C40 ➾᪴ ě A-@PrH`H0``@p F>T  R A^( p@-@P|00CS0 S  P `0 Psp>`@-@P Z 0`00@Y060 Cꜚ - M ? Ѝ0@- 0 0 MPP000@ T!   + ܾ0 0 0  p h0 0 0 30 Ѝ0H0H0 T00D0 D[l]\ Mԙ NA-pP@`' T. V5 0S 0S 0P Q 00 00 R` FQ`00`6P0\ ŽT@@p0\ ⼽V$$|0\ ⳽ a bO-ß OM4`lPP `p@dh V Vv Z.` ϯP 30 00 [ .Q Q\.Q a :0 嬯P 0X [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V 2 P00 0 ` `0 0C SA: -0  `0  %+00/00H!81 0 41 30EOߍ:[ 000$0( @,庸0 0 0 `0P P00 ZX00000 ޼C<4 1PPI U.R}  :P q Z<[[XlS WD BO-`PM@  0X0 X0_( 0P? % 000 00 P @ p \P 0 "00P > R  R 0 @`V  pWI1:pG`W:\pG`S C0 g ` Z`pGA R  0 0 Q00@ߍ R R0 S S   P} ` Q PD fP@ !T: p P@D X0P@- #[0i0 ʷZ  [` pG Ka   pG  Va ᬷXV P 0$P 䠊` `p R R R RR T * ᔩP  RPB(GP@D PT p@`V0  P% T ::`P ܸP !T014@1:q0 ▻0 0@ 0 @ 0 @0`pP`, 0@ 0@ 0  PP P 0 `@X \ $ ^@-pp10LMpP0D00@I LP0`S. @.0 rP) V) QPP0 0 0  u>P 0   0 0 0 D0 30LЍ>>PpPPP O@ kT88C?F/ BXQb Pb$Q ̍ C-`P@M: pPU, Y @@NO00嘶 0 >P0 2  0 Ѝ|@@JO @!T Ѝ=P P$$C?R/ ⮺0aP O-||ʟ UMMLō`z|ŝ`PpxU別( 0 (0S 0 S00X :0$0(0P,0 0 @[ S#p`P ,0)09 0 L5 30UUލЍ5 0 0dP0 $03/P @[:0CoᨂS  Rj  P0 `PPP0,W4'4p8#8X 05400 0 T0R?HDL@08< `\ T^*`P0 C 0`PS0 $03/PK @ Y& p@ T`0@W4<0S 0 S  R0x6P0 0S!0S H0S0P叵P0X`*\0L 0R *p  ȺH0`0LpH0 00S 0 84H0S 0, d0L P0QH RXK p p XPH `BZO[P0 0 0PS ! R  ȠLȠoQ \ V SppQPW  WX0 B@GAq 0SPSPڰP^!P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @EL0X C0 0CS`:7040$0S?0 @0&@Pe0 s V?@ҴX00`VX @`0@&``(PK S  C'SRE 0P 0`~0%P `a1V?Z/ (0SW]?Z/ O(0P04D0,0^?R0 0 @P0 8 VT D0,1Q:*,pPvP P`Po0` CR00V 84,p@PPPpZ0`P@ CR00T@୥P`@:$03/P `2,0D(`C 0T00Pu  , D00D0Du 0(4PG0 g@P0 D VH0S0P T D0,1Q<*,0P,0XLp@ 0% |   N881 0 00S000s S 04 P @,,?/ 0 9<{ `=Lz O-<<ğ DM<h@P 0 (PP `spp]0 `P ᶣP 0,0 P0ß RR RR 0 R R $0 S S 4 ␣@P  0p 00S S S@ 1U g*@ w@P 0S0 0 0R 0@B PE @ Y8:I S@@3 $噶 @ I@E Y#:  劶 U@Iq E1P@GP `p   yI  U>p#` V `pa 0  0`!L1 0 <0 30GDЍ(PPE pP 6P@V P0 0 0 0_ 0Jp `pP0 00 0 x0 00000pMRp`<y x x 9p@-M`@P ),0,0   0kЍpLIdI@-M@ $$ 9 ЍH I@-MP` @pP0P0 ɠ@0@ 0   @0PЍHH0@-P MP@T 0t  P00 000[ P 9 @ Ѝ0@TI 00@H(HHA-a@P`PM^ Ud !0  `p0S  H  0C QA0 .SNV 0  @Ѝ0 XR   9S 1 @ `F V 0  RU 8 <04 c#!$c4" 0.\0m0  U@n<0  @S 6t t O-ß3 0,MPQ0$00@` RM Pg PU0@:T000 0j Tl 0ßP P` ` @0H  P [ `VV @ZpW` p$@WH(4"<00S W0G> S0 sP d ᴴ(rJp<0p ⦳T TS / 0 !1 0 $0 30j,Ѝ!1 0 $0 30_,ЍO@:TP \p ụP :Z<V2 0S 0$ S$!, P`qIp0p ZV T T0| OUU0| G<0| @F0S ep$@r @.T`p$@WPdlPWp4s s 32q dq @- 1 0,M@P0$00P`' U- 0p0H 00000001P*  0 0 $0 30,Ѝ 0 L0h0 U0i<0 ٲP0q p0pp Pp O-HHş tMQl@p 0 R P P* / 0 $4 0 l0 300tЍTIP`<0T ⤲Tu T 0S0` ☲x<0` ⑲ 0$40(,04801@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<0000j:000@T `0> Zg 0Sg* 0CR00`:Ft"2 0 l0 30 tЍOP@PUF*0: T00S DX"H 0l 0[P3@T` 0Z00S RZ  @T0`zu YPr S 0 S P0@n Pa0SC:γ 0 Y Y Y@,!0Q 0  HP mx8 @R0PHP`0T ⥱W Tt T0` ⚱uC0< P@0 j0~ : L0@

0P000P @ P 00 0 PZ 00 jP'0S$: I y ?J0C0f9PPT 0S  0CPß01G0 AAPU0 Z 0CJ P&JPP @0P 0000 00,P0 0  0 480 0P*<\f e Xe O-P,MPp@P` T 000S000Z00$0 0PP`W0 00 @P $ 0R00SQR+X` P  >0P 0幰0  VP`P幥 [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pc z zP 0S   00S S0S S ^ S@@T000S00Ȫi0\#00% ^@ [ @@ S@ U80h0 0J0Da p@-@PP` U 00F G p 00pt060 ͮUX7<0 Į0 0@p軰0TS004a a  -M0 3/Ѝ/0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04P0 z00 s8` ` 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04h0\ C00\ <\_ <_ p@-@PP U 0S S S 0p@0/p0p@0/p40t 00t ^ ^ p@-@PP U 0S S S 0p@0/p0p@0/p40 00 ] ] 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 Ⱝ00 ⩭] \ 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 w00 p,\ & \ %0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 >00 7H[ F([ E0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044>,0Y0,dZ eDZ 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044K?G/ͬ0a0G/ƬY dY 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04iS?O/╬00O/⎬X X 0@-PP@ M T 00P00 Ѝ08080.rT q[?.iX W 0@-PP@ M T 00P00 Ѝ08080^/MT [?^/DW `W 0@-@PP M, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/00a/V hV 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044j?g/ի00g/ΫU U A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0t A0/Co<0<0m/⇫(#[?m/T chT *LT A-PPp@`M2 W8 T& P R P P P @ЍPX 00@R X ЍA|&w?q/@00q/9W>q/0 VP` Y0@SP}$q{PS 0S ^S _R p@-@PP U  ;p@8080,U ?,@R  R A-PPp@`, X2 W9 T P  R 0 R 0\A/V 0A/|| =/⼪d0d0/⵪XLL?/⬪W0?/⣪@Q  Q Q P 0A-@PMP` 0J U@ 0pS S  P R`V V V ЍW - 0SP00Ѝ W` 0SPVll>%.IT0/0%.B h Pp %{tO TO O p@-@PP U p@@ <0<0/U$ >/(#N ?N 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/ԩU ?/˩M W|M 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/⋩U ?/₩xL {XL p@-@PP U p@cD00/nU((?/ep@PL K p@-@PP U p@D0D0/NU,,?/Ep@yK dK p@-@PP U p@"D00/-U((?/$p@K J p@-@PP U p@KD0D0/ U,,?/p@8J `J @-M@P0.S00Ѝ6@-M@gp  B0?R0S Ѝ 00 0ը0CЍL 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /H0 00/L0 4# /0 48 - M ЍO-pSP$M Y p 0 pS 0S0^@x @^a \sS0  H Y B `@p p@TX @0S @S^ pZN ͥTP @`T00 S 0 Sn*p 0A>Sc B P_^p0Q ^ QC (00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00x(00@$ЍATw0S"@@A@pZ g@0Ġ?  0^0A>Sp0pSK000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/P 00@G0?Q0Shv?}/P Vw*p.Y P LP m?.PB9 p9 $9 p@- M P0 `00Fp @ !p < 40 0 1 30ލp@@  A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ@X  Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ `(000 R!  Q 0 ARL ?R@- RQ0A  RL ?R700C0(00/C/A-@P`TP% UVT P @TP 0?Sp 00(00QSp@-`@P ʋP@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1AP軤(00趤00겤?00Q @-A?SSRB 0@S A藤00蒤(00/-- M ЍЍ/@-M@ *p T ЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@P-TR +T} Y ?p"i`00D" [*SP# K@00D P a0D0SW0DA0D0S70DS| Y[SP;+0S \0J0 ЍY@0Te UGp Pa 0A0C0B QSlUPPh``?pa00Dˣ0 0R0   ЍY @~0T+ U# Pp0a00D~0T00XS"@ 00DAA PQ0Pp>cj p>cP0?0 ⓡBPp>c00DZ00XS UPpb 0N00XS UpbPPp>c 0?U0@PP0@ p>cP433 1 00 0M0Ѝ O-@SM \ YX` 0pS000!R !01 VPP E`#3`7P*Q30A 0#1#2#4#8 P 6    U 0C  pS|[P0 0@pQ 0S  ЍT 0 @0000@0  0 0/ A-@`Pp0 0@$0$ 0 M Ѝ P8p@-0 000St@@@pdddPP@P@P 0000 0 t8l8p@-P@ᕢ p@G-@`Pjtpt0plp = T  40    G) ((. - A-pP@`  @ o000@P p@-@PyPpp@O-@b@B`M@i ( RpPv r@0p RD 00m1P[ 0S` P U [@0Z P i0@[cP ^ 0`V P:Z UP4a`0pS PP @T EP 0S  3/0S 0PU@:W .0@@00˹Y Qx00p@@oЍTЍ0<0 0*0- T h65L44@ @-@!BM1M 0pPG040@@@ @@=aP`d ! R a@`@0 , P0lA@ P; P1 08!1 0 4 30>BލЍ儡P (⃡@P  4/P Q Q 0 00 00P g0 0 b @ P 0S 3/ H000P Ob<  $* 3( <0@-@PP$M U! 0 P% 0 0   0P $Ѝ0XX<0H XU<<|0H X@1X' ~' O-@PU  RM `100Xqp0S@ @@@ P ఀ $)A0PS,00a000S 000  000 000 000 OT@00044<0 Xv\' P' ,' $' ' & $& & A-pP8  0S@P$ 0 @S 0`PP0S PU @P @U000 W 0P@@ P ((<0B/X)X/.$ O-(ğlMR  0 S X 3`000Sa# 0S00 #3  04 4 0P YP|3|s|0@p 0V^ p p @QS  QN hP0 Sh @p $ 3/0  0PY@@RPm00SS" 00C0T@lЍxB0@@@d20\ 000SN  R0200(   @(,0 @p 0TTP 0S 0 @00D00@00|P 0 S PW @@(0XS,  , @0 R1 1S@X 1 0(   @(,0s6&>I/X60S XQ?I/X*@lЍE?I/X@^(  (,0J t-\d-d-8,D,,*`! b aC-LLŸ DMpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W@!1 0 0 30^ЍU00ì?dPER ?\00S T?* S 0  B1<0Q/,0A!b0\P  @1Y$0`0S00 S0 p@` ; 0Q,00\P  @ Y0`0S00 S0 p@`H; 0Q,00\P  @Y0`0S00 S[0Q!/ b !S : 0,00\P @Y0`0S00 S;p: 0Q,00\P  @Y0`0S00 Y" 0 p @d``p0 |@`t9 0Q,00 \P  @qYd0`0S00] S()Q2?0c01Q 009 00\P @0@QYD0`0S00= S8 Q00\P  @0@8Y+0`0S00$ Sd8 Q00 \P  T0@Y0`0S00 SU3PU/P7 Q00\P  @0@Y0`0S00 Sx7 0Q,00\P  @Y0`0S00 S_0 400080 0@<00\P@00D0000 0P0&  Y0 `0S00 S8 0@90@ S0 Ř Y0`0S00 S!Y@0&  `0S00 S00(&@2?2c 1 R11Aãd0Sâ/c1S0c05\P0 0fYY0`0S00R S 00  @0  p%00 S0R`05:4 0\P  0@:Y-0`0S00& S0 p@`0\PS00D4 0 0@Y0`0S00 SY@0#  `0S00 S0 p@` 0@S 0 @ +qp  wqp  0@Sn R-Q Ry0c"QÁ22"0"b0A Yh0 ^ YP ` R  \P Y0`0S00 Y0 p|@V`q0@S 1Yi I` R  ` S`\UPs 0@ST P 0P Y   R ` R  P<0`p p@x`10@ S 1h Y(0`0S00! Y  p @ lP)\(\ ףm   x   *D  t   (  <  , t  ,   ,    < nx   $IQ t  0@S 1 Y0`0S00 Yj 0  0@ P  0 P$  VR\ 0gS 0` p`! 710 0@ ! },0L!?$A1c P0 T?"dN2c 1 11N @1?2cQ  111@/ d0 S  á/c1S0c01\P0 0zYm0`0S00f S082Q0,00\P cYV0`0S00O S ` `o 0P 4 \A5C-MP@`np<0@000 08 @pT `p[pFЍU"00Ѝ@-$$@M Ѝ O- M`p@Pp뀠P 0 X0X 0 0p0 @g Ѝ@ Ѝl LO- M`p@PA|P 0 T000p 0~@9 Ѝ@ Ѝ L@-0N \0N@ T \ԘT00\˘00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q 5?T0cQ@҃01Lo 1fcf Qq P@\ |q00Ⓡ?G1c0 0@1\00C L``S0B0S0BPD@Q``@P QS5 0S l lTàn 000@002c2cPÌ 0;S0C l là0Tc\0#3S l là)\P*Qgfff$I  ף@-000 0,@ @M rЍp P A-0 000SP``0S@P 1Pp@ {P ( tT pi0 190@-mΠ0l6@NaG` 128"&.2db `3c@Ey:E.€Q_uk9"mnףp= ף Sc$IųQ\(\ , Q(\)\` c 0<0 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0 ):60 0($0(>! 0!‚!!!0C00!)aYoÏ(" ?00 #2>[?@G'PE@Gp1#! +" 10Q,U#1 ?0 25:$20 #4"".<2Q  3 #L201d0T\`"2? B4sppp0/SX0 is c 0㤏"):60 0($0"(>!!!0C"0Y)Q_("Z0%R^PVXPo`v c 0|0#&: 600+$0+.P3&1110Bh#`V :+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0B$):60 0($0!(>@$ 0‚!!!0C0`$)YÏt4(" ?00 #2>0r/D B  1?A1c 1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\\%\;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0`000&  0@00TPP@D0S0@@ @$ 0Ѝ& vc 0 ሎ'):60 0($0'(>!!!0C4'0Y<)("0,".L<0@0P<0000' 0 P<0@0P̔T 0 O-`@PpM 0S*  U 0%-> ZP9>Ÿ !"⑳<0  0  S 0 P00^00;0 S! 01P0 U 0~? UP౟ !"; 0U 0  R!h&0pP l6m&NSp@0GSH0P0 0Z0b 0S0010ƒ!100[ 0;hhPx@2[ O\1X00 1@T$ <T=0 S0S >S@ <S*S0S -S0 C Rp@0G100H 0 b9@h&lFpFtF0N  0hc@1 0 0*T@T -T00D S0@0JSn0S,S  ;S  RjH .BL Sa ,S;S\d00PU 0,SRx@PL 0SI   HLu& `h& ltp&l6g.D<$0(,P0` P`ş p%cR0#03 1d002c2c# b?0ppcW"Z  ^  R P`N |4|$cR*p$lpLP 0(,P0`p 04(p0,$p 00P#cR0#03 1d002c2c3?0  cRP c sP  RP0t#3>#!BcR*x3t3(p01c00,^00P00D#4p 8 00N  0hߐ@0@ ؐ @s 004p80R'  Z0S  |*n a\Z R `S@ʟ@ < VP@@% .