08i^<  i^:FNt ti^@@<@T 08i^<  i^:FNt ti^@@<@T Ui^t`Ai^i^i^$ hi^i^i^Ai^i^i^A.i^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^mD{i^i^i^ (08@HPX`hpxH$Ti^i^i^hpxN$ i^i^i^K$/i^i^i^ (08@HM$,i^i^i^PX`hpxFAi^i^i^Ci^i^i^Ai^i^i^Ai^i^i^!i^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ai^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^!i^i^i^4!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^ B!i^i^i^ B!i^i^i^!i^i^i^"!i^i^i^"!i^i^i^"ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ai^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^!i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^\?!i^i^i^\>!i^i^i^\=!i^i^i^\<!i^i^i^\;!i^i^i^\:!i^i^i^\9!i^i^i^\8!i^i^i^\?!i^i^i^\>!i^i^i^\=!i^i^i^\<!i^i^i^\;!i^i^i^\:!i^i^i^\9!i^i^i^\8!i^i^i^\:!i^i^i^\7!i^i^i^\6!i^i^i^\5!i^i^i^\4!i^i^i^\3!i^i^i^\2!i^i^i^\1!i^i^i^\0!i^i^i^\7!i^i^i^\6!i^i^i^\5!i^i^i^\4!i^i^i^\3!i^i^i^\2!i^i^i^\1!i^i^i^\0!i^i^i^\2!i^i^i^\/!i^i^i^\.!i^i^i^\-!i^i^i^\,!i^i^i^\+!i^i^i^\*!i^i^i^\)!i^i^i^\(!i^i^i^\/!i^i^i^\.!i^i^i^\-!i^i^i^\,!i^i^i^\+!i^i^i^\*!i^i^i^\)!i^i^i^\(!i^i^i^\*!i^i^i^\'!i^i^i^\&!i^i^i^\%!i^i^i^\$!i^i^i^\#!i^i^i^\"!i^i^i^\!!i^i^i^\ !i^i^i^\'!i^i^i^\&!i^i^i^\%!i^i^i^\$!i^i^i^\#!i^i^i^\"!i^i^i^\!!i^i^i^\ !i^i^i^\"!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\ !i^i^i^\ !i^i^i^\ !i^i^i^\ !i^i^i^\ !i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\ !i^i^i^\ !i^i^i^\ !i^i^i^\ !i^i^i^\ !i^i^i^\!i^i^i^\ !i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^\!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^ !i^i^i^!i^i^i^ !i^i^i^!i^i^i^!i^i^i^!$i^i^i^4!i^i^i^!i^i^i^!i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^ !i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^!i^i^i^ai^i^i^ai^i^i^!i^i^i^!i^i^i^!i^i^i^ai^i^i^ ai^i^i^ai^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^\?ai^i^i^\>ai^i^i^\=ai^i^i^\<ai^i^i^\;ai^i^i^\:ai^i^i^\9ai^i^i^\8ai^i^i^\?ai^i^i^\>ai^i^i^\=ai^i^i^\<ai^i^i^\;ai^i^i^\:ai^i^i^\9ai^i^i^\8ai^i^i^\:ai^i^i^\7ai^i^i^\6ai^i^i^\5ai^i^i^\4ai^i^i^\3ai^i^i^\2ai^i^i^\1ai^i^i^\0ai^i^i^\7ai^i^i^\6ai^i^i^\5ai^i^i^\4ai^i^i^\3ai^i^i^\2ai^i^i^\1ai^i^i^\0ai^i^i^\2ai^i^i^\/ai^i^i^\.ai^i^i^\-ai^i^i^\,ai^i^i^\+ai^i^i^\*ai^i^i^\)ai^i^i^\(ai^i^i^\/ai^i^i^\.ai^i^i^\-ai^i^i^\,ai^i^i^\+ai^i^i^\*ai^i^i^\)ai^i^i^\(ai^i^i^\*ai^i^i^\'ai^i^i^\&ai^i^i^\%ai^i^i^\$ai^i^i^\#ai^i^i^\"ai^i^i^\!ai^i^i^\ ai^i^i^\'ai^i^i^\&ai^i^i^\%ai^i^i^\$ai^i^i^\#ai^i^i^\"ai^i^i^\!ai^i^i^\ ai^i^i^\"ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ ai^i^i^\ ai^i^i^\ ai^i^i^\ ai^i^i^\ ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ ai^i^i^\ ai^i^i^\ ai^i^i^\ ai^i^i^\ ai^i^i^\ai^i^i^\ ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\ai^i^i^\! i^i^i^i!i^i^i^!i^i^i^!i^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ ai^i^i^ai^i^i^ ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^!i^i^i^!i^i^i^ai^i^i^ai^i^i^!i^i^i^!i^i^i^!i^i^i^ B!i^i^i^ B!i^i^i^!i^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^ai^i^i^!i^i^i^!i^i^i^ai^i^i^ ai^i^i^ai^i^i^ ai^i^i^ai^i^i^ai^i^i^i^i^i^bpf!i^i^i^ $ i^i^i^$i^i^i^$>i^i^i^$i^i^i^$si^i^i^$i^i^i^Ai^i^i^m i^i^i^$i^i^i^ $i^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Ai^i^i^Yb`i/ $ߵ 0iV66`9vC{@r oqd'#Z(5[(g y{pv6x o}?so$vn-ɣ v1oF"k-B_W+Zg1!_0kHIa?&'xXS\4 p|]{ 'Emܶ>[7avqYr?jwP"g!_HJuAEW0VK6arOKz> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4x 4 (||\ &LLNetBSDGwKPaX NetBSDearmv7hfeb3D0D 0p@-h6!F(F;hFh@oKihB F\츱I&H2 F\ I&H(;h+?U H)FCN*jB K Fhh! \&(  0MF Fj@2iF\@C!jH M0# 05 H\ I H IhF\FHiFKh(Рmd )4 FIH\( I H hH\FIHKh( F@9 )@ FIH\( I H h #H\`FIHKh( F@ )K AIFFH$@ #HU xKXbpG!ɰKXbpG!I I I  I  hh\LO3FoBH##"K]4!ɨO3FoBH##"K ]D!O3FoBH##"K ]P!ɰO3FoBH##"K]\!?#F "HK]h!?#F "HKK]!!ɰ KFh[ ?#H" K]!@! KFh[ ?#H" lK]!@!ɰ?#"F HTK F`! F#8 BIOs-A"@L#F?I?O#V#hY;JBD#CS#`#h7J@*J)=4I @F+F 1IBF =!= *F-IF#;Cx*I*F)I#"#|"hhB"IhC#`Ch@FG_HJKFJ`! KC#C#`#`LKKIK!!@!ɰ !=#n$T!A8KLhMchk`2B2A khc`##8bh;A1??xE][!!ɰ!KRKpG!ɰ!I 1J kF[ijG bj IkpCj_ iIG#j( ""C#b6##j"G??@h+#jC0@8mF:BF F@9"Fo pFj.؃k"!0FhGI nk0FhGbp3F FF IjF [k2F)FjjGF@\"iFh [@T` Fp!K-O(MezLFF+N#mK 1FCEr =#DK#2Rc e2BsCai i:i#iDca.#SQ E9C@YI" O\= e3B\(#SСl'k jG??bkHI BFGHIFe(sFFCbkAI @h+bk=IO WFQ&#[@&# #9x$# [B$##[B#&#DJVEB&# 2BB#3B#T#3B#L#3BEE#?A#k 03ak#H0#k[bk Ik F!<!`0r*R*xBxKp p: F F*2Bx0L<L< L <L < L < L < L < L<L<L<L<L<L<L<L<L-CmL#C "kI [L#CgI" [B![ OzwaH1 rT\LAq%eUlr Euad!V#%&#######EJ# > F [ #SY#C F [#SY#C 2J /I/Id!#t >z F [ #SY#C &J "I"Id!#Z >` F [(F1FOzs">Ozp*FFF3F 9Jxd! #2 >8 F [~'!ɨubM!Pwhn F F [-C)L!j& 5jCk"6%2D jjG?? bj ItO OE;h+;;`k2F!hj[jG(#j6i= I z0[չO ajH!ɰ #!@𵅰3L%j #JC"k1j DjG??bj &ILC#0kji IG(ki!h[jjG( 6E 2Bu#0kI'jiG0 2Bui!hH16EBBг.F! m F I0F MhO @!!Nh!F#0!=-OFMF0+FА8+BJ@ A#0+>УhHch##H#####oH## ##o"hH##H### Ma@ B; 0 O + 0g0M0Mܳгo$0+GИK0#0#+`OѓK5K0 #0 K *F> +hO;;+`0)hB+` 0+Eвoв|I {K0 #zIvH#Sv g  e  C 0+ހ$1eK@C! ?(0++hIF^M25 2$JF#,0S! # F#PHLKOqFOsEz@AFHF>RF1FF8F>~F AFHF>"F>rFFHFAF>YF"F(F>fFF #Cd# @!#d4 RFv%H#^IF@F>t: OsEOA gw GFFF`h : mNx!H<p~!H00+>,0+#H# $`h "40+"H"bBv F>2FYFF(F>F FFF> 2" "HAԡJFIFlH"0$ h *NЦF h  2h 2 #C# @!#FPH"OKj+ 1cQyU@GH !2F+FDH"lw.7OsFEr 01F@F>w 9FFHF>@F 1F@F>k"F>4FF1F@F>_"YFF(F>(F1RF y(H "0AF0F>F: 6OsFEOAAF0F>5 w6OsFEOAAF0F># 3It1"+F2F@!H}X!\ F!F I &`9F>$6DB pF Mk(k@ p !FALB#a1 BBРj"1(?h5IF5H"5H .ijB9@B0O5F5D k;h)F3;`?nh$IF$H"%H;h;;`+"Kh H ;h P;;`+Khԛԣj2F k!"~(ۆB ?:h IF H"x H# kB##U!` x!`!F K FBhBP00BHBo!`2N2I3L5hk3`KkB20Jhg"h'B Hc"`5`-H)Kh? h3'OhFO Jc'`B ۼЃB#DKc'`h;O cO 'hB*h;"FFJc F!`B/ p"`Hch3'  h!`!` !!8FM(hJh#`\`h`3`+h``3+`8!!-CF FCFF3:x *ѧoCB/H(F ?Th*IF*H"*H (Liӱj"!b( ?:hIFH"xHj0#aj2F!@F;(ۆB ?h IF H"VH(F.a} Hx6# x!`1$J#p? `#J#N`ZF"H(F5F(F>*F +`)F9F0oF$_OxF(&(F8`-n2F1(xxM(F@, *D+ILI>d(!F(0 Bp@B, F4D0!F30(M?hn2IF5H"05H(0;0+1Kh/  0#` 0+*I>( (H;(K\i@0x+?|)mh9hF_[ 0;0+Khԛ@IF F2?? H:!X! x!!ˠ!h !`p%NL3hh3U3`U3h`;3`[Kh C p!`!ˠ!-GF'L#hx . .$H{oJF(#h||xBN3#`0h'6hF0B FjF(0#!i #"#QFF(F[ B$h6 F(к!X!!! Kn:f*oB (КmQeppGIZ -OFܑ&nLء0F+V8FFh]ѻ`+Z"h E򔀶F`hOz  D0QF305(o?hUIFUH"UH0;0S@ 0;0+JKhGԛchUFK"`6{h;{`+8F.n;hZ:`x -"hB@E0FD`h30AF(?Fh+IF+H"*H}0;0+8&Kh 0;0+KhԚ -chUFch" Kh˱h8້[?h IF H"D H=o@F.ch "U#`!˼" x&!!4!!`-OFRMF\hX0LK#`00 8$EO#F`0ѲET,R+O+L;I;H 0+QЪh*NвE`4P"$`H:hhh2:`;h;;`3-Kh mo hk`:h::`* JhԒD FF8F(h+вE0CIH,вEѪh`C00$4 F,!˼!!` xK!]!!!FxF!+#I0F?hI*FFH"NHF I"p1Fo+x F!+(?hh I*FF H"( H-T Kh# I:FH" Khoq xy!Τ!OF FB ;h)F (?h)IFH"HoJ!" x-OFF F0F xt'tt 20Fq'8F"*iB T20Fh4-hDB(FF(o!!!!˼-AFxF FF!+&I0F?0h!I2FF!H"l He "!F":F)Fo(F3x F!+(?h I2FF H"D H-p Kh# IBFH"6-}q x!Τ-O$TMFxpkh;k`+%NH-FF#ѫ@>h>GIFGH"GH"#`DK`oj&FF4F+hZ*`x fBE۴FOy  D0IF30 >h.IF*H!-H0;0+)Kh _ 0;0+Khԛ U#K"`$ /Jh3`0"UK `0FE#`K hUh&FK`  x!X"&!!!!h!!`-OFDFF; +--=`9 (|LO3;`hB:zNx iAF3h33`x>h\pIFpH!pH3h;3` lKh  3h;3`+cKhԞ#i*FF> "F+D,MFlL0CD< +QH=hB10q i30>xhTuYF)#i@3D ",еhB5@Bp5F5D i0)F30>$hIFH!bH[0;0A0P;0; Kh?<?> i#U>`!˼!`" x&!!X!h-OFFFF)H%!&DyB { x405BI%H x ^+\(\  YFHF:$0 5@DO500 x00 x00& +" 8I"@ h#jF ` IZ>( ۽0+;J`0+;JS`]!@th  KZh B)iBHo !@-GFMFliO !+iB$4 F6FFi+ #"#9FF0FP F,̿4,i$kiBHIo!P-CFF0H:oL0B̿H F FFB (F4()i;F"F@ (-hLF@!KJh30 Hoa9 Ki" 2 #Da Y!B Kh30a8Ki@Ho !Y-CtMuOli:h`3xY2I +"*6` )ŀ.Èé..ooooooooooôÓ^0-и^ LD"0?ظظ @:h30 A2@ (I>,#HI "`CF;3>h"+@HWo F20ZԸ-и^ O3#DO3 3H>#.I "`CF;3>h"+*и.0/li*/YBYA0xBEz30u*К Xxjj;0jikh`3k`,i[B,+iBڤO4! !Xp@#Lc`ci3chh( 320`x,* ;* bh*F#*c`h ѣ` Z x;+`aBу !! L FF  +U{3B:!El!8F Fp>:hIFH!xHp F8##+ia x툁B <\+9 N0 3h8"#3`3iSI($H0F<*(F 0F9FTc I F,/*/"bU"Zp3iI" F !J1h8#@ C`!F H  U;"@hO1#@;R!'8Mha1da, *1I @B"``3x 3F30, *ћ+2x.*rx *0300FF0;0S+h F" jiFS`B#10;0++hԛ8FFF(o! -GFILSBhn8&E+(EBEA030%0FF@FhF1ea0hIFP#10;0+_ hKMѽ%2FAF H0;0+4o#i9F B̿z*F(0FhBF*@FF8FF03`^`00hB¿h5=D#h  8FF@FF !-GF2Lh2gaBF ܺB ]OO -4 '00F30%F0;0#h J* 0;0##hԛ6h=`i=F'0?Fbi@FFF(o!-C F*LF FF 0300;0+:#h 2 L#i9B̿h FHF1Fh9FA#i5p[9#10;0S hѽo !-OF`LF'#iB̿H F0FFUEX!{B ۷=F0Ou5D30)F7(]0hP;0##hhԚkEJAF10Fd SbF(y0>3fa0 (Cbi(FFQ(<0"!;0+%h9;(F(FF(M*i1:DB< y1IF>@hIFH!~Hv0;0#h  k0h;0##hԘYF*i8D=+i-hDPo!@ xF,La.3v01F30F=hd!IF!H!&!H0;0#h  0j`;0sQqjB .D#<(F#hԛ;x\+{x7?+7! x-C#Ll2CЯH!sF o!B=@B0 F5D30)F=hhIFH H0;0+#h @ 0nP;0##hԙ1%@!"p x +8"B!@B0.F6D301F(0b;0##hԚ*Fo= 1Q"ZU8x!XBXAt!+B%+!nB$۵F0Oy  D30IFq(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F|B0!B!EE.F0FF6D301F3(?10n`;03#h?<?>0nZ x1ZU1 [x (H1a+DB!ݳv 1F2 (?0n`;03#h??13Np DBvp{0++1{H! xH%FF+D++Q*>D!͘J1h8#@ C`! KF1x!+ I< /! F9< H  !7KL0x *7IJh+P1E *DH 0 *! 0x!+0(00HR-8u0)F30=bh%IF%H $H0;0+#h ; 0P;0##hԛ# x )"TV(QYxT!  x툐K-AhL F E1P0m (x /!ŲY-Y(Zf?gJp>U<W%EF Fn)p)l) x + JHEE1 ho(FaiFF( F+n*p*l*0 x +1 (`iE0EEaiFF( F+n*#p*l*0 x +1 (#B3caE0EE1#2+Ech+HwSx310Z Ho !%8,F(?r% F+n*=p*3l*60 x +M!i (Ye1(R(3x 1KN!0F(@LJ#1O3`J`5E0EE!+ОH"1F83x+H ch+Sx310[F(? x!+ѓH%E0F+n*p*l*0x +ޮ xH"8HTXEE1 }H!i F(ҮG @ (ŮG/V/(F1)F31(E0 F+n*p*l*0 x + EEbh*?%Fn)p)l) x +pRJx+?PIQH *zEF EEbh*?ݮ%Fn)p)l) x +F22+?REF EEh 4H,%EF Fn)p)l) x +1 2h8EE`iA#F( F+n*p*l*0 x +1  B?E0EE!͘ Rf! x@h`Wx(%3F+n*p* l*03x +/9FZEF0EEaiF( F+n*p*l*0 x +@(%@0@@aiF(xLF(pch HYh.'#iB?#FE۾BڠHIE0 F+n*p*l*0 x +41 P0F=h"+9Hb'0 !͘!Xpp*r*-[x +)џHE0x *"HE30EE2E#2x *0b30 iRF0;0+ƫ#h "" hB ( #b20;0##hԞ=!2R# gIX(C2Ճ# 2 xn+7p+&l+.aiFyF(i F+n*1p*'l**0 x +E1 a!2C22 2C2CE0EEaiF5(&F(ch+?h.լ#iB?Ѭ F+n*p*l*0 x +1 0FE0EEbh*?Z%Fn)p) l) x +êEF EE!ΰQ(0O5%x310Y)aF(?!ich C83 F+n*>p*4l*70 x +}1;3x!+ БH"1F7f3x+1+?`NH#vW/F0F(o#iB# s(cE0EE1+?U2+PqLoHbh*? F+l:Ҳ* x +fH Fai `D1F(!0x1;+<\I "\N`60`@800;0;%Kh?H?J/ #CHDh  C"!F"(?쮪 Kh+# "9F F(i:F!F0D; J+iZ # +?Ů!!/ x3!U!`-OO$BLFBMF0&h;#`>K hKE &`S`9Ho h0 `:FF\ >!hFb(+Ji +hO 3+`0F F+h;+`+"Kh \ "hFgB+h;+`+Khԛ&h  XFF$F(:F1F0F:( !!`!r!!!-O[O[N;h3h3sh3VHVoSL#hRK"`T 030S $(F(<+F # C |Ol E ^AKh v3h0sh;`s`0;0+a7KhV  S2 ܾ' `FZXZP :Dhh  JhPhhh`P`JhhPh`P` hQ` ; =?a [! {!!l!d!!!`-A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FDF#F!! !-CF LFFh"hB#hO bh8F P#50F h`0Z"`d1  "`%(Нp IF H2 H*`h ! x;IFFH  x-O]NF FF3h˹IrhK* FG()FH lpCO;#`o Ob)F6o@;?# FW&(pCOгhS FW(pCO3hkh[+x/+0(FWH)F FW3hCF@!F(F:(8~H"F)F Z(#FxJvOaxovOb!F 6 F(OajJ `\ `W(eH)F/!(F(Y/! F(SG9F@F:\Fo0ڧ o+EE X@O8S0*@FWxF蹼B=O8S0P@FWl萹 P1 BB T1BB?|3i;$si F+pCOyV(x!FF'F)F@F;RF!F@F; i+^й['OX8F8j%IX"F0;0+@F*F8F (0' Y/IH|WX`O ## 0#cf%E#c#cE /!P@th $m !xdqxv#"cdff#cdf###`##`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@:zIFH K#n Km KK+++KK#n Km KKKKKI 0 xf+e9eddiede{dtwt- (8FKh<jFHD\ D8!8FKh<jFHD\ D8!l\ $J@Ab AObUC:&hIFHd  ]Bh@AiJ@ B#THKJhhC @Kh# @ AH x!и!м!ДK\hjHVHFV!h0l K JhhCKAhӱMbBR # 0K! 0i 0KhK *FKhXAOrDp4\F F(F0@V!\!`!t!|!x Kn:f*oB (КmQeppGIV} pC O س_гO I * @O г`O% /  | @ = ;K-AFhmF,#6H F5Kh5Kh+9 #"2!#t0 *9FD&K&JhhC40F#KDhC"KhKhpCOѨhD FKohK*FKhX oOrApaF9 FF9F@FK0Fhp!X!`!t!и!м!д!!|!x!ДhF&"K(FF "BKh[5B I#IYBBAI[bBA5B 5B!!8Fh8#;CЪi Fij h-GF KKh Ff&hPP #;C0m+#ajvH 0tKh+BBR #'7K!\0iI i *h4ijaH`Kh+ !k^H !j[HZKh+ iXHh0C_Xj"TIز1C!k #PHakNKh+m KKLJhhCl0F7IKhh;HKh3pCO9hpC O0FP h]=Kh-K *F:Kh<Or@p8T FFiHFd|!I# h̐ ! !0?_j *H"IIFj8F:KhK0FhT!!А!t!Ш !p'-!а!и!м!д!!|!x!Ь!Д!X!`HK-OFhEiCj3DDKh+DKhñj3DBK FBJBOhhC55;hE FOi9N!i3hB _6"i2`#h&˹)F@F+FF@F+9F0F$(F5OEE1: C@&06hi 2B  E KajR*h*jDDVEF FO !X!`!t!д! $ 4!.K-GFhEiCj3D*Kh+*Khj3D(K F(JhhC5w%K5hE FG⽣i)F0F+Bd'FF0F+:%hFG #;CGE '0ajKj(FFE7hi 6!X!`!t!д! $-CF#Kh Dj4!Kh+!Khj3DKh4.h'lp.C ]i#;C/, 7Q2k;D B 'F0ijSj0F{Dh 8i!X!`!t!д $ FFFhFCF (C iD iK!hF6L, F(+F KpFh+&&8FXFO08s(I*F F`F I <2F)F!FFH> F(Fp!м;PM-G°F8p"! %F9""!9&DBҦ !F@FJFFH"tD(FBB "? i"!4D9p0KE"? h+a+F$#C@ƀ.8.