[y(  W.y5:IP % ^, Ό3# qdO0RS@dyWEVPP $ ` @E`E`ȟ(ȟ垫 ,`&AOĘ.hY11:hH.B Nh, ΌT3# d S 0@W `PLH@1S\` VPE_ 0":60 0 0Ϡ!  >00Cइ 0R ?#0Ϡ 0,ό~(C1   ၢᡍ  Dǟ 0R0 pǟ0 ' ^, Όp3p#p q\ ` V PE    U6 00cP:S8;Q$0(080` Pp@`PL40#XT YW W0#Qp? 00?0S 8@<W 80<8p< 0 5/P `0Z\ QX Q~T QzP QvL Qr p0`S P Q$% Q!S, Rl0S pWg 0 SdJ1F Pe,Px` BrIX 0S@`TJ#M @A 0S7 0N080+ 0>+PW0P0姾`@EOo [*[:[$4[4*[\4$*[B@#[1 "*[$![[$ ! *[[ *[ [$Č*[[ *[$[*[ *[$ [*[W Z2\T}QR [ *[$ [$ RI SG` VD  .`,^6TF 0 FC :  0PS.`Z00æ0@T )9 F0 0 30]Fۍߍ0/S 90BQ 0R/S  5P HI@@H00`Ꚍ0@TR ZSZPQ K `@p 3N$ (,004U= 0\ 4 Q"<$1Vp+ ⁡ZF` R@!X0,`$ (004@T@M`^v  \`0\ \0$0\4 \$!?8:[ Sa0J08*S R\ R\P 8ZC5PO L| 0Wp@0P 0@E+.C E0a S`Nph@@W )P0W0 @0PY a0共`PVPP  P0/SR0/SO+P&0/Sr F`Fh QPQP Q Q@Q@QDQ PR: 像AN h(0$ 圊$ (0Nh    Q)`z@ P$ hp(0,P0 0^  4Q"<$ 1 VZ $ Q\  Zp@`$0^ ^04 ^$0^$!? $L\ Z An pd!v0S PW!@0W^0 00S -@=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``0SZ0@?`c0SPⅡQPZP }SPPA@QM0`0 RW@ 0# C !pȉ@pP(0,PF̉S n"1 R 0oS0" !0S  0H0B 0410S01 R  0S !0S RNh0偉00 000PW @0E a0`ᅱpk@1 \像B<02h% p+ܒ  @ 0 hhNA-pQ@Z 0Sl00 01ɀN  hh6l67`P`P 0:S  ?P `VpFPU N hu0PPT`VNLg@_ `S T 0:S*S+0C013ZS@Sa0CSO`P p@-4P4@P@ APp p@ * 0 00P/Ѓ t,0, 000S  p/ᨃ t1P/ ex1@-\FPN<h0(0Ѝp( @-p`Pddd@ MD@p0 #P UNLh@(@ Ѝ@@l@(@h  @-` MPp```@Da@p0 P UNLh@(@ Ѝ@@l@' p@-1!00`0S2 @P/0 00PU  0`PT p ppD` `0 `P@`@P`y tX''<&& p@-@PP H p@0i44D$ $0p@ [X&Tp@-@Q0 0PP L 0p@H44D$ $0p@ :%PdP0 0np@-@P0P44 0D 0p@ $%`@-0@`4M000$0(00 0 000D00$`00P0` `0 0pS`4Ѝ$dX@-h BR\ ZR00cS@T 0 ̌ p@-818!00@0PS4  `P:1080So" 00P ʀ0h T 0S"ZV p<02@T_V ` 0X008P H00P`0`p`u tT#l#""G-P@UH\PRp^@DtPEp`Ϡ pcWV 0 0 \V 赅T 0 T<0BT00 W0p@- 00S" P@ K`P008Q x00P  0P@T 6p 0`xP`@s t!(H! p@-`@P`P U 0 D0Pp000\ Lp@0A0 OU$BT0 F@r T(  D0@-00@S $000S 3/ (kkp@-{ TP@Tpv   03/P مxh @TpA-h0`0pP@P UP ῅P  $0p `@ djG-Pp@  ?o2W0S Z #`v% :/P@D @p@TP0F0 ̂hPGP p` 80‚Z p8HT0 ⷂ HT0ⱂ| ` , A-PP`@! ppT P `L2 @0L€00#S €^"R000 ( hh (hp@-@R`P  p@L0X (eH p@-@RP`  p@L0X (R O-PB@ Mpz?0P2ܑܱ0 P2LB TH `SW !Q L 3/L2S"P2S`% @T2 W0 R S `@T& 0RS> ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2P2SU PAU Ѝ\00P2S `@T 0400P2S`gTg0g$gfpf@feete A-`0P0Q0PP MS@P1 V7 T=p`0 80xq|q8OT@D @@`@p8P1TA`NPP0@ 0 0 1 30ލd0P0 (tVHQL0 (kiT 0 pk j ȶ -(0( 00M 00Ѝi  --8M$ 00  0 0 0~ЍЍ/i 0--M0 pЍЍ/p@-0 0@PX)w`00CS`0p S  P `X0 X PX wpXH`8i (\0\ 0 `00CS`0pS P X0X /X)h (--00 M (0 XQ ЍЍ/$h (--4 M0( 0 XYЍ Ѝ/g (G-@SpP\ 0S:X' (S" WH v0` V V,* ᧁ0p0J0 ;PM`ꗂT 0 @00 `pp`:P,0`Vp C000 v z0 0SJ 0 00|vQ40 cp0=0 \I|PD@0 O0 0CYv I| --M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-Q`PP@M8  9pP& o@P#  0P S 0p@ 0$  0, 0 (0 0 Ѝ0000@Ѝ 0owЍ00>0 8e 8Hh @-@P u 0#C@u0;0 , Rg@- p@-@QPI 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00SpsP xsP `rsP0 PW40 x 00B(0<0 nl 00$ A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!@  x0S< 0[1!r@  x0S p x0SB 0[1!T x0S, 0[1!EKPKNx0S 0[1!4 @?   x0S pT 0[1!@@@J@@#J!@ @@ 00B S01 00B 0B P$R x0S p% [1 0!0 *R# 0B Qp 00B S@ i  x0S  p q  x0S np  ;  x0SV 0[1!x0S Qp  0[1!xX0S 0[1!x0S 0[1!~xM0S 0[1!qx0S px/0S 0[1!Xx0S 0[1!K pu pn pgs R  0p 0Z  [p 1- pJ pC  x0S p6  0[1!  x0S 0[1! I x0S p J x0S 0[1! |pD uppW  ip$ bp [pI Tp)_ x0S 0[1!] x0S 0[1! , xt0S (p 0[1!oE x0S p$R_0p' p7 x10S py  0[1!@x0Sj 0[1!3x0S pXx[0S pL@ x>0S p?  0[1!  x 0S p*  0[1! pP  pC p pD {pP  0B Q^p 0B 0B P$R8 x" R 0Yp0 [1pP P P P P P P P q0 S  p  0[1p!sP n$Rp00P cP ^P Y}Pz TxPu OsPp JnPk EiPf @dPa ;_P\ 6ZPW 1UPR ,PPM 'KPH "FPC AP> <P9 7P4 2P/ - V P( &P# !x0S p  0[1!P P P P P O-@ϟoM M0Pƍ0PD L@ D0S 0P00!R !0s00d00 O 0SL   RR l D 0  , H /ܰ 0 G/@$匰` 00040h0\0 00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0 @P `r01(0`0 0EZS00PnP5   R00s D0SE P`p=*X1RRXOBX>TQ.`Czˠ0N@QPDD D,PTD0l(8   S , ,p @ 0, 0`  S 1, / +0Pr0`xf0`0,0^ 0 SrR0P0,P0#0R00S^ 0 ,P` @o x0, SL0ML0P0P pp ,P_`rnPJ@P @@P@`,e0`0,0^` 0 Sr0,0PK, `pT0SL0a`L0V@? @T~ kPP' PEUP,prp*PKz`@d` @,:9 ^ 0!S0 r0FP00,0`p40S 뀠ZL0,0PQL0U 0Su 0S@ho Jx@,0PJ P @0  0 $0@s,<`P4`` ? P&xP0 ?p 0@4 T`0rP P*U& 00E S0`0 P! 00E S P@r0PS 0r0P@PPk00s0fs0 PSR\  0SL0s0\0P00E S pp qp00B S$R0V S,L0 1,  (0, ( L0(0S0c(0@0, SL 0L Sx01:`0r PZ 0SP00RQ0r0M0pd`@P,_XpTp8p@pQP)P @tDN L pJ ^ ' D   4  | P 0 D 8 L0`,0@p0S , ,p1S0qSt0P0 P0p@@@PJ@@3```. @,: ^ 0!S0 r0Vu s0@<0\0L,@ R MRd d`00! , 0f 0dp,pG@PI0`0`a,`  : R+ 1P0 S0r0<0V ] @D`S-0`r0 @0\M sdp\`pGWdW0 0 rWPP@X0T080@01SY H008 @0 10R+ S0bB- C S!!/.(BcS0C0P0`00pBEQ0@*n0 Bv   B0 `bS00dp`Fdp`,pG,0BpGQ 0^r0P Q0` 0 0Y"( BZZlڌ0$  JZ   R Q g P JZ$0(% 0  \0 S0>0$@ R| R4 Hp8 @GT@T ڐ 0 R`@0 98TJZ2\8 Y`    d 0RM@ 0 pGWpW ڐ 0 R`p0 ,WHXXڠf$p``@HX   0R`0 S Ig0P000TB8$ ⌀@DT   0R0 S "g0P00@DT 0'0 P @ 0=S0 g0P000$/f0P00?  R pMqdppP@qH00Q@`0 S f0P000$ HLXnhP00- Rڌ  ` K[0Q0S f0P00dK[0$ 0^ 0rQjQS$0ld0Vr< 0 X0WPP@T080@0AS] ^fP@@,08 ( $PBU0Uj$p`@PEU   0R`0 S 5f0P00PEU0p+0 PP0 fS5<0 0eS$0 \ f0P00H0$ 0C`0 ;0@P0`02Sj eP@@0h 0> 00$ (  0 R ,0     d 0   0 R |@T H  4 p=S0 e0P00r0St 0rQ00e0Pk$-0  P0 S e0P00& RS {e0PH$~400NS `Ur Tn`(`0P@p0X@T@8@?@0S80Sp0pS@ @  X%n$p``@HX 0\`0S 7e0P00HX 0T0P0  [ 0   SL0, L0Ϡ 0S-0qr00@S࠳ C P@|  RT ,0P 0P0DTX  ܯ/s@  XP@@P@T 8pUT`U@ PEI@D0Q 0T8 BXX ڐ0Q@0SXppAWW 0ጀp`P@JZ   R Q d P `JZ$@0P` pT 0^p0\S0 od0P00<0$S*0$Z[ڰ-$ @⌀JZP   0R@0 S Dd0P00 07d0P$u 0D \q) 80D \ql`0`S0$6R ,0P S ,!0P, 0 P  0aS0 c0P000$S@4`X0T0@0_ 0D \9qx00CH00\yMyo\ P{8 @TX@ `""   . B Q/D;2#0/0 0 !.BϠ # *@ Qʯ  A0F,PPF# 8 `P QP Y <"N8" P8@N@8@ @ `N BP(Q B IQ/2#΂0/ 00, $!L Q. ! A0  @8PϠPB!.#uS0[0$00 <,00s<<M,dp\ ,`PpG`, @0Kj ^T ,  r0R @PmS00$. *   S ,>+7 ^ 0, Sr  &@SL0 00,pL0+>;+ ^ ,0r 0S ϠP0@SL , 0101,0p0L ,0ML   R ,0PϠ# 000SQ`', @0j ^ ,  r0R@ P\0S 8  B0S0S S0\8 TXp@4`_@@Q`U$f`$`p0P@0rXT8ne`,`S00$e` jS  ! L0 00 ,pL0S |0s  H00S00$r1S} 000QG0$S@ 00 ER0 nn"!  00Bh00?R0S= 0h Srpe@p4`_X@T@8@Pa0P$80SpH0pS0@H00$0a0P00 a0P00 SL,01L , ^j 0S r`6 @P"; ^ ,0r 0S Ϡ^Z 0S r`@Rq ,P ^. 0, Sr S , ,p@0l P}R ,0P1 fsa0P00 ?ja@0P00^ 600 0a` ` P% p ,! EQ0#^0  M50 c`!39l;a@0P00 S   L0 00 ,pL0$a0P00 010h0X@Tdp@,pGS 1(0P`p @ x0 eRppS 00C?0@S$0v4 0  Hz (z 3 z y xTs s r o m |k j D`i h f ,f >L000L0t@d@\pp$p⌀@DT4   0Rp0 S  `0P00} 0080@4`X0T0_{L000L0PS `0P00 \`!0  P@0 ?|@? Pn P0p@ 0@00BL0P00L0L ,p0L dL000 0L :L0 00rRL0 |0PL0 00rRL0 mL0PL07PXP8p\V`!0D \zmx00CH0L0LY040mo 0 0 SL0,L0 00, 0H 8 BR @® sc@`0`L0 Rr L0JL0 Rr L0A_ 0P $X  0A/\,mSm , ,p1^$ ,0r`0S@ l^w  ,R! r0j^\  ,R! r0]R7 ,P1 ^ ,0r`0S @=h > 00$ @$@L0P L0}aL0,p@L00yL0 R rL0L0 Rr L0@T PL0 Rr L0@L0 \lSP$|@0xL0 R rL0kL0PL0z0D \lx B0?V0H0D 0p 0SL0 ( L0L0 RrL0@ @ SL0,L0 0, 0! @^ 0P $|@ L0 Rr ϠL0L0 Rr ϠL0 L0PϠL0; @w4TL0 RrL0@`L0,p @ L00L0 RrL0@L0PL0L0 RrL0@ 0@00`0X0T00S* P,pP`00E SJpqp00A S$Q0!S- 10P` b SL0,L0 0, 0m 0 0 A0D 0pCS,L0`1 `0,, L00D 0p- 0SL0  L0 p,Pj@-@`P MDpa@0p0 00 0@a Ѝ A-@P`ppa0 0@paO- M4P@`p08DP $ ЍO3 0:}T.T>P.P>j`p<.<>} 0^`p 0P  05PKPE@E[ @1=1 P_ 0KD0'=010=, 0   l 0ЍOj@@C>0 SA. @0c 0c6"ш0@DX06A0D0 0S0e0$00$0 0[$0 0C$00H00k@00@COo0B SL@S0C0 < B0@R  0H 0 00@000C?o200XU 00eD 0H$$0 H0d080 0\00S400P(0Z  40S00R  x Q  RP * S0S[c$0 SR(@0S @ P6 0@0p$`@ PP. H0S@0 0R0L '  0`S)$0`0$00` 0~0d080S\0400d00d0 Pm0(0(Ѝ0P(0 @T[0 0\ P04 X0S@CN 0@6@dP$` PpP@ VU@0S^ @? pP PP !0$`@0$@ x ,00 ЍOi0d0[\9 0 1+b@!%V 9p '`@P 0`pD0S 8YP D 0 8 40@S UA 40|`0Fp8`01CXP* 0'd\  &%(@0PP`p'Pn`Pd`Ѕh Zk 7 7`p & 0 000 0PU 0( 0P dPT]`pwSd@T[6x0P0408 S00Ӣ?1  40S2 6 0P(10(@0OM(0T" 0$  0r 46U@ UA 6[ 0`pP 1P )'0 0(@ 0 (, Q0@Ѝ 5@k01 ?$B`p @5P 2@`p @P 0 0$ ` $ 0 0$0S 0SD0S40S@0S VH0SV00 `@Pp 00S0 0 0S0@ T  R 000S(0V?t 40( S 0@0 PD W > pP< P6 000 00^ `pP$ 0S$R0$$0p $0S  Rv 0070S;V 04 S` p0@ s0R \\48L20",`BPPZPW PK @0S\ R\040`(@4 P` 00S0S[ V`0S S P P(T~  0t9S 00@00C040S TPP10(@0W PP @0 0R0L 03H001c `NT ?aCoc?`(?yPD?] 'l] \ lY ?@T ?@$@ 0P(e@`00PTP@# X0p`&P 0 0`pP e0PP 0%P`#%P00[0?0Sx0P0$ @R00P B0A`p$ 0$ @R00P B@D0A$ 0#0`$@@0aZ<0`Z R0Z @0SJ |0 4018 P 2pPS@P   ! fPG @PZ(0@DT Pt9U P|PP0( 0$ V$ + 000SK0S 9Y @` pW VW  40S \0Sq K<3| `p> 0t3 \0@`0 UAx0P01 a (@4 ZC  3`p D  0 0`pP `pI0PP 0PP A10(@0:d0S x0P0B|01Po @qP0 S  0S% S  0 `pP `P  |B\W0 X-P p0S046S01::S $00$0 00 00H0@hTd`[کd| V0E0SQP@Q0a Q^ Q TZ0P P09Y ` p 1@ P0S 0S? S040 S @P @VI 0Q 0Q@ T40S `@ p0S0SdP0@S00$`@0$@>(  0S0SN0` pWe 00S0S0@QPQ0Q0( 00S0H046S0H001::S $00$0 00 00H0100@e0 S`q p|( `0 pc0S0SS(0RP0S 0S S0Z  pP \ R\040k0@90`( p0@00C04 \040D1( n00C04 P\0S9 ( 09Y @V `1 p$`@ p(0`@ p`(0 p 0d \08 40M@- M@P`e p dUT 0S*BP  d@ep Ѝ @@dep Ѝ$S eT@pe@D !460/\ /460/P@-@00 R@XP@Rp@-P`0@0R@*G0Pp@ R 0 R Vp@ 0@!|O-0@ MSX@DPa`101 0_Yq`":0 6  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ -`@0UM0@,P.0L10c 0.      ddQ$ pA  @-K@ @-@ @-p@-`P@ TP P0F R @P  c00pP P 0?0 bPA p@-@P 9^`PP  }cp0:0 qbpA -M Ѝp@-@ P` !LN_ !@Ap- M9 ЍP/D -2")2b3c1@2`M1 =ЍC@-@PPM ` p  0a Pp`Ѝ0;0 bL@  p@-0@Q r P p0 S P1 pPP   ! b@0O-`M p0D A QP *5Y @0S SnF @ 01P j P T@r   <0SY`Ѝ<0S Qn@ 0SC Y 0P  0 8 0` 0S00 000c"00 0`V [00T00SL<00 21` b ! 