$#.IO#@HKOrCF8RC@5O#"#h7??9\h+###.@o;`.O`*K)Jh`)J`+%JOC`OH$Kw. IGQ0B )OX.+OX 8!! D"}<!( L U*@8m!! d"OEF=`UO S;`y+FB:7CѸ=`.RFMFO.?~9 KMi+ Lch+ݠhOBiFTr(`` M! 8#LcbKi #"#h7 F 9Jh gO0h(( 8![ Ki* I O0h(K JIhh!{"~$!F FF&"F)F8FT($D,D.0FF FF&"F)F8FT($D,D.0FpFM Flh,Nh1i)FTJ#s`hB`3` FpT#s`l`D9 jJh j FIi 8!! sFKMlh, FFhBFGN#kbs` Fpsk`3i;+7(79h +=+)v_3I O0O3c`)vP"'#h69R'Jh8F'Kb*ڣj+!I"F!h6(,98Jh 3J-`v0F)F7CII#h0T(9 Jh # c` 8! 6[!fm|-O]OK F:hX, x*Fd}IV#0[bS#"F#0+<;h+܀!0FpO##oJVV,KF7KFOq@F3FOQ,@^J(h(F ]0ӱVK!0F##PJRJOQ 7쌩F T;h+'IK VHOSFIFV,7:\SFOq@FKFOQx,R4J8Ih5K 쀀!0F-Oh {0Ȑh.Kj;###JT#!PF#JJ  L 7 OqXF4\OQ$猨7*쌩F TpW,[| x!"~$!p! 8"~!!!-CXMYNYLh+#3`30 C#i+NKOOh8hAMKMI8hh8h5bhIIhTTFhjpCO$#C`iT`@Kh+?Kh+(h(!TPhTp(h("0 C #i+ ,O2H9hX)K8h"`5"O3`2C#3`)O#3;hj3b0 CML+h# h#+`;hӱKHh7|K"%hQOSI7F F(FI` # h5 8!!"}"}"~$P!( "~l"~!!"}"~P-AMI S|(8Jh " Sl(8yJh wNxLsjp+^0CZL0#qKrHheipI(F7(nI(F7(#i3+j)F?gHfHfKh;+9dHpaHaH`H`H@A(F(\I(F7ع#YH0O3s`VK"`O78F MRHQHQH+x jxOH)F s+ S+ Y+`i(aiHH{y+FHuĀCHmCHj@A(Fy(4I(F7r(+x;HX0#8I j6HK5I(F7X4H(F7@@CB0H(F(F#B8#(I0O3s``a%H)F"~ 8!"~$ L D'  4WY"}Lmg*:VYz"~KFhC F0O0  -OL =OOu-Kh+,I <,()I"FH2$Kq"hBFB8 I O0*(>0+I HOq$&H!FiGL#(  W) !FH J`Y x l! !"~-GO $7H0Fh95F)FB#кXO5(F +I >(L'Kh+&I&I .5FO $"0I!H[jG0iF RIJF$H%F2V kH!FG(5F H Kh+II "k HG(232! Dg!!"~/!MFHF'p1FHh/##p-K)FJ 'O0 MK0Fu")F7t/#X;9FK JE #p !!hF;`+ T7hZ` "ppG-OMO3F+hu( (+hjG(+h kxKhFF+7рL4 F FkF( F((O3uKh F# F(.@΀nI" STkKh  (ڨ F\(оbK4+`O"FSh(88ZJh iP ;+! FQKHIH#y/+ 8KH6JIFH2/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(U!B F(2? F(: F$('! F(!#y/+ e8H64IFH1KBFHKF^Kd0[8Jh ;hjGI" Sp U2@_("~!!! "~-O/0 /\M+hlG(+hjG(( "TKhF[RKhS 8PJh dNKhùNNT+hjGJI" Sm (ڷ ++hIB FlG(9KS@ F(1KS#@ F(+Kh+*HS((O;h C#HS찹:h0B`CXKhBAK#BA F#(! F(+Hi+K#B"~"}@ "~x!"~!"~t!"~h!P!!@"~`#y/+ 88uH6uIFH1trO0:hCmHST0+i;hKB`CXKhBAfK#BAYbO;hKbJ+hVZF`H43h \Kh [Kh+ (94+D +B;+;PHF+7@Y0CکP;h+?ծCO;h+?Ю"~"~$!"~P Kh+( (KhlG(۽@ "~h"~-OMN @BHFO31h02X@oF љ;/+2hI ? 0h( 73hJh  IhpCO2hIk(((ۅKh@cN8O;H0F(yK h C0F[0FT(QsI" Rq Mx(ڪjK@b1y28F/)FY2BcKcIF !FHFS;p(YK hZK!0BAWK!0BAۗ+PK!0!0F(0F*FIF0F(FK8h C-0;BK +<;+ P( H P"~(Ec"~x!"~`"~!!@!P"~H"}"}!"~p!"}"~h"~D|"FR4( 7b8Jh 5P=P!ګPAFPF(PHAFHZ!!8LKbh#`KhZhb`O IOC O5(F8IOsK``Kh( #D 2 (!!"~ d!KL#`Kh+bhOIOC CO0IOsKhv( #hh D 3(!! /]!KJI`OB ``pG!! dBK-OFF>I  =L#0c`(O9HF2PGwO{+F1FZF8F6Fg BzmK )FPF(? h0j -z / iB!#h(&"h0DaDa`# b#( K"`hiDa I "~!  dp&N-sh;$Kh+#I fO0p((K L%1h h( #haDa#Br #rh*5B I 3(ۄ%w( d !# FIiaFFSe!S-O 3S\ٰS<Qm 1EU[BC XFF2"O0(7bKh+5O 0 0FIFR2(?OzO ,UKhUKhRiRKhBu)0F  B,Iy2R(7<SCJ8h@F O87.>J;Fh  0F  (*7S3J8h O8BA BCX)s9F0F3(O8@FYBC XKEB RI;F( H 0 IFR( 7SJ8h 1B BBR I;F("~T d!I[pL-jMN)h hf( #haDa#Br#p 3h#b (ۄK"O0`! d"~"~Q-A  2N2BOtp FFD`aQеh+F"F5$LCF@jFEFD(F!Fd(O0!deE[B#,u2+OqqnBOqFЀB"Fq(FFiFDeaF !-CFP FF.(F #( @(ܭ-ȿ(FB0FFFIF8F76 'D!-OBCFX OThF88FRtPOz # ,v#*/5,v(#C$O0'73J[Fh Y@JBv8F"F(/d$Kh &C4 /*BCXIh)sYF8FJ0hFO E ѼD0$fvbDO U4BIZF ["~0!-AFDL- 2*s'%' h 0BADAq-#h4Fi*F6F+Da0B BA*I E (%K"O7`#Kh#hB+Da'8Fua(#6DBr##h2FF6F3DaKhYi)0F!)(0"hBDa܇!2"~ d"~8 Li#hB ٥i!*6Kah8@X8! d-AFO FL- C,=iB1F,F&DF"F6L-F#DaO0! d-CFd FO-v C,8hOyBv 0O,FF"FF6F#D,0f %FO0 d!-OBCͰFFQXUh 1F"hFF6=KhiF8FR( 7S7J8h -v U)T.I( 4K#*1Bv8F*FRr('0-fvD0&8FRb(T7J8 61BBTI(O0 T7 J8h U eM"~TIud! dF8*TTRV(7VJ+Fh *R(7H4Jh J#4`8"|0F(FiFR(!Kh '0B CXHh1BBB0CXHh1BBI*F q "~t0 FFiFR( '0Kh۹pCOI F52 FR(-6 J#Fh O0 FRH(Kh36J#F"~t%'"}𵯰FF6F4#g##9'N3h&Kh  FR6ꀻ3h[## J!Kh[##J!iF FR`6xhN+6tJ#Fh G/6j J#Fh =-iF FR<0 bM^BpF FFR p2F)F FQ(Kh368J#Fh  O0"} FQhKh36#FJ@h "}-GFxFF/+O80O/ (FO /!2tF(EЀiF(FR`@(Ff0/##piF(FR`鐻p@@O0&Kh#:F1F(F!(FRj(iF(FR\` (FAqa#jF(F`O&O0"~8-CFh#x/+ 1Mhh(0I"#k`O09 "C@AR0U*H6~#h"J3h PN3h B"'0`!h;FJ1*^(6\0C@$8F<@0 K$h34 JAF 4`D"|1"};"~@-AF FFFFR(@.Kh ( 1BB 1BB#I2F oO0pCOI F5Bh FQ&(6J#Fh  FR^(/ !F0FQ0(6 F(/J3FAF "~tL%j{S0F(4pCO)BCXPh(s U%BA## E `iF(FR,0pCO  I*FO0'0#"#iF(FNSF( P Q# 18pG-AF]VD,QT(6T9J#Fh '7Kh;@$ F<F2Jh(?+=( F .K.JhhC""RS 3 F#h4۱5 F)FQV( 6J#Fh  FQJ#4`(t'`g(t(@0CQ Q#0 '"~8"~< "|-OV @@2(tO )FM@FLFF4;+ЙKHh5ꈹKhs  YF FQ400pC O9F F ,X6𼀺"шKh+𾀅J#FQF N,@2 FQ(Cu6j}J#Fh;yKh0@$ F< *(@(HF4́+*dKjHh5 ! FQ(  FYFQ(6(`JKFh Gq F#R)h 2 F0#VKh+$SU 3QJBJA"HF#>z,FTPGWS9F3 FS#Q,XGG9F FQ(P(qh#"2###jj [IjYJij MAj VJGjUJZO "  m@F5\(4(jpCO`&س_XгO4г_rsh @Bj0sh@B `PT0j09K9Hh4x(X w O7г@OLгO#4S3###4$Kh+RS 3RR #H#4## AO@b4P(5shJjhd#  ##si"Z`"|"}  $"~$ R 8pFhF# J@ ,BO@v FJJb pp W aBK-Ch "FS>IJF F FCQͺV(S 3 #!<,!F@D/GF(F (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`CF F#s#844;+c$j FKѲ3 C "| KFI Fv4*I B Fj F2#" F^+ I B!F "} n    mS 3#F9S(0H# 7F FC22p!x 0?"hFr)FhF)F F0@QDFB*OЙB+0,08FK ,F+0 ,08BA,78a,W80%F(O0BB ;$('ѕB!CO0 0= (AqOF03W3kpQ0!ADqQ0 ЕBB$!FpFBFҐx)@a3?oBO4BpBrS[@`E!FBF )*OFОB+0:Բ,@Qp@p+0 ,  @p)@pBA, Br 4Ba:Բ, Eu 4EEpO0F0;D,&ѓBCO0 0; -AqO,F404W4\pQ0!A@q04IQГBB FKh(  IO2` "~d -A F-O!-LF9`!hy.Mih!` x-) !yO &I1 !q!ya!h  !`!!q)F0FAQ\AFFDF1h*hCFIH?$)F0FAQx:,Cx:+ KhBU"2`9` F*hCFIO4'0"}  x  pG hhQs"F3KF FE2oBoCA%,F(F!FpBxm*% b*k*x**"x* *w*ѪBrjaBRBr0F FBR*!B20`CDBpF F-Ax3$I O0F I NFI,!`u4 :00  `HF;x+,!8F1F#p=!8F1F(I0F$'F  4 ]"}(sFF@J`%(Fp< +4 FFK"`<1F"F5B#+U"}(IH,  x tKhQЂB` L I Ip I_ IY0 X x-GFFOIHF I  F@ F8FbCF 5 J;Fh 0F/#cUVF@B-OF/!hl(C0L?I!F(J%O.Fl#@,FF`;` cKO XFCѾKhKh_SJ)+@K`0C@?hz(<S ˭EsE˩EEEEEE˵˹˽EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE˅ˋEEˑ˗E˝ˣEEEEEEEEEs EEEE!%[EEEEaEEs%EkEoEEEEEEEEEEE%)-E1WEܐ\1K)` /I 0I` 3*K)Khx-*(JYx#``#$K"#K$J`#K#K#KKh+!H|0@ʀK"`"K` 0K"`J#`J`J`_"~4"~ l "} x!c h'0!"~X! y"~t"~L "~8"}("~< "~$K Kh(B zKK KKJ030Kh0(Ky E 4(FQF I" ;JhE6 NF Z` KJ_KKVKTxKh(?bxKJMKJJ~KJG|KJD{K~JAyK~J>xK}J;}K5hKhkK5{K/{KcKhMwK##0OtI`*䭸+SohFQIPF3X(ҀOIPFx(@̀RFKIKI3H(@Ȁp4+#OFO }F(ѻ'8F3IPF3#B0+?qRF0IZ8Fu.I3 (Z0HFO 30e"~l'0"}"~x ! "~\ 4"~4"~d"~P! "~ "~| "~,"}(\a"~ l hE>I"HF3030'8F O FHF#]"9FHF(#RrK#FLF'hoI8F3x`ch+?ծ04030"8F4(߭#F>X{_EF'h\I8F3R(h`h(?ܮ4!(ήTI3@(gh/?ˮ4PI8F36(FNI8FVF:FhhEF!(ڠ !}(O @FcF(ѹ9I8F3@F#.0+?:F0I3x,I"XF3 !IFXFO 4!8F LS0$KFFgz;"J%XFKAFG3I@J `K`K#@C %IH,@I0;0+򎂰1 A > F "}Ǜny xz*̀5309<{TZpv%+~#&QS)D&MD(hK)`?*hI 7K"D`K"D` KDhK`K"D `KJ`K"D@`K"D`K"Dt`}KDth0ޮIxK"HMh>ϼDdaЬe_ +ؾ  uI# `tK`*``qK`rK`#+``mKnIbFDdZKhA(DTgK"DT`eK"DD`cK"DD`D4KM"+h]KL#[K`D4p*h XIcXIXH#WITH4L#TIQH.PIRHx.h  5C!F*FF(R$* :* @AC(Ь @A#&0F2aF0F-L#h;#` I:F i=I# +x##a x;x{!F8F0%2I:F L=/&a*c* C*M* &iFm*&iF$I;F / Ft#iC#a#И0@F0IBF#iC"a!0BA I;FBF  FIg#ca Kh` ``hTa@|X!"~-CFK FFh@= F2W! Fѹ I  h(1BBѽ@F#dG%"~X Lch !@W``( IO0"~wCK-OF_h/YX4+J84+EB0CX@PF2^W!F\F LF2BE 1BB( i, F(( `xU##:9G&@ ) FyI -O0!h @@B.. 4+ ##4i;a+i h0V FS "~"K-AF\hS8$*-4+);+&B0CP@Vh0F2 T!@U 52EBi qBB F+ѽ h0 FA"~K-A\h&T4OV_]/Fi8h8F-ѦBѽ"~Lhs!LGPK`0I O0JKh S BB L h' K`03#h Jh  hNv "~"~"~  Lh !@ `( IDO0"~ L#h !@= `( I*O0"~QP" 07@ @B-OZNF3h+qB C XOB0C XpCEBQFCO#CFGFF(Mh1@Q"F( @BBa"(\V W (RhaB C`E` !BEBi##B0CE0  BE""C"FBE/ X##h a`I* bI ^"~ Li !@=a( IDO0"~-CNiñ%O F@Gi\Yd### hj5B"~-OF-F'K0@=HF1X! FSFYEHEBBЛj+0 "F `v(H%@ FI Oº"~(-AFKFFFiԱ@=(F1T!@!jBEB!BB(FO0` h F "~ pGF!KMFFh{x/+ iF8I*F i MF( FhI*F [, F M@(F2 `(s`## ##07Kiab`"}8\s"~-AMNOilcha3h cjh h;h C #3### h Kh!j h< hG FDi"~"~< FF@(ȿ@8FĿ@  FFBL"DBD1F eE28D[[-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, F(q#"#0(_2FAFBLU&`##0S' aC'@;#0r2BB 2 Jh O0 M2FB2J2FAF1 (B`CXQh BA 1 2 Jh  Fn2JI "~ -CF*KFh7)I8F @" W F5 /F(70FF `p(F``0G(@h,!h0F1(fh(F1F1(0F(F``( I O0LF0F FI"~5b}F KFFh h@"T @T!h(F1|0ah:F(F-0`h"~p%F(O0BB.3O.O TlhTB!CO0 phTADq039Q0#B9FF0OpB DB0[(DDK-A]\F@. * F7JO.#BD#<x/+2/JkF@   (AO0 ]^*) .'D|3F^D?)D3FO<p\'JkF@   (JkF@   (ڽ JkF@   p pFh FF*F3e-p@(e"NF-F h#(F#`3`pF F IOa KhOq pGOa"~0# L#`\3  hX`ah!`!`(̿  0O0"~8FxO08I"1Kȹh2"` IE"FOqF(F O0"` pNrFر%hI(F1dh I F1뀱I#F*F  K 4 O0p3h;+I#F*FK"` 7AG"~-AFFOq0F0O0BB! FU2S #840K;+bK@A @A ` @[K "dFBH"F (lu"F<tm" !@|??Dy`" !VB`BPH`BPBPBpBH`PSH` hC 8 &2),1)9Ж($/5);#BB4#($84K*K) " "$zh'TPQBCqR#4(4C C(43y/+!#3q `#4#84(4CCBB($BB!X$zhQBCA #"~"~-CVŰF4;+: 9("((Kh;'8FETI( T~I(T|I(TzI(T~HU*O ]h4#3# 0 !#5(ToHU elM#5ɲ)C($ #! (bKlV !Z ! *B 1%(# (TRH6#$0!# #(TJH* * K#1# Ad" 0,7K$j# #g(T;Hl2# *,L#0+K!jXBH : CAs05YS$0%YB C?|T#I( *0#7#0BCXQh" KBH#  ": AEq00 Q$0  B)C"~ Y  9 y     41> <#(TMH"@#(TGHFKO  C' S #F(T;H!<!ܠ@ "+FQFF 8 "IFQF =.Oq0F*#F(F}F0T Oq0F)(O5* ! N($@4 +?%  U(KBXYBq*(  "}H  p]F FBB!hF1 SI@B 3`, J -kF C#SbSb<#h3bhF ]p "~8F0ZoFI"F )F F8@A Fx-+CxI(FvF`1h|I*FF bO07oI+F:F T0F( FF( KB L' F F  ! L h8 h.@pG"~pL,FO0p KZh*!FD(& !(F.U- p"~3S[K"`KJhhCL#h+I ,##`KI Hh)F HI 0@pG"~"~P"}"} x"~$!08!HL I M(`PI F h` 8(h FL: Kh+J  O0!5!>"~!@"~x s FSkK"`KJhhCM+h+I #+`KIHhLH1FH, F|IF H> I p@pG"~"~P"}"} "~$!0 x!^1IFH $!d x0ͰHF$ FM0x/+I(I F(iF FM00H&M*0 &1BB *1BB!u!y!}!Jh3`pG"~1@IFH ! x-CF=OFF|h;I2F;H9L F.*kh;k`+M(F bF F (R$ Y\B\Ah#$ F hpC O!L(1<h+Шhzh'H1F09Fti +F 9FF(j GKFHVTF(w#" F.Cn POR1FB 1+ytL FLF(V#" F.CMOR1F8F1{oL FL(8#" F.C/vB .w{Lz FL02Fy Q FFOVO 2FLpB i 3Fa[EFy Q FFOVO 2FLVBi 3Fe[EFy Q FFOVO 2FL+ Pkxl<+=+/ Hkxl|+#F dkxl&+#F ]kxl=+!#F V jx+*k' Njx-*k( H) F% D# B$ @#F =#F :,FF  "E9""""#1FKHh"#aKs[hM.h+` K.`0FH"xK*F1"` F.F F0hx0h3IxJ\ HL3(F!Fp"" t##E9#pFFF#- do[ls 8H)04 |DHSBHO)Ѳ??=H ,/FF Fp/FJC"D@`?  !,CC@?  !A\@C@BpO!!FBAO!!FBABpBBO !!FBBO!!@Y@C@###-OFFt0%+F F,T G9Fv0&+FFH##FT1FG;FFPF,CMFDFF F(F!F#""K𵍰#FF#q,F F;F2FF F(F!F (Р +Z9FF F/. TF F F FJ!T" "#8 FMh)+8'!F"-ObOFFFFO O ,o,w,5,8YH,##\FF$,u ",1FXFh#+F F MH.'+ػnIH`  HD TT'+$`.ѻ'9JOO6#3FEcT" F F## jJ #%#3FAFFXFjC $,F##3FAFFXFYCCt`.8i',JO6$4FdOFT8i""$#$#-OFFFF@##F9+FF F@+ FF1  0E$"F@F FECF:F0FF F+ 0E`FF&FgFF--"#a-CFFh +F F#F F0+##FT1F G;FF@F,C C$$%(F!F$"-CFFL0+F F##FT1FHCFF8F!C(CCO$,F(F!F"𵇰NF F FaL!,`툱CxI+уxN+ F'70 !,P(a4`a`!+hF F#H0-(F!F"$@(-GO(Mh7'L &K & hh0*x  0;Jp0+k +0+xF;F=F+{#hSF K(FhF F H*F F ,C  kM p h"$]$\" Jh@F#F/))`!`"0FͰ M0x/+HiFK0&(FK0 &1BB *1BB  $cpFOu(F)FFNH FKX` Fp@ F0h"+mF0hnFHpp"$epF Nrhr Kha H`F (Fp`p Fp@" $y-CFpMkhchkmL #h3#`kh`#k`#h;#`#fKh lh\h"cH ihbH"  _H!F 5 F8F\N.x0^9F(`WK@h3`;x/+ oh;F7x*FN-3h3`! F>RF!FF(R-5OHFS#{b'IF0h " hZ` ((3h;3`#%Kh h! [`hG3h;3`#Kh -И0㱣hӱKhK0h H KGh !-'%xb" "(](q("""( tPK0ɰhh##*JK0ӱhHKHMhHK0h fEH chCH ]?Kh !F` 6K`hFF;VF˼-ѐ- рx8 Kp(%F (  0 +QD"x0+?;+ JB?JB? ! (GU'ex03+ (x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + }K"Z`h`@"` C O3wKk vK!h+ f(@hpK+`oKh3B@J h +Y\#x0xbL9!`` `I h"c2 `^J!`"]I `]I ` b[JhJ"JG`b PK` TKUJ`UKUJ` # RK`FK"Z`* c2@ ;KB@4+ 8KhQ`hR`"`*@X!m;K&0++ѽx0C[hh3Kh"`"%KbIGF)(a !K` K(K`Kj*Ob@F F  (zCK`Kh+b_.0Jh;h`3 FFHKh+y!c """8""'(  l  " t""(F+`xtKh+sJ bI+ oKpKXjhoKBh +` hK  j^!C #F T]L#cb h*@ y`bZK"`ZKh+?. *RKj;I! OJ`OKh+h !HN FA P&5F"+h`#`# =L;3`3`#h3#`;Kh`:Ih  N#h;#`#2Kh +!(-'Kh+&7 8 B'K!`'K`'K`#K` K`&HL+h#` Kh +` bz0PK`K`hK`LB Pi3az H|"""@""""""""( & eJi ;ahcL3` `K^H`_K`^K`^K`+h #`ZK`RJh;`WKh*""2QKXj  QNKh+ # JJBJJB@K!h`#8 CKh`h HV! KiBF)"hxc*""! ("JF+PiSapG"K/!0hF3*  FI"H!F"pCOH!FOH!FI (PCO (F"!FF(%F(F)0"8) ))+p%LN(Feb3hhñ3hh!F&c(Ffii3cafa `jp""(L HhFbi*i8cj i:B"`F""a" " pG pG-CH (9F 0 FAFFIFF IhWq"F Hh > (#  FFFI.h/ W)F0FT K`K` F.`""8-OFhFF/T* F%&:FF;:+гB@F ,\D0B&B@ F\DZF9F-+ٸ#!J F-hS`I*FF p"<)^ -AF F*sL$>Kh3"1FhFFah5H 8F A2H 2H )0H1F z.Lk hCh;C`+B b"hhY`*"p hCh;C`+8 T"hhY` "p4H H1F -M`h+h3+` @FhF+h;+`#Kh H  HH1FhZ`hZ`"8)e)})) )"")))8FL h0*xxB%+`h8)F,n(4K8FL h@x+xB)F,\`h84J K "0%h I:0Q;+г(,۝rh "D-CFL%dd#h3#`|-#h;#`Kh˱C-0[ChB h;`{8h(5+0F"""D "K-AFhO6Bt%3xF+B:*,F:)*lM+h+"..` F.`l<:+5F*%*. H9F(.F,F.$"8 )-A&MX+h3+`|.+h;+`˹KhA0+ #h`h;` 6 F00 (F#h;#`;Kh#0@ 0" t"!@0+@h -O&F7F5F4FHP xc+,C-H:-H6H O 1O~ .O +*<*@*R*;**** **"8****++1"8 -OaLFaMF#hF(h9#h` .>Њ.؀.:.2 .'/.3SI h: `*`kF *Q"J]J]JyJ]J]J]J]J]JJ!F@F=J z9N03h33` hxK3H F(H$h,"O /*ј0/+ F"pj/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZFB*`B*` p"" t+>G=-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`53h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33` ci3h;3`+;h+""""7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +-# "` FF-h+x =+T Kh-+x+KhBۛhD: *G;.0+6F0rB-F I"FO  h(3"&sD;+K 0 ;+ ۲ +0;0#;0;0R ` #F"""""G= pQK-OF[iFK G`sh`p`JKF0OZhVhFK3   :DEѸ#x+ pD`F xɲ)\ف(FMF Q((K+H(TEF(FO 0CD`th `p`@l 1B- %F'O) ,FTE"x*Ё* e%FIF((й HIF(l%FlMFOF,F""L +C" M L Nhhha#hh3#`#ho`;#`+3h+a"""8F+40)FFb KjD``b8") FOF";F;#9F`F0FFahhh+(5`.F*h2,`2F6h#FFF4`&F#h+%`F! ȿh1-OO FFF[غ*Uк?Hк "x*4"xRE4V' غ\"x*4!xBx% xҲ*Ak"x* bx:@ 4"x* "x*4Ax"xQБB4"x*4+Cx+*+Ё+xҲ*?+[+ѠFF8F?) *@߀bxB44"xB{x+ѸAx!)^)lт[x.-?u]-!)^)]ц#"x*+WЁ*UcO +xxɲ)@*?R[*5FW:)YNI(F(QШBOqx)ѱx)HШBFEKY\A B#B " pF K .F+]*[E??7F4t:F>F#5BЕ  85qE8*\*F5F*x-*&jx]*#Ё*\*5k#1 B( #6 6(ؿO 5BO 5F *?OFDF*"+GE9-OFF F #x*+N?+L[+@cx!+^+'ѣxx.2]*<[*&Zx:*&Zx^r]*/*Ё*њx*/*/*@#x/+(Dg4c:*њx]*À3F*3x/**3SxҲ*ف+4 UL+FfjxxҲ*ف(1 x+ 1B`j)`jG\(BL$BICBx/+E#'>KAJA`pRF0F *HDSذ1JO,i )/L+J#XF3x@+*Kh+{$O C@*~uK 8( h8 `(hCO ` h8 `( hC`JCJCE9"" p t+N""G= ( 8(hC`o~p8( hC`pr}eJCxbJC$O \F^N1h#0`N -8FCK[x+RH:F#x79)-KNIM3h;3`+4+hZ*`"p8F*h0 RFYFh*h0CYD D *`32hD3`u%2K"Fh2Kh: C+`#p-KRF1F8F) 8Q(#K*h"Hl[x#+:Hx3F`+H7;x:3F78F :Fs-ЂihaRx*3;%KY"" p"+f++-O FFОKZhZԛh3Lt"h0+x~+(F9FFO O #.Fع9ع:P=L I h2 `I h: `*q"hQ!`IF'8!h"0HMO rKO F *  i=Vkx+Ѯ0Fkx+ ѕ0+x@++y=+ ObVJh;`+#hZ"`"pOGC#`#p KJh;`+ #hZ"`"pDJh3`0C#`#p?Jh;`+#hZ"` "pC#` #pj#h B,* /I;#` h2 `O O 5F3'Jh;`+#hZ"`"pC#`#pN#kx3۲ + 3h;3`+#hZ"`"p2h:2`*"hQ!` ЮmC#`#pfB"`Jh3`"L"""  p;Kh+!#h B<;#[jx*Ѫx**@**y Cch 0F9@C<F##i :F@hSihap0F!I h: `*)"hQ!` IF'z8J!hh"H{Ojx~*K=+?D#9F0FtB"`B"`.F"" p-CF0308``K,ah5DVDM ,|,!,FO B ;h"pJF)F0Fc(fфл44tO BӔJF)F0FH(K#FНB ,* *Fx)22B8FtBJF!F0F&(AbЕB <+ +Fx)33B8FJF!F0F (#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030{C;`#p" p"-CFLFxh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FF F5C#`p" h p"-AF-LFA,H| hCh;C`+&"hhY`&O"pB"HAFe hCh;C`+"hhY`&O"pB hZ`W&6)DhZ`W& hCh;C`+ "hhY`6hZ` ++H@+H:+KhpGhB`  Kh) Khj3c1 i@ pGh(h pG pG" Kh2`Zh:Z`pG"-AFMFlF+h3+`0j  &0j`bKZhB`h`h$hB`g+h;+`KKh3A$""" K-AhN,j3h'i33`@F)l`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x*h+3h*h#+BF!@FES"!@FE($H3h"`Za2hchQiWa Dc`F)F+ *!!h:`*;#`+#+p#.x+pK03`hKh!.pH`"`!`!)o " l , t ,8 L#h;#`+chZb`xD#h;#`+ڽ@9"8 L J#hh`hRhaabhZ`#h`O3 ``#3a "FLFI#h3#`~"!(FEN3hh(7hi`#O`a K"``#s`#h;#`3Kh@9"mI ""F-N!F3h33`E)H)FGF~xpCO)#" F(*C!" FEj(F I"p( FEH)F#" F#(C FEH)F FBE H 9Fp3h;3`# Kh +",R,`,e,,"FLF#h3#` . O(F}`) K^`#h;#`8``3Kh@"" "pNM4h+hh3+`(i#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@np """KhpG pFNM3hBpBHv ",8ML+hB8 "8FPM+hh(X+h`8 KhB`pG %Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` "! :`"<" ,s, t"--&F0+fH2K2Hh2KaYC1%0N% !Ow3h33`B 0B(%K(Hh%KaYC103[h? ѻB5!0*nh(ЋFH OpO5'; 3h;3`Kh@Qh сBU`p2"<-NOr5"--u"8FM+hB+`Ћ@! F]+h;+`3Kh8@p8""-OFFF 0hI FOOؠE`BԺ; F0#0%ݪph1FRFKhBE?  ++ +E :0+ї0+k8Fx0  BmnKnHhnKz@hZCB]а?\O B -" "!cJXFXF(Fh  3h^J!HFHF(Drh  Q=XIHFHFO (!FDXFwch;c`+ F'#h"`!F_G;3m># fW+" "=J!XFO#7J!HF5J!HF(OsB "IF_shHF(DD(H  @IFP˱ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#h6Z"` "p BFI F!-"< Or5--------0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8F<L4F69FPFi(((F&jKC;Ԕ Z) "R,B4HH$ -."<..$-C.N/H@3ic-M.O+h!hP0F#*H*HF!O1h O A$H2yC10CE!Ch;C`+#m hY` "p F+hh"[h*`+  H 1hZ`"<.2"Or5.C.3.e- '=F>F:H0s;D+7Hj(p(g(F'%0Khh[h .H!F`+Kh+KAYC1*H&0FF.)$H $N0B# kC H5Xz0hCh;C`+1h0 hBԿ # #P`p0;! KCX0hBԿ # #Q`.F.m.q"."K?J` F F ;K`/i..9KN0+A0˹EF)F E讹2K)Fh0)h3@RF+H30h!F !F "K60s!F  !F !F /K"a.!F !F 0+F(DpH)FD<( I .""""< t -&. FF JN js0+""BO0Eb"F t-OFF #`hL@FCF( (F)h+#h+$|0300F0"B/00MKh+~LK60[ BvѺt+t"{qDK!Fh0;0+?Kh+.0РO rFSFO BӾ АSBЀ0!0h?ЩB Yh?= O{YE/Yh? O{YE"3AO1Y`!0`FO#P"0C0EOqE"`" t """<"-GF F F" F(.KN04,N0hPFEB4hEF F0)&h@j"F HO| &@0BڽO0C0C0 F64Д0ոД0#0*F!F8F t -&"<$ HChM,+hhјxFH* l(p(Z($$$ K6 "0 D@Nx!7h."FF8F+h*`Xh(0h!FE.". t -O&OFHFїKhhOZ"0FFcH1Fn,p,H>hO F!0FH1F$к$ F {JF7h?!'T;shh*݀$! 9V-@.+"F0F h8A3C!F\JF(0T<0З0+!8F?F. F0FhKQK60+8F0^C0KВ?м<F X" ѯB!(F0F~s0 ;!KCX/J!  *(Fak]?cWF 2S) 1>0%-?; *5?2 *-(F$&$$ "/"/ ./! t/-""#;F;+9jv UJ)#>;*;+\+"э0\#0"+рF;+Њ+؀+=+Yأ"Ҳ*o%H"0F7J JFFHF  0 CoCE Ё"#)J rF;OOaO}bF"0 +J$#"#I- K IJF%:#s*0 }+If0 w J$#] J"#Z*FX"</g/H/_/d $/i/o/b𵇰OFF,mi+j%h-$7]rEO""   XUM"hBJ!p(F"hh:*+߀zHB`h!wHwHh.F`h!sHh%`h!oHoHmHdhh=޹ch˱iH hh!+heH-hcH`h!waH dh5F]H`h!gPHYH~h!\hSJHtSHqh!ODHiOHOHd`h!B>H\JHYh!78HQFHFHFHJhGDHD`h!AHAH;chh7`oCBH4&, D4C hp$r5UFF-8F ApG, 4S l)F@FDh(F&F0-OK"M$` #HF0Kh+hHp/r/d/+hx,h#%8$ F#!H'KdN(F_J#Fh2`$"  C(F.'L&h.@"h2"`FpL :&#hDE׀#zH"Fb!h"(h]U(@_8F \\+˹ FC(ѝ J+ KEйIF$@(:[HIF$:(@𻀼$hh2h(N:2`QHh:`*:[FF},Ѹ?wIHh:`*[FFkF e?c2h:2`* [FF $MyF sF A,I(h'F:2`*XF0.$J#5h2`#OrJ3h33`p"(h" " YF$(? HYF$? i "4"0"0180" h pI",M$A4 -A&wHdF(@030CFC0;0#kKh 7jKhh-|.u^r#5F0#5kDw" ,`5kDx" , O <^r#03F3jDw!%3jDx!3`kDOHF,\r# 06kDw",6kDx",;H #<6L h!#h[3H'8F&d/H!F+x0 *")FF@t0;޲.'H)F?BB+r H)F0(F30JF@CF0F0;0# Kh wN(h)FF HCC1<""1> 11N1T1s1"-O&f$5FHYFh00BфKhg[h˱HYS/a/H/EE&`` s4<`^x-.ћx+FxB [x :+V;hRxh*<,Mѐ:2"F-H@`F%VF#F=`Թx:+ "F#H@`FO? I2FHL!FH$\xY:, 3 FI2FE3;`YFH"O {F=h %3wF I"2kF%(F5544 45( F H5 K( Yyh)!`aYqK;5""pFLcj x9ih px-)Yx)aYx-)ѝx-Њ3]xBRxF:*[xiah Ha( HVxP:. 2Fb%eb"5P5=-C [M Fih+}PhWHx-*l4hbaih[h PHx-+0FD ,h$$+hB,ۣBDH8F*hAI h3 `Fh #FB"ӔF#FB#o #D4 B#DB#` h; `#-Kh 90FSLSLS B F0F+hBH$OFh+`:hF2:`$thYC+*;h`;;`+~ Kh+?yu+yG  "5f5w5""5p L M#hk+p+h&;+`+k"hk;cq X"BhF"h,#FZh:Z`F$hD`8FEhkC`+݈ #C"bZځ"h`8F !"Jhij`$ XF;  pGxɲ)ف+тF3۲ + pGxFI\pG\?+ pGE9xFI\pG@ \=( pGE9FKHhkZ X6pF FFa(F[h(F,KhB`KhB`p+x-+kxO3`HKhkku a""6 X-OaMF+hE?F:x[HZKZJZNhhh2`+fѹ?:xf*3h;3`+O FLKkhKLK(hha\:*2`/ (F02h:2`*'+h3+`?F2h:+*_2`۹ +h3+`?Fњ(F$F2h:FF ДE-BFFYB ()h1)`h`C ( Q (|+h3+`Khh`s["@F_ *j 6 p h" XKFhFlFi +їi8F%;F (JJ"! F% F% DnJ3F! F J2o-Jo X67 76𵇰F FKhX*F! FKhBF%OY KD1+ѠFC Si3SaFKD1+4F6 X-Gʰ F%Kh[hKh}K)Fh FG8pK"!hZ`nKF`nJh3`+ F2gKhF&xcK `cJh;`[+/%h-@ 9XKh ``Z`*`VM /h -hF+(!O0wMKh+FKHO,hHKh00h3 0"``(FM (?\(A-3K9Hh02 (F;h3;`0h`[h["-0;0+\#;\(`($(0;0+[F;h3;`0h`FJh;`+#; Kh (VBF!RNF,FIY X" p" " h8"BKh#h+S=K"hZa7-%>(%##`TF(F(u0 Fbb00Fa0 @(FRF|(#&(###`5%u<(>(2&(.##'#` `0 (j\`a0j-("`00F`\bV0 a)`##F#*h{(2DK\8?K{O *`O+h*h2*`h#(FRc}(F1K\ 08 (DR}(2FO 'L L)h_9)`)1:!\F )h=#9)`)d(I)h9)`8)O:0O {'shY  I +F##` Si3SaM dVF0F0H5 t9 X8!M*hQaa` S+h$`H(*h Si3Sa+hh+hiHH8 F X9"FqpGChBhKFhpGCh hhBpGh"HF FFFch```v`FhF@(!H!K7ih8FBȿ`#DF F9F F@!"FF(@! %! % !F%! %!F %1i*Ff F@; dKXh8 pG"HF FF)O@JFBѰB0F@KhB` F)F0F@HpCO F?$#`&iOr@aiOr@ !h.=0F20FO@ *F1FF)H - .0# 00;0# Kh '#)F0F(h$^h*F!FF(F?P4F@0*"! F?0B"F"@;p d t;;;""pFF FXO0p !FFH! F?BF.$ h! F?C .$h}!FFHK@CP;<p-AF"FFCFB#O"I2F8h. KF33h8hc%I"FI8hAhB BF hCI8h eIF,h$-$ 6 <<<<<<8 !MFh?pC Ѫh* b ! F?fE KhB`8 !R F?XA " ! F?PB" ! F?JCH"H d<8F KhhBXhFhBch)FGh?:`8"H-O$DF 0F@ qKhF`D``ܱ 0kKkJ`0jKhJ`h0BdKhB`3h F;+hB FF8 j!FFXHk! F?($hF@ FGB(` F? Fjt+pxh!F{(j! F?0300(  +7K! Fh0BF2?CF'$h+ + +$h !FF*H ! F?j $|h+0"! F?^KhB`-"!(F?P*F!F8F30;0#Kh $030BF0Fvh-$Fh+"H   "<= d"""-O%JNFXFF#U`3`9FJ FA:3h-I(FHF(=ь,Կ##Wk.m0F[F0FF03x0+x+0F# (0Bc0B_iH1Fòs+v+fHV-POF;++-+^HD  PF"F1WHQF BPF#` C 2h"FI2` F#BF!4+hBCL h8#hXc-["! FiDBF?up "O2Y*,$\#`$Xh!FF)HO2"! F?00F) " #"B! F?0$0h!FFH?+#F! F2#BFHS , M'( =4<=l==9=^ ==="'0"<$F F)^ h;+Z/O2+UZChֲ;C`+#hZ"`p+h2x<+Ѫh+h!F+h+;+(i!F>+Ѫh*I F+H!FH!Fh*ch;c`+ Ff#hZ"`-"p I F F;>>> 8F$|K,hh hrJhB1+K"`$j`8*Qh)Qh x),!" D" K60+,KhK`"X"" tF F@I F0 F(O0>wFP0J#FH !DHH>"d>|8FYCh;C`+#hZ"` "p%(FIF FH -?- H!F?-8!%ch5;c`+ F#hZ"` "p>>-A$MFO+h>3+` #;`+h;+` Kh{A3Y;3Yx#0YdF4""X" Jh`2FpGXX x3 pG pG"XFONF3h+L[h+Gx+ %%HKh+a/_-],R9,B,M3)djF F$00\+L-`YBYA F$|0O&DR-! F:<#>,33H$B#`"iF ?3%$+%KN0+%!K6 Jh0+%K60+%%,%FKN *, Ф* ٓ603)ЩB! Ib #@R CB<"X" t"׭(-OF FAѓIh#$(=lhI F#(𱀎I F#(5'I(h#F(@c/6@.Ҁ$=O Um?(F@ȀzK*hzIhO (:lhvI F"`tHtK!hO HF FoI"F(^mOnMsh+h3+`ph&!q` F+h;+`#dKh 4@,#;`(\N$%FZh[hxYH(F4)FVH ,UH$u5@-QHn$kh{khxcLHchh FFHH4@,є&Fcx>p+''.ـ5L.@/F4N , $,$[h6H3 F5F.HX --H%%4@,-(H$'/$-(HO R/L/O D0+?#H-DH0CH0FFH >>> ?J>>| >"X"">>>>>>>?d ((,030 FHF OZhXh&D@!0F0;0+Kh+?/?t/nKh }(h(f,h#x-+cx+$.?]5'/?W%,F(""X-CFK"`kONH $, -ѽCCY0Y0x3hAF33`x3h;3`#Kh Y4"X"\""pF LF#2 X,D2;+!(F##2p"XKXmh+(x+ pG pG"X-C' L N131#rQ3@+1;1qUh-hFX2(FaAFF(FB+hF"X",K? !8 pG"X8F M\2B ! ! ! \B8"XͰ#IK`a)8X)42d"AKAJd2`K ! ! F# """b>*##`" >l?!F>+P "@S  CC "X","""K Y"X8F I'!F F `]8 8BOrOA ?h8 M Lh#h3#` :#`k`#h;#`3Kh8@Ծ8 l""-AFF %FD'*F1F@F>- F7 /`#Rh+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+d3 Mh+hq`F3+`hc``0D `"""8E F?C K[iB F8@ch;c`+ F#h*xY!`p8 lKiܿ lKYiֿ lFfH:!Fb?R]pGKRi]pG l 0 FKFR ;C0!Dd#pH<0@pG-G F'!F8sx+[I0FP3\ch;c`+ F#h!F0FZ"`""pWch;c`+ F#hZ"`""p3x[HI0FV7\0FyF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fy#hZ"`'"p'=F??h lKYi4 lHEK@> lFxr+ HH?@h-Ah h2xh+xB,K=!0FhKh0=!F(F@B!'F=++x;/0;0 =*+O%p=F)F0FA??F/F5F&F7p p h"ChL!2hJh FH F "@%Fx B #` Of\ 3F[EB{]#@*`E9-A("l DF: 0('FF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;"8Fx#8@HIF F!B H!F8@'+He,F#x+8'! FFH!F"FH@-@0@H@K@N@S-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`@Z @^-OF*LFF0; #0% XkE"K)F@=& qhղB IA%`56h;FT ZFK""C/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O"7` KDi,hB Ѡh*FAF:.7`'F$h""HKFy F!XDiF0FF(lChZ `0F#r!:Hg`h0F@4O:h2:`iRsq Ch!F00DGkh`Ѩh*ikh2R"*a T##"#$TCKFBB0 ;h;;`Khӱ@DH$E $ T5Fh`` t@`"""Kǰh!Kh$@ K` K`G]K`"K`B""-AFF=!F HBF!FG(F?cBF+$t="+*U"Zp&41F('`(FA 0F!D;@sKǰh!@#K`G]K`"p>L0`FN-0F x0"#`0 BF p@"@(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp". ] """8 t"@pF MF+h3+`T+h;+`sKh[p@`hp1F?$hp""sM,hLH0h `#;0p@Ah 0Fx0Fh"`` kh#0Cc`h#a`5p@"AT%O-ѽ@ch"h2`Ԡhch F4h,5[ՠhch#@c``&F""FF BhiC՘G(h3DhFKFh(F"F!FmFرCh2CiՐGph4D gh)F8FB0=!8FfD F$hh" -CO hFF+xr+'':HDFX7Khh޹А$0n,p,Ѹ&/(F3O&)Khh-#2F9F(F F/Ch H*F$Ch;CC`0 h-!(Fnk\=+ 6&pCh#C`.:F1F(F.(Fe(H)FAX"A[AzF"FFChX)8M*h2*`q#c`+h;+`#Kh ! DRx I"8F^ch#c`chCb`ћԠh"h F` ""4 NO@#heh0m:hhH"h Fh+Ѩh!"i:@hh0DGkhԨhhk`h`#i+a" T t-A%.FFH.FhKH7Ch>V Fv, e, f,Hx,%&%.FC/0h)F6CA"(ܽ@(H" A-CFX FT030;x-+F!|xHM(h*hGI"\0t`3`0`;0+w?Kh+sC"8FF=!8FF8F%A"h##3a%8FB}hBh`BB'B0(Բ` "i#2ac`h\=+#8F% KB 1\=+ 1#30"C0B)@)%!8F|ch+Cc` T t""""8F F8`h)FC$h8H6N(x(I($ H( M+h*`h@8DD$!FAA" hxxpG hFxxPxKxpGsF"x# "` FF F"lh{"hh"+ jfC2s3H!FB JhF3x10Ix BH!F"F0F)FpB@ BQ0Ͱ FiF= M0&(F=(!60BB8BԿ  BA 0Ͱ FiF= M0&(F=(06!BB8B  BA 0Ͱ FiF=h M0&(F=`( &1BB *1BB  F F= I#\Ch @iBѤ5j=B!F=ؿ%haFF(F=8W 3jB8FMFxCx-*xKK"I#`rx K " I#+K" I# I!(H BlCC\CtBd0Fx F!+Cx+x8 '0(F(𘀰0+@𓀰P- - - -iF F=(Y  x@ @ x8 FF|=(=-c b#)/5bPbAFKbbbY^!hF;!!p@O  p@Op@_p@Op@_p@@Op@ O @+s =B= +x(+ #x)+kxbxC  O0QO0NpFFFF(𘀰0+@𓀰0;+z !*9HVdo)F F!@ {)F F!8 )F F!)F F!(Կ  FF(FFBB  FF(F FBB FF(FFBA FF(FFBA FF(FFBA FF(FFBA)F F)F F)F F.cxO0p#x!+)F0FCv(++x)+kx+0x@ 8 FF#I h!&X=!IT%! HUD%-/00 chx@ 8^`hC0\xx!+B Ѐ(+x)+Sx+H CwCyC{CFH!Khz C KhHI3Fh "8 D!7 "F VxFFJoAACoBAI"F 0D-OF F I/eh~+x-+@kxl+_E+-+o8FF(@yJ8Fkxh320[`F(@>.pI!X(mKO U;x%+8F"F(@)hdHO>@FHs+ѫx+KЯ]I8F!.F(8FF(PB8Fx5.+MJ+xh320Z(FZ(Fȿ,(F+h FR0 FF AI"F n@H ?>K!h;HThx+M$y F&0o.?A>s"|# "`8FhBFx˹OBoCE?I H:FXiF"Vh#I!FPF=$0 IO*hH?IF,,I!PF=CD EDE EDD DEDE10:%K&J"v$KhFHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<0FȱiF"##,D"FFC+D Fx,F F0FF,`3h1F`h+`33`/hb$h-hx`h3`pG0h:`pG¿pGpGJh3`pG"`Jhh3`pGpG"`FOMhZ`x .