0V0FTP 00Q-<0S 媠  @+ TQ P@  @ ZqT  aPPl"! 0#  @ y`P 0~ 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   aV X@@pp0 `f360@p1W@:bPPO-p(M@ $0Dz\0000. 0P-Q000Q 00A S00P0 ` @ a0`A @00A S TT Љ0A0SpЍ0S0 EQ 000 00S 0@@ 4 8 S ?o2T00 0R000Tpp 0 T" =01$C   0 5[T40 S 40S4 %0dS40 D pDpW(0Sp  "WD 0PH pBW 吰 0 A0SX0QD0pLW p W0pw0000P0D S  X00SD0X00(0p 0 000 40@ 8S B @ T 0 R ?\0 0dt p0d@0P 0  p ! `0P    !`@p0P D `0 V@0\00 D@`PC0D@`\P@Q0C @D@P@T00S0S@DPE`F@0S DQʒ40SUVS0P0 P 0S0S @ ` @tpPppW= T0 R"2 VX0D S00 0@ T0 @DT`Q (`Z``Vm0 x0@9#$(0p0 0#W00S0`0/0 @PX QZP  !KPG (0S (OM[`0 P0V00C?o20S 4(48jP@ 08W1h@l0&`p P  0 P(0S5 ! 00XS" PP0Q Q3 Q000S000R , Ѝ@(p000+S -S 0  0C \0S 5 00S 1CP 8 *X=( R4iSy ;ISv NS-|@  P% 0 00$0000(S 0 00Q QN P  @( EP00<0 p0'X%% HPX@P@u吥\ "#AA  0HX 0!z0 G,pGHPX@\ p  먀 T0y0S  00S l 1 CR& 0ES  7 p8 e pg0p T$1 0 W 'X)($ HPX@P@t죟\ "#AA  0FHX 0!z0 G,pGHPX@\ p Y ,먀0000Q5 P00000000@ 8 00C PP0E @00C PP 0> @\ @7 Ta@`T ЉQQ@T ㉐T0C00C Z 00L0C Z@P!8 0 R8  b8 nS s1 8 @0 0C10 j 0T"0 0 $0aPg0D0046(q56,0!z0 G pG@iP T 1@PPk Vn 0 x00`#$P3  B\<(0Sa 00 0R0 (0 ; V瞯<2 A??% N(# 40P0 pP  DQM PJ Q 0P 0G \0P 0>P X0 0C BX0 0(0 1@PVD[" 9R 4 01a,06D0`X"4 5\ 0T"0 0 $0P? ( 0#P 0 x0x0`00cx0  0@(@ 0 D0 CeTd" 400C1 0  0PTx0 0 x0%0D05`P$DR!0000V0j (0S 0   ~\0w (!D0 00C 0yV0a!0Z0(0D @X0S@TP P(@_@ 0$ 00 0S0S AS00 (000D00P00w46|56,0!z< G pG0x06Z! 6 (0  # [  R T VZ 00K 0f 3 S 000@ P  @1Z@d@P000!00*X0D 匠S 0  0C吰0C!000 R0SP00P0000  0C吰0aPj @ O-@ 0Q@P MPP+`PO  0p$Q@  "($(!(  X"8H XA3pIqW K "8 80W#8S 0Y 0  0 Ѝ@P   ! Z.``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   33Y0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:ip O-M<0p rHJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0S{ P [ OSU 0  UE\ PN Q UP   U 0CC10B=P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0Y"00IZP0D^0[ @0 QL 0S@00S P3 4^E *@C b`P `D21 2 Q\` 00 00S@0T@DUQV`Db  218 PE x @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E SP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq hXP@"00ЍSn Sh S4 `Pb@00@0 0( 0V@ !VT 0 PeS5 0 0@0saF PeP\  0 S S S $X@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S |0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P X A-P@p` P  0 P  0 PA-P@p` P  0x P  0q P@-00x 0 00/ @A-@< RP`pn3 ^ P 0 W@0 p0U0`PEPV 0 B P @` pT  0 By Pp0U`98C- M V @PQ 0  C 0C2SzP 0 Ѝ6c @-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ @U0"S1 1  !2R / 3RS/0 00 c Ra `` 0 ` RA 880 ` R/ Tx $H A-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q K @ЍO-1!0 M000000 !1 0 0 30WЍ`pD00@0P(@0 `a U0< @( R  00     U| ^T@/P/0TD00D0 0D00D00D0 㦷0  000 D H \1A-0@`T@p Tp P. Tpp8#8S!Q*' q/ q90R0 SP aT@X@@@  000COPX@ TppPZCW@00?2  000ax̮A-P0 Qp0e S W`TUU WS\0 P@ WPUP  @P@?00@-tQ@AT# SQ ^& RT50d035DPP2 0 QAR0@LR0 ^ Q(0@&Q Q0/#0@T $%R 0@ U/02U0A Q "0Nt@D23  0R020N 0p@-ˠ Q @NT#S0^8 ^RR:10@op^0 \# QT=0d035DPP!PBU3@!A1#T2D1$!$L ! A"Np@\U /Bp@T  $%R# p@Rp^ !Lt@D2   QAU@DP PE 0@ pAR@D P ?D, O-8`4! Q [P@p M7 ^ [ R&B *p  ЍT>WP 0 [ 0:^ [>  0 R&B*`PVP3 "[0   Ѝ$>' G- PXl X` PC Xa`  P)2Q>Ϡ8 qD ?qV   @)pYP X Y  0  $Šˌ '5  ?@pY 0 X``@pW]VVA? pAAG pa2GA n2.! N3!3 a<`G-pDR凄!#ࠋ A Zb @Ġ)Q" Y A= b?ZN j? 2 B> Pb0502 0j 0J66j 0P 0 GH% Y# Q0I4 2 Q Q%0/Q  G2 0 0 10 I?z? J :> Pj<5<: 0b 0B88    2 0G-逓Š ˌ!Z #j pEAŠ"ˌW Š9 Uj U`P \0W: Z0:30Ao U^ VA(0UP Z@T6\ 0D:p `Sp241"#<  N2!@NE4!n<>"G V;4A?WN`F?` F62 f<26 0g<ǠÌ 0G>Ì Z>GT T`#0p!`3p3810 Z@ S0:\ 0* `p 8 4 G U( APF?w.?0 @2 `:1:%0 0e# 0E4#4E \1P@(` Z@0p0 \@ S0P(:0Pp 00P`\A@0p(o?Se? A! a< ! c<àŒ! E>Œ Z>C0pVl\P/P / /BR30!#11S041 #<120A#a/| P/R30!#11SP41#<120A#a$00 0A#aP / /BR03!0#1QϠH1!020 C 0c2C>`0//P P03 !0##1RD$1",!020 C cA.c00 //p@-K@T0TUo JP& 6V @DOoUB@dp~TTQ03@d5 L  000V`pp@  000pp@-@;0$SM% SR # 0 Ġ,̠ 0C,0cΠ!= ЍR h0h 0S 4#6>ЍȠ\03:045S ?S/ 1 ?S/  (1+ p@-R@;0 ? S5 RTJ JP 3H: 4Q P  BB bS^7 ;Q039:0!00C0cAT  p@0 QABAR^   pT C/o^" R p@50^p p 0D;!0ˠSA- P   \ \ RL0R :QR^\RB AA!@L,lS^ 3Q031:0!00C0c @C0$qaVp }@~@p4? 0\S00 AiQ3:0`0   0 P /45S @o/0  p0d 0S \0P 0S //Q @-P00 00 ?S/P 3# /R /45S @-45S /00 00 ?S/P 3# /R //45S @-Z45S p@-$$!!:S$&O3S%C>c0&0T @c PC22 Q 5pQ/pa1^ Qp  000pPS \  000p0C?oP20S d p̕0@-0!*P M!: %+ %U  C!A Ѝ0@c O Ѝ0P0P 0S % Ѝ04>70 -Ϡ M\Ϡ # Ѝ Ѝ-Ϡ M\Ϡ ~ Ѝ ЍG-鸒!__%!J #  Z Tp`8 0O} @JOo\B@Tj GtP0 #* @@8S*p@@4q#<p100 @CĠ+C+0ct0Ì@dZ0V R0`! #* `8SQ:P#<1` ` F:+F1+`f2fj Š'ˌejህ0 auP6`Ǧ0!03\ 3 0 Q @DA 0DGa ʯ X00 \ 0p#*0 ^0`#:4`O-d!D㣏MfF㡏(!# Y YP00 T4 @ Ѝ` Y@ ЍO0 T0#: 4#<100 CI+CA+0cY2Ci\ e kuEJaU AQ 0L22*0 20 W Q0P0Q\`0 R 3#0 \IP0 # 0!K* 01 0Q @*Ā ~  Wp`\p`Wp pp3p#^3#\` \`Vp R0P 3# `p ЍOp0H 0(P 0! #* 0(R#*0 $1Ѝ2p``R0 #* 8S6*0V 0#:$",!E0 0 C+Cba+c0a"e"kuJUa AQ 0c 0C*W0 #0!*W00#!-*%! # QP   00 / @- \ llQ  QP/> 4>70@-! # Ϡ\Q^ ^0030# P  00  k @-! # Ϡ\QP P03# ^   00  = 5A-(a(1`pP0MS3 U10AT !0S 000< @T  0S00 0Ѝ  @00D1S@0000S 000  th ; 0p@-@P0p R pPQ`00App@D `80 0QApp@̋ th0  ,0#10/!Q#8Q#4  00/Q #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P#pP   ! CJk`gP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  I  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1ǫ @P4 P1 p@T `P@T10SfP@$ 000S 0❫0☫@T 0C  pP@h0ⅫiV0S <0z ,0R0i t ptq hG-`0b@TP塢ڃ0TP$ Zp  H p0   a!  \2)R0L`0C\0030 `-pG \ `#-0P!1^$23\ *G-0@`@DTP  !1QF*32\ I*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@! H 00P0S 3 # Q0 A B  02NS bP 0 00P` A-P@Q`pE9 ` P0 T @*R0 b3ΠŒ2 ET* 2> P08 T `6 # 502,130?C-` MpP@P А'V`0Y 0 CII5` Ѝ s P `!300SY 0C@@1` Ѝ0S0/0 R /@-\ap`@PMB D1P5PP3 pP-0S  Q4 Wp 0: S-d6P  8#800@ 0$  0,  0( 0 0ЍH00Ѝ<0L0E0 FH00HO00` 8Hp@-@P <00CS00 P<pP0=0 uFD@-@P 00CS00 @0I04 ]Fp@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SH 0 p`0>0  Fp@-@P8 0S< < P00P! !' 0S 3/PP೼000P @ P G00 00`@00aa;\0`` 0p29P,080 EG 0P0 @-@P 00!R !#P 0C 0;0 E@-@P 0 0 S @U90;0 Ep@-Q@PPP 100S3 0 SQ 4000S8 0"$0 3/0P:03p00P @ P 00< R 800p40PVK9P009`0J08 5E  0@000 p+G 0 @00z <D-Ѝ/@-^@S S S  `0@ t D0@ fG 0  0@ x6@000 0 0000/<P@- 0At @F41S O- @fQM  Q 5/p0 `( "Tl @`t&`p p \ P P pd` X |< $p4  P` tP(  `!p%(),$-P,0d t415 T9 8 ċ<=0  "#&'*x+|./` 2`03X6`\7:`;Ȍ̌`><`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`4˦pd APpM_ĀmXQ 0pkPSQ 0pkPHQ 0pkP> Q 0pkP4Q 0pkP*Q 0pkP Q 0pkPPQ 0pkP YQߍYEOVEp,qQߍ/aQ@-P @41S  P aP05EA-4!@w pPP/1S 0L1~ @P!w;PPPUQPMoP gPQp ]W Dp_oRDpDpp@-@P 0@D@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V xD0@BsD@SSO-P M1 Sz$aVp$q( qSSp A`TR X`D (1 Sʃ P `0(q\ 0} P@  Ѝ Co$B/갰[" (hr ^ P `岰VH$8 S pV pGpK(VJ (1 $ AT$$( 0 [ `( A^% \ :0  . @PC@@,A 0 S$1N(!r5 V(* T$$H0 $A(1 [$9((~ 0Q0 0 $A0 $ 1@(!$AV 0 $A(\ 0 vqP_ Qp{`$aV\O-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 oPPu2  $`pP$`  0 _`P% 0@SP㲀0C  P\ \1 \"  gP  0 kPp@`@@,Ѝ 0 jP@ @ †Ằ[ PಐU 0I   gP(A0DS V(Q  0oP 0 @-@ ! \ @$B,B00,1S@-@0@ B00,1R@-@1  @0B,B ,!O-`ᴙ0S ]M> pPwᗣ@P Uq  @| bBP 0  p4 < pɟ00 8p4  D@@ @ PXP )V P0pS40X W!3^ XL ^^@4<P3  uD H 0$ hP 02 KA<,0(  Q PV\^ FP  0p pt 0} V( 0S% A/ 1++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^ز  9/@P OP@P]ߍŸ 0( P p1DN90  !NtVr QU0 aPP$4Q$删Pd q!Qq@A0 ` 0 `]ߍ\@ X@QsS@ R2 < p 800p4  D>@ >3@00& Z (@ %@@Pp!@Pm@P@PcS0a@@ @@\lf Ta``O-(P`P10p5fS@(Pp6 R ؑP. ( ,0[ D`D` S`1 005,`5Ohꂡ ןP ر % Jw> ؑ@-@ 13/, (Q0@-@Q /00 2? 0 O-fMS` $ [pW 00.>0S*>0` W-P  Q-`P pW010!! 0 p< . .F>O00000 0000%-0$L00JPdd0 ,;w?q尀Z <80b1*@-@`pQPM -00U' `P$ 0S r?(p0 8" 2 pЍ -Ѝp -Ѝ=00p 2/A-Q@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   8< 0   '  P       P  0    V/ 000   0 0   0 0   00   00 0ЍR 0B8#8` `0#0BR0PP      VЍ40b0 $: 0(0S"( S:ꤪ 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 1y80b0 $71 ?#rt8p@-@PQQp "P 0 0$#Q "P 0 0#ppO-P,a V0Fn  1|"@P" `Vp0ഀ0 0 pu 10CS08#8*S0SX PP 1b0 $0  H 1 Fp(8V㴠(1!p 0 R 0 1Spp10CS㣰7*0K8#8S  C("( 0 S0081#810W10C1 " R \P  0! 0 :P" }"0b0 $i0XO-Pp@QM h"00 2~T T Q200Ѝ(  @j ꀧ0 0$00 ? `PW  R U8#8Y* )P 0Pj1 "0C @iT㴐: 0 b08#8Y:Aᴐ@DT@* 0H$H @DOoS0CB0  0wp@ 0S0C@0  P 10CS0R*8#8STP@ [!pP 10CS0*8#8SE 1 E1@0CS0 *8#8S"P !g !bTr*H$HTtPW 20 2Ѝ4b0 $/T !4b0 $/ !T` !0 0 P*  0SB @D `S: Z s!q,`W@ H$H@DXG c!qWo 0G 1 P AᴀW@DT@:b0 $>/p3b0 $7/ @! ;!  pPZPz 3b0 $/02b0 $/D@W1@ H$H @01p 1 0@1@p01! z P@ Iy0  j P 0 r@T 5 T/000 `   Pu ,` 0R @T  뼁VpD  뼁0V$ p0H 1) PT XR  B1 * 崠W0pG1 $!0IpG*0w崠1 加1 0 P* 10CS㣐:\0b0 $o.  w P갂 h~ ~~p{@-@PM 0 0 P Ѝ050 F.{O-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ a P 000H"<2 0 4 30Jލ Ѝ >@0X0 0UXS 00; Is0, T:)[' P0K/S  0F0P00: S /000S0I S/?00 1X0 -QP@PV# 4- 㺴p!/0SY  \0 RK Y P/00W p zP /@oo G \zXy@yR Q0P:Q0Q:x.@-@-@@ᡐ $ @ @ p@-@P#*P$  p@践 0@-@T M 000 @P 0S  Ѝwb@ O-@0dM\`P T0 `%. \$.\p @p.\0  (0.\` D` .\ ,.\ 0.\@ H@-\ 4- \8-\ <- \P LP-`` ( \40 0  0< ,@8p$0P` " P% 0#0b0ea8` . p'gH, alngx+b(*gLb0`l$`&eX)0n, fe l c8(쬊cfj!g|*g̉b,, bH ,l*l$gx" fb(*錈gl* e\(e!c<+ci eX(eni!c8+bLc fj$n Yc-!  \  6-!  \  /-$ \  '-@ \  -( \  -D \  -,  \  -0 \  $-H( \  ,04, \  ,80 \  ,< 4 \  ,L  \ 8 ,P0 0< \0,dЍ2-bynd 3te kexpa0@-\M @ RTP`p000 0@  , 4,@ W P H0 0 T0 30 \Ѝ(( 0, <+  q7O- `@<1<M0`0p (8P@)   000 0@p' R$ X |  h  L,  < 40 0 0 30Ѝ{] p @-pQpP`MD=f0S7 (@P PUЍ Ѝf0S" 4p1#'p+0 00  0p@  ap Tp@@ePU  @ P܎CՎ$ +@< 04 0O-ŸlM `d000 00A0PEY!0 B"3*S*@p? e: Rs:0KY 0%Y*[V 0@0 oT0@0@0T@PZ0&Yd!1 0 d0 30]lЍxx0 <}*$@ J00 00t+[0Z A 0S$@ 010 0S0000X+@  Z 0$@h0 <C* T:0KY 0Y ``0 <3*0KY 0Y[$@k  lkk O-$Ÿ$2 M0p@`000 刀 * !0  S P [  @ 㔑?P N^艐     P@PF *Z3 Z0  D 0F 7P  P 00e @@gP0 f0`00d X (0 0 0 30Ѝ jxji|,  0@- 04M 0P0,00D @T d 0T T H0 0 ,0 304Ѝ0$ ꎌ @ < A-$!$1 0HM Q0D00@P ` @vT( 0Tl ` fV p 0V  T h X0 0 D0 30 HЍ$ $ >L t 0 C- 0 04MP`0,003&`@ "pW:T p 0T &T H0 0 ,0 304Ѝ$    0@- 0 ,M0 0$00 @ P+T ` 0T P D0 0 $0 30,Ѝ0$ TӋ P L @- 0 0,MPQ0$00` X p@ T 0T p d0 0 $0 30,ЍHV?Z/<m($ ꚋ   xdA-@P` A!8M11!X 0 P 0p0S   L Ƞ,Ƞ PU00  000 0=ЍS)!1 0C8##Ȅ00P ` /0  ) P 0 0 0YO-qpGW@t*8#811 PaP`Fp`5 VM*X%XPpCx0'0岑ᶑ PaP`F ` VC*X%X'X00 000 0 OVh&h7*V 00("(RP:Vh&h *V  8#8SP:1bL0d p'|bL0d p'1\bL0d p'@bL0d p'$0$0 $|'$ccbbbO-4M 01X0CSPᰐ0-*A0@D8@808#8T0)*0S6 H$H0Dp@` 040 $ ,P(0Y P P0ES0001P0P0PYo 0V 0@  `P9hU&hj*P0H$HS0SZ 000pxV'x:@@T,P*8#8!01(0  0R 1 S0"8!#8!1!V 0 0C01ő YX0X 0Ӂ 0C00 V* S 0P0@Pr V@ HB$HQ01Y00 0(0"(Sl* 0Vi YPU:( $0$&01 P0P P P k01P0 P0P a\P   Ƞ,Ƞ` @ h0&h@HV$H@TH*8#8  Y !08#808 #814Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx'x@@T,P>:0 $=&600 $3&hbL0d p+&L0 $#&`0pWlaa_]]`]@]C-Mp`@P&  PP!  00 000 0` Ƞ,Ƞ0@@!! 0 040000 00q@PЍЍO-M@ p8PPO 01 0 0 0رR 0ⲱ 0 1`0CS㣰H* 8#8V: ر `PF 01 00 00Q00岱000 'P 0 0<0 00!p&Vp@PЍpЍ 0p!0@P,bL0d pp% xtZO-\M`0儀pS:@0< Pတ(0$  r@T X=*1 #0C8 #  a#Ȅ 0 Q 0L 0<S@@ a,^p  8 00t8,000F 1Pc `V 0`h0 &h0CcS00 p㰑1 0CS&*0S 00$ (0pO `VO 00 0 00CS001!R p0p  0  00!0VS00 IY㩐* )ቐ1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 !0 B(S"8110  p"      0<00@pS- 0S 2  0 y   a0S @ M3@ 00 ,w 0 S<@p  ` \ X\Ѝ3<S00 01040封HX㨀*004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H 4(0 岁ᴁqpGpWx'x*W 0 08#8S:00T#( IY㩐i* 8#8V * ("( B``F  001`01]p@   @  Z`V<@p "  p D$D P 0 0 0각HX㨀d*(ሀ10406각HX㨀P*(ሀ1040RbL0d pc# 2  0+ Y*C@P00,bL0d pH# bL0d p@#0bL0d p8#IbL0d p0#pybL0d p$# 0!UbL0d p#hbL0d p#Lq0 $ #@pKTXY@RQQQtQDQQPPO-@`PşM ,p00 q p jPK 10C0XS%X:*U2 @ PHX$HU px'x p 륰PPE0X 0#0!01p0 P T pDx'x 0l0p b$"0  0Ѝ 2 p TQ\@10CSP*8#8TQ 0 0@Ѝ P  ᴡi PP r0㼡 W0 8 #80CR _뼡P W 0J 1P 0ZK[0嫰:2b0 $9" 2 p @ P 10CS@d*0D@ 1 PPF %0㼡 W0 E@ZTk 뼡0 W P0J 1P _1b0 $!1@DHPE$H up@! @10p  _P 10CS@: B01b0 $!A  ?0b0 $!0pPEu0) 1 01p01 &P0@D1 H$H @U0PE10Z!08#80 !PQxN`ML|LR0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P , D"@ (! 0"JO-@2 (P0 $Mp\0$ 0 @`0 @` pP "l(,"$l$"0 g  Z  &e .e  x10\0@0 ` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 000000 00 0 0 00 000 000 00$ЍJtI 0G-1?p@P` @g(X, ! 0P0 0$0@`F0($0`7#?V@F?p@pp+ 0$ <@P U 0$ ?@PP?`V (S! 0$ a0 0$ ?V@F?@(p@ @! 0$ <@P U 0$ ?`@?V PC-@PP M) $ap:?`V&7 ) `0(0 `!W``paa8!#4a4# 0!Y@h  ЍC  08R(@R )`@ b (`8  )`8 b (`R @-G/ @-@-@P 0  @ (v 0"DR @-(/w @-@-@P 4@  PV 0$$`DO-,6TM0^_~?40H0800؁p @P,0,$4 (8 H`D <P0`<p P 0`p 0, $0@0,`P p @P`p(0 8W l00$Ǡ$97Ɍ,%%97.0$ 0;4,; 4.0*0&.0"0( 0'   "0, Ϡ'& .*̠Ì !  ,  , 00$0 40(0[0340~?00<@ P0    ,   @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&  B+7/P  7/Py 0 S 0SN 0#10S0S0壀S0嘣# 0 0 X BuPS0P1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 B  7/P P0P0Sz,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 "P 0 C07/PH 7/PP@7/P 7/P7/Pm  7/P e0@S@4 ' 7/Pf  7/PO0 00@哩)YP `c⃰Z}* P  Ut@P 7/PlY Y   0 T0 0#0Q0 4mL0 (0l0 (P 0 -0 M0 Ѝ8R Q0P:Q0Q:t@-鱬A- 4PS@M  $3/0dp  QP00 Zr4P4S  $3/000Ѝ900A- 4dpV:@T@T 0P0 S  00 S  0;r@P0`0dp@A A-`M px@P0: StrPP ˅P@ P 0 d tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0u@먟 ( 0@-SN 00AS 0rO-4 MS|@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0     Ѝ P@ 0 QP300 ?q$R P1)00@000dS0  pq0Vp 0  $6/ Ѝ 00 Ѝ00O000Q 000A/0@-S@  R   0 >r0S9rp@-@PT @T 0 `pp@T̔P`p  0S S/P/$(0#   @// / ////@-P0S`@M:Q !S@Ѝ0 0p{ P G @xЍdT 0 @00O-PP X 0SL K 0SH p@ap-[0T B,B R`  0S7*V5* 6000P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D0(PQQ  4  D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:p0P 00``F0``G  0Y0C00 00dP  s 0 0C0 ` i 000NP nX0G0 W X<H<0 N L00]H 00Yp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0Z0  80p@-PP0 @`v p@ 0@0, Po @op̔ R0  R/ S/p@-Q@PP9 100S 0  R 0   p+  0R0x0  0 0c00 P @P p0 0 $0 $0<0  p <|@-$aPP`p@M* W0 T7 p   P0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0d00 V WH<0 M T(L0 D Ē C-"2 R0lM@PP0d00= 0 C 00  P"D2 0 d0 30lЍ 0`0S$ pm0PR ! WP00_0pS p 3PP0001|0`  0Sh$p@l ᕉPC @10F L010/R 0 p 00 0SP ` 000p p00` ppX0`  xPا뀑 l ( H p@-@0MPm00TanV( n0T1S On0T1Sn0`n 00UTX!\!R Ѝp@m\!n00Ѝp@m00UX\! X\!0 000S/긍 tp@-0 00PUp@0fm00TQhnU0` TQUP ZmpX1P0X1Wn0T0`X1ꈍ th0h 000S/@-@0?m0X10CSX1 @6mT1Om0@/m t0 000S/gp t0 000S/p@-P@0mU0 \AQ\ X10CSX1 p@m`n0T1O_m0p@lH t-X X0 04M 0,008 00 0 ,0 304Ѝ뜋 t p@-@QP  p@&090  t,@O-M8@0 p 000Dl0T00XS<@ 00DA B QR ap >` R0T1 W  0pt pp 0@`> p PPD1?0 $:0p 0>00D-00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333800 0M0Ѝ< 0@-PPM @0  㤍P 8 ,0 0 0 30Ѝ08 \ H0 S8 0 / 00 @-\ 0 S 0,/00(@-`H0 S8 0 / 004@-~  0 S 0,/00<@-H0 S8 0  / 00H@-o~ h0 S 0, /00P@-[H0 S8 0 / 00\@-Fp} 0 S 0,/00d@-2tH0 S8 0 / 00p@-|  0 S 0,/00x@- H0 S8 0 / 00@-(| |0 S 0,/00@-,H0 S8 0 / 00@-{ 0 S 0,/00@-H0 S8 0  / 00@-z 40 S 0, /00@-H0 S8 0 / 00@-y08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000h ! / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@R`P R U  V  R 0 p00 (lQRp@-`P@ 0S0 0 0R0  0pP0l (R S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00҈҈00̈ Έ4 ,0 0 0 30Ѝue e - BMMRč d X @ P   P1   @e 0@- @-||Ÿxr M Mp$ȍP|`@M TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p0\ @p ] 㔆0 xQBnP`.d0a/ofH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00De0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@Ḇ@踆0 00/ ] 0-$0$0 0M 0孆Ѝ\ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/\ t@-@p@-0@ ,ppPU0Ppxcdc//////h //1O-0pPW`,M y n1 0 0  (05/,Ѝ|@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+ 00 0 0 00hT0 0W0H00 0O{@ddDd@ddccxcdch//O-̟ M 00P0Q0S Y [00<,0 0$00  00%SS   SP p  04 HZR X< 0 `P,0 ,@ S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V*  0BS0C [ ʄ0S*0 H0 H RE  `  \ rSe{- R@0%%%!:0Z0Ņ% 0C` RxZ%dȅP  dV0  d/*00  D@D P `pnpk@ph  0  ` 0P0,@, m *XJ 0 H R 0R0100 H R ?H|D P@T S 0[ P0  BS0 P cP0 `C> p(x $ p SPSP` p@0 0P  Q < Z* 0[ʅ Q  BR B0 [ʄ R* 0F ?   0lX pp|    Sp!\{0S P`@0 0P  Q Z 5 4px,  Sy@ 0  d0R\ @RC0?T0S PA`B 0Se     +  dpa R  [{X,}  * ( S ǣp@ "".!d  `,  b S       R!0P0000p@P`00@  BR B R$ R) Z 04 0D Tu  BR B  [ʄ R* R[ [ R   RR R k     x  BR B8`0P0@00 Z0J0#2 0 0 30Ѝ    0  D @A 4       [  { 0 Rz*; P0C C   @.   +  @ ("(   "@ (B(pp-DA@  @("(    ]v(0D T)Y|0D T *@(  ' 0 ? p T0 0 FHpZY O @hA-|@P@ `l0pP@PU J0S 8/`PEuX@pW0:0 TL xT 0SS S  0R @-<o/ 0R0@o/O-,,@CM Mp4čP`0@  0 @0 44 30,Cލ Ѝ 00 00p0 `0pP `x0 h 0p-yL+  ^ 0^/ꤖP090Z?L0/ 00 ,   F  }PP. U<(0 0R0K `1  0 l90 X0L80Z   80:080:$ 00 0 SL@0b0!0|刀?A9c!g}P g0S c@a0 P \0`ȟ-  ,80P80I Q"  (<  0 0P _R`1  0 70PX0 800 00   1 01 080<`0 0(|P& I 0 PU `1 p 0 60X0 ^80]0 M 00 T`6PL0&0@@ 0 Xu@1Q 00U0pI} M 0W 0@`vQ@  ˆ20W000QP M  0 0vp1000P w 0 H5@X0 M0HP80 |P0D x@v0 P [0ğR/0  B (0d0080[08lğK/0d @u0W 0ʤG0 +S .0CS?>P<0 @e6@ 0@.0Pf)P AQPRn `1SC 0    R 0H080n |P8R6`!!! Q2   30 @| X0X  0H R; 9 qW *`xR|@P 0p t@7/P0 80k`V q0 <2@X0 ~40`!02 @XUttP S0 \01S@ 3`0`00S S````P13 u`0 |P00 `{P101<0@PD WLhP p0< (00 >{<00PP00 P 㸠D-E E   ,A @0Cp$|ܺp,<|HP(l8( TP B("(R D ${P(0d0%P#0@@ d06SV `s KXpV0H0("( D0 P TP B("(R D zP0d0@0P sZ|0` 0S\(0 0RS 0`1 u 0 10XP 0:X0   s bJZ0 0d @ts PD 0 <2 X@l0rZ0   N }{H0Sp=00aZ00  dFsh0|p { G0("(0R D0 P T B("(R D  R,#fzPʈil AZ0@ 0 |P`P 41011S1 H000 30 X0/0 4(@X@" 0cZ0   <0d0%d000 x4 X000`n0d0 @ 0P Y0 08 (0d0`0d00` `0 x; 0+S .0CS&@0P `Y0X XY%00 dr05 @XwrP0 @x 7Y0&008X dark/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@~zP$Ѝ0 zP 0"c110$Ѝ000$Ѝ00@-$MP@YzP$Ѝ0 dzP 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  0/@A#b@0 Ѝ/MbO-@44ß CMM,čßS1 PXd ,p0$P0000 0  p 0p v P<QP0\400F PJ0T0= !8 S000 $0<c\40 ; P0 0000 ; PP` P0. .I l10,430RCލЍS! I 0S0Q7 Q1 Q+ I    `   4.48#804"4| $,$8(|#8"(4pHHHU , $@ @D* T8C-XXPAM M č@`p04$ R6 p!0 @` o P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @H noD opH(  ' P0O-AM⨑ M  čRxpPLpA@PF \pPPB t @+0d1P7 0S4 `  0S+ 00@ p$P00@S 0S0S 00@ @K @ zU @> :@ ,0 0 4 30AލЍz ' ' % O-ß CMM`,čPp@X\@G0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00 0 00P00S !  @D DR0$0 0s<  BG80 tP0 1 00S|z0000   Rl@00S}0000 q 0s0S0S GvGꆌH% # O-p0ß\M P@`iT V  0 #à  #4 :4 4U@ 0W 0 P 0FSX0 0 0 FFP0x 'xFF0SUPPm   B RX00 0 BEP FFF PHFUTѺ7H10 B ( 0  m0 `F 0S0   F F F0 |F0S   <PHUT0XU `$0@ P\Ѝ<P0\ЍPHUTt! D,hC-@0 Mp`P(1@D T@C)9F0X 1F0 ' 'F $F @4"40(4"< U @D0T00S  Ѝ\xLL$0 P( Ѝ,@ТG-@P` p崒Ḃ. F0S@`>0WV!: E@E @,0G?o`D2V0S ?V0*G `DE0?U0S XHH$0 P,,0 P`긡A|=(0`( "4`43Z1S//O-0 MP䑐 0S2 @s胟p$` S S0  P$  <P- XPC  tP-0V S0  SR 0  SRS ЍPd1 00d1 ,ylP0 Hml }P wP060 P0 dQl aP  [P090  |WP``UW@0SP  P  PO-@ ;_MM0+ 0: 0P050WC0XU 0 M01+`,: 05p d!  d!. 0`1q1110NPP~  ʟ ~0ʏ Wό d10 d1 YKP& `P vP`0DPS_H N p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000008jP >000{o0p+0+P 1#S;S 0x(S$ 0l(So 0`(S@ 0T(S 0H(S0 88R00sS1 S S(0 n/ 7R1 S S0S00 S S SS@@ `0 O_A_w0P@00Q"0A'A+S}? H7R1 S S00R00S 0P0 S S00  e@@0S S| 0p @ @@@@@800sOg/0050&i 0GbPd,P R`P 0e,P 0R@m\2@L0d!S 0 0 2d1p< QSq|81|rp @ όp0`0S W`0`SHPDHp .Sp0SWP`.