(hCh;C`+*hhY`p`(hCh;C`+*hhY`phZ`hZ`"` -AFKFFx, [,',QT,",KSH!FRK"aB\+Q#mWWWWWW!WWWWWWWWWWWWW%$8F4p7,/,$+x/F50;ٲ)تBFE,$"K58F$F;Y< գa$)W;BDрFGEGFHK/F"a\$A)7;0; HAF K"a$ $ $ $ $ $M"` MvMFFF,F `\(аG.jxc*$JiCsa0*!J5 hxF3 27)؝B0A,FM*ѫx-+x,@G%F^+ F;?+@C^* F :FF"` KIhKh"8M p FxFSLHcihz##ap x{MBFHiihH[h#+a!hh"(Nsih"F)FFHS#3a"`MNNBNgMhh.13`!@"`0FJ3xh320F ki2FhF"` N-GFFFMF@. HQF$&q#+a,DQF H:F/D5D#Hu"`O"x-O#N(F F3aeKhS#S`h%!'J!F(FC ћKh-  L(ѷe=4#FS+`sa,FkNKhBh+ц\. " FOKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+|7F^H)F8F\IO6DXI F'O4{xxOxp غW غ%o p Ff n r t v O\ OM ( ^#? pHpaF-#(@@^#a e a!F(F=F{pKikL h>"h0@+#I S$zT`&dO `I"dh PFd(x! s#;ps `ЀH#F2F)F"0vL"zI#n`I"F F#kBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I<|(I ]tRI DЯHAF6D'H9F0D HhM, rk  ؀*+※逺@@/@+@ @+@N +@T[-ڈHY,foY(dkr(y~H5h, s@  yhge*@p+o@v@}@/S++@+o)ZHuh,(𶁸/@=NH%,MKH%,-@GHh|,c+@sd+@]=HH=Z[[0[=[IY[P[WZZ[^[e[ YYYYYYYYYYYYYYYYYĈH,  HH ,ԂHH,-~H~H,*{H+zHzH,wHwH,tHtH,*qHqHpH*8,kHiHjH,gHgH,cHcH,}`H`H,v\H\H,oZHZH,iS VHVHu,c SHSHj,] OHOH_,WLHLHU,PjIHIHK,I+FHFHACEKD<,OAH?H@H/,F>H>H&,@-?>:H%<-@8H?8H-8@5H5H+8 C2HYYYYYYYYYYYYZZZ ZZZZZ%Z&Z,Z-Z4Z3Z9Z:ZAZ@ZHZGZPZQZYZXZ`ZaZgZhZoZpZwZZ~ZZZZZZZ@DiK_KJiF8,R^K5**7ѻ7к>ѹEѸL/R-X RO %;h+p-ZSJHJHJH 3*FN,ٻDH BHA,ٺ?H?H7,ٹ-OQ}K F#{IORyO;j(Fxb wHAFO HF Q}+qHAFO FFmEUd dEFFOI)sIY[I K2EB4YJ{j qDBjOrIF0F400hB!QJB,RbBPCC0`01hFKB8FKB]F#K $>KB>KBK9KXBXA(7H*F#FQFp0iB;j+/H*F#F`0[0F&(;j+&H*F#FQFJ1+?I1FHBFQFT1=20FOr1FHF#1JH%H""gdg}VEWWEVgghhG" g[cF FFO%h*o`0o0!F(F+ 5+ps J{jqDB I"F (I(F!F ""hg"8F I(O2 F!8@ FE"(K[i+ O2Or@"sF H8  "-O$P F(H)FF4#I;8FI;\0F+O(9Ѹ I"0FF`'F?NF Os:F9F3F@F(3h+ىHBF)F3h,0Y (AF(Ѧ ,`~I0F(5 8`И0;h0o@FZtIF@F(;hC;`FnI@F;hCkI@F;hCgHBF)F4eI0FvFH ?;0+?6/?3"O3F@F3FK`WH)F4@F7 FRK2he OI0F:FB(;h BJH)Fv00*0 (0AI0F$0">HR=I0F ":H:I0FFȹO3F;F@F ;h20HCF2F)F4P0,I0FFxO3F;F@F(;hT0"I0FF(CO3F;F@F(;h`0hc`hhhhhhhhii "i%i4iQ"iV"(i\iii}i"cyI0FFxO3F;F@Fn(;hX0FoI0FvFO3F;F@FX(l;h\0/eI0F` cI0FZ"O3F;F@F<(P;hd0YI0FD"OsF;F@F%(9;hp0NI0F,FOsF;F@F(";hr0DI0FFOsF;F@F( ;ht09I0FFOsF;F@F(;hv0/I0FFO3F;F@F(ݮ;hx0$I0FFO3F;F@F(Ʈ;h|0a_+sx+H2F)F0EH2F)FH#2F)Fiiiiiiiiijjj1jQ)FHFvX 0 ,ĢSE?j)FHFe0SE?ZFI< \+ZЙK#":bPF2\J3h20[@#PF;FF# H)Fn4;hO!+@򰀇HRF)FDbH^#;`0 )FHFCE?(?֬)FHF8`CE?qH)F44oH1 D@ "1F F8H<(Fp6 I(F K"1F(FS$4BI djKh@:r#`O0 8F&L5+I(F(5+J(FI( J(FI(  I((I $""(jAdeAdrk7F(L)K(b0#05+65 I((Fs(h+ h+H #5sI(FX(H+KH]`$(F5 0 J(F I@( H"VEWdfk)dmk: 3i"dgkKFHBOr F@"KJIXh "܀dmF1 BpG3+P@FQ JOa F舱 x (( ! F( @pG#pO0  L!hAD@`H:mh 4H> ss0MLKhF!h )F(ѝ0c+ C+S+ H,s+##` M0#"sspmIFhFF( ѝ0Y+ F(H mp!F(FC(Htt%t7KFHh " mI#F"hFO("iF FP mtEFJFHK!FH@h" " hh4pmIFFjF0H mpkBf I0F (ѝ1Y+cFHxAdrtYtrt*Fgj zF JOazzgzGz z ]t7 FFQFF+x$+kx+_(FPBUxT)GB))HPF+I Z9F)HR U HBFME 4 K$"8F1F)F2F F |I*C`yI*F(vH(pH砀+h0jkIG6hdI*F(dHl+hbjaIFhXI*F(ZHT+hbXI"kAhLI*F(PH<+h#ckMIBh@I*F(FH$+hcbkCICրh4I*Fh(4H +hcck8IGh(I*FP(*H+hcJ ,IoFpI*F6(&H+hJ0#IL UA(BI*F(8Hui" suuu|vv-vIvLvvovvvvw w+wMwuwwwwx+hL0N #IB=x!I*F(Hr+hN0"mIC$hI*F(HZ+h#ebmI( I*F( HD+hce Mx8vIx[xyxxx-O$MFH:I8FAF(ЦM.h.M{x+@7;x`+@3>x`0B,a 0O E `D0 CFh3ScE*FFt  eI0(F"+(# l%^BxI(F*йI""b0F 1FF8F@kh+9F FG 5vJ#R(F@#(6ѡD0i a F,iI b(FC?m@kx+S+x`+Pى+x`0BJSa;RX[hDkB XH)Fr3"+)FUHj0|U*h a FOI b `A?1(@ЦikO F0ZF a??@H a:#")F F(kB8H)FO3B{ 0k[@B{.H a)`"AF 0)KRF)H!Fh:'K[h+?ۮ%FO3& BЮ Z B02F0!FH%#D659FH $Mxy yuyyz)yzTzz:z" "zsh F0:*F`ڍiBhQ`p0pG09p FPNF1F愈 F*hrhHI" FEI" F!FCHxmAH!Frm>H!Fjm[/IB FpX 0hhDkB3!F+ d(H!F)O9q뉪hk{1"Ih Fk{1IJhI FDJ7kP!F* !F kF)!F* !F )O9 )!}\/+8>F FF & I H!F0B F@92F;F)F F6AQpG@pG8Fh`Ȉ؀R[B@[(R[B@[шj FlFbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXeTXEXTBElRuBD3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q I8F8($.Ih.(D4LI h80 +h bh I$$LQSUX"duE(0FWMI(h8r0jh F I( H0,#H#.#90"@dz]n|s,M-I(h8Fih0 F )Ip='Hf'Lfih_ "F2FXih "F2FNih? "F2FBih? "F2F8ih/ "F2F,p H&ihH"@dtpL("F F !I hjF80bhI ("! n..ahjFHpih " d I h 8ah0 FIkhjFH"@(d}(d~(0 FmIh"hF8( I" MjF I(h8|0#h jhI50 "d{E-A&@JF@O FF#`;`=J)F F6B;hB9O%,FE8I8h8H0zh 4Ite(q(O& B# B)F~F(zh %IDQyh#HH 쾹M"K F@ os*+Fyhc0t B (#!F6#*##4'( 6"d|9H}4E(FLI h80bh(FII hOs80ahHXg"9F0F;F2FHah "@d@d-O(-]cLhI F(I UN52saOR I0h8j0rhI?s H  ihs! DZ`h+ ]#XFqh(4?J#TKFBFHbI FX}LI h8(0bhI T F}IF(́ 80wI @ W7shpC_pJqH| w2D;aOS4_I80 }F@{h[D{`h+Oq ~1F(9ФFJFKFOFHFDpSHKI8 0MHF,?]#JH##u2BA7$h( ( }xF!(F 9Ŗ@dF3PB eA-G(Fz#BRk:F F??+FH5GHtOr1F8:HHzH8"dw"6Z dx`u{ x3EL (-A FIh"(4I" !i. "(/I"&"`hzxF Fh'Ih"+ jfC2s3!I .I"`h8xFFhIh"+Ѹ??I*eMI,(h80#h jh I H6Ow "dyE'-CFFM$OY!IBF @F4LMDOch`hBF `0bh I8Fh1FG hC8 lA"UJFRh Ih"E(7 F Mh I(F툱 I(F( K Ih80 h 0X\"dw(7 FMI(h80 hihH"0"@d_IFFH\ fk x-OFF#PF F 3 !E " h)I0F80&I }( I0F80 BK  -F%,3 B&}yIH  E!FO#:F0FQD5O D0;@dpF F-KB8,KBA}SB F'IF d%KBc#3B F FKF;(FFp@8_ Fdp@F FH8q FFFH@ Fp@} FF HF F"p)Fdictaraynmbrpv|K !*03(pG"-AFKFF送bFFAF^@3BF.չ?z6BBH"602!:BIܓ)R!PqFRH2;H2TETN02F#!*0FcB{!FFDEDBs2c0F4A)10DX2"(F!F{<02 H H H H H"@_zpFe}k3CK#;B2BBHTO0 }pT"jF0F)F 0 # H;C I I\"! F "4cm*J"h pG"KC}F !O"OF F0H9F }\" FtI" F#6\"! FK2+h+#9FeH#"iD2BBhf#iBm*~"#3N3LB d2C0I7(.H+J! 0*H#B d2C"I7( Ht2ù FH2B1o0"ACE"0H)FVROu-iA"0 H025;D <"dm"h-O}FFO  YH(ܫH }O7  ZFUF()@CK"`I#f(Ah H!dJ#9F6TZ즳KOYh pFpA@2HDK"*n XBfaeo- Eq`"c) O  !)MsH hK2CD!?@s! D9FcJ< !?@s! D9FYJ'` 1˹TNK2+ }BYPId"(F!FNH*6+42+@J1F  !F(F0=JF)ȿF-B1FF`h} *F#F`D1*+2+P2+b.J9F :`n(F!F0#CFF'F3FJQFHZ1F6*F#F.#Cm#2h"jRt0 <HWA`]@#;gNJ)ؿFFoa` D1FGHQF`EK2+z#EQ"BG=I*ȿ FF-B`1F6H`I2+S2+N #)D;ҝ>0 )+&J1FZ0B0)+4!J1F}0, E#*$+J1F#0X #" B2 1F@F|P! |@F(I I"]0r-AFCMF bN B0R F9NE8N1m1F*F+5HA6x3HL*F1FF/HB *F1FGp)H21*F1F&H,1!1F#H@sD*F1*F1FH1*F1F?H1!1FH@sD*F1*F1FH1H*F?1FA6"0 ,@Sdv-OF-PT(x F3H2B@02FO A# { FI2cX FH RFIF!2+i^ p JTFS @Xr+@ՀBuI#FT+!ұJ  -BFu $J Bu%,F31I{ O IFF O O3IFF ~yOpB? JTXBF #B? F(66c2 +@z/13';F bH-rC +À鐩!###F*FXH FhBuF6cJK*ـHB0R B󡀹jT@DHH2FT0 SE9J2cBy(9H 1PFF8EBADAC=DC  x<E'e,F%F=F&az^(F4?7HD2&F&"""%H^+B t-G FI#F52Os zFH)FHF4BFЙH(Fz'8FғH!U*Ѫ)ЎHl"!O3d 0o{[g`#`'8F<(ЂH9F)|[`` }H01F* [R#a0a[jcbk}R"bcaib[*jabezFeH z F`Hw#iclCcdglkj( e(0*+* dRVHVpjHFjc+R!h[bc:F#cKC&#k"hSCBBHHUS1FHFR4\CBI"0F`@Ip"XFع1ù11U+і1+ і3S3;3U+і3+=/H/I ;F(],K'!h:FHF3`S 31ES13#kKC#k"hSCBB H0Fz@Fz1FHFR4C'#kC1c1#d@d :VxRRaA cckO !hRFHFKCrck"hSCPEBMHAFHF4BѕA0  O"A0akO AHm  0B>HIFc  e0Fzy@Fzv(Fzsm5H1F%h ik)F@23D f,H)F)HAFcjCbceBF$HtjAFclF e opBBdeH2F@sB KR#@r[OsBOr[HC1"#!e#ef 0Tw F F hzcF%H#k%!h*F8FKC"h#kSCBBH0Fz R1F8F4#hCk8F!k!"lKC!*F"h#kSCBB HR1F8F4~#hC0Fz(FxsFhFlF# Bd,`,n3f p  o3gK ,,mB  J  Fl H@2FWI (O3 +`CY-GFXFh FF (Fz<8`8H)F@ h#@F UV2F+FBB H)8hz(m@F"h9hZC4,m"hSCB -O$D FFx2mO@Fz FX|HAF(Fz$ F BF!F*xpikxBxLm(iOpEx(F(o $Bop@E>x(yѕѕ ѕ X, ,y,ly,Ѭy,(yyhy(yxOI"MI $lOrB0opBB/O 3mKE+(Fz8F'z{`OpE op@E6I`Zx1IIQ$lOp O BR   op@BX+O @0FzPJFQFCFO 0FzPJFQFC QF`0FJF3m[ED٘ O 30FQFPZF;D  iCaFH J FpGHpGHpGriP-OFF FFO 'P0BHF !jE!2K P@F 3F8 2 6H9FZF5I ع#I 754  F9FZFF)H)I +j#b#%I2F(#j+bF F!H9FrI2F (I 3F9FuBFFH]I (I2F(#H FBF9FH I t(I2FyQnpF$+mBpkhBыYl`Q`-AFF IFF8F0*F1F8F  I, *F;mB4X*O30`L-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhBёh,F" FX,٣BRhB 5)2Fb 2 F)FF'HCF*F1F8FtI ,УB H"F)F BF)FHH#F)FlCF*F1F8FTIRFF  :mB!chSE =RF1F8FH#I e`tX,gL-OFm hF FF_C8Fy-F@fH9F1&0F:F!#lfVci!ipp+pOsBopCB m!OzopLB9&FFhKE|(Fz+p"poj`OsBopCB &&l!F@F"r((Fz&2F(FQF,PFzOlY `REO.bEn2f2 px3lf"Cl1n2fFkFn2f1Bp3 in2fN2 3,m@Fh 3"h;ZFDXEBH&t  e:F)F@F3>BT-CF FFF%'#mB#kCkJ8'!lKD/^(F$0B' 0# 3+!,0( 9F*H';F2F!FHFCF+ #IG0:F1F FE7nBHI 1(n'c#mBn+ X+JHI ("m#BqXA#d!FHFCJ3yphhO? OBڼB`\&knx05" -OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#*FCFHBAE:FPF3B#E#*FPFCF0BAE H Ha ;:FPF3(BB$Y*" -OFFFVF+q+++H#I OxBlJB@FJAIF1bRF+F`(AB-  H H ;B# Dhœ" -A#NF/'e 3c~@Ff+FB5FAF&|F$h,F ?",+F" K OpyBh %pG" -OFp 1F /B+@ mB@$O3%F'F C 3D04 X0`3v0 # 4 BBПHe cO3=F BD00+= @- [# BBwH(1Osp 63rx*F*hHFFlHkI (J(1" AF#(11&(?tB1۱"E!DDD(1'DD#DspC(1@JK@!  +EI((1C(1D3{+@sxXF 3 #- =FF Or!XFWF:{  +D; # ! SF ( ! ( ! KBHH5'0+?BH>-9'9{ BB5? ;F/FF'UF  ;F/FF*:" C[" Or!F2{ g3F!ϘB# (D {);Op3h( h'-?Ӯ -=F HF#!O3 1+FAFC%&qz ). D3spz  3 \zD OD= +8O p/@쀺 opCLRB_ѳ}p}CCC_0`o uOrYF>O0O3  \--/׀ :Fr#AF  +F C?/ B1BЃHDD$!GSC@ AFHI K(5wDDvDL opC@FBuuu_#__/ P0BhC`^ `ñ(FFHI (DD#D 0wwsw`Ix \ F(@Ҁ ! 1B?HFFH}I F(# 1 1v 1 3wL opCB 1su 1ui 1FCR/RBڲ B? ' ;F/FFRF'1SEG盹`I 00h+?mFYHi%+P BRX2 2*BhB?R8F[XlFKH(Fe_FHHB^#EI jF(#spDDDv 3 I 1FX5)FF8H;F6H6I F PDDwopCwDuw5wvL BOuuu`DD#I(dP-^/h 1/@۱HFFHI DD qD7wvopCL Buwu%DÄáZv~Āùü8:ĭ !BHFFHI F 0 1D/FFyH-OrQFP( x~ rHCh55Sh03h0埱/#CHDDP0Bd0h_C`B(Fj$!;FFZHEZI q($q; www; ?w p#d0B)(FIFMH'MI S(d !$1%DEY @FO3Q_`#5# ;F/FFFi7K 3B$DX+P0B?^ =F HF#!O31AF +FC!D00ӹ  BB ]K*F3B$D$@G Dv6:^ł" -C F#Fi?NOAEF@FxzF08HAF| HFxlF(8Fyq1HIFH8Fyf@Fyc+H^Or!clСk)#mB"H/ X( +!ShB khC`5 !縹HI Jk" P  F H H " Ŝ5ƹ^ƌ8!L5% %5! %F %%UUyy@U8YhZ`F F!YhZ`9F Fh)И`FF!h" -CFNFF5F$ FU-28FU%JFi`AFC" -OFϰ F rIFFppN55hnIE< o O dh E|dOO 5jnDB $5Z0hnxR (YHU 5 1+$5*mB OI."x2*$ 4!;(hBCHF#"GW2BBCHjnHF 20knB EnOr!38FfCF7J !#G8 in JC$!FF FL  !#F " 1HFv 1 vlopCB 1#u 1cu$1#w$1 cw$1w$1wL 0C 0#T#T2BB H_jnHF 2knB /ƽ" "P L x# 5" KpG"PKhpG"PKhpG"PHRI l x-GFFF5ILch!hHhS!hH 9F0F-PFyFHch{ chS<$h!FFHn "P9>LR R]pG R]pGHR]pG R} -C]$FiF?H$F@3B`-O]F0{$1FFFF@2B۳hrpC`_@/!@FCxr+#`OO4shxХuhh2x,O4JOaV!"FBV`*(sѥs1F`2R(ۥx(3h/8F1FO sh2:F(gѳhpCOT {0_JOaXFXF OF,1F F2Z(/R F2(۸sO ""`LJ;F! "!2FlFI2:(Qph+` F72d4H|O_I!2 F'FOr@!O2_FF2BBХs fXh1FP($`|5x2" F( h0I F2OI F2(ۥshxUb## F ] F2AIWF F@FpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`HB<`lwhd 2  lm(d ( lcd`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\|q|pctcWlFgdfW\FVcbaXXSBBczgfp j $d$(^(,X,cW FH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr< F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"4!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3BF F)DF(4#h+%(FLI F p:FF!kiF}~P.r# 0 #kD#c aq 9K *q0E0 XF XF&c0Fa  j)оB*{ BF F(%k`(F1FR #v5Dbr ##h%c+I F :FFGiFUD0D{# 0hKd"<Ȧ""x-GF@Dz:"2,@4$4MB;ۡ@AFF=FH0PF zqil, J0hC FKh+Іq """FF'F pchK x+`hF2BB' pch x+ `hFh(2BBРh(-AFFFFy)FFee0Fp9FCh`D`@FA-OFH M)pH#CnK hZw>C ЎOrE1F(Fe SbO"j;h]kUCFh #O [br #PF MVKh*FSOFBiYQF[;hӈ[Ӏ# 0 2Rcs 2*sO 3DO F#cF 2爈  oO`FFXF0;0#0[0ch F@GF9&J0hC0#0[0*F2FYFF ki0DN9h"i ORKih %0iF!i# 0Y FFȺ"x"<""""""MFFFF H(!F(Fp @3F:F@AT ~,uJ2BAH!F(FF( p Kp@OF M"`7 FF0𵗰FFFX"!FhF#H0K7## Khr`hZhiF F o`o")-OFp FFFmJ2Bp.y𠀖By X"!F(F#H0_Knay88kd[Kh.`hd.~Рh(e.zRKOzKFRFC ;Os.gRF C KF1FXFk)F F?@;F @BF@A @F9F1KFIЀF-OP0 ! D  C  , s ڹ-U3 KhC7 ; o{`oMRF C KF1FXFRk=FF U#0+# "`m""x"<#C8 R FFCcK0phOzOg)+   JJ  P C  @ C) CB| JhR# H*F#F2BBh8""pN3hKMh,hC;+hB 0hv(hv#+`3`pT v"""K"h pG"-O$ FFFH0+ ChGFPF $ K*j{F(@J0k{0k_o3FO{FB!ZFYH0K#BAK(FhsKh+>ѻB iR# B#33JC " Di  E# 0~K!Fh=jh|KB|Kh[oBVؑBUۣiO #aO hi)6R:Bh C O O iJOa(F_Khi "  ZJhRoREVK!FhR* OYB*RJKKF i*GS6IhC!!)BѕH0+pSlBK @`@A##=H A7h$H$J;A1H0+   #_!F(FKh˱IOr(F #p@[H(;h+ I" K`̥"0̰"P""̻""0F FH#t !F(Fx) )HK+0#p#иK-OhQF F x+%,F(F!F %$܂&2Bu82BB"(F!F0[F FFJO hR Bq>V! .8 &^E(^F0FuFH (F!FmxF+4EYh~!S FBƀXhuy}K(F!Fh C `GFwI0<\%Bii(QCL|hȡLṟPF-08F dK h*+`KzhB#B]HAFZK 2ZHVK" zh(F!FBO5zm 00 (ABq" C 0;j;;b4$;4L3B2$ h:`OR 8KhB1Kh#F=# 0pCOг O?гOޮ#3pi3aO  #32+?z!K9Fhq#3pKh8HOVK(F!F 3KFXFwAC"ц#3p""T" U"""<""`""#e8, 0  OpYm   +I I HFYFO[!Oi AQ'J3A=#Kh+?