[pGWV0 0TPP /Q0$00x4 0 5 30_ލЍ4 Rq W W Zt$  k?00$` `P k V V` VV00;V0SJ`V 4 @0p ;V  00@`V  PP 00P 0 Qh!P ``V;V \# 0 00@`V;V  00P 0 Zl` $`| 2R1 S S0Sq00 S S SS@@f `P N _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ0000045{_P.rP `N0!x3!|3p\aDP` DQ }o+hQ(z`,JP 0 Qh!- =pPB-6j`P@8pY 2 @P'(  Ԙ domasearnamesortoptioninertt listchp@-!1 P@hlHM QP T 000HЍpp Qx#r c,qV p 0 xT00oPT $000HЍpA-P RP@p0`  R  @P  R0`\ R ]0 X0O-0PQMp 0 LL40Hh0P0 `MJ0P0 0@($      2P dPX" RM  0!#X㴠`Fe 0PP P dP R X@00PU% 0  0 `F@YP) $@  Q PX `F #Z Y 0 &L00`Qߍ @$ 0P PEQ*0$ 010 $]  囡 ` 0 Q0 :0 AQ1 :PACⴐ R PZPK $ 2 Y  wTP P K) ( p  k0 IQX P p Z p  JX  0 KJ 0 0 0 Ky0 0 rꄎx @-@0@ 0@P @($$00HfT  @-$0$ 0@P 00 00/ጲ @-@P @(00Hf`T @-@P00p@-@PP  P  0 p|L0X $Ԉp@-@PPM0  0`   00HfPP0 ;P  0P᧠  0 Ѝp០Ѝp  0 Ѝp L0h $ꄈx ؇@-dA`P@ MI T!T1 PQ0 Pp 0 RpGS( `hGp; ЍA@D@cP 0bP 0S@ R bP@0 DL  M Ѝp0 L `M ЍH00 >00 @(܇h<0A-0PU" 0U"0PUP!q@@``FIP $IP 0!E`1$(`P 02~P''0O-F帖@ MR ,0004 6P0$ (0xfxvx`{np`S8 X&Q !GT@ d(!< ,&0C S00 60< (  A0dP@A <8@P( 4<0P(0P{ PQE@40Sf0S h 4 0Sm87S H% 4 0S4E@00S S504 RT 4 ,00,000S4ğ0 @( 0TA4*02P10S P1p1 S^ h40( \40 0Sp @4@$0 T(81P(6VrP0440^ 30(P PЍpAR 0Q*# 0T@!6# 40(P8@@P(0&1pRv4"0# <*Ȝ1\ \0X 0T:p @( 2<01P6(P_4*20(  20< (  l20< (  X20< ( D20< ( 0200 ( 208  ( 0 0(0 (  10 ( ̡ (0( 10( 0Q0001刡0 0 0 0p10 Fp ( 4PЍ>p M9p  u p\TmpP/ 0. S 00KL `K` lPd@( L<lPȁD0p\@@x\O-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 ЍP4@0@-(0 $0 vcu` (A-@@`V 0 CQPq&GP pG UPFP 0`0 \@-@00 R \\  $0!0D0 0@ ($ T\@-@PL  0S  T0S@GG@GP/0-` 00 0Q,000 P0($0 8p@-@P!0`H P 0(S  1T  0 $000 `pp@-`0PE@P P EP 00p C) A- 0@S  P p00  ( $ 8PP(p`P0+O- ,0S 4Ms 0 +娫   / +~` P @l+0`{p^/  L[@P^_@@ T@ } @Q0 :Q , @T  :R^@Z :0 Z:P00<0 0Px` `@ 00H4S   !d$R; PSu00,0Q090( RC 900 RB ) 0S  Q )0 0($kIj@(p` 0\90 4 R B<ɟ  B QR 90  P`0N( ( ( X 0 80P ` I H4Ѝ8 0N`P P @h8p0 00  H( 00Dw0DS:$8B0`800H@004  P`0 0 0H0C 0 1 ,Pp$p$p(,(\y*ppQq(pW pA$pW P$G@X@`A$ppW0@  ^(0 1,P1 @P(@ @(`P, P  DP P  BR \`A$Nf0@(`P,  P1#0S0 0 PPp`@(( |p( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000%4000C?00s( $0:D$00( P A ,P$ppT (0$0 1000@`p $P1(P$@ `P@` p$0 W$000\KW 30$1,k, X0, 02$@0@(P (n`P I R-EP( 01 (0s_PP$ 0 1(P$@;0 (P$@$10$)QNSIKE 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `{@ @0`/V@| Ā<( 8(~T |{\|whwTw$wwv\v@-@P  0Q ^  00$0000 0@ ($ $p@-l@@`VpPPp0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0MA@P  0 p"PP``p`@ Y`sA-p`@-APP T  0 000P    A _=Hs4s@-@@0/< 00(/000/004/00/00/ܑ 00(/000/008/008/xA-``PU 0AP p[pM0APC404 0 ,(0` @BB/-@@ <0 Mb00a.DE Ѝlq @-@P 0`00@050 p( DD>I/,,I/D0 XSq4S}Su 0A-% !@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A~pPQ?U/0RW0O- @ştMTP @p0P(0q 0  P4 i (H0$H 000 00P000SFH00@0 ` 0\ D@ ) ๼  I Ა@ `Rڴ R  D@D і0I ȠP,Ƞ  BHL  (@(04P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT0@:0@I@00ഐ0, ~0P,0 R 80S* 80 <0,080 R4*Q^P0@00Q0 00 RPP ` 000@H$HQ<08#80 ᳠Z100S B CX TP\50S$0Q0 00 R 0P 0R 0 $0t 000 PkQ0b80S 880,0`00 0 0 0P)d0S 0% `P0U$0 h0`S,0 80q0B8#8 Y0@0:0 I 0( Pഐ0004 000tЍ( 0,0 800<0S80StB,0h800 <0HLUY?]/e0,=.\0LL(LO- @\T @0`S0P p@D%P 7 g6P( [  8#8R40  E 0(10S0 1$10$10 0S0YP 0 P0S 0IP  00S 1$10$100O-MYP@000X00 ``FV*:S 1 !* `p pGx'x  0 F pF000H00 B 00p0@000 ``FVA*hY&hI V `!0p pGx'x º0I`h&h08#8አG0Zp01`*0ಠ0`0p00rPP Y```0S0`0Fyp0 ,x0p0 ,ohY0&h0``FVr*hX&h\ 88 p0 0 00000``FVS*hX&hD Vp1p!8#8 R0C8#8p  ` `Fh&hL0Hpx'x08#8ቐF0Y`01p *0ಐ0X0`0p0 00PP @00S.0`0FDЍЍ 0 ,0p0 ,p0 ,heT0 ,0Dkh`40b0 ,8JJIIHGGGG-p`P@ S  R0 U@ T8 P X0SJ0SQ 0R0Ӳ00ô00 00A8#8R0 BY001 *("(00 000oUU800C80t 剐BY001*\ ZHHp0 ,b 0R0ಐ0CSEO- R P0@ B( * R(-W ṯ0P P I$ r@P! 0R  B( *Z`pV Z@  P@@p@-P@ 0^\ ^ P0Q3 Pp\ p pG-@` 0PS 0S  0 Q@PS" 00S ᲀ\: 0 BS P> 0 \P   00(!S$! 10$1P0 P @p0弐ᲀ 0Ap 0 S ॸ10 B\x ἐ'xP  $1 0$1(!s00O- @T @0`0CS0P@D p M!P 4 3P' 0 0  dP 8#8R0 W Ѝ0 0S0uP 0 0P(000@- M@ P p10 Ѝ0O-@pM 0 0p`Hpb K P PM0STD0Z 00 @ @ 0 pWM0 @  pG W0G*0@p 0@000S p0C8p#8W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 P0 ,x0 ,0 pLLp0 ,44p0 ,}0>f>l>}L>G-Ÿw?`0 0MR,@pq2SP:0JSM P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00CL1!0C8 !# 刀#(;  20 2%4!,1 0 ,0 30B0Ѝ 6P1 ZP崀 Z (0 p剩P202 ◶p 000 $  ` 0} 4p $0b0 $lL  h<A-@pPQ`M 00 2   Q Y:1Q|ö0" B\1"0001 0 VA00PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " 6ЍU00Ѝ0PU Q:(0 $P0PU`PH0P   1P 21 z2;@-0 -M Tl lP 0PS @P000S 3/ TV؜ 8 80 $0Q/ $0S/4N X l9<<0 0R/$ 0S/M  t09A-@T 0SAYp`/XP0P@QD 0 <pMP 0A/PtH&O-@$Mp*^L3T|$;pp4pD0q$4SO 0! 0  0TpC(zBP b0@S3S10 3 ,3 3$$ 3$ $ 3  3$$ 3$ x3($ h3$,$`== D3$"D @L$Ѝ $40$0($0,$0$0 S3000`V" YP  2RCLPP2&C*0 p00ShP\R0 p0 00CS0z 8p`  RF(4S VZ  4S8 0V0$R0S  L6@) 0@ D*000`006@FU0`00 ᶆ 4S ! DuL6@ 4S $Xp ` V V ,4S ^Xp IXp4S VMXp -Xp `000 ^Xp V?@0`Xj.aH&<& -&/H&&T&,O-@PMp`P\H 2 @@00,3,#7p: RPGP P X f0@3 hP>  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  xPPXPPqT! ]]`P "  HPP* vP0SQ t_xYPdqP3Tp`@ 8Nx%,1 B R 0S ᣫV X \ 0S X  R 7/P  R )$ %2 $ 2 \ YFH<&w-H&PDo^xO-yMP[ 10`Hx00 00 (R9p8`K[( 0RJ S| 00 0 `wvPePRPGPBZf0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SR0RK 4R q'  P M6pP/W  0 1t0S ISp0S &0S0@0@P0P/S #S 0: S00! [s"Sq0: S 00000#/W00S %w0S0(00S00JpW   0P0M l50 0"=0P @/P05,%0CS0$ `0 \  X `pPP_0S v0Ss 00   B R\ L` V `,Q' /0 < P@0`@0 k P0` J/R  S/R/  # C  R:  ` ' 3 0S S/R$ 0hSR& uR0sX/ HL!R\0X\!R\ 0 X00: S ҩ C C `BR0: S P1: S  : S!  Sp  Sh V Sa S L0S !DXPL,0SJ ! $HE0(尥 0Z  Z80 S800 bQ xQPP1: S 00Z0S 80`!0CS!80 TT0 @VPR X0P Q 0S !:X0S !X唧 F[ (0S0S 0 0 Qp!|ul&H&<&A<&<Vls0&N6~?SO-@PY\.H&6p@<6XXP\`0O ( E(0, PU`00 XP\`> ;:DH&$(@&p(P|(|(P(h l (hO-MMW-JGw '<5p 0 Q 0  xH0(0h7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S XvsPU R8nR oR0P<0,&`P  *P8]s`P,PPP{ FCRN , 05 PjPpla4 1SzH0S?80S<@0S9 P0SP jP4PD0S 0$O, +⧳p P44X(D`尠XV 0PU 0040D0S YލЍS ,0SX sP 娠=`0@0S0H0S 0  F2\P P 3R㓵( F QP3m W` Hّ0Z ⺤P t3  dI\)P \T 0D40`FP NPP [PPT0S#0: S[PPP4 01!࢑P4L  0R p 03P0 T0S|H R 0 T0SP p[P4T0S 04YX 8SU # WpVJ  i."  ."  $."  (,." 0 4   8<  @ D  H L  3]P -  XP40SP8`(-  k    H&F H&  J s     @-04eP000U00SOr0C?ou21@ *3p0 1000C00S9 000-S40 2R)0pP EP SP l hDAsP xPqDA84 4" 4" 4" 3!00000C0b*P&|yS@P |S! nTXcQL`PN<32S L#L0D@X\ 3 0S 000S 0:hP 0_PPH000!S 0 崱0S XRd000S ƺPmDC@p#A1S bVqQ"mᨺP2S 1"!D:Ua`0:E$\lQ100S S m!0`00~01qc@Pjh Po rbPj @qtPg 2S 0"r r r2S`AT"MmTPG2Sl p0"PHP, H0"`(C0 0C(H&lH&-Tc$((LX(&&@-@MP`/P@P@PH"3 0@B@r0 1p= 2Q=0 q E - PW RZ R\ R3 0!BSQX &LPS0: SO00 0p 1pd10 ER!JpDpwPePLP PP0 FP 5rf0@ S00000 0 0 0 0  Q |r"@ K@P0: SpGP r@47(H&EFvO-`M@S(JqpP!"1p 10a1S 000`F0PmP pP {QTP xo`)TPp'[A Lp@J,0Z 0aKP0 0SKP 00] 0 * R 0Z /0 0 U:@Jp @T?Z1KP U:*Jp6QH&-7UWO-JM M@:S\(`R"0p1 @DTո+0 aS T  {K?iP fP hP ?{vP00`000 00` 0QDJpP0: S !} PP nP 0Y/S / J>00$CP@T 0p/SX/=P0 S:L$p` D H{p(!H&t&A-`P@MRD4 0婗 JP  I {JP  I qJP  I gJP  IPhd3P0\3P P$P@3( 0P+( P3( P7( P;( P?P ( PP( P P8$@Ѝ(P (PP"㭬(0S ({P(0S (qP(0S (gP(0S (]Pq0S kHPh|!0S0S ܄p TY`PLa @1R` PU 0E /R X#P(PU  >00,0/000 0CS0wP0$0v00S tm0s00yꐇ갵(H&q;Pĵ(Ny;PE&;;;k;; (&;(;p@-@PQ&`LP PP 9`t .ph00SVɃP`m-P $´ 0@=kFlFH&&&oFO-MPOQdq&`pXFP&.p D6@X/,60S ЍfP WP! PP p `RP dP (vP iP0p0 `rPxP pp0p0p$ppq [,1@ES ᬶV8e  0P0SP$0`S 0S@ 㹝pP܄ PP4Q0S l @[*0/S /;P0.S0S .S0SZ< 4 0 R  @ 50C SN00$S P P& 00$ @& 0~l0S $ ?RR00R0SV1 $ w&  0SX  {P ȟ 0!0 0C0~ GP 0S' @0S 5S 0S 0SHP0 0] 0 0XX  BPQF0SJ堫P D0S 0S= 0?S9 0S͝F<S  & q00PU GP$0 S`0S;D0: S RR  S/o" R 0: S|FP0S  ުP SF 0SG 8P 20S .0?S *0SF(GH&vF:GQGGJG GZGG-P@O0$`p!,p 1 R1 p0C@P ;pP vP0p`FP`p0S VP /ڳP 0S 0S FP0Bp0S GGH&ж(G0@-TM M 70 $ E.FP.F@9GU0F0T000D 0EP00սCSD$⎩P3 LP 30S S S" 30S!  R h#6 R P#!SRL3F (3! ,3 003 3  2 20S! (0 2 20S 10S(002PU%B;P@ 0@pB00CS00  0 4 0S60016 R0S 10S<0PT<0 01 10SQ 10SM(p1\1PNL10S H10S \1 P1 t0S ^160S (@1 \F01 E(s 9 0S0F0S 00p0S0S 00@pP@Toyx(HV@F&((((((ZLG&TG&V(E&V(vVVC-@MP N2#2b@@0 S Xp )W"[+pC 0 L1 0帳Pl7h EPTPx EP<88 EP$T7 0DS 00S8 @0xLU0QD0@0 0Q%@0SV L uPQi!a0@S0@qDP `i@@L 9P ,P P 0@0 00 ^@L!L!0@0 00 0  PLD0S lx UEPX@9_L&H&cioBt @yht@t@T&*-`gt@->MCl9O-Mp5M0W"냾@0o0C?oPd20@@@@3#'p3 X XT 0S9 ZP7 [PP3 hRPGPP il3H@ PPhP dP fP00vP00 3@00P00Pk 1 00T㠢 00B R; :zP" @b A0S #S(d5 00 0 備PP4 p00#ᯚ@P/0Sx '. P  P|p H|p+ \Dp yh0S<0 0@00toh5h!0C S?00S ě$ p_" p0 R qX  Pp P    3/P00 S '$ p7" |p[p000S p~X8놄(G&H&ʃ-ńD(ʄۄՃoO-M M`p\TtI ^^AT5 00 5dT5005T$9 00cP * ^P ᎸPQ gA0@6S0Y S~(,)pQ hQ` 04(TȟS SS @g05505 00505057 GP AP 7꘷ p0"S tugP rp 0"S ( apӼ0"S P 06gp0z05000001 00 00g0e0c ^D ^  ^ QS00 00055UU # G7Y5S50`FV%R" 2) 0%0;dXpPx%5S 0BP80: S055@%0IS00YV05VB܄$0P0 H8݋pP 8sPP`  Ad$iB %d[!t500000 0@8@P#2 @A QU040,   etPcPSP PPʄ$d @" nP tP0 aPP pU] [1lUT  u$  $th$ @pX dЍ $f4$ @p3!d 8X8 @p2/( 8 8GY  HAT@D3PP`p d`TE`8 @pP7 P5 <"X0B!v 0!pX 0  1 P Q !Yd 0P0WdTK 0@Sd6\6)Dp08:U08 p0PU 8 ڬ  P P P0ZS $`V    ttK70P`\\Q-H&&~DD{D,|D(;H}D޲ȱH&yaratcidO-0`pOaM⌯匏22242222322$ T/E%pjH?"42`FS 20000b2^S R2SVV10 dbV% ``L0p L2pP  ``L0ppd2S Pu?PX0: S0d2232d2o``Sm}0 =TPpm0S e zPRP3P/P$S@'Pt=1@P A@PP=P00j0000] ,2A,00SP ,c<P0d2M042J02G02D02A02>@\ | @5Taߍ02/202+02($p 0$0U /ᜨP000S ,$p萝db0X+2<[000 0B@ BpP 000S 3 S;3+00Z 0 pP 000SX"\2RRX2|Z/ UP Pq>PX0: S : PP _/>P )0 $$ PtbeS<PP XU<2^>p X:{\10  [ *<[| d 7!14\)ST <̲03U8  803N88 P 0@C R\ 2SY 2S 0sU~ <pd2SL >plV X!\1 D`\1X! 0 \"02T7,2P7(&Ը<9I&%\Q(`(6b[z P"P \+0`p!` 00"!,00!` 0,"!? 0,! 0 0("-!( E" P d0$    0T(2S3 쒕Y081@t @2SX"P# h1`pt 0 0 0a?a!@Jq"P 1! Y!0T2<<23Sa "2AS``b2S 9+8$)0 04G"PO D%B%%I [0g2  ၿ @T' 0@ET @@  k  RT 0 S`0  '0s r `Vm D}1T Xw1"20"0z$PD$P>-0O- EM MP 00P00`PPP@ 0 $& pԄ0040pV4$9. ލ ЍyPcP PP! TP' \4 ST1.H$d0@S0000000  +0 000003[30S : &pP^^00X :+ PF+0SH8S R) Q$nQoQ0 )#0mPPq " +002"@xѮP' ̮P" ǮP  | ^U.;P wOp@.D F8"89PB8$R,00 *ZpWD ` jHP/ WP1Z 0ZmX@P6X?o[20S@ -X `@T  jH`P4j/]P  9p. <8ڬ>04P(`CQښ. . a0C2,S!R. !$RU>"0]()H&<zH&p@)-8)Ej$I&0) -H)zd@) edA>\G-p@`㤁Q!p$Vㄑ 0S 0S l`d10pWA TP <O0S $IpW%ZЍyPmPPP fP t. n0@ S000000000000000`;V 0<PP .P.P 7X-)H&h?O-H4MD$` 8P! 7P*70pD00PPP#:p4W00S 0S 0S ,Pp3 a X( 0S00P h弱0S T嶱L峱WPY430S ЍzPOPBP FPL R"P0@*S002 0P2 *P200㘒"0 0b R .00P2` P00 @ P00 0 c RPx s000o00l00i!0 mR1 P :1(\100000P000L00I`!000D000@1p=0000070003P10SEhLPhU 0$}P `IF+hMRZ r6ERZ0) ()4H&,0)-uxI&p,)ScO-@Mp@@?,eP6WpG102˗vPlP+HP1 TPH ~7p0` 0& D D0`Z   =Aqp` 0S v[ 5m@ Pက $p R 0S00!S0  4 00Q40 P000S ` 0, TH₼PHJ?00-S 0`0@0( 0P@ᴍ`PЍ@}0 0<P@ᜰ000 R0Sk3<0 @ t#  lG B R. 0<00@ R T 0 00S00 ZR R@u0DKT$0o R" 0:E%KU0<0 iR BR0<0 BR0<00ST  R\" :J%FZ R  :O%A_$U@*DP Q@:IP0.,@p $0S$ 0@  200S0Q@$0S0S (00(0@`4P@ `$`(`$0S (,$TUT[D0$ 1ă00S00g?;;0 4;$#(Ć,4 03/p V `p Pp7S8L7n8H&7z88T&L&`7>8??-88庯J&@-44副,可$0$00兯 Ѝ䗯J&3)O-@P8M -`$@9LF8 (4@v`^ 4p, (p Y6 R|, 0H L,P00P(\80彸pHP U6hEVIPHPUpPH5`dh0%&p)D5O005SO /5,* 0 0$00 00 0  F!P@PP$VBAYϸPzZ `Z NZ4 AZ% CZp| RpRda J0R WZ00!0 0 ƣ0DS ,K0L0J0ؓO005N03Y YH0CM0H0500!0 0 h 嘣0@S L)YI03Ypj0zZ0fkZLZb 3mJ Z] PV䒟TUmѮPH0SI0SO005SQ LPM  Ƿpp 0S  0C !P Ჩ@P4 N@uLp``Ӹp/>P 26ᓮP!< 0S!0L BB@3/ (t8 WP``P Ḫ(@P414+ CK @R #( ‹p0z / PP 0"0C" B @. (( ep0 |HJ&3) K&qK&q04)J&qJ&H&rhK&8K&hi-qPK& riJ&!rr8ohr*rkkjiriui m@-P EX尭@ʭց9)@-HH堭@妭<<埭,0400园孭 Ѝ䲭|P&9)49) @-HH冭@匭<<六,0400偭哭 Ѝ䘭P&9)9)H@-t@t kh0(,g m(k0Hd8@_@040^0p8eЍ@s9)pQ&G-`M2PPP63P1 op* P&3`'3@PP%3HPR0 0 K0@O@`u 3 Hp HQ  3P  @ p1a 00 @ p0 t@  d080<0@0D00 0000P0 0 080$@P > 81 HL@P@T@X@\@HP庬 H㶬111 0400,0@@,0( 00PpPPUPT0PP 0/`Ѝ處?ȕٕ 0 S&..--:)O-`pPH6MDF(` 0 0&}p$6U K V0S`@@0VoP 0SЍuPfPFP RPZ 5g@PP0P 0 hV0#S /P` $$0`0S  $$0`0S;P V0#S (ljP $$0(0S x $$0(0S|00y0P ;P)q )q  ) (` @s0KSq0v1Pt1 C@Q 0cR pR bRJ UVJK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX :@010S_ 0P|0 0C?oR20SV X_ꎫ00 0$,0$00S 0U00S 0 v0S0P000010S1 0S 0咦P0 0  Q00s  h1000T,0 0081P0S& SR 0@0@0 #  R S 0P(0s  0pp10S H0 004-H& :)6I`z×T&,O-@`'M M⨆V$@@@ &p㌦/6p0PKlU00S 0C0 1U0 U!qW@PPy YDP㬀H= /p`*0S   eAP* a@P5P00@50S $z@Y d UXuw@000@0000p ᫥P 妥P 塥P4 >P/  ZP*pᑥP P( T}p q?PXq/T00 000#0 00$00 0cPPO`P'ݍ Ѝ( P(R@TPY ;j1 PP(!hP( ]"O`PP p810PP 0(`p` q?P 00 00$0 00PPNP NPNP NP PdP PP DP!@jP0PZ zP( ]Pp` oP( +ⷔ /☜Pm``MV":r0 0.p` d!d 0P.0SH00 000$0 00 0P0@(p /py.w.0Pa0SJ(S'- 29S!S1X/0S (^K`P@\pS:)),H&-6b@(:)zd@:)edA p@-P@7p@-P@7p@-P@73@-p@-P@7p@-P@7pp@-P@7p0O-nM M800㈎`4PŨxP 0h~0 P TPL 0D~S$0Gp000,>,$00 000 p@9=> 0S=D$R$r R  $}Bt $J`<$.m`|0A: x0@ <$0H (0JP.p T" <4 4*8< %H#`PEB@D4T@@0 0<@ᮣP < $奣P '  |<  l<$$r $|L ᎣP 4<$0 00 X 0 k=}0(00 L0, ];0@m R; ;$d0 00 0  Dd;V0!00 p0  6,; H0(00 80*T (:$:0!00 0  :(,0!00 0  :,0(00 0  L:0l:@8:0S P00x: 000 ` /!00 8 0 :0!00 0  :0!00 0  H940c 00 T0  ,: 0!00 0 ` 888Ȩ@0S C.0, <PQy<圢P0@4 啢P@ 0 =Q`8Ȩ@ᆢPD40 ~PD40D4y  H 0P$0n P800 1 1 (K$8C]7@P00U7 000  ္HL7G: PLP/ GP Q0S 0T4000-00* PEU UY~ V⡥ ❥0. P`S 4S<4Y1 H4L$0 V4-pk?HL4P80S $E~G?GGHtLW0.= 0 $?8p5WLHt04SH$L4R0 &+pP # V-p  4S@  <pP  =Q  $R $0@0p!$Tk = (,0XP,0 r0 4\P WP$$@03m`Tk 40S0X44S.=0@+R$)SR- (8 # *~2Pb0T40S'P `#00ST4Sd31P L3 50c (8p""ŸR H$L4P*`@Ppp0 L4H/0#! 0]p@2 C  /P 0- ;=op~`z 0P0 <"  I!L4HϠ0#q4S 0"?W p0$$4RT SQ  W  0@*p0| pWS  S!0$Q] +S0$0 Q$ Qh*9d8<)NRbH&-WZH&]>T&L]oT& 0>@)O_V  6@<)=OtE<){PS&,<^NGO]HL$ P,} P+P *+0$PrS0] 4S$iP 44娀S04144 0S @4S 0 $L0@4,4S $4R#1ѣ1,40 000$0Uu )t )0S +>Ȉp@& PQ' 0 d|K!;]P`E}A@+ 'nP9X+-Q :$42041$4+nT4S+ +d0 |"!*)))L*\4$8: H4l4: x0<$+0@ 0*pU|↟P Z +tP{P  <wp  T<  $0+- 4)O-0pM I Mi4, ( pP_8`4pGs04WZ h¢  ⾢YaB 4S<44S $$4R0d`((p P hl*p 8 4 SP,0S x0$a t$W0 0O 0$UpW$ t1SF $$4P?*`5NZU CUʙp7DPEUPPbPEUUPP6 (4'8#80( R&0C Rn ("(N044s04b0 00 p0 6T0(00 8V0,d0@E L0 00  0$50*00 +0 )0*00 +00!00  00c 00 0 D50!00 P 0x,00 1 $1 l40(40SM00; `$>0P0H$uMhp)p 4S 'PP$t$D`P#\  P(@PD4(0(00`V Z<0 00p"#7$p = 0P0 r0 4P P$#0$M3}p$p4S80S4p 1S !1B0"L 0S M^oO-`PMD \`[P&DOP8J &P%p%%p `Pp.@` .DG pRĎ 0z: P  Z .>> Z %P t>HP %Pd<;Sڱ%PL #jO $N 0qQ >{QP PX( { =0 2S1<+02D0WC=0S 7=C@4P 09 0| ``0P 00R0S DcJ 0;8;08; 00<ppGx`a<`00S 0hHP  ,!.u8P:P :2@0SUȌp Upp̌ ňppPt  lI 0@ @ 9 0PUP 0C S0400000,00(00$00 0000000000 0000000 0W0p  Rn PPlWo x s8;  00 |\0$ph8; 00 D\0$p48; 00 \0$p8; 00 \0$p pW  |0 x;0 E y;z+`0;0; ; '0cy;0z;(0x;P+D@HP \0q$P;"0#10@00 0p[`QHf  p   p 0L$P[0S PP [0?$PX 0  00 862$P,d 0  Vpp6& $Pp5%$v!2P(10[[[[,Q0Q4QE 0@PPPP峝]<;SdE#>؀C 0 7PL@PCL P4O 0N 0N 0$胟N# 07PhL@XP#L 3O 0N 0N`"2Rz 0!FPt ' x4$44@PFPt40S 0 N8' f@P 0FP@P 0EP D2 h0弖1"pt00 e1@+lY@0W0 00D4FPt3 IppW & P 2Q#P0:CS0 I#PD 2$ 0%bB DNN`p l2WN@P 0ELPZA@P 08N 0@PEP D 0}EP n1 .NM  h!@T Ɯ0S MI0㈠d0d000p+t!pP0S 8<8喎PK*9NgV*{Gz??eA 3H&-n`RMb@A7IV*^PN*aV*dL*\8N*]T& V*\W*9V*Z_&8 N*-C6?V*u8~AM*$@N*@@H&L* M*M*0_&[xW*&4W*Td:Wx/FVgt\#Eq 1;K_q W*PK*N"t;@000aV WL0 0 ( d|0d"R!RT 0 Q @ PG1@S4 2R`2嶰0C(4"<8#8[1LR?L0 d0ᢏ0 d2$2    p˚p0xt|0?lxt 0L# M 0ILIᰒ GDP # !BDP #! 4+4#0à3D0h2 0h22d0D#Wp! أ0$#$@0(00"(D02 0BS@ (SH; B 0;wpD0S?0#3!(0H0C8C8S!/< 0 0H 8(#8<"(X 0 D X4币  x9vxs 0#;    0;5 4 0W9؃0$#$@0(00D0"(`pd4 U T JuwP@0V/W a@ 0RZWأ0$#$@0(00D0"(+4u%0 H0D 0Xp4<H&0CS00 P 6Q20 0#!0 #0pD0 0 Pk 40 Pb X7Q0ln|a0 ePD 0$#$0(#"(!M0 QP/ C0 GP% 0 >P Q Q TXp\n 0 ,P| r0 "P 0 P 0 P 0 P 0 P  0 P @ 0 P d X9 02 .0SD S`& Ss W؃0$#$@0(00D0"(p  SHZFWH `K F ` P  J-Z0H(`F`J 0XHZFW&:;Z  uPW t  ḫ  [W( fp JZ X YWh T;O-M`P@0-S@eP- @3 pȣ#p*30SP a`F0P[:PQ9 JKP9 H ~C82P@ 3 C d0@S Lp@20SxK@HGG 0匒 0X dICY'+;`P<RP`8b2 R P i0 S D ?U+ 0 U!0!00W_ {p4 ,qpi0SPpW4Kp` _pW0SMPN p00@@ 0xB Vh*#p`F4W+TH&_K]b+ivO-PAM Mʿ@`6P &0P0V00-S' @P ᷑ 0P0}B@0p0I\[00G`F0S0`@DDA@Du%p ,0S@bLP53 Q  wP -00 n`@[-00  D0B5S0 700S BP B0 0꼄4P B0000x4 |4 0S dA L4 00 83P   300S Pm0$0h0(0e0,0bt0C?o#2p R0S0$0ƖPt㾖P㹖XFx0H[ @DT43a00@`FrS= RS iS1 tS xS㨢в+ 0p 0@00@00S  0Y 0S x8< Q (0 B b/S CDb)(0S  0`6_ll0S (0S |ڳ1 00XS @˳2(0S ( 0`|-::qPp+*- 0 p\PUU:)4@W+$5MF-h+_&H&#H&J_&\%(&6$O-PLM'P0N0n(.$p>,# PER a0:  $@@0SC@vPcPSP TP LP d0@S00D003030800H00 30$30(30,30<00",0A0@)0,0p S qW3S(~ )P @ P< P/P LЍO~3S w00p,04 8<@ 0RWS[Z0DSPQp! 100gS @{D EY0`,  aR @L0Z S ?0-S 0 @ 3R: "0 0: ` P0 0|:0 0h:43043{0830<3@30@3ppzzyyx||{U ,0U ,0U ,0U ,0U ,0 0 0U ,0L00L0U ,U S S0X0X(0CS00 PD#8 D#<#  P Q0P0083 500b0,X0$X 0X@0X0 X0X0,0  _,0 W=P屏PdH0S7 0b09@PH0SX'BV0- ,0SSX p43 SQ0PL/aUF cU2 gU0BP>03S_0Sa 00gS# H0S 0|&Z` 0  d<0Sa P6pWpUpWX 0S00:' ,n0l4j8h<f@dDbULЍ0000H3P0P xH30娐PD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R  B   0y< Q $0Q P0 00 R  B   0y< Q $0Q P0 40 R  B   0y< Q $0Q P0 80 R  B   0y< Q $0Qp P0 @0 R  B   0my< Q $0Q^ P0  <0 R  B   0Uy< Q $0QL P<0PESZ $3S0S zD0S] @p907S G 00&c;sr<  R  d  v      UlPڒ0S 0S 0S  Q 0   xpqPU 8 30(#0<  В+%+H&O,c,Y,%j,8(,-.-%i&0+`+.&8+@+H+P+X+(+,,,p+@,--- +++F-S-a-o---+-G-PXMp!PHh  C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0 qp(4 0P 0PQT3;JZp=V Gw`2o`F#!P0 0SU030#:U 5%$P+P p#= XP&T6K/r043PvTS0 0 S6# G@h SPEX!EK/r0Ph 0 0<6Sr46Sr 06rS 0GpT2R01 h⛜6S 4▜_P W0`W  0>P h,6S m/X`P b|`Q0Q K "fh(|hD`<6S46S^E`^E`@6D&SH1 0 00R8!P H& R$!$Q $&R! 8&R0&@PR  Q   @ fT @  N@+ 24-4H&4345h+:54+(+<53^5T&"592%5&P5m5434455p+\6_6b6h63e66A-P`pI䁟HM!p10PEU HP h0@ S SHHIIp1fh1X1 T1 pa 8P (1`   aPP ^: L`$@@Ԁ`(` `C HFP GP0S <PxW =P X/:0 0000 66H&-i&6+66yt 6Ct 770G-pHM`0BR"up 2B1 pGS 1S 0$  !RS@# P+PTvP<$9xP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0:HЍP  PP  90S  Ae0 `PFPW a W (pGW R $Sw ,0< sW p+ D DH&DZ7i&-(D>+&C-Mp`ᫎPPEUy%p5U@U`F V/@T xP hP GaP tP,5 R y0%  PV 0S A@D PI `VD ?  ; tP@PA@3PzP0S<0S000S00S00S00S00S 000#7pPU 3 `V= V30SU7 0S4000000S@0000000 0 3兠 0Sr<0Sm00Sh2:P0$0:]0S 0SW`V UUQp%P ` P dPB UB U UR<2PEUNPPUH Q \PA M8 U2 @U U60000  4- U+2PJ 0000 0 !P   $0S   pqpV*V@ T L 0"600"$0 $P @ᙈP t唈Pdn K+dHKH&nJJ-KH&LLHJL+LELXLhLWJTJLC-@PpMa M!$p10S QฑPE R ލ ЍRP fP74p`"P` 7WOJMP1 JgP/0: S2  S)J HP0 JN@n` 0 4S00` U0S RphHJ PJ @PJ0@+NH&NO%O(OOO-0 <[Mu@P P ;T(X#[@u0Pd+TX8\ 5uP;P  0S4;8+,(Kh8S <PU hXJuP@ NOoB:p J*:(8p AP `ZT`hNKPdhXd:xJ 0pP0 `*p`W0 J UD,* 0 W0C 00܌10 l>  \⍊8P`T0>0 XP彋0P- S)ċK0 ]P\9Tp {P 49h(grP 9T(X(]XцP 8h(\40FDS00 8(z 8X(T( |8,8 8P 00S| h8l 5(8, ,, ,o 8,k 7H(g7l 8WW^ 7L(Zg+cv PS:?