<3sp6WFb(нOxd8 0[m   +H HYFO[+8a8ba@FKPf"P"-O"`KFF`h0 \F1JBii'UCAqh{MArzN(F0i F tJ3hh*ǀ+ǀqKbhB#BnH9F$X"!BjKHFAF9fKhF*@h#**XXF ""X TKh*SIOrXFHFAFg##pX0+ #  =DJ;A1,RbhHF9KAFBO5{m 00 2ABq"@0# 0#j3#b4$34L3B(L$hi2`OR "KihO3hiFLi&H ` `+?9 !Fi1oQtVd[I"m"T""" U4Q"""P""""<-OFtKFFrKPPh9pJB.00 O`F !!O O|ZB Err $ XGD XCG ,uڎQl `GKhk 4X$F0F #HH-hD@ht5&б"8(.vЪ-OFH0g+zF3*sŀ*j0F9FF `Jg]JXA +q@#WH-WKh+rVHO@F+j#K`#H"H(K "` 0Id`F` hB ѱBEh``BEhO_O"S"0m҂҆"X"Ҡy"@"|"tKh @pG"KhpG"Kh .WpG"-O=F$"Fp pC7FF+TIp`" `I" (V "#C#p = I(0" `IX " (V ѣn+#HH(0;IOrI"K"`KMa)hZa70%45Br  k;B2IBr OѶOyvKh+TuHJF3FxN kBBS;B2nKh;pO#lHz(+hp^kOy1FFHF+cK/GhHH)F#00XOrIp (F F-OKh3JFQH3F(#OHF#@Hp4(@cpoGKh+S8IOr$O@5@0 - w(F @+K G0O h)p>X@= F('J3A`X(v sq(@hK`HH(@e   "`"""HҴ"""""<"4"0"s""Py_?y Ow *FсKh+BqI3;)s;ңn+8{Kj{Ih + hd0 ( QF {sH sKh[#rH 0#:2FQFF(0 0ó dKh():By5_Jh<.y.)  CIEGu -w ='"- Gfn*IEu *Xo=QC'D C##2K5Kh+? QFT#uF0HQ*0;#u FFQF'H{  ko   ˱4C##2 Kh+?c  T*TFH~UQ*0;# 4KF F H  """"4%"<"LrӚӱ``Kh``O@V  F ##p#Jh3` Sp03KhOsBFBvOrF g`gyK  0 0*G`hL*BРhP*=РmAFhM F ##H0E0+E+haKh+YmXCC/XH#VHhUK"`#px o`o`n#eFKK h+ #OpC@k+hCKhZk6UkC3 eDV*uѠnIFvmFC(4KF3N`p O h#H02 kKDwF=2hI9U +m"<5@$D5@AplRm @p # C @ C7 0QѺEk0@FGՌ"p"t"""""""<FFBB0V#H#Kh;HC0FH0+?#"#### H( FfI"+"0^k"K!-O'4LM jB0Qk'0HHTDLDNEpBu]X"!%K K K 0$jBaAK`0<\Bii!pCL FViLvIhLrsEr1 F F*FFB @Lp  3BL -*F#FEO LB|2h4E C 00 FoLkCFr02"\Bii%aCB FhBrdH0@F `Ki_J_Khh*J+J]Kh+NxpF F$K'h C5@Tp5$@CO BB2FH#FbXFsHYFX "T"|="X"P"""""Ԍ x"0"DԴ""<"p U9FZFz0;FF)wG8FC1GBBF7HvtGbEs8nCwEB?z Bq $a %N1h PT xhss3hD"Z`_8FO LFEB?O$@@&NEBOJFN2s-2F( F HYFKBs ҡ XD!~`&""-OFiOTF *@F"8F!FP(Oݱ!BBJt th B "O-hh B4G4""tpG-OX"!8O#P0$6KF&F4Kh4K`;hjB0;h,QFFd pC3F)I*F(H2#0EF:h B6F-t% F)F$FKEh@h  )F FIx*PF5Dot"<"@"8 x""p"h hPk[kpGKh @pG"KhpG"Kh -pG"K-OFh$l.UѨKh hF`J2Bv0F&Cxq#CDڀIF(@рXFWEHEВJPFIFH?(h& `0ñy+JH*(#q&&K`K"`2*syIOrFis0;#q#q8` d0+oKh[  ) #C2y3# ? BO۠ !hQ 1F-F LD.F @!B:BF F軈"h*ՀHIF(@ˀF y*?J"8Hq(6J'h/@;F $HF0)IOr;#q#q8` 0+&Kh[$Jy(3 #D@E<#hHZH=(?JF9F F H"""`տ"("+oa"H(?讠 c!F [XF0F @FQJF9F F #4F3B#]C;C#xQ FFy3# DJE0#h{ 8 #;hc#3B#zKhyH;h"#RF9F F .&(;hk#3B#iKh 4r;h&c#h   !F@F 9FRF F !h DF#0F3B#C;Cy+ z.(*q+IJ%GH%`0(hEK`cz.+CJ28FA?J2Bs";F (@+1K"`~ܰ(y+O h]F oxFK+"UU+ OF"Kh+Os##`#q(&?2*s׀ h"$MIFF@Fa"4wֆ"֖"`ֽ"C֧"2*s)5[Kh+@YKx+@XJ h"IFF@FRHm(F hF Fp@O##;pPx\DJ hO FHF#FC*2*s.# P@A# hJF@AFF/JF Q(7&Kh+7*H2*s##0y{xB hn%*FIFF@F{xqos (K&`{;{] H(F# #`U h@F H|"0"Dթֶա"(! -O|]6xK+4HHK"`  HH! _@"#FF9C аH,K`H{(ЭKh3! @#"䢦K PX"!#`0KĒP0BFӚKh*@`BP'@OB<`BE! |]H2H#(цH(?x! [Fw @@q{HzKhñ@,AFF `C;F2FrIqH(nJ#`UKj++lOmNlJ>1h0F$`Hvb(3SK"`B2h:B>#@A]#j\J1hjx*ZI"#] 0UH1hjND0F0vb+ljF @L pOr!@F@J>hjh*@"OB .@0F%2F(j (F(O bEo ( X \ `  .@p.@FI#] IHXD["זdס""ת"p x""x"DF"R"""0fh12G? 6["(j )F(O bE )$4&6(8w 072 zt~p"`BmW( *!Or FF gKY(,PheKh(@ O@ 60F JF%B# #& oh Fh2A JF6B 21 `oVKQ?j+? 2BB????2CF1Kh+/KBFKF>-K#k;k(OKFBF,o&s#K`C3Ck;k###K"eTkvwx+VKQ?#;C?XCh`D`"""4Y(s"KhpG"-O}pJ0hC;kKhB }0ñD<`<1FFd `C#F_I*F`^H#0WI ; Cx C*SKhRKxRKx*)pC3C*ѯ&HMQ+hx*ѳB6F+hB#HFAF#(7KC;4HAF<3H-(?yiX"!F(F#H0##'Kk`kd&KhzphBdbh=)F(e0FVH HFAF#W(?AKk`0)F=HFAFeC3C0opo"؍ x"0"8"D"t"د1"ӵ""p-OFܢKpXF!FhOrKFx\2FIBii(ACBrhBrHF0(F xJKhh*u+uЕKjhB#BВHAF%_FX3jO #D+d܊O2 FFOQFiFv(1F\(t0KhI (Kx IK@BhB>~H;(@0zHK0nNiF:vOORi8h 09hi,&J# 0 0%Kh*\+hF\K[*OH AF)@𘂸@*F#h+@‚H(=POR)hKhL"")8"8""Kh#FxJ# 0 0+h ,%*@0%45BB1вH+h0e4u#h+@fH( ĢOR)h4KhKh#F1J# 0 0+h(0+@x)5ЗH0++h <"x"(%#h+@0H^( DOR)hKh[Kh#FV{J# 0 0)h8%<5lCBB4wHF+hblCB#h+@lH( ġOR)hfKh_Kh#FZJ# 0 0)h@%D5lCBB4WH*hlCD5#h@+@LH( @OR)hrFKh?Kh#Fo:J# 0 0#00+@?0+0+@3+hL53@-#h+/H)h.J@h$u3`#L5#P5OWsT5OcX5- C0H3/ODOO@nAHDD3D#DLDli@OR0Kih[""8"Fo"""""ؔKhiF:iJ# 0 0wH(eH(K])0BqH+h" #h[H( OR)hzKhqKh#FlJ# 0 00+?=AlH#h+0B۱C1dH+h #h;\H(!xOR)hHVKhMKh#FEHJ# 0 0JH#h+GH#h+CHx#h+4-[!`E1[[!)?Z9KX*F:PFx\BD H"8K( F"F/Qh)B%H<#h+<5!H4#h+<)H*#h+έH"#h+H#h+@9lC<%O|l8CD%O|@T""8q\)""+h,5+?E#h+cкHJ)hh0e3`#,5<#(5lORN4uC<5l8CD5@ibKihKhiFibJ# 0 00+?Kh+5њNOR)hiCrBB$hiF F2 F`Z`+he`#`\`i,`Ca"`"<pF FF!X"hF BhFe p FhF)#  H0+ ( Kh[ H##`  HF H(##` HW"0pF N Mi3h)h Kh32hi(hp@p"<""K"`pG"p8FM FEBA H K"h Kh0,T1BPhH8"`+""< -OFF dFFBB ѣ3C F@IO(HFAFx;+6I:F(FT"YF'p EEOHp7$)KdLiFY8(F .)F;FF/"G,B'd3C #0b9F(FO(K!F0FdKiF'?#?;p<#4C0NP1uR"<\%ZK-CB}F F@𨀐0+)Th@O`n9(`OHDOb!F4LKhKHKKh+:JNL533hOOx)hFOHhF Wq:F h3hIFHF{iF"2 E[!;3h)hFl(h:FiFWp L3h)hF_0#0#04#k$ \3#j $0$bj44OS<$j8D$ @L$"#0H 5L53 #P50"0#"# }TU"4|""F F\#IB?ѓ); Wp4b   L1WqOr]K(PEPE@@@ @ Or]KpGT-A0Kh+@J`L h(ڡKhA(IKx+=ОKh+9НM+h+RМHKJhhKh*Pі *LFOPsFMOR1FiKih0FjKh1F0FfiI h# 0WM& hO)FiMn h)Fin}h B9iB!}H|H+(+h+У )F hi6n(FnEFnJ#[M`mJ`+h+E`O;h0?[N3h+5gH+h+59hQM#OR0ci #X4QKih8FOKh9F8FiAI h# 03hKOHNH((`LKh#KHKK4M"`OR7KihP7Kih0F5Kh1F0FiP'I h# 0;Kh#:H7K M"`OR#Kih(#Kih0F!Kh1F0Fi(I h# 0})Khk(Kd e1FhCl2F)FF$HHrKh(J h""""""""0"<""""""`"""8!"^""w"4"<둽-O@>pkB6K asKpEA"#-)F`A@O E@Ҁ(FIF\%1FHBii*PCAqJhXF{OArD0HF uJ;hh*+rK B#BnHQF0(F vsaJ+F"_JC 00BO `0  +DFBO. NHO|#Br#kLcB a0;0#;B2#shn;s`AO3IF7:LORi7Kih0F1;h1F0F.i&0H `t)F ` )F O  I  cD3[ED+?G IF>$0$$0 4 4hb $` F"h"|T""" U"X""""<KpFF @P%8 mC8 HOCiB iT%0FaD% a p" KKi@P"0Bi@"0pGFiBiapG"KFh 5p KB0BB 2BB    "S-CDM$OcFF!FFxCFO4 F DM"FF;FHFF(F' , 1#-O]F0{$1FFFF@'B۳hrpC`_@/!@FCxr+ #`OO4shmХuhh'R,O4JOaV!FBV` (sѥs1F`',(ۥx(3h/8F1FO sh'F(gѳhpCOT {0_JOaXFXF|OF,1F F'4(/R F'h(۸sO ""`LJ;F! "!' lFI'(Q Jh+` F7'>4H|O_I!'F'FOr@!O'_FF2BBХs fXh1F*($`|5x2" FZ( B0I F'OI F'(ۥshmUb## F ] F'﹀F F@FKh @pG"KhpG"-GFFQ F8H Ԡ0kBOru@GF(F!FiD#8F#`" :HF|e !K (F#!F#"CE i"a*F8F#F0kBzi* H "]"""<~"-OFO L"hcF 5 rȲOR50IhQ tF"hD#xH(+$1$$O &HQFKh+𱀈H6#hm"h BHQF&~H FFFp@O #hFtH##RF "F#m"hkB Yi)=("hD R5 [hC^HQFaWKh+X[H< hIF$#hy "#F4#hkB Zi*AMH9F.LIiLHKIFhByIE XyBو=B@HQF# i#aI;H(L9K"` 6H(3Kh+:+F%li*K`F)K BT(LO3 h 0F (рE t(# Bz i#a "<"0!Q"F^^Fw"""P[Q"!h- kF !O 0 lsUK!"I%YE 5Y%PO 1 @  0F (D 0w +O! kF,FR9I! BM6JhQ#\ A51H%0+4/H +8 C  i D k XCALp B i!a`4I H(K` 3 0FkSC 0kB Si# H9FF!F窪"P""0-GhELEM+h#ABJ@Jh"#F+hkB]ie6H!F{ 3L2Ji&Ԡ p4FE ȐBi#aA"F8F4'   S%@ 5#AFH###biH0H$#8F###bio($i H( K` "<""H"Q^"]"08M+h %3JLBH#h 8# #CH +h##CH #h+H H(   "(Fk?*F!0 #k4`"gPF ck0 g #BB & ,PFgF,PVK)hB3B;BQHLO$PFFuPFPFXF0O/F OshBihPFg2BB:H2iO A B47CF@@PI IPFZرBB%Kop@ 1$AFPF^I  #k`4 `@0  R#`H`B#80380"TWABL*EWABN0O/FOs hBkiO 0NFBB47CF @@PI jIPF80+)K@1r1;80h BhZ`Bh`l!6I hPSPTglT@h(?P0DkT`F>O1F H0FkP`hT@ 8h3DP0O 6-GO CiFF jCK@FQp O0$kFFkkCE0Fk F+kS(p#1F(F#JFXF(#IF0F#RFF(?h!-AFCi&F@jFCKOVa+p j1F FDy Kop@aQ:FCF(F (, F$!b-CFCi& F@jFFCK@qQWp 61F(FqKop@sQ4DI JF#F8F(#AF8F#kF2F(F(F!bK-sCFh F N3hBF HKFHKF0hBF!F p"T"K-sCFh F N3hBF HKF$KF0hBF!FJ p"T"KpxMIH<N$+hmBp(hPH H( R(hS2hR[m HS4Rh4""X"T @IL h@j . hW##`"X7FHh(j,)F0 F"X8F F KhmJh Kh`# #BB  8@n """*F!FCkCCc@FC:F)F F7-Ck#Cc#-O < F FF3`0 b/5A/7L/.ЬI  kck`O0c/i/1F(F0ТJIF F>CFџKhBЛI o(FhAF(FU#H4pCO#,FO  F  3h 0h! FF#C-ЁI FB#ѠI:%03h+bd ^ $F( Fyj kHtD D fI F&]0F&k,3x/+0F`J3F (#$jFXI!HF% FSI33%7kVMI P IF%0r C OsDI FiOr1F%t0B FCO M`m8F(; FF64K vk +"J;F!|(FInz FF!(F(? a mEӯOF,Odg-OFFF!F0{I0FO0!ESB4+tIJFCF0F Fj #pFA\)#32*X 6+)eI#"0F#"C0F####"( Fj ԫ4+UIJFCF0FP4+PI#"0FENIJFCF0F#"C0F##JFCFQ(@ 1[+)дFOJ--J FOK??K EJ  C .IJFCF0F> 4Bf$* ݔ!0F&I1*+"0FOJ (?)ha3`JCFF0F0 +-OFF OaFj_F8{԰H1F$PTet@E!$4###F840FOcu|0% h +Oc"F9F0Fuf0EI F4C4436G1FOb FRI FB$ Fja$0|IH4pBO30C_vI FS$4{sI$B$r0pI$4 nIUvVAlIb$\0hIUvV1fI$I4Os$4FUvVt"dCF8F1FJCUI:F3F FEvI4$4"8F1F2)FxF FBFFI Fk$B:F F@I3FBFKF F0O01F F0I$Խ@$Iw $ F<$*OܘF # pKpOsKNcȁOsˀOs OrF jjHm0 F F -G FxF(A DFIF0FM 2F;h&IH#hKFFEO0M RFW&06H#hKW%02F I5H#hEE%A6E x@pa"$4Q9`#+N FrF7hI`O08Fn(2h I(FQ2*2s2hI '0y-OF hF2 F*OUsڋj k2*s BO0 0Fi(0FF (Fi+Zi)WУj BS0(s'BBG0(s'BB;90FIF0F# XFX"AFPFG0F0IF0F"AFG0F0ck0Fi I 80$!m#FXF(-i"QFXF&(FFFFO0"1FG FY0 4"1FjG Fb0 FzkI -CF F WFCIO0F$d"HFAF3FCIJFCF F"3F(F9FFFCFFI*F;F/upFaFK-O F O Ihl FHF&'!F[P6.I"FO9Z #Z @h CC#I F'0PXpFL%#i1FT+H=pX-OF%MF F$IFF{   C!x2F F( ) YFF' )h2F FKJ5BW-2! H#x2Fq+F Ff2F Fb F X@-OF FF F)C B C /I FO60F(mYBF&I*F F; FYFkIF(I*F Fo o   F" ! B9C 0YF FL #@ FC@ F:C # F0I*F F)+Jf hsF FN "0h `xK*Ѱ2hI(FGO0pZ `Yxi)3FxB*3x#h+2hI'0sFh F޹ "` N0hDF `xsphl#`2h(FIO0p'0Fi* s* a*%0O0 !FF(IO0pFF FuPN!F0h"02h(FIO0p'0pF h FLKhf(`0I0FUO0p F'0i*F4 a*b*&L*1IF=s*.t*  F1xK!Fh8 @B h+I#O0 # `10O0 (1F01 1'0pF ! IFF! 2F!F( H#0+F0H p@")-GF FFF ) FIO0OI$ iFHI:F FOi#"# F#RFCF@ F I:F0Fi :(U0t-O!FFFXI FO9OFHF9F ! FpF(#" F yFQ FѓI$sJ<#B 3u^0EFE {I[CsRBz^B: F@i }I5Bz5F6SFVvI=OC8!# F>0$0FiFmI#"# F#2 PFiedIw4cJjk43`o4Ors`OC#4xHF9Fr4iHf{i YcX 8 F/0?<H$$0 C@`FBFF3eOCseO 0 0mE +JF;F! F0? F4j##h IYF F 0?  4$$j j 4j447pW0K0FhB.I !0@Be*HU#$(H$4U" FF#H"H! F0HO0!0jHh  FFH v FFHJ8!hFiFH|!mH x          0 C F X F$"8F[-GFF!F4"IKJ39F0FCF+4BJhB0AJ(FEL*oТa+"+ hh h`hh4K{3I@Fh蠱1I@FFx/IBF(FS.I yiO0*LO`h`&I(F<iTE Ff#F@2!(飉ZFIBF(F$TE FP$ ! @J(p~(F0x(F '0      FF (!FFiX#vT3#3FHCjji? F@i:-ODFΑFFJ By I B ABRF8FbI $i4Y\I8F%(FiEBEEx(. C FJFNI8F%Fa#bcbб(.FK DK.DI8F0(=J abFsFHF40 HF(Y bCbEBaiAaa ea!` a`k #  BB!iMa%aiPFi  #h[hBJk#ciCahaeaCi,aa aXU(FI8FL y j  `  0-OFT, u/*F#FXFJC*F#FK@ F;iCD *F#F@F2C *F#FH(F8iC D t/Yлi+@:hzh*rzR LB{q[ k # ^ b S BzZۦBzV SO,u *F#FPF1FCMCjPD  O"OB ^F8F ,u*F#F CF*FC 1F#FHFi  i F F?isF-O iFFFR mI=O65FRST hIi gIeIZ  e#i;a#i_a F20F)FZFSFTfEEF$CEv cJFRICFc#f I##b #C0F)FXFQFC  ZFF SF)F0Ff#Bv,e iyh [8hbiFp ,IYs8aG,`a#[b##[F#BrISi IfBq Ia0!f LC#i;a_a F8e~ A \   0   iBpGipG Fi(FpG-Cg(TE CEr ڀiW BE~!!ibl FpF! !FF8 F IO0 p J !e(  # 4 0 FIFK"F6 H$~ I H, MU4 H, zS  xDP*"* IO0**    D@pGpG *8F FF +7&( *,!#% 8 : *"+J@!HK FI*Ff      JSj O0c"\D-O3OBF F@`I0F%F(Fh[JBFBWI0F Fh3O~'F#FFFFjvECFmFE"4+FIBF+F0F$4@F)F"4AKO {FFME FhXCPCBzOEF  34+ݗ0"+I+J@!+HT*K'IJF0FxIF 0FGC28H#)FFj$XC"FjJFF5EB9`E  7 [j/VEWCcnc"\-OFFF#O J9F0F`BF~KhB(F v!(FF#C&uI(F= p, A,f,pI F F s,# (F0O #jO (Fi#0??4jhFc11 4+ Jݗ1"MIQ2BLK1JIJF(F!* *EI#@ BR"BI(F2*?J@!?HT=K*;* :+W9Kc"SF(FgF  7(F0?q(F+0?k!@"v0Fd#0FAF(F0)"I(F)P K 8H#1F6 QF#F FQDA9C0F $) Dl8Xc"}-AF)OOHFO h   FFHI2F FO0 F0I2F FI;F2F(F&&&&&-GF F0?-4 d$9%OIF $$1jj80j &.a(Fh (a F0IBF FO0 O2FiF F FI;FBFR0F&&&')-OFjI OMF F F!@cI FoO0! F! F !  F! F4F# $ PI~/@LIO$ 4#"!+#!f F0ѵ/#"!竱! FF(OO O #" FC 2I2F+F! F0яO #" FF(IAFOrpES2F1+Ft#" F#yF F0I Fs[I F W+jBB?z IF FA+ъ'8'L'c''(("(3'pF FF!4"bK31F(FCF KhB J# F  F0I Ap(t (|KSB@pG6h#-OFF F   b-V FxxJ9F0FDCFuKhBQ+s F'`i+Mi+JBBD # F# #HF??F* F < 3 F FWI"$UIJF Fq-  F0MI F(F#i$4"PFYF  F~F&AI FiE6ih/hx#EB[  лz  #C %,I F BF1F F ;F@F??F#EByH9`F F F0  F0?~ F# I#JF( 6h(())J)kpG-OeFU#FF##J9F0F2C ѹKhBиI q( s("F F0O0## F##"8F??FNI7V#I F$4"U&M`AEp 5:FI3F F! F{ Z ЍI F! Fj hI! F_I4  ! FL!  FF 4vI F #BBqI F b4P = FT6E g EyaI:F3Fq`I"XFH EyFF a EySI{ B AÀ.wÀ B A ))9DI F   v24'j 4N47a9`B \!0F0a F 4j,4$41i HFAF FY0? 1+*I 4$$j j ) )))*3*G*t***6h++0+O3B A۫- [m F1Q0IOsF.wDSKI F+.w .F:F3F! F40?N!g  F j!+(I F3++L+n-C%F FF.F 6JAFHF0C/+s F!xi+TOsBBI %KhKE#SV FV!-N(.a8 ( (!$I  FW0, F , FH CCi+ ++-OF$4F{Zк([J XFT2F, B^F0F&#F F*F  @ XF## #*@KBF!SF((EFTF EFTF3  5KF3 B#@+GOzs"(F!Fp(=S # ! ZDBZ   v 0F T O (F!FOzs"<F FT?p+?l *F#F #T DT ,H,Z,D-CFF F *uC ! 2 UI*D!(#0 @"!2BF3FF(3F HBF9F #xH!F |,Z,c,l Kn:f*oB (КmQeppGI" 80m#$!t I gJ"F!F g?F,r-CFFDg( C3=?AphH=C"ѸW!dHFcH>CD|1kF  !ZJYHDgO VH|F]8RHRHRH#C%HHhFNHd)j FD 1![R,""[LBB]04(?HMO =H@F$+(FUFX(Fg8m#jF$!mF0H)F"BDkFBHF=J!{+F!J!H1+Fѕ1+HoFH=C"H1$+Fl0X,,,,,,,,,,-,,,-,~-p FmiFCHF#AH#@H4i=Hi+ ;H#!#"ji i;+ #j!2J830H~ mp,J!"")Hp(J+F!#J+F!""#H`" HX!J+F"HH #SOaBFH:(FYF(FH0 Fg-)-4-@-K-Y,-c-m-p-|,----C]FFFdFT(F=IBFO0 ]iCE$iy&j2F!F(F2 AF1Hu#.H#JF$4u#)H#JF$4!&J 3F6!#J@3F0@ ("I 8@ HJ!@@Hm#8$!?HH #SH`Oa-----m,---c-..-O]FFF@J ^J XHh 4OC KF@## "",ـ# .# ( . +ՀQFH#!#"jiP  J!&KFr!JFKFlF&R I&"v&H2F9Fi+@K!JFRHF2F9FF 2F9FHJ9F$#0O l"sF!PF$(vHQF0$$+ء1 0F l  1FQFЀ#(F&#~F t 8m#$! 2F9FYHx2F9FWHt #S!TH$i."j!F(F k$i, ]F2F9FCHT=J F!nfOaAHD#QF#"jFi{F-Ѐ#(F&H3#Fl)KDiRD(8 DB%J?1# *! #]  i+;+#j83J&!f&2F9FH#jg h 1ff..#.(,L.:-m,-.@".O.`,Z.{.....-OX& FFF4F`QFJHFXAF@𵀂H(@𐀀Kf0Z@ƀ~I (F!`(@𙀽*0x-`- H-bW-fA-XtI a=-S%/Q!9]?{EDD8F0Ѵ8FD}DzDwDtD qD`nDtkCI8F(e>I _ .ؿ6["QF@3 # "R F*\0;.$.$.P#0#$*KhKEc!8F104]$H !F8F_ R睲7x##OsH$ +s8F!Xi+isVBBձ"F)F8F$i.. @th." ." 43>+F(O>@"l+?.(?&yѸ\J8O.pAF8&dWJ1F^UHp8FF@- ( 8FI#5FIHAF@s8F#&FAH1F0 7 4i)k?(O?8F# 6E8F8F# (B8F6iEF &O]iH####!F#*ji -i-H..#.(//+///-AF FF!4".Kh3SB7F>F(K$3AF(F8CFı!I"V萱 KhBJ F"i*T* L*I a+, F_0l*ТsH O0 F06h/p -//}Q+B@+pG#𵉰F F F /J1F(FC(+s Fj!`i+Ei+BgBB<ԱKhB# F##")a8 (!$I W F0, F, FNH. i0 00IpG@pG FFhF @шzrF 2 B-OFFPKF$ F 4 896F : ۉ>00s+И0l+(O "HF4+K(J"3Yi2F(FC.#KO F "  `J# #i?01FJ(Fz >0=0<0;0:0 #FZ2F(FBѫ  3Ѥ  0X2-C FFxk  FIF>  7#I"F 6 5  3 2 1  . " (T'EFȱ1F먹#S˄0 00**+7/O03)0XpFL&{@!J 6 {c{#{zzcz#z#h 4G. p0X2-AF L% 7 8#1FH4+CF*:FV=ѽ0X3epFL#FD F5`ir)Fp@Dp0X-A FF(?4;=J440rABOA66N  #38NC0 C8dCS00hF)F#@c0E !HO CFI F6O0'F:FAF0F I F$0F I FtBI;F FlD0F 0 CC0S3s3333 FFF((I@4"!$K" 31F(F8CFKhB#J FJ F)U*L* Fk0a)K@I  K9FhP06x6 E '0 FFIhK8SB@"FFRKh JS BB KSB@Ih"@pGpG-OKFN FFJ)F FF3 ѬKhB ЫI ?O^o+3h0F($$*ڠK!vI(XHF!F8FF(M8FI(聑I,F(@HFI(Ffb2i;+>F4jOsI"F︱OF1+F8xIZFFP(FDuIHF8F>!(FqI(Д!(FnI(Д!(FkI(Д!(FhI(Д!(FeI(Д!(FbI|(Д!(F_It(Д!(F\Il(д XIF(Fb(дTIF(FV(д OIF(FL(дKIF(F@(иѠvF()F@F(?z  4e (?F8ES"1#@??@ŀI FT$$)F:$4Bh6I I FB8F~I6r*D(zI*D8F(rvI*D8F(sI*D8F(roI*D8F(lI*D8F(rhI*D8F(eI*D8F(raI*D8F( r]I*D8F(к1++O31Os1N|O@vArEI*D8Fn(?jrc?I*D8F^(?ZU $$)Fz$4B/ LF(?8FF8F$42F[N??@!Iy"!04I0F(? FIQ:b:t:x:};:9J::::9::::::;;_9I0F(?׮ p(юI$0F(?ɮ$L&$0FI(?&>(&0FI(?(0(0F{I *$"AxI0F\(?EsISF FR$:"(D.?$BF)D@EFN$$1??\I$:F)DB$41F(FKFbRJ+FOrOCYF#FF0F  8 ˌOr ##OCke9F(e8\!e(F12F (a$4 ??*IL$$)F$4Bl.a\!(F$$ 1(a??I$$)F$4B999;+;6:;;;{8;;pF" FhF!ih"hFohh3SB*FF "C J  IjF0I 8 $p<i'<!!ӰF F#,"!j#2#c.# #@'# #"K"'K*(I p)6*B3 I,+!>:F!0F:)F FS@i<ii!FxhF  ]HKpFx +@EJhx Bxm5@Cz0=I @@B;H Az ix J#@;@BO6F/H1Fbh`i# Bx3@CD0#I @@B"H AF6 iFHF(IgI(F6FFdI(F.FF`I (FF(2Ѣn# (F0&NJPQI (F(0+ѡn)|"l0F 0onFIF#  ***ѻ YFX kױ7I5IRF (AF0I 鯱09F:C"l0Fn옹"l0F!n0bnl)lckB(Fh1+#o˱!F(FG0mI*"l0F!n0k0Fm0m}<====#===x=<=\=-AFPF$ F8FF Fd(FzFp1FF8FF(AF F( F$D(Fj,I]=-AFFIjFFF+ RCFO0&8FF(А"!F"9FoI0F0н0"FI@F+h=iF0 F@ FFF0#`O0\BF ?#8Fh"FF(F2(!l FFFF0#`O06BF?#8FB"FF(F2(!F FjFI@#`O0]=pF.IjFF0,K!P)I F^8 FŔ)9XBaA;@!0F8FI0FF(FN`I Fĕ! IFF0FF F0-O0pC==>i0,M I"F   {0#i7" Oa#J o+x7#ci Oa #Jo#xc ,M0)F H(FZ0D!FH FP0Di> >B>WpIFF0J(KV!" FlFRFh3SB"FFIjF(F0I p>>gi>F"!hF6IjF FC&iIFjF8KOaJI FC0)PBaA:@ I F00O0 &C?p?wiisF FIjFCF0F$h@K@Q\ FJFI Tx1F( J! H I(FJC Fd p??w??@7 F F0J  I(FF@K@A( K F Fn80@2@P@Z@7 F F0J #0I I(FF@ K@1 xI F880@d@s@@ZpIFt@O5#`(F$pE@-I (FdVFIF I+F0F0 I IjF0FTFI FdD@@@@ˀi@𵉰IF,8z#`O0 F0FdFI `FI3F8Ff0 I F I8F%V0I Fd(F@@A iA%FXC HHH&]A2A3A5   IF0I 0dFI`I(F0I2%BȿB b Fd > XH1F5 ixAAAZAAsFF[F` 1F F_0I*F FBCXBXA  ApFIFF^X Fĕ pIjF(FmFĕ !hF0IFF0FF(FN`A ivp F IjFFp@K@fAB" !F(F0O0 p#*]BbB;B2 @@e !#F(FI FF(F` CCA?wA8F]ICF(F$@K@1q~) FI d 8A@Z?jF IF8#`O0" FJ0IE^ AAH AIFjF@ K@A"lI F0H2 &B#?wiB6IFjF@ K@A"DI F0H &BD?wiBQI#jF3I x%]i@ F I$F@K@1"I F8@P@Z@F08 (٣a*أWA*أ=H#`O0F"!I F#d0I & iA%L ! !x b7` "FH8A2BxF>F !J m!HdNL!K(7FHZQq"F(3FH;FKl޹m!HFJosDDF1(F"F H(F~ sh(FG6hB A2 xB}A`pGA`pGA`pGA`pGJF `l `dpG JF `Qm `SepG JF `m `epG JF `Ql `SdpG JF aQn `3SfpG 8FFH0b#`O080 +$ A;+R#M(F>(H #,T CK \" JFnpG BЀi -OTNK @@ D`LOy0FI  DJgI B7I DD@uAvB;L5FD0Z7IFFF'F&F%FF 0KXxF Ai)i+8@ U, BB" B@FG(!@0 02KEB SEI BA@FG(By  @FD;e6DD" -O]FFEF 3FF[AFћJ TO IF AF F*F"FJ+"$Oan#Jon9FH."9F(FnI*F0F0&цK)FI`"9F(FnI*F0F0)i~H 0 AFRF FW0 qJ)i)qKZ`#S:Xh"9F(FniI*F0Fka@#+aiidH! FB"9F(Fn#"^I#0F*Fa0Yhicn#F(@VI :!#nSJOao {0۹:##nOa z#HJo0+QFEHPF0DYFAHXF0D0AF FGa*F4I0F+a@05Ii5HfPFd#3MH0k F("K/It-HRAF FH0I0{@Ā`P-ŀh"AF FGi z"9FPFnI0IRF0FD05JI0 +FgE E,Ei?pi~EiFiFEFFqFF" DFiD =N ##J#S@#S/Hp#S+H@ #S&H&H##J#SH@p#SHpe#SH@Z PP-?=kh FG-h0"AF FG ]G DGG%G=GGH-OF FF` )F F0?I:F VlFFH9J  8 FF3I :FĐ/KO0 F@F |'YF8FnYFPFfPIZF F K0hՙL0hԙM0hՙN0CO06[AF F F (-h. XIhhAGRD" G{ 𵋰FFXFI I(FvOF("hF.IjF(F0h+I I"0F(J ;`;h I"F TT#(i8TTT FFm:I#FF hT-CF"I F$F@ KOq N4h NF(FF8FRFȱFHFmCF J)FHF$p$(F$cD N4hF(FF@FFF8FmC J)F8F$d$$$qd$ C0` O0UU#UFIjF F\8K@ I h + KN@CsC `UU#IH xU0IFpI FHI F I FK!hFhhCZh%"`~ IjF F:0 I %0UUwUeT#i7V7 FmFH/mF H Km4F8 H0!FH,FVVV!V&-CFBFyI 0FC BFsJ  ("!hF "!FhFnVlIjF(FZ0,ј"! gI 0F0aJaH8Pp`KXh !F_HhxB:ZxBr13 VH!F!cFRI jFJI(F0NImFLH:KIPB HH0EIE)  6H )1:H m (L F1Cc½hBъB3Zh*-JFh*@:"(9F^hHF#KW/B3(FmFHHI8h D#6B 5#'F %TW (i8iW5V4W?WFWZTWaWmWoW|VVWWWWtp FFF(`P1F"FF(hP.` FL #`O0h p F:-AFFFF<j#`O0 Vri)FF@F0 Fgl`𵥰FF*FF8J#`O0%#+~!T(F0 #ji!F8F0h Vc`-GF FFF #`&jJFgC2s3 F2Bw2BA "#h"+O08F)FF #j1FPF=0h@FIs`Fh F"@!~-MOFFFFFE h8 cXF0$hj`O0FFļļĜ40 40 0 0 pj(86hkbbc+-OFF@# Gj#`O07i)@1j)@ IhLF(@"!-݀58FF( Iji,KFD/!@FF#;% #5#    YF@F0F(@ i*@,ɀ " F F"x*O O "#`@Fc(-}I8F&(rOsQB?kY)?fy\)aA\ X^0 X p78Fc`F(?M QF  9F(FBF(FcS/?5ri;FIF0?,i+ր,ӀYF@FpF(@QJCF  th(( h (? -3-b#O `UXպ@FF(A X X0@Y*@##"O;IO;$N!? F F YPO;+?2kDO;Ҳ^ xX0T:,;+?w*kDx?#*Fa- W<+ #ɲ CF!FA-7<0< ,ـYYYYY ?qx1rF(Fc,J+ i"F$F FJE ch0KY-AFFFF@F(#`O0@FJF #ji!F8F0h Vc`-O%FFFF   3pW;F:F!FXF5g`9hYFhFKFG( F5y F00h+Ѕ- F^.#`O0 (  "#` -GF FFF #`O0:Dj#!ia00sIFPF@8 0h($h0-+ PF,(( iIaiybh*=C$70h|( 0ht(H #FF)F0F 0ck xk`i+aZI |Fh#FYFF$ !FFb8K`T7`ZFF !FFb(KeDa7Z-AFFF`i0FFB hcaac bF0`ixO05i`ahcaac-AFF (!FFbEF K"1F`FC/:Fa0 Fc$ F%wZ-CF F ,!FFbFFK")F5FC$/2Fb  ;F0 FcO HFZ -OF!FFFFFEOh F B%`O0lO hBԹ`#h:FY+ FhF[FdFG(|h9F  7 h[F:F FG(|h9F7-G%FFFFE(Fh_h'ig1F h1FFGFPF"k  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#AhP0O0`k$h08F Fb`ciE``a#`a#t F8@O08pư'IF&IF0FFh#I`" d#`O0Fp(F0F F,xxFBI Or!hF*)F/*("!F/&*(" IjF0F0 HZ@ZGZNZ^iJZIH xZ1K!-CDxFOrB F8 Н9'0 8N@CF:@C2Fy. ,I@FI(8F,###p(,""p])hcNH#F DI#iKZZZI"k0I  iIZpF NM3hB3(hp(h F"!^C(`F4`($ (#-OF+pFhFF_x0+(8ICx h310x+ 5 3K2JF,xT!FPF:-K,J5 Bݒ!HF"`'痱ha0ix10H(%(FEHH7h 50IJDh!LX1 XW90\ I@O0<h0@W< C K5 [[[)pF F'x0+$JCxh320x+H&>Bpb\20 V1CB"FQ H)Fp@O Kh#FH]6H [[ [[pF F"!~- -7 %#`(Fp"#, P۴O,F!0FZoA\ @T`bF(2F K"#F FFCF I 8FFFI"(Flr*F1F F@[[pF FF!"hFjF)F F$p-OD]FF(BJ  ~?F;J#  PF06J/Or!԰(F"1F(F@< D]ah0FFhKx+ё0 x+"JOC+a*F@FyIka0I>$h|KEћ0Ohx[s@C(ѝ<1O+K ZF\i\#pFHx FCF h++ &pI "!hFV"1FhFl"x!F*(" IjF(F0 h1+h/+H6\ei \lKx;@FHο"o\|F FF Fgh(F9F$hhKxB8F( IH x\ FF!F(F" FF I `I"( J3yh320[ I*F F0O0 O0\\ i:"F0J :IjF F48:#`O0 I F00I  \\i9\"F0J  I Fb8#`O0 "nxK I F($0 I F<0I ]]\i9\"G0н0]#HJ](]!pGhJB ~BB J IBFpG JBJ IHpGHpGHpGP^ PPP^^^hJB~BBrB J I BFpG JB J IHpGHpGHpGHpG^ ^"^^^-CEDGFF FF(FB:FIF0F=F 9^), "FI0F< 9d%B 5/ IEBӨE0F=K20sQCW^*^-^IF00I I  F<8KOq0 F ICF HL F$i^6^F^Pi^F!"!0 #I  FC J  I F0I ^^i^IFjF@KOq(I F0 I v I F0I ^^Pi^6i^-CEI OsF_0AJ  <?H # #%Ss #ccb@0O3a#bb#c1I"F0F_0S.I -H "`P"@*J x%ahY2 'Bx:*$0%O 0;ca IEP#`O0a 5 -x+I %CF:F!(+F"3a+Ѥ _ __.8i_a_6 _?_A#I F0J  F IhjF I F00I _q_w_i_IH x_ð2F("!0FI2F F0(6'Ԛ'o%%"!8"!$!"!I F0𛀝l * ِI 8%%%H8l m-!чI F#`0e0нb0+uЁH I F#`0T0нb0+jzHvI F #`0C0нb@)B]qHmI FI#`000нb@)BRiH8"!$^fI$ F0(+H R`I F0@]I F0[I F0 XI" F(@ǀOsBRHCPKx+OHMKx+MHJKx+KHFKx+HHGH#6:I,2 F:.2>02$+*0=Hx)-.,C0C**+6H xh300[Kx:+* 0H" /H)FT&$'i))HJ.?n7/?j, 5i!H8;H2 ^H*(i8i`h`i````8iiiiaa"h`````` _.```a  F  FHOsBH P#a!a+0 I$jF%DED D D0I(F F08i_aF"!hF IjF F0I i_IF@ KOq". I F0I | a4^PiaCpF FFHFd0FE< &D3+ HN=ѽp@> - aU^-0%   I  gCFH F 0,FiaX  IFh8K!Gr ! Fac^P  IFL8K!12 ! Fax^P0" F!" PH  0@J"!(FXmFOb)F F( H: F  0@Ax+x+i+aa IF@ K@Ak2B I! FS0I a^Pa IFh@ KOq2 ! F-0I j a^Pa-O=.I#F Fll&tDOC DOP DOS ~DOB >DA'{'p!FKDHF!0D"0 +_ + D '+?n =/ #MJL 33}@B9@B+JأguA7B'رO 'f13?,!!@C;2%2]A$1Bc22Hr 2L2zrF"DB9FE#x*+Հ++Pfibc#c;2+R+0+΁Jx*?)+:;'+Y/WY=?WWWWWWWWWAWWWWWWWWWWWWWWWCEGIKMOQSUKx[cx!vIFcx 3D +Jx*ЁJ'+FF  e E> WsH]70"(HFF ~nIiKx+СxkHtdKx+!yFxO xeIeO bcx;7OEݘ(0 DB[HN  FXHDMKx+СxTHS0RJBJQIc .BKx+?wKHIF qFGH꧉FIF6CI F8'p_FF03F;D ۲+a8'I3HXlKx+?.-H !Fn&XF *  :F&H%KFJErEJ H ErFH  I :FJ"hcfbb_?c|ccccPcccbb;cdBcb"^Pb1uJBѣytIo!rnrKx+?"zyoHd+zjIo!sZhKx+?!z fH L {z<7+]HRO ZFRFX,OEјSI $MKx+?la NHIF FJH'IIF 8'   AIFFF?KGDoc+[:(XF i  :F4H3KF2JEМE/J0H ErF)H  ;&I)J)J)Hbx!F2+$'Jx+F$H$H$H$H$H$H$H$H$H$H$H$H$HH#H#HPc"hccddGccbb;cb"^b$b1bEbNbSbXbcbnbxbbbbbbbbbbd0IFjFxBF H F%00I (F$D(FidLd`K"`pG DpG O4S+2h @pGSBDSA"D Raa]pGFazFH < FhJh+`#D Rakaf ]pG RaXaS]pGK[h" ##!##3aB0HO0]#DiF! HT! FJC H!F Vj0H!F i(i8iJp(gK%[hӱBF! #*F#!+Fa0!FZH@$  % U U F:FhFNH0LHLL%*F UU"!\EJaai X :HB9H"!O0.(" " 0Hp/N5`"O0Ch+!3h+" " 0hB+OsB H! FH4h,+OrB+ + O333$ H#DitiiijQ Djjj7%SKh#0@pG;>+b#`Y T! "D! 0"H!"aFI :` MF(` IH!Da([ k`0 Hk~#Lk MFF H^IP Hq"FR \k~ x h(0TK! oCC B K` 03ȲCBKK!`mmm(0TKI 1CC B K` 03ȲCBKK!`mmm(0@Fd#%BF#CL`BK` 0K!`mmm(@# C/F۲L`BK` K!`mmm(@CS_FL`BK` K!`mmm(@CCOFL`BK` K!`mmm(@ CCcoF#CL`BK` K!`mmm(0@CS_FL`BK` 0(шhTIòCS! C_FM` %B۲L`BKK!`mmmnmK"#I@h] P-AF!'FBO@F`)FF()FD(77 FhF]I*Fk(F`. `0Fkn| F xn+Kxo+4'k%FI00F`(F'x!Fn+ Cxo+0`(=F `(чnIFFHz n x-O]F S D`oooooo ooo po-Oi$ F #cHRFIF%.`N'h0 '߱^KB@oqZq{;B;FF8-Fpn5F0ON-1F^(xh5FNsh+tCH#-FFsh+f)F#### ##sh+Ocor#IF@FRF3F`#xS ! F0p"H"FAF H $ OV <BV<K[hcIkV,-YFHFV <' 6W Kp= I H $ O Ipp<qp#XrCrNqpqp8FF T)Kh@ (F(Kh8#8xn+Cxo+0K"`FC 0_FH F` H%(F,/0F FFK,!F0`{#8uuIFHJ Tu x-OFF"! FFܱ\؁oJ%FF#5``09FjJA9 +;+-%W"4O5@FK3hZ\C3`4#`#gк-@@F(0@NIBF r(d(M(DU(aG(,e8 (S -----.----.--.9CCO Csg{#gs%kC!I2FiI 6iXCO Cs`gHo0Z-?Y0gS cg g%3+'(wwvw '0] e$#H)FT,(0I+F"F T<[T< `Oa#Jk6 ` www7" FFvxB(I#F*F 0xF^( FI@ݿhxF^T( FI@Ϳhx"F>Bx (I"F bx8F F I"F b#x/+ !FH)FH8@8yy#y<IFH yP x-OF#F` FJ F|;`#`0J)F FC0,o(I#:Fi I iU#AFVxhQFON'({yx{ '0pm c"F3F#H)F#F2h 0h++h`R H2h?F+F"h IH {l{'{s{8F F, I"F #x/+ !FH,)FH8@28|#|8|QNIFH |h x-OF#F` FJ F|;`#`0J)F FC0,o(I#:Fi I JiU#AFVxhQFON'(~{|~p '0pm c"F3F#H)F#F2h`0h++h` H2h?F+F"h IH P~~~~~8F Fl I"F #x/+ !FHl)FH8@r8IH  x-CFF F#3`)FJ F\AKh,o(I#2FibI iJ2hR U#@FOb`h9FC/C (8'0m f"$;F F#FH1F0jh IZ FFM8F F I"F H#x/+ !FH)FH8@ظ8IFHx  x-O%FF")F F`rO.FFFFqJAFC0nKhB5ѻ.&X#4Whd58F`4#`к.@8Fh0@YI:F u(f(M(V)9(:G(+g8(S 555555o5555555g55U(oC oCgoCoCoC8hO gx8hO `gq8hO gj8h&c#%I8hi2#I hiU8h%VNo ^.?] gW #g cg.0gEDCj0oCg#0+'0 pJm f(+F"F#H1F#F*hT0I3F:F +h[o eOa(F# Jjd0 H0#!o @I7" FFxB(I#F*F 0F]( FI@ݿhF^v( FI@Ϳh"F`Bx (I"F  8F F I"F #x/+ !FH)FH8@86KdI \x( Il}R1FH x x7 " FFx (I+F"F (0y8KFF K%*F!F8xF I !FD n(F8@_˻#@-OFFH"F F!`F0rIH" FONJQF@FC чKh {28F(S ::8888888888888:/8:]:e8888:888888<8<8<=88<88888888:7:I:U:w88:8:88:88:<:<<<=8<<7Kh 6K"`N4Kh+1K"`i#saBiC#0ha!iCSc(JhC`/iCi#0hD!iCC diCcg!0hFiecC 0hI!iC3biC@iC3 I0hJFiF I  ('0 #l#d#pDAI hB `Bi"aYBiBbaBiB@aBiB"ao~Jh*a|J!` zJh*WvJ!`i"raZBiB2aBqJ!`Bi"BaBiBaD"`D"`ZeI(FhdK`cI(FhiCa`b^I(FhziCa bYI(FhniC3a`bTI(FhbiCSacOI(FhViCSacJI(FhJiCCa dYEI(Fh>iCab@I(Fh2iCa c(F#hiCCi#C0hR!3K`0hr!iC`biC#`0ht!iCb0hw!iC b0hx!iC ciC###;`Z#ObXF@ hhZF F#p#l#d (O#hTZ`is} ,-G], d gsH#:h9HIFLE0xhK+i B9hBF#sa,,IKFBF X8hJi GOa8F##Jjhh # " >2 h@C&8h H2F,LAH l kkKk kjjKj jsi ]FH`#d8F Fx I"F #x/+ !FHx)FH8@~82G`Bx**I AtF@h#F(FO3c`#h"!Xh(O0#hhe`i#"!(F#h(FiiF(:F1F(F@ChsFO3OzrF FhF!ZCP(`h#2F)FpO0sFF Fv#!F`(F##2F( Kh#hBch+ѥhuh\`ZI*FhFO0p#P(< `0 <pG FIBð)>2"#@##" #>#((h_ IF H#`O0C] o -OFFFFB2%O )FZF`DU`J#D ;I8Fh3`D5#D :<D 3SK<3&C(H#`O0V<(D+V,*I #? ?-O%& /F(FUF F/u=.z<#`O0 G J {O O AF `IEp %/FFNFHB%UF7FFNFWGCPh(FFF FheFI (-AN} x FF!F@FOr(FV)F(OpMF4F$N4D#I:F0F #Ch N}( 0F L!D ĕH #-C["F FFAHH@!(FFF! "p4h:I0FkF렱1FF5H@ :!(F`.FE0H4 JiO3GOFFO&k.0+O&iI2FACFBF)FN(Mi)9FDcd.iib``cakh5eaa #ai#sa#8< ##-H@# I * gz "]`mIFHZ d x-OFF$"!(n$#+`{NF`'FzJFD`yJ`yJIFC tKh[ +g8(S E9DDDDDEGEUEuDDDEDFI0hQ#F0hj#F0h02hTI ###OI0hhRNI h:"JIPF(  PF3x!CIRF b ?IRF Xz !##n7I"PF  PFt#x0IRF -IRF-z ڀ' PF02h%I0hO F9ObY!67ph707Ir4a,b-'0'( 6 LW\BCp8  f"F+F(#!H1F#F*h0I2F +h[#!hH#H#Hi]FiHi\FiH!jH 8 ph Hh HTZfs7" FF2xB(I#F*F T0`F\@( FI@ݿhrF]( FI@Ϳhx"FBx (I"F }8F F I"F #x/+ !FH)FH8@8pG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`tnh`lwhd ^  lm(d T lcdJ`p`lSd mO(e`mKhemGemCeQ BC p`"J54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,>cW6F0H>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOrh F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"`!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3 i jYh:bJBO5sAJqm"@X\CZT#h#ihFhhQn   @$Ci0Ch$:$A1ih:` jSCEzsHRFKF X "PFIF0\EFF0FFO{ "dKBD@C. | cC 3B DCFx0"v`0  @ C0!C@pd0 F  @$C@Cki0 !F0F "PFIFx0@\:H4JEhji4YAF8FY$$TRBAT`7SBB @lh0Fki!FkO"9F@F:(AF8F|h h  E 7OEL @POr9F@F ## UTT(#TpGP#@ \C TpGR##FIH) x-ONhhQn   @$Ci(C;Kh#ihFiJ_hB кH%,F(F!Fi+@𯁴HKhhBvqn n  $XEC XCE*|q]KO O m*@"Th$%*(iF@nB@r D!@\#Th0;0#;B2#0;0[030#3B#030wKh+yn  C0$0C0cETT0CDX:P0PecEqCX0 A .@ yn  L 0$LFF[FOrO| pDO| ,2D@ Or[FXC00DvI90;)0;k+NB3ykHDk 0D 0k 4$ [ 4Br$$0 D$0k40340OE|hikBKh#i:FF&hhQn   @' Ci@ ## UG 0OOc O  _ EZO _ E, O_%I%H@hkEuiKiBuUHC%O,FO ZO \' Tu!=QhqEvwnWaFFL3BArL A TRm x8 FyFF(F2"2Khc h[K(`h[8# 0Kp Fh!F+OfOv2Fy)F F3#3ps)D 10Fp#-O=ǰFF!OrFJKƬ$uOh%h>y)b+JJp>s!tYh#I(F>t!0hXkYbO HF =GD0p.JFI #De@BL@r[ CSfd04 @+F#"hkAoB@lBoB@iDoB@fHoB@cCB@`3B@]3B$$#O @O ;FgKhC @`O*Fhk0#F0FFp`" XF@F2FXFV.@! 2F=Or! Fx Ozp>xh\eCC4HB@0OA###.K00n()?h#De@lB @r[ CSh0p8h( t[n@+FOxSFBFh rC2  خO F; 0#|#  #T#+[JJOzr>thSC  (FYIcd#ddd#c5!0hXkQ? #DeL@eBr[ CSR #d@  @C!4 @@+FD0VF$ $ $ $ $ $!OpD0 @0 H0L0$K0OA00~C?"h#De@lB @r[ CSR # HhD'a =Aq%@45<48$P@B0OqrH :KhK <48x08@j{(0@DAF8&FUOsXFF9F#F&%`9`BA#FXF9Fd`#O3sӫHAF&F0$-BOCȿOؿ# @O 3JL@|*O3BCBs[B @@`p   XJ"JBXC2G/2GOBGrG00 `Y @G")F$OqOsJ I"Aq0DBrOlB8F/('Bv8/Fy";FJ<#F @pLC4bBXSB=F6";F0F)F@~HH@J` DHODBڛ`@OrJp#F\"0F FF)FD1H@`0AOHDBHFF N9hPo`(F!P#i<$8D0`a ,`Eݲ <$nw8tOF ##  H 5-bO A$%*ON@CHODLjJDrDBD  RJh*opSC*30 akLO3H$ IA"pF3a@' ٻO1D+O,%x#<#(5#03Kh+?:#05 F/Keh+!F,H3d3d4  $I r#K"%k\5O3O#t+ gVKh2"T  @"+C@C9FCXFO##D6F F':F>"#ON 0##%~T#h!%ZkRhaL4PkR3bisb@bbD5lc@_OSfKhcKheKheKh0cXTc#0HUP0*hckP @X0DbijJB"9cO4A" :kF3xa 9iB9c0H& ̠!80+@)L#+r&H 2#M9{i`*h[KbC FTOV"s1F#DvFX:> <####F^#T#|T## 0##O`z_Kh+V]I # he)hOP^FObhObxiDQKhyih)h0+xiOr!Wp0+K#EKEI"FfC(uѽJ0+P# 0*{+y; |.hO`1F| F)1FOP ObFv "FF(ObR)hOPF"H0+hMj0:4D\Bi"iBCDFhInDr  @#"C@!CF# J|P#### @thT+hjLO ^FhjB@XHD <8TOsOF  "CBA\%IB& #0P D.4<`DOK B D p0C_C  CBvۇH,( h!i Kh `0 0$%*¿:n@p0xK)h+@") t o[Bx0x #\0 2`0 H$%*dJh;3#h0$%2l09nCHd0 BTH% ,i ;j D;b.  O FDKE@ԀzhBK`BRFvq9nh$%* ݠi "@nG\:CBTi4K i2ah*Od {zh*KB)KTzmR 1B yhP%BPCm @{*@g d0 F00 FPC8 @Z2R8  D~# T U 0#X000+ j;B,x00#T003X0 BKzhB5smxBpijYh:bJB5smxBpi;j;;bhkZ*@ЛO Yk1Yck)FwH+DBЀZB"D `0%8 {i*DB@߀B [!Zk2ZceJ{iBLh$5+nO n9D#2F8oEOK$%BFQ# 2A# 7$ $POjE;h#jjkF h !jjUn1Rk!b@%hj!Zk`bh`iik _OU(D>;h+aihi)Dhkci4M 0o+F(#h\%@(MBii&jCR@Fh]nQ@p  @! C@#@ K\%BM+h+`6_ zhOBvr:n 1Gpizj2zb U#TT#{hJF`SEvq9nh$5+ ݡi #@n\CTi i3aKh+Ld{hSET{mS 2C {hP%SEPCm @*,d0F00 FPC`@Z2R80  D {hBvs;n5@ Ui{j3{b  +KFOL O +$BFQ#0A#B B @I 88 z @J k08Px`0@OEFEeiE=D(F5 @E #kcDBhWHP%U\Bii&ACE Fkk   EudED   !C FE\+5Kh+@+D?. ;h-K  FF'I2"\Bii&HCBFhqFBrxn  @B #:C@H#0DXDBP+h+)hj;# Khӱ H Khӱ 1 0T#v1 O t|:x* (F0UKhUI TLghcgQKh+303040 40JkhSC#oCIOb`iAMfib!`*+hh1F:Kh9K\5h0+WpOr!2KhzCF:Fm+h+hiZkFUhQnLdH  Rk&@Ci8CNjcjB+h#hFZk3h !jjUn1Rk!b@8!k`ihiYkI D-1)#|# 0## 8#-O}FFFFJFF(hI2F (  eI@F&ZF`(F(F_I*F@F0h+ZHIFvO0 }kcj`j`+k#akkcakakka@0#bB0cbklb/}GI:F@F0vBI*F@F0;AIJF @IzQF8"F F2"F;I0F9I0F 7I0F5I0F3I0F h"F1I0FB,?/I00F"!8F1FHF0' 0Bg.BOЪ# (15D*2*#0e "F ]( 2@dAde@dzf /BW-CDM$OcFF!FFfCFO4 F DM"FF;FHFF(F, 1#8F F I"F #x/+ !FH)FH8@8 pG-GFFFF)F@FRF3FFFj`#"LD&O` FVE`۽#D#  6YH-GF4 FFF%! F@FKJOF#` #q   K" #!F# F 3F m#: ^FF^ :p FFFn2Fg2F`2FY2FRppFF F((*Fmep-A @EB ȗA nҍBAӃ Bt ҍBA E|   -OFFFXF# " `0FB xFPx(PI3F*F m,3a,M,%A,!JI+Fb< ,P$eBRFG701F8FFF h Fj$6F6  @  ! J +FJ IF&PF~$61F8FJVlX 1F@Fh0pC O+FIF&pfPF|(FOZ"$$`SEB# @4 !-AFAN0 0FB FZNFб"F+FF 3j*FBF[ (FZ= x2(*] #!3+BDk\CJ N"@CkT06h+F@&F@F (FZ0608,{ 06$0 hpi;` D# @-Oð F! FKF j!@FFO1,H06RFOKDXhBKF &>H!(6Eb0+ݬl3kn FH`+i1Kh+@͂D?G4 5 C0"F 2 *C 0ѥJ# 3Pf$&B06KDhSF&  c#. 6$l# @ # ##  !# *jkiH3.F".p#D0DB0+ŀ6;𾀴Kh+𴀰K j. Kh-@0LlCm񨀧Kn!H[O@g"! (( F jDh06kC3jR#06h!s$(x O&FB&u$ O K6}J2MEo #"O"!llS;nsJ#3'4/5Dh0!jlH3&#h0#@!F$(@I^IZ8 &.)F" j$Hh03jf)F 1ZC"1 DO1BAOan@Jt!5$0"h0F%021 5Jh]#v@FYF ,JL@FYF 6*FB0&0O  &DB&#ME@FY1V3F @0FY#"!zl+ƮJF% 5ME J# # @ !# $ci"3+DF#F%B"KE9CFF 6"DDdF #KENJ1 H# DD2H# 3F%05l@K"q!M>I=Iɺ!F8I06Ix!4H  RF1I2HwXfRF-K @*uV&(K0F@&"#ciD"HZ`[ !O)D&DV0(D Zei6HFHv@K hXCF:FF0F)DHDC. !# ## @# pG@pG8 FFFOb F(h `hh``h`h`(i ahi`aiaia(j bhj`bjbjb(k c( h`(l dhl`dldldPPRRhm`eXXZ~Zmwe(ns fhno`fjf^`^8p FFF FF|(R hN`(J hF`hh@``h<`h8`(i4 ahi0`ai,a(j( bhj$`bhn `fnfnfttvvx xzz|.|GеF.8ـ3+5+-+%+++ +p-O}FFFFJFRF(hI2F (  eI@F&ZF`(F(F_I*F@Fp0h+ZHIFO0 }kcj`j`+k#akkcakakka@0#bB0cbklbB/}GI:F@F<0vBI*F@F40;AIJF `@IQF8"F F"F;I0FP9I0F 7I0F5I0F3I0Fh"F1I0FB,?/I00F"!8F1FHF0' 0BeBOЪ# (15D*2*#0dX "Fr ]( 2@dAde@dz[$7L-CDM$OcFF!FFd4CFO4 F DM"FF;FHFF(F, 1#-AFF"`0FFFh3,x[x+(I;F2F nS-"F-G= -S%'33g= +dDTOH( FAFDTO($D4OXDOxI;F2F% I LF Hp I Hch5"x4IHd- l x-CFFFFO 1F(F\AEFtFۏByI3F*F -O}FFFFJFjF(hI2F (  eI@F&ZF`(F(F_I*F@F0h+ZHIF&O0 }kcj`j`+k#akkcakakka@0#bB0cbklbZ/}GI:F@FT0vBI*F@FL0;AIJF x@I*QF8"F F"F;I0Fh9I0F 7I0F5I0F3I0Fh"F1I0FB,?/I00F"!8F1FHF0' 0BdBOЪ# (15D*2*#0cp "F ]( 2@dAde@dzk 4G\-CDM$OcFF!FFdLCFO4 F DM"FF;FHFF(F, 1#0" L xk%h3150 +۲T2 *0 ## K"`pG$1FHO0?FH -OF-h"!F}R|#h<chh#icii0#j$0j+#k3ck80c%@0*B0$D0#F0"G0 l2L01#m)T0(@#,+fHKFd(aHC9 ]H#COr@c,,F3TH$;bvOI"~(MHd#"f븨!n"F EHIF3l >HBe+npC_ICE6H6I"툻^pE_,B)7xrWBWA 8ysP"(IjPF8J'QF(QF0FC?ਠBu!BH#0 ! " B BBF DB 7K+`S 31O3z3B%B" )+p'+O""   ) !!T3Bѥ!B+F(F(#r2[C#2hCR[siP3i3[CB#hC[+3iO ݻO ٻfffgyRRaAC-SЂhh *Yd @8  Ae K hM N OB`bxT1 $@-'B=$IFH ( x-CF FF!F"F2A F(;AFꐱ}Kh"!@Fh:F!F(FC FHKhtI"FF h+ IJF |ihhs`h:F$'4¾sFMh hNJ@FH Hp"!(h h:J3F@$$0KFH6]I𵉰FFh3SBF*Fh/4'78F# xNKF2FbBF  OEcqH,qHpK" pOaX`2+F@"D3`2!+shCWI`b .ձ@ rh{:r`Aqh hiBEOrDHq;F2F1 @=K (_hW #9Mc#ADIQE#3)DB#,H Ԩ+@  #M'! {:"shF@ QEW s`)D`FsF'+}$$t3P$`$bMl x '$H$s$e6$;$I IshQ + [B( +D Hs`B13s`KB+ D;%$;e6-GFFFF ` w jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  59FFH*&0F ō$-CF#M -FF(F@h+HCF:F1FHHIFh?  ?H !!h R0;h< IC@@$Šž x Kh K* F%F+FFH  %tΉ xvIFFHK"FHXF"F Hq"FHHa"F ϰ xpF FF+ * *x *##pp\* Cx+IHn(F;'*"*+;.F;B+I5FH xhӋ FKhhSHKh\B Kh ) (O OCOC`O0%%%FFFP;"F/O#7O? F`,HF+Jh`)Kh[ch(I; h\B#(FÈ*# ##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#1h (/#@# %%%ӗ xhhFMNO F+hh *3h[S9hO  A L#2ycy 2, F%%%%$@ K : *B ( QppGIv x F6IFF(4I" F2I(F(F~F FzDB ,I-H0 #x/+ $I%I!F(F4*F+FxQ<,Fp/+#xk/)F F1x/(`FF+/* 2* cx.+1F Fl&F4F** I((jB=/+ӸӺӽ xӾ-O]H#1#3@#SaKbKSbKbK 3ObhH>H##*SѤJ#3J`J#3[h+(I`NMFtFOBFIHH^:hOa F0:h^# * F8D"F9 + + M#SpFp1F0#xs1 @ObU%""vMFt!Fx+F3/+" AOb F% @"@!V)hM C0iHx5`4-cI PaJOa10N P A0ObXI %#8x+`+)?+"D+PI LIJI!% @)ObQ#^$;$+%#a;+R#]S]+ǥ]O "IF ( @FQ F?Ү#CK"`KhCK"F+F @? @ Y9 %&P%$@%h% x@% (y LF ~(E @wQ?( BHzr A1l dIF X( @ÈԑI BK# FIF :F( FKhK"`2 &IF (tItHsrs    # )# O#s*s3s;s3&3RsZssY ]IF F( @F(?ҭQKhchSI; h\B­NKh+h+? H@F&F(u)F@FL1G@FB V~O #! SF*FF#BRD D/I-IF+2BDSQ+FQ =F 9F87#FCCKE@+?Xg-AmF;`3,/*h$&I8FF8x+ 1F($ F miFN(FFF(yB02F)F(&h=%F4J 2y 3a!20h+Fri[FXF1F$F6K !$"v#y3#Dcii i i i i #j i cj i +F"(!ri3hS$0i+F"!4bp% 2%MO xZ%?4%%%%ЁK-CFhIHhH~O#"2Fy`!T8`vH#uH"#ÈCÀ5"HFF BhTjIFjHiHIF(F( .hTcIF`HlaHIF+!0< FTBF\H"F1F(F(*hTVIFPHLTHIF(FRKxR)r)vPI0!BB(ЈBCIAJHKH 80"(F(EK"?KBK@Kh P # O( #4D}`(<`1D'B4(3( 3D(B]S(,2DC(,S,C,S,C,S ,C ,S,C,S,C,(3HW/ :`0% %?4 x$.Px%%%#%%%pGW37YKIHmt ~%# xKh)Kh,Kh2IH Fd[h9@# FKjFIh(hTy IFH: (%%E@ x' 0mQ@pGpGaJFhS BDKBKm I H ]"S BD %E@I%#b xF L Fh"i DBH4h*F`i9F0D.DB`%E@ KiDao J3 Im H F]ʻ%E@%# x#MF`+iBli FphiT0FSFha.aK(aHm##2FK%E@%# xK FhCK$h FF`GKh I%#F??KgmhT I;F2F@ HR(F\%%E@%%# x8ML4K0+I"m* JK$#e###c`*H!48%E@%#L%%IKsFh F;H F!F`nhGKhK*F!F 40 KEmhT% I+F"F`H p%%E@%%# x8FL hF F8)FT (4pF KM`khB NT S0IHZ l`p% 0%E@ x /K-AF.NhC5-KhñȀ*O:!(FpFh#(F;u`n(7 I(Ft`IhTJ FXIhhTJFD3h33`,F!F HAH%%E@% 357T%J%𵅰CL##V@IF@H##CkHF;I9H:I:M8#8KF@*1*+F6H7"1M1F/HH1.h.I##&IS1F0F#.h#C1 F"I0FI8#NK*3F7"(h Fu1(h!F1)h^+h[  V JK %s i%# x%^-OF(ðF FLF0# FsHtItDDF\E#hEӫoKhCnIkHDE FJ{1`0eI C#y+<  cJOqPFy20[#y^J\I#hhUH8.#..2y"h`y1A:KR#D8F!y >NJ0/GKhLICH#hDy"h`y1A:KR#D(F!y AJy"h`y1A:KR#D(F!y 8J 6Ih4IX0+$I0Hy.B"D .F8F'J0#y+QF(FB#JQF(F!Jy.B"D . F8FJ0Ѐ!(F"J!(FJ %C 0N]n %Kh(K[h +pG 0%E@K(-O", )$Fh*C(ЮHKh+'d;`}I"LzIHxHPOa"hXF"#hԛ0 +XFd+mIsHjjI$qHdqIXF9#A mI bbH#FkI `4 ,\I -,FORKhB )#@C9 , "FYILH jv `8,HpH4+?Į#@!@<ո `8% %#%%E@B x%-OFLh5)BLp#1FB\ y8@%ch(D+Q9F#hF)0B ( 0pIpH09"h*<.:/F%u-oiKheIhH#h+@eJ9h`0h!Z%ObHF 9399393HQF:F .?/O#0 5D//F-HIIH>HK *3*(*)BIDH2DKh{CHX :6Jh">I2F2Hji#Ob5/F5F.I5Hm4I,HT#2I(HNP!*Flch!(Fg(ahSo%IFH0#I#+FhZ??G 3 9FHeIOb8Dr%E@ %% x9%#P%g 0%N%%sJ#-OFh,M*@iNl"BkKBBИB ,MeMhCeKhdIeHh#` F(]Kh+ h ``h~``hz`hv` ir a`in`aijaifa _n f   kS c`kO`ckKckGclCdl?d("x x||!hMK+(%T%E@%  """a" """CÄ ehih iÌ sn(? Nk#BNFB宧KhJJh"IHRK"`uPFqFHFmFi@FeF^]XFVFRN8FMFI0FEF(FAF=Ob! F#Or #`Os:Os9`Os8caa00 7d650kKa#ca0C@S 2eKa=;$ & `Jh*7 Fx3\#=#caiNl#B#i#|3 #ch#h##k#k##dcccfEH&"hCN*CICH + F?1#SKhDB< +#<H!F7I e%ZlFF FF K!FFh \F FBI 1F(F@%Z𵅰NL`NI MI hKI|`II tO aEI#ihF(Цh@!0F(`#p=Kqh?+C0`h*F8HY#7K3FF `(FQ,.*2K%hpOOpCco h5%AOq h #"! h " h! z hC Z7 *_+-+H1F .FAOq V(c%Z %[%0ðFFFJOq0K" FZ`*FC0%ZLbh*I#c`%Z𵉰 FJ!FhF H"iF F DB8hbq I O% %Z𵉰N FF F !hF OhFiFF8h &"F)F8h p!a %ZLFrP!p")Fð JOqH"C]O0,4F FFKh.F ZhBZ`C!+I:FI2F 0"h!h"^php\ O3@hS` XBXA#F%[8 FEx- -*F!FF H @h!FFH8@H [!FFH (7((QrHpGHpGHpG  M F0Oa\@I M] I n; f+X1 ໋mZe "ppG -CFF9?HC =HDkCDHz+hBH`[V\*5O O rF#"2K!F@;?IFHd n xHFHMM F/h{+`7(@qBM@A\j$p`\rF P MT1ORS/M;1@Y#Bv,pF  H!*p!zH0F(I  D F>!F <,vP" !ZPU $F%F'b V" BmI#F*F0 J I"F(FO4?@HDJgrnIF;H[1  P x7tMI,hF FL"h"ch I(h(hh3`0@pG 1 .%h$ 38FLرh+;+J"2C|hP8@IFH2C lhPIF H%#h 8%h$%h8 < a-AF("F"0FAFP0 I ,FOF(FAF0FUP0 FAOϾK1+K9FHZhI[ B t5V# 6H9F l%h$ 1  -CFJNFF 1+@1!S /}BAK"!F(FC 6+CF+F FY K]h!F*FF H)H|Hv %h$ 1pF F&#fO0 p*I"F BMj C3F FG1+K!FHZh81+ OR>#H$ %h$ 1 -GFF`iKh۱#hH# p (%_U(F NFH lO7(%7O QF JF("D@F O0 Q FGO i "(" BHI2F j'FFAKj C`#("9F@F (7k  IF(" F"(O eE('FFO MEݹ 3/K /J! ,3FQ p  #B##QpB##QpB##QpB##QpB#1HAFR#H########<%h$  20 .-CF`"*x FAF0/#FH#P(FNFP #O3%F%9FHFUO0 l F#CN2B,I2F 0/#C#C  #"F1F!IhjC!F0FJ3F!u# #5BܻO1H1FB  H)F# H5  %h$ 20 . iZ0FF%#UO&0 0*I"F ZKjC+F F_1H!FR zH zgzg+z;g+;; ;R0;2 %h$ .d-OMhOFF;h!F'O[E,k FjF(^J   TZF4!O FxPFVIO BFOS AC@1+*F hO0?Ѵ@ Y M")FHF?F)hE >IJF h")x(Ѹ?7IJFOX T# C/ID# F#F1+Ѵj2OCCFOR)F0F,j2C Q#1OR0F(FbF*F1FF @D0h(FN+ P0KF"1F"FF @D0h FNs%h$t-OFMF FF@FLx@Fx r,LB+ KiV(0 JKKFbE 28%h84۱IK- FEIbhc- F.r 7@3+0KB,1+ぞHQqI{+H_qt/#h"k@ҁHFalH#3p+I) @IOrHIOrH+KX+ AFOrH+ I}HOr,AFOrvH+{wIsHOrAFOrmH+{nIjHOr~oAFOrcH+krfI`HOrloAFOrZH+k^]IWHOrX_AFOrPH+[LUIMHOrFp_AFOrGH+[8LIDHOr2HOAFOr=H+K&DI:HOr $OAFOr4H+K;I1HOr ?AFOr*H+;3I'HOr؀.J[F !*OrAFHH*OrIFJ%Hl$Hj#H (/@K$*JBh/3 20 28 .P%k!*2<DNRWahnq%h$mH H 8X"OcOs0V(0 )F0FZF0oF(0`#N0lO;0F(0mC3N\Jh34m;3 1IHmC3H*/k#h4+d{/`F(aC- NFH? JQrHakH,p+ ьIOrHIOr:F?chBjBPFNqF(?}-RFyhQq"Ts3FGjJ!DDDu Mbl H )F0F"SFND0 0{2C@3+`Hzcl{O + K^"F)F0Fk$*ѹ 0NILp#C3F@G2C@3+9IDH *;ck O O 0oF%0kMF(FKF0FN0'hC*O CDEX@FN F@FNh +O# F%;ackCEK0 `0 C $IF0F$RRF ` gk%h$%h8 .%k%khk`"AF 9B   hBЋh;C 3D( KhBъh*O:\F MCF( ! 1*)F0FN20?#CI* F*)F0FN0?ٮ# OcO ;`BF;F)F0FN0!\h +8hMF(?F;F)F0FN0  E?PFNFF#;hRFI F*')F0FwOHN0?CFMF0K JIhX\FO;F)F0FN0?jHCF:h!F F%h8 1-OLF=!''abFBUI (QK 3x3QH0FM痱NK@HFFVHFhHH!FFK@HF D%;Kis;IFV(C=IFP-oYF0FFFݱ5H[F"FB80FM4 F)Ff([h&FpEC]B]AF(I(H#FFEF0FFF"H"F0+HF(H!FBO F FIH#FEFO   %l (ARek x-O'OcjF9FXCF=FO WQI"F0F(0!sBѩFO hEP(FMh0FJ  chB h9FLF(=I"F0FF('F0Bҗ0+"a `Oa0K7N#9E  `8 bF&H57$I LFK gOa8F$K8Fh0:FFH  8F(:FF H `( bFHd|Ade'%l#FFH$F0LM+FFF H( Fp@MJI F(1FI pZgCiJipB FИp5 FF(FB )F Fp@O0-O F-"F @F . ܩHR '6OdLI 02F ڜI+КK"F- --ѕNOc FPONOCN7+@NF-6++@<=F #  7+@x@PixKBOAvKB7AtKB7s%BoH %SS8SO TLFFD(,P;3[+| OK'] EUdOC(7+VON O O *F#F!0HR;F!0 RL ;N#;@F B8F X <h]GwW %z %x %v%x #% #W<B/W H2+F@<O"Gh27p<B7h7 pE7ѐB٢\+ZbE.F"p$+$"!<|K2F!x x8#tH+p,FxK@:fм[\Mм$bRENU2*$(\(*XxB*32 _x0/!٘xB31 \$LLl,4L$LO Bp73oDGH,,(3B #A$+h+;3hXh wF(63h,Dљhhxa+A$Kh$K *F,9!K"Jhh;#<$"3hYhBF'ћh#8F)F(FK M0KO2`($ J1F(F (F O#F#"/&H"&H&H&H"$"-OLM`!`H|KO2` LM(xJ!FF |(uK uI$`!FsH(lqKhqOlNI("FqF(a dK"%eNB0+bKh/@[Kh+?OS%hF(4YK:F `hWKQ%hKUKhF+rS SBPKhd #FDL,!hKKhkIK"h`hU#h3#`CK`5h*x#h?Jh#3`2h*h)F8F(2K7J)Fh0Khh.KhF#S B)F+Khd #F1h)a%Kh+?\"K h`h3h33`K`M@FI ,"! FZ#F"O aP%#hCHYd&H";%h%q0%%&H&H&H%%%&H"G(OI+)0+"Kh+:hF(3K" HhKhkKhF3S BKhd #FLN!hKh{K h`hv#h3#`K`XF%&H&H&H%%%-OM(FF0`)`;#3`Kh$`3h+OJ)F0F (-3h+*+h gF(,9GKGIhGK: hh";#9!*1FF@>Kh=K>HhX;KO2`$ F M($5J)F0F (#F"F!F  YFfF-(%h+(H9FH$2&K +hZhRE-ћh#4RFKFH9FK K(+hXh??2BA$0FKS#"$&H&H&H&?%"c&H"/"&I"K#COKK)&I""K#COKK&I""-CM`!`HlcKO2` M(_J!FF (\K$[M`I88K!"Fh4+h!FhF(5K.5J!Fh4KhhF[ IFR(:$#K!K1F*HO #C7s#B%Jh"FLm YK!h )Kh+Khh#hKD#`K`H1F&H"%&I&?%h%q0%&;&H&H&H"%%"%( FMwKO2`'I`hF0KbhIh "I0FK&`#COO#Ob1F(F((F M3x+;F"!Ff` &H"%"#&I""KF;(FFpG# 0O3J`HKh >#&H%#(pFFh@ `]J(FHF*F(1h h( Nh I0FKXPI0FKS(O0p # %# JKK`%#<&H0KO2`Kh+KHh@&H%%#FJKK`%P#z&H(8 F%%Kh@ $K"L$M(F `(h#h;K(hhK)hHX#hKJ!`(mO3J`8MhI(FK I(FK((F(Kbh Ih~K`&H# %%#%&H# #JK-K`%#&HJKK`%d#&HLK"FK`#hK"`%#&H&HJKK`%$ &H-A F(O3(J`(&L'N'O#h+ ###`3h8hx+8F H##`#h(I@FK9##`I@FK1 `8hJ3hNIx6h- F>1hK`Kh;>K>HhCɺ\;N%,,,-=w5KO2`O 2H>F]#JF3!F.K0F',5p*H Fx(K*F(FpF FJ|#z)FF;Mh, FXF(FH!(KO2` FCJ,0FIRK^(F%&?%%%&H%"%%%%%-A@OKO2`(]+JJ(CFL;R#!B#a퀱x|+ (`($6Ih5K5I` !F2H ,N$-M'+h3;B,Kh۹ %K"`BJ*$J,(юh, #;F P""R$ 4)hKh{K"`hR+h3+` K4`&H"$&%h%q0%"%%pFm@6O49K` mp! F"R$ F4,! -H>-K/!(FF F`AObh&Khk%N F1h1hh;`+ (-#KJ Fh~H!FBK O2`!F hZ ` "p" FfB1F c H$&H& &%@%%&&&)0# 087KO2`0(4JiF=;+0HYh(F;+,H`Fh)F(HF(F!F(F, +!HDFh!FHF F!F F-KHh2,+ Hh!F Ff!F F KO2`&H&P&Y&a&l&t&~%&%p(LO3#`нp@ K NMh 3xK23x+)h Hp@HJI(h0##`p&H&7&7%&&p(LO3#`нp@ N M3xK3x)h#p@HJI(h##`p&H&;%%H&@KO2`]((JiFT(HYh( Kh Kh# K Hhz HYh(K"&H&&%%&'&&?@yKO2`]((JiF(HYh( Kh Kh# K Hh4 HYh(K"&H&'.%%'5'_&?M FFFObhFo$B HiF{( |V$ObhFBIObhF4K"` M'g!K&?@ KO2`](JiF(!H&H'j'@ KO2`](JiFr(!H&H''@KO2`](+ JiFM(+ HJiF<(&H"/''80 KO2`8 L#B%h#`H%`IhH&H%''8C+c KO2`8 L#B%h#`H%`IhH&H%''80A KO2`8 L#B%h#`H%`IhH&H%''81KO2`Kh+Hg@&H%'81 KO2` L#h!F ,#h!F &&H%!F #0(KO2` Lh!F H F!F FHF(&H&~'p8=KO2`p(:JB(Xh<F33K4Hhp/K1Hhz,K.Hh.H!(,I iF [z{'Khd K&HhH F)F S!N"I0F@FP0Fx41D0F " FhAOh8GKJ h;#`m)F #&H(%( ((1%r4j%(J%(Z&HJK K`&H(]&HJKK`%`(j&H FOF(O3;`(N#3`KHh3h3h"Ih H33`;`6, K"ph"@H&H&H%(&H&H(7&L %M#%H+`%Kh+h#`0 O3(,+M !J##`(h`KhFK? + F !,`F#H#pOb)h? +Ob!F H JiF(&H&H(%%%&D&@((8Kh@ F(MO3J`8LhI FJI FJ(I FJ(!FMK L`+F(F H)*F!`QhP#h!%&H# # (%%KJh+K#K"`K`%%(&H%KJh+K#K"`K`%%(&H% 8F F)F F8@ۿJKK`&H(&HJKK`&H) &H(-GF FF*@(nhDI0FJ(ABI0FJ (>@I0FJ(pO,7Шhg,5h`%! q!F lF$-H.Kh+9-I-K.H hh+Fa*Hh(OO%&Od%!K`!K`Kh{IKH hh+FaHhfQF #IF  K` K`(?| O0)#)%%% # %%%"PK`&H0KO2`HF( Kh Kh# K Hh H4( K"`# Jp J`&H)%%))&?&7&7s F(KO2`pKNh31hHp@(Lhh "(xkjhI0h#0hSF H Ip@&H&?%"c&I))*80qKO2`8L#H%h#`%`&H%*6-A@VO3MJ`KO;h+JKKHh((8+GKh#CKFHh$8h "CNYh`;hK@J`"?LchchEE3$ch;c`+L7H (Nch;c`+O2H (E1JiF(ѩZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhv#hZ"`x +&H%x%*;%*u%% *j**%08O3J`0((J.(!Xh1F?? FAIZhKh-t##&H"/*%08ZO3J`0((JiF(!Xh]??Kh]h I*FF F\+s##&H"/%+0KO2`(ѽ@H`@IhHZ&H++O2K F@H2I@h"%+-A(M8O3+`((!JiFu(XhF(HzFXxK*F0FF8FD4 F\"F1FF "FI@F"F9F@F@Fn@F#+`I78FI4N&H"$%%!K-O@(KO2`(($J(!H"F(7xK*F FOF0r|#!FNLF;#)F;`#` #KRhX(FIL&H"/%%&H&I%"(pF FO3J`phI0FIXI0FIzI0FIu($hhqCJ KI`` Hhhh#$&H+L+S+Z%T%X+b%-AFFFF8K:FIAhͿ@hI_#c`0F JhF``B=H"hIAh񶿽%+%+O2L"`((@jh5I*2F8h "+h+##`MON"&H+ 2%'(NO3 F3`н@cHh OF0jh8h I@]@hI#c`"hI8hz#3`&H%++80; KO2`8 Kh3 K Hh8@oL#H%h#`z%`&H&?%+%,8C+KO2`8Kh3 KHh8@E L#B%h#` HN%`IhHH&H&?%,%,3,8*8 FKO2`8Jh2KHh8@ L(OIh%h"` H%`hH&H&?%,@%,m,u-OMEXaKO2` M(ܛJ4(ЗK$NU|FEєKzhIh1Fxh "64IOB(FO #' @0BKh#FF+21 VNF#xӹ3p(0hhCFktKwHhmK`0B4$+ \+Wcx4;#x+4jJhbxP1@*#O "dF0bx P1@U,:B U< 0FBS+\UH;FJF)F.;I"8Fd(# `#6I"8FX # `獱(hF `hh``hh`+#`x(H:FIF@F FO0 E(F*FQFF^h+3`c (F`` h++Kh-ѣh;hH+8` K M0 03%80Z0;0B0J%0 %0 h;`+ڊiB ( hZ `ppG-O\ I"& F& (@O3`"F`;F (FIh  0 x+Й0H)F$6, 7 F \ h.3x+;!0FF(xIIwI FI(TuI FItHsH*F!FO ##p0+.w5x-w/!0FBF^+^eIFuzcKf++@,Z#x+Y[I FO-+x3TI(Fr#FO (F@!FJ@KKk`F:!HF:$FXK'F#FO #F(H%F4F#;+(F5F4F,FFF.Jh0*!F|0@ kObFXF  ` "0 0KhHIF*F06#F `"`0;0y0}000000 %0%8%0w%+:FHF%(к UPFR,T$-+x+𰀸Ob!FVIOb")FOb dObNI 0 FlLJ#E0XhGMOb+`]DI FTQF @w?Kh$ "!?B(xHA(86MtN:F>g0*M FRN7(<AOB+H^)Khh)KhI1H#12< F!F F>2H#23< F!F F.3Ho#30(?516%(34a%4(0w%40 %%x%/4V%%%I M(h(< z hLA-**[ l(h(< fKh+@* -DхLMO0F Q@9F0F/FQ0F)Q0F=S0hBRwO#C8uMrL)h2p2#BQ0F(h#WQr%!jKAhhdKhmD1%cH_I2r hAV^I0FOwR0F[KhӹTL*jP:FcRQ0F_h0FS' 7VMI* +FKwQ0FE>*$+=&BL-Fs8Kh39K"F=I5h8F:I'v0Kh31K"F7I5h5I2F8F'M* hL h0` AKh+K%Hh$N }#h$$0h5,>2h7F(`QF(@ !FhO5FFFO ,FZ%H/%&I%4%D2L2i5Q5f5z55 9%480 "(`!F8x3J3h20Y5O4O%FFFOFJ [FhxO O4^F%FFFFO H.@w@w? Hv+?O5FFF&F IXF05 "F&J(5x+к6aXF(QEaXF(x*+Cx/*ZxX6**/36x+lK#C~jH"9 "FF99x-*0 "FFwIEuq9 "YFe0taXFرu,"FuYFW(?6O3}x+/u:(aXF(%FaXFtرaXFn ` aXFc0`"3"qXFR'I6MF(?$GXF$qXF;(++?.eH1Fr*د#@ոИ0HA K#CѮ H9 / 975&I&I567g66ҙJ2+ݖH@1KBhKMAAFW!KBFIh#M@FIKBFIhH0FG8@FG4;hx|+! a8h0:+++9h"1vK)lpKuHhV??oI `H`BJE%kHϻ%jI++3%gH%fIfK)fI KKh+?GJ1)s7IJhBOpABK h)?K# h F+)@KB':2??\!F(Fx:#b`#)+G+%)F0 )K:h.IF F> J2*s )K) K K!H#PBBAh h h h &H8%8{%%%B@%%t88/ 8&I&Ih))+2$K%"hhB3M`R]>HAE(#(G0#($#$G)#$&#&G"#&'#'G#'! m+)h+G#h+ hG##`~%s" F"IF~( I" Fx@#FF FpI FTFXI" Fb(I2#F MHX Fp@h++x+I" FBF(030B80;93c#!2HV0Kh++p!F3(I 'I 'MB Kh+3!F:!R#.(KBh "`!NR#\4hdI F8#x|+ FGJ#3`+¿33%t%I%t8%8%7-AFFGI "F F3h8F#3OF(DEKhB %%GICN1 0h0hIF @#`QF  -#3Kh+ 5./0Jh*@3JhZ//3/K0Ih(F/*Jkh20ZH0 !h3`$,R,DKh*@+ d$$/d,(-d$/@-->K"`35%vH%&H%H%%%L%%9%\9(&H&?9 %|/,@Jkh20[ -$Op 'C..FE8[)-4JB[$$+h+Ů.Kh+? G1.O)K"`IF QF *h@BB IL#hkKE йٹй? G 1kKE кٺк? G0$/$R,?7='<MF0+ѕ , <  # !1'@C`F%Kh%JhO2`[F'"H!K*`F( 0;#097+ѬKJIh0+?᭻ѻ ?":`<5%}<_%<<~<%<%%@<%%;%%RKFRLh h/1F@:F!>BFP@! h60H#h9FDO#0BKh+ؿ<#Aq!  t#9s Ozs"!"raC h+ h#+'HvP&H hO3 #`4!K(6 hAF h+h#+H h*F!8F'`0Н90+ #"!#8F h1F^%%bM%H<=%vH=7-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?Kh9(&@&?&?&@%%&H&H%vH>2&I>@%w\A=%%\%>:-H((F#h+(F#h+~ K1; HKO2`>:%vH>`&H-AI" h!F JHI Jd` Jh JhRKh5:+x-+ +ЇKIh4K]Qh,KhKhB:#O3!}K}H>F(2{L#h[zKO2`3@3@uL h(O3#`+@ +@bK `kK ZK eI dI SLtQ(8_K OK`(TH!F(@ڀTKdTBOA8a(@CKh)Y9)` G`#2F#FRx|+! Tq^0F +vP1Fl'K`6Kq P/K C ؉(pCOK%IhT@K0# 2F#F*(:Hj/ ؉%%&H9(&I%%%%>&@&@:%w\%\&H%&IM  >>ݢKL#`&(USFH(⮙K"`>  KO4h+@AK`HK0=JhBЋK4 E3Kh(bа?O0oO`L0 .4 O03! iyKh+DxKhxKh+wKhwKh+9vLvO AF .@E#BAp  0~-@ Z( `cH [+`FO0F;+ A ؉ JKJ ىSKh0=4-(!KHb  # G# $ Z F Q?J2*s (h +s5K 9h# =8h#Bs##r [?|#3B# 0F0?m X?h#3B#DH#BAK hTK# h&I9(>:&?%\&H>%@%T&H%&I%&@%%>% HM(h(J,` # # KO2`^ Dt ?s +?} Gx x?%&HǰJ IhU# FJA `J g KL KhKhB@ +DхKh+]O2#Jh;#~H!F(W|L#h+O{KO2`3@ƒ3@ÃvL h(O3#`+@ +@fK`eK``K $hKh+,Mk x-+ +bKbIh^K _Ih+  G WI VI MK SI(R x|+N !(g /!F^h+ Xh + DH| ##p Bı ! /##p(;Khs<h + ^5H5H,h + Oq( /H+Kh+-Kh)Y+(<H!xF(@+`+j HinKh+о %9(&H%&I%%%%`%w\%\&H%%%>>M>=X&H=V=T?$&@>JhB!z~K@}KhB?ۮ3!xK#SvH(Ȯx+!pH(nLp kH!(ecKO2`gJ2*s hM+@ tQ(u\KM \K`\K` C ؉0 "pCOQJ#`PJ`PK8=OJhBLK< EJKh(rа?O0oO`BL8 < O0:?Kh+\9Kh.Kh+:Kh:Kh+;++s'K#Sm G ȉ!j(` +H\ x|+! q 0 3 vP1BNKM`K`Ko 8  HKO0F&@&I&H&I>@>:9(%w\% %%%@%X&H%&@>> JE ؉ L ىKh8=<-(frh +]љK  # G# +@,J2+)?{C@-Kh+?sKBn!i???a!# ##0PuK hrI*FF FX@oH~( mHv[kO#C&% #""B,F >B? (4E2 Bu#"#(QOm43 $ FG0U19h# >8h#hZ@s##2BA# 3B# (F+ 0.; Z `h +B%K [z `l [DJ3A` AF ,M ,.LH#BA K h K# h H%@%%% %??5?J&I%ML/a(hf)hc` I Kh+?:  8 7 +?A G< j<%9(A%\pGKHh>%?81KO2` L" hF( H<KO2 @`4 0&H%?FnIFF F@y)F"8FL hF F8)FE(4 2 L hH H I l0 `hOaKH*FH%BCBJB=% LP H I H0hOaKH*F|H%BkBsBj%F H! FFhαF,FEмB20!FF"*Կ8FO0 3H-GFFH8I@FXF0,eG,^1N1K2M )FF4(hH F! FG 8 z+F F5WPFCF ISFBF <,ISFBFhn F "PF(h0FGBh I "B%B 3HBBC 0?L8x!*$*(b*7FxF2 ) ))X(*2F!x"-92 -?%[(88+=+? "((xK!*F0"8("("8(\-]x33x-"-![3[!3[F#8#8% 98LK (8 K8#8`$8jFF $838%%%ML(8{SqxF#FICICH#OB.(ڂ0)$8+ 8hhrCF 6H(8Kh;`+ hZ ` "p)H'HCz3,8#H)h "#0F08 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI `I \p %C% C7CCLC_}IpGFI  I"F @hFDFk L#h3 `KhB(#hXBXA 9%KJ-O-hhC˰C h!@FR#0` 9t#@0s: nK.z@08 V@MPF1FX@0 P0F FsS @oKJ Oq8Fh2J{IEFPFIFPF KZF2[FFqDOaaPFOaaFPFFqJ[FD+UKe-vx۵sXK(nWK#F qEp c`@0F)F@0Oaa! p {Z(FOaaF(FHAJ8Fqqx5JSFD #HO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`xI6`hw4&I@ 9H&IA FOF9FD].!0FHF!FDSFp9F0F*F|]d F$$&I@-OFLFF#x{I FMhf`h+ЁH!F m@+z.!#1&(+0vK(F 8+p +VCT (lKhFF(&F;+N!SvG68YH9 ++3hn_!QI(иPIбknD!F( HHGHhnO0}A(0+8HknB(3H3H~G(0+&H+Kh[hnVBhZ`x ( (hnCh;C`+D K Hh ()KHh"OQCT xTIhnCh;C`+,AI+ KHh%)H&I@HH&?HHIIG%%IxI% I%xhZ`x h 3@ B""p ( ɱJ$pri2`hnBh:B`*\BѪhQ`x!J`"qhKBKHhthnCh;C`+@"C p (0~ B 30@hY`x Z< O#p4IHF%%%J&I@IKhF;sI FCyxI" F(hK"`320[K"Z`I FC`K"`I FCW K"a I FCN(K"Za JeJj&?JoJ{Jh;`+ڊiBò + hZ `ppG?K@Nh5hO33`=H(6ѕ;I%tF&Mh }+h$N3hc!B0h#3`N0h(!0hfO33`#+` +hN3hc!C0h#3`#+` K `V$I"F *>`%%|%&HK@-OFgJMfKFfLFhheJhr4 (#4{4+F3ph(F4 M$*@RKOb(Fhl(DH.!#p;H(*9I"7H Ȱ6L4J6Ib4I2#4#p0#cp,"! F(#K"F*Ih#L(I F(O3 ??0+Cљ (;hch3#c`-0+L H!h,!h ~y%&H&?%KL%L%L L\LoL%@2!FJHI HL&MLF F !CeIF C` I2F(F4F` I2F(F,F(I2F(F&F9F CH FLLLMOaL F p&;K"-A`KMhp.hO30HL($H ! xCx"+0!F"@<x bE#Tp.`"+Cx"+020;##p&7%@&HM(&7%%p @BFFhFhFIF  p E F)F(H!F +x/+0F1FFF(F|((]/(а@ M,M.-O$hF%FB.K4$hB"!F8Fh1F0D0oO CCFE? O ;hS%5FB8F&  DE;hX3FhBE 9  F FB3 #'&I%jF KIhhC0 н0+P#J``P#%@th&I(FIH*I hKhD` hKhD `h+ JhBĿ` h+JhBݛ% %MT%%Jxh320[ "$x RxJ3h20b; * +  O0]@p 7FL#h+#AOq#F^0!hHL#h+#AOq#F(FJ0!hH0@0%TM~%XM-C&\5FO\] GBҞB#;p",, <) Ԝ@BDU85\,ѮE5-O;FF$x %)УE#F"TcF9U FVx c.L3/.-.G%.2Bc%!B٣pM.wKh+ۀvKvJh+F0Z#F)m..)ИBT3m.n.gKh+hKh:0#F)ИBT3]M+hS`H..Ac.?F=1#F[Kh3+h+WH/+10eF  +ђ0  FO 01*0;  #;)FB F/+ FF!+x/+хB5*ݼШB^..0фB@c`B9pB44TB-c/!B% *O<p݃B9"B p#+!pB >"\TmB02 pBT3/* K(JB3Bc`#F%&?M&7M&7&7 pGFFFF1F8FF0 ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ Hj ( K#`o#`3hZ2`x +0MM M-CF!OFF8FtCsFBFH& yIBFnaB #H9D;U$BK X J K(hhhhB+`  2`%MN N%%%-Ol FFF & #cQF@CHFPI@BFI2F(FB~Kh+6Й FqhBi.F2i Fi0%#! bh1@C1ii0jI `@B a`fHO0 l "! FvBF^I+FH@! Ff0XH*F`#$0<`0+ ( !XF Aq RFIF FJ0jPh$+9 iO 0+;!HF  t#9s Ozs""r!8FCEh+h#++hA+?u"H*FO2";FAOq F(0; #2F! F0 I+F{U C(<#`N/%hN1NDNvNN%HbM8F F{)F F8@)?pFFch;c`+ FCFѣZh+ѣ#`h#+h3`(Fp#hZ"`xF FF!F8FCFѣZrh+ѣ#`hh#+bh3`(Fp FF I FFhI F#x 0FpH)F NNNFA I"F ,N I O F>0I"F ODI \I OeO𵛰#FFF03 FKhB#HB#H(F(򌀊LN/lЊKh8FF(FD4 F|"F9FF,I"F0F"F)F0FB[7FzH9F (F@ԀvHF F| F!F FmHF(F!F(F,@eHdF FW F!F F x+T[H#h*F0h+@XI#WHP"(7SKoq0hYPKO2`%B#< Fl!F FB#< F\!F FB(F;IZ h>7HtF(F>!F(Fl,/K`/Kh4.KO2.M`N-KhB)F+H25*IOB)HT(Khh'Kh>%J#p%J`%4,f)H,(%8OO%p%%OOOOPPO O&HOP&7%%%%xP%P*%%%&7&778B" +FF0 + K#`#obQQ Q2pG!:!H&MK!Z0K>13H"1hGpG&M = Q^K-A°h#KhCKh,@ BI I ~HZ! ! yHwJ1 wHwI !<hGqKrLh!hٹ FjMA,ƀlFx@+7kN#hx#bK1hG+jeH(F(4 h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`QNQL0hF(o1hV:wnF3hHIx3h@x +(FWe33`3hZ2`"p(HnF3h9Ix3h8x +(F4HF33`0hkFhx:hx,*hx *x"#QpN!J1h[hG(Fh2` F<K!FFh-3<*FOq8F((F`BH&YH&Y&Yy&MQQq = &Y :4&YQ&YLQ^QQQ&WQ{K! `&Z IK"`=&Z!KH`P&Z&N Kn:f*oB (КmQeppGI -CFM O"(hn1+`&O  "(h$ 0s FF HJ>I"(h&W = R&O&Z&HD! \! X@CF3ИVBH*! B! >F 8!F 4K/!LA F`A" F I H I !FIHIRR" = xR'R*R6K"sLXhI`1N[P+x;