@ 0 x7P(H7hgWpmP78=l7 87<(8 (7T( X(2@7 7P 00S% 7$  6t(6 6P 00S 6 6p l`E v68`W`F080 P 0S46E `V 8'p H+/ 5, 5L(5kW0P0 p5`(d( \5eSH5P ? |5?Qt(GGލЍP5T H+i0D4<  G as` GXsU GPsV G Hs  GBsW G ;srq/G= 3s }GY,sZ uGStKhK`KTJHJ 0S0SA  7@288S2n@Px |b<S P 0S V VD2 kN @+u P:B?lo |081<Sa\+Tt P*J㨉0: zP 0oTP 6@PJ JfH@PJ J0@`yPP0@P`|p@+t0(@0@000pUp,`40U0 (P<P8mW,(PR00S ,R  \0,0S %V,8S=% Sa,8S lp@+s]rt&&o6uH&]uOt-q&{t+ttH&ttt-tuusuxu  $ uzu4+( vA-P` E\h bP03hap2S l, P3UdN}PO p 9P/P00@˜7' shvP303D$p840pEWQU 4 000`គP C,sPE0S3 4# 3Pc`]ZubP|>3`ph `\qPT304hHf4S 8SyeP  !3lY P 4SsRgePn l PpR|,p`bG1/΅<01 1> 110101$1gdSQO,# 2R CzCn}lp`d Pa Q18C8S 8`Z`qȁd  lQ00S ce P +`3P?o20S R=?o20 P P l)e18C8S 0 S S 0Rc  \cd=`S 0 0000 le18C8S `fd0,vyH&T&,ӌL ٌ&t&*t& ,0,$ hL&@-@`ᭇPP p1 lqd!pX10SAH81P@ l 1*$qP  ނP 0 nPbP 9P0P S  c0@ S0VP DC 00@0 P0  @0  00 kl0Sꭔ,c H&H&ؔw&A-`4C0P@00$ 01P0 01冂P00{FoڳpxʟhPX叔sP0r0m0"SBP GU 0+0C0S PP \p8NPPE ΋P 0SƋP10忋ڋP1 0Q OU 0S㿴ǏP̍㼏>PEh10S \10LN9DQn0S(1(P#P9{mMP_qp 000000S宵 ㇴvq벃{PP`0S PPp00S8긓,.9,)>AHOR[j,,,,&,,ѕ,t,O-`pPLBD @`4"Xp(2 0 qQ PpPpGeXfuP`P GP IP EP '0 a0@S0000P r000 |c>P tPU\0c@=P <f0,  H&b H&- & A , O-ppMzP\J0P4,LL@(4/x4P@ 000 0pP0#X0O0@T.`P@@#p?30HXD}[p Y0S hn@P 6@TఀPH3 @3 8- -R R -R iQeRQiR kR eR" ""sPPPEP IPF -PF }2Q@"P00h2hT2XD20P^U0S ?SPP20`^V0S ?S``10@^T|0Sy ?S@@u1100jhfꈱ400x (0\  `0x !1R- S` \0  0 ZB, ,A\aP  W;Y  0SG@    9S`0S   Rڰ1\0| 15 ,^ -T&m  H&   H  X&]&b&j -s {  -ht@, H&  gtO-@Pp`LM@"vp1 UV! Pp .gP uP GP `0S@0000T PUP  4 p  !.P0P 0S U. p U  p T Y p V p.`V :L \mX@PPPm 0 . J-A H&H   Z      9 0O-@xM0p5p%@l5P@d5b \5p@P5b/噂@E@eX00%`5(%(E5$%$50`0lP`%P P @nmPD DP4 fPğ5 CP6 ߠpP8 rPt$p'p4`( P00: S0S00',AdPP( p_iP 00SW p3 (3 C;3`3paWGpP < :xSQQ0@ KWPPD kP k |Ђ ͂ʂBe 0@00;P@8UP@`Q V ((P,@4+4`(PV,@0,@dB( (P404`V(P,@((P,@4`|V( P# 0 0S0 0 0 0 0 p \ .W-*(@P s 0:00w1"s1kPGZ i0Q a^3 0 ЍpU-[- X\-(G- [-PK-t U-|]-TM-([-U- H& -3 y tS-,[-- U- -|T- |g Lk pg G-̌ i $[-xS-0,O-poM0 @e 8@0 @$GpPT4 W\Y IpP 0  P(0: S ) 0T0[0Sf Y \Tu@PH  P 0y ,yzPqP0f@Pr 4pUaUbPEUPzU" !0 p 0d 00 0@3 1 ( 0 x300t@r pT 0!0 02QX 000ḐsX%X <pP0; 0P* Pt%ePPh!! A I !0,tq"0+P , ǀ  oP"   IPk0S 㳀 xb0S 㪀\0 0/X0 e`p0  0  Q   S  R#4p UP`00S T u 㹀 V@p꨾- 0 H&; > I K j - % &ht@   0O-PMp00@+|P? $|P ?M /A⸌ߍ(@)._.X?PX1P?/01012 211R"T122pEp>p^6&[0n0d10 .0>pZ90|n0C 0 0R080 h勔0 l10 B1!1pq0 ᮣPPZg0Z m 0R- = 00+!0 80 0YSVPMP 6P@ ?P7 4Ptp=N@PfP j@PD=P0=0X1h=hVP0V30 [0000z00u Po㔼l㌼i 0pFP 0PH ڋ0$Qa8 Ӌ0 Rᰢ0  PP  0p!& 幋84'0,00`1Zp @ \⤔1SၢP 7$"ấዄ:0P @@ @0 Tp 0 NpA@*( P0Q819:d!*`1 xjpp ^PL 5   8:8@p, D&`11`V yPp)YGB Y9+  0d1 #mpM8)pђ?pP \X 0S` ( 囒5PQ -0S Zo F0080x8"/0  M  0  2s<8"/0 ?  2sc!"# 5p B 0<^ AP$*? F 00 7@p 138=ᶅ2 7@P@ z@ w t7 @傎p~0S 9 0HX~0S7~0S ~0 Q  8 0 +zp~0S &BAp~0S t&OBARP q HS@c 4_,͑0 T S 0Ǖp) |bp% P  0$A>0 0T1a 5T@ ptDAȑp$0 T1Qp mWbp\嶑$Pp 兏p,k@T 5@ߍpA X000-]0@00 P  {@ 0 30 ԁpt@ F#\ XP$# H43l pI  ̃+2pW 3@反pTAL!R`14`11◓P0@!P0!t;00!R00SRd18(;`1Z  R! Q01Y<(p H`1 1Y4180; X >< 4900l1PU| 0S 1P]P 0S  待 0S  ᭑ R080SX  R   L1p20 S   0%`Vga7 ( & = H&\ -  9 L | @| p * L  l   L + , W l  l  2 Y  &(0@0@ 冎ѐh8n0 A  Q/0p@-x@0Ppp@ P T0I,fp@6 0 0$010L*/4T*/@-@Zy@*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: ħ8(T"%(.1$5$9=@<FIMxRW]cmspzp  p,((+19$9D9d9l999 99L'V3[8x?xD(}L(}U[dmTt\|ЪXXX`Xt  %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %sx <,`@@#&@@,29= @F@@LLU@@Z%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdinLشfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|Tiinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.EG9 total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s,,$,,))Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"}c}Tcc}c/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+LLL<LLusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression:C5@FP%-V"SKarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %sK K LL#L/L.M?AMTMerror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQED[[[[>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error EYJYtRYWYf^YcYdjYcYspYWYcyYcYmYcYlYYr YYpYYnYcYv YYb HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:.[ (8mYSgirktEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpectedaa&a*a.a3a8a\``````````aaa aaUnimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)dd@ddeeeee!e+e@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error ddddddddd%d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATION (0hd(1hP(1h(8h(0h(0h(0h(0h$~(0hPS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad number\jjj jj jjjjjjj jjj jj j jjjjjjjjj j!jjjjjj!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unset,q2q;q=qBq\GqbLq<Sq<\qcq}gqhmq sqxqzq,commandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexpr̯r(r(?rrrrl#rl'r-r5rS8rS:rBr`Gr4)JrD)Rrx@XrpK]r$brXhrxorЧsrhxrrXrXrrrHprDmrrxLr'#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260409153151Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failedxy  yyyyy$y)y/y3y 8y@y FyMy Ry Wy\yxxxoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOP{|'{T){'{'{$'{&{'{'{(({({){&{){({*{@*{){'{$'{ ){4){)illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedtty#3#3233Ā#ˀҀ؀߀ @@'.5<CI P@V\bglry PC$TCYC$`Chq{@@  @ $*06<C I@litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %s@ϗ@ @@@ @)@.@3@:@B@C @G@M@V@^@ejpwřљ@ؙ@ݙ Ҙ#*1;AGKRZahp%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:or]n~Ԗ&D`s~%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=ɐosx1ƛ%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:w~ÚɐʚϚךܚ '+15@O[kt%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFOǗϗ՗ٗޗ $-5=CGNX^gnw˜ɘҘטߘ/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd )!1%s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:=AFNSX^djqѤx|̤դDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>=DIS]fm|Ǥ̤Ѥդ٤)9Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdDYDYYTYDYYLYYYYD# %s: *ש۩ kfo}%(.type: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u רި#*27?DIMVafkos}éө%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. ٯ%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:&@)SLO,0  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootable)Pw    7 Yi+?Tj !#$&123456899:(;B<`=x@ABCD*E@FUGUHUJkLMNOPQRST UV*WD\Naicsdefghipqstuvwx.J[(Dd|.Fcs'.Qds ,FVq$AYw7R.Na*Z%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype !&0:CJY`fmuzvfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY29@CG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:!6I&@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:b#;I&No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec] $AI&AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]$CI&@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),112 22*2X2a22222Unrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to function3jI&Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:l4\kI&@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored6666677-7;7bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGG,,,",>,,W,,Pgpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: `!#,$2X4H:P4RRSbUXhYYl`8 Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*@@@@@@@@@@@@@@@@@AAAA A$A.A4A8A@ADAJANAYAhAtAAPartition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %si@(|I&@Afp:sNo MBR in disk to convertAAAAAA B1BXB B B B C :CJCaCvC{CCCC D D5DKDcDD D!D#D$D&D1D2D3D4D5D6D8D9D9D: E;#E<AE=YE@hEA|EBECED FE!FF6FG6FH6FJLFLiFMzFNFOFPFQFRFSFTFUFV GW%G\/GaJGcTGdGeGfGgGhGiGpGqDsDtDuGvDwGxH+HPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s RhI&@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremovedTRI&@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]CS܄I&@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]xUHI&@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] U(I& a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l+%')Hx %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)%den_GB.UTF-8 (active)UnusedExtended MBR - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s ()start %*ssize index contents%5d unknown%*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: None %*s[ %*s ]Could not find index %dDetails for index %d: StartSizeType: %s (%s) Attributes: YI&gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed YI&@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l ZpI& a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eC]]SFU0eC]]Hah!IdontNeedEFI]^(s*K>; ^^|nQn- q+^%^|nQn- q+4^>^|nQn- q+K^T^|nQn- q+e^p^|nQn- q+~^^=rGy=iG}^^;Mt?^^mWC 3KOO^^yD<#*=(^^YbBRuoqr^^3Dh&^_\ M}-_&_@Mjy֬7_H_-чHY_]_-чHr_v_ZIчH__IчH__IчH__2IчH__L6 %?a__S'@ )Ѹ_`*1@ )Ѹ``1x )Ѹ+`6`ST.qBHo6֯iF`Q`%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL`hI&@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-bPI&o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdineI&@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeehhh[$+-/EZZZZZZZZifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s rrr linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroy?tziK&Ftyialiasdeletetrailers-linkstrdescription-descr-descriptionttthK&jN&ttthK&KlO&llPO&6jN&rkN&i O&tThK&kM&tThK&jN&tN&tlhK&tlhK&broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6Zxexpx|xx xxx@xxxx x0x@xxyarpdebugunnumberedlink0link1link2||| || |@rrgetifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %dhGsh~, s h`@s~media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaopt0P& 0P&O&O&P&`P&no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %dp0htunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnelAhhK&:P&bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif@Q&J $Q&nJvVLAN tag(ELly{}NONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAPR&M>$!* hK&SR&X0R&Q&]hK&iR&di!* hK&?0R&oR&ieee80211 listsscanT- ΈΈ$fatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinPATH/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMshinitMAKEDEV exit status %dUnable to run MAKEDEV ,V4kern.driversmallocusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group nameCannot set file mode `%s'%s: invalid user namelrRF:g:m:u:%s character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid major numberinvalid minor numbertoo many fields for formatinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxisclinuxnativenetbsdosf1scosolarissunossvr3svr4ultrix&  %s,%s,Usage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrw/uniongetmntinfopuffs|%s on %s type %.*s: %s already mountedforceroupdateffsmount_puffsrumprump_%smount_%s-oexec: %sCannot create pipeforkCannot open fd to mount program%s/%sexec %s for %sexec %s for %s: %swaitpid%s: %sstatvfs %s (, s) %s on %s type %.*s@`m y@ž͞Ԟ۞  '4J[} @ŸП@%s%s%sunknown flag%s %#x%smounted by %s%d%sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s])nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'!&*04;@IP&UYaek/sbin/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddenlognoatimenocoredumpnodevnodevmtimenoexecnosuidread-onlyrelatimesoft dependenciessympermsynchronousexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsffsmsdoslfscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmalloc(usage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node  !&- 3: BGSZ@binw getmntoptsegG:jM:m:o:rU:stat %scd9660%s on %sbnorripbgensbextattbnojolietbnocasetransbrrcaseinsuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedupdategetargsextattgensmaplcasecasetransnrrrripjolietrrcaseinsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node @JUX[`imrw~  @æ@˦@Ԧڦgetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceext2fs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdatereloadforcegetargsdevmtimeatimerelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node ũΩҩשܩ    @$)07=@FLTX@`hgetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: mount_kernfs [-o options] /kern mount_point $/25:CGLQX ^e mr~@getmntoptso:kernfskernfs on %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsrealpath '%s' failed"%s" is a relative path.using "%s" instead. & 2usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath U_jmpu~  @į˯@getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead. '*? -($25GJM + Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupʶնض۶   $*1@9<AKPS Y@biqw| @ɴӴݴ @getmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpsrealpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s $vhw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'NU_jmpu~  @Ǽgetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}A*LZo%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).r7q*Gn 3[.Nsusage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead./+-$ ")7IKWco|%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @BCFIL#N0O\Sgaxbcefhi km&n7oFrUsfuw -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jd@@@h pp pp ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880go"&FUX[lru@Ig{  "$&(*,. usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%x     pusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uC+P%command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c ũ©)+S QJNChecksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s YYY YY|YxYtYpYCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood ---.-.V...../4/f////0.0%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +8/& Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/DDDDDDDDDD EE)E/E4>EDLE@dEsE}EEE0EEDEEEEEEFE!F-F@F`LF-FYFkFsFFFFFFFFFG%GCGKGCGsGCGGCGGGGGGG HHD%HDHOHVH[Hregcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): *D/D3D:D?DFDCTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%cpooo421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)vxxxxxx ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBA]Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1Y  2I'7+5 +n+ _r !Yi}>MPd{++h/J;#'++++SY+i++++++++++++++++++++++++++++++QPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYy #y pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4]WValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS&  ' ) %s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s7}}}}}}>}}[g}}}}}L}h}}}}}}}}}}}}}}}}K}}Ubn}}s}0}X}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     "2( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated.    b- ' 2I-4 < 0[-= < tR-I R U-c m V-~ W- TK-ɍ ؍ 1J- X- < Y- < Z- < z\-  4G-# U-* 1 U-; < U-E N \\-R 3H-\ m G-y 4\- 0K- TM- Ž SN-ю َ RO- SL- QP- < oP-" < nQ-, |]-8 Ž {^-I < z_-T b |S-t y`- < `- < a-r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula. * %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5 ~ ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalid )   ' - 4 < A I N S W ` k p u y } ͣ ݣ a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF 8  , /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug#. ɱ ұ ٱ      ( 3 8 = A E O U Y a e k o z   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s 6 ,^ d    H3 x4 J J 1L e0 u %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error   & / 6 E L R Y a f n s x | ½ Ƚ ̽ ׽  /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijz$ ܎ D 8 D ` Đ (   h Ј $ Ї   ܆ Ć $ disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS Ԑ %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhck<258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new xhxd(tw4pqwvkn|klr,kxk( 8d{mTlgPml(m\lout of memoryA )   $ $ ( K - 8   > C  J  ! -a T ] d m x  ,gpt %s %s -b %llu %s" ) . 1 4 9 > A E K O U Z a f k o x  %s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eC쬕 SFU0eC쬥 Hah!IdontNeedEFI (s*K>; |nQn- q+ |nQn- q+ |nQn- q+  |nQn- q+# . |nQn- q+< @ =rGy=iG}D O ;Mt?Z e mWC 3KOOp { yD<#*=( YbBRuoqr 3Dh&Ǹ \ M}- @Mjy֬  -чH  -чH0 4 ZIчHN R IчHe i IчHt y 2IчH L6 %?a S'@ )Ѹ *1@ )Ѹ 1x )Ѹ ST.qBHo6֯i  %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/    ! 1 A6 @ H R b r %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new   (ԧ4ȣԮԣ@x(ܠ(  X$ %s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s N %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init SY^}22,^222.4jn22v282=Iy21GS:2 _t#166;@Ujsplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument !b!c!d$!e(!f/!g;!hS iD!jL!kT!l^!me!n ol!pw!q r}!s!!t u!! v!w!x!z!y!A!B!C!D!E!F!G!H I!J!K!L!M&!N,!O5!PB!QJ!SQ!TV!U`!Vj!Wt!X~!Z!1!4!6!!!|!~!}!!!! !!!!!&!-!5!:!@!F!L![!_!e!l!u!  }!!!!!!!!!!!!!!!! ! !>  !) !3 !? !R !_ !m !y !option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLss8q8q(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deletedrrrt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deleteqqsa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULLS!]!f!m!q!{!!!!!! - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s1!6!;!B!E!K!protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)! !!!!!%!ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %sE*!P*!\*!k*!t*! %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s*!*!*!*!*!'!#!G"! *!BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- DDDD: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'mallocDDVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory .d1!gj1!gp1!gv1! h|1!,h1!Lh1!lh1!h1!h1!h1!h1! ialnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~1!\&1!6!$>!1!:!,>!1!1!1!1!1!1!1!1!2! 2!@2!2!x"\"X"ASCIIcs_pathF!XG! bc_base_maxXG! bc_dim_maxXG! bc_scale_maxXG! bc_string_maxXG! coll_weights_maxXG! expr_nest_max XG! line_maxXG!  re_dup_maxXG!  posix2_version XG!  posix2_c_bindXG!  posix2_c_devXG!  posix2_char_termXG! posix2_fort_devXG! posix2_fort_runXG! posix2_localedefXG! posix2_sw_devXG! posix2_upeXG! stream_maxXG! tzname_maxXG! atexit_maxXG!/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[H!̺$H!p*H!0H!6H!\:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d rk  UHC:"viV Mv&& januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C025J.0tcr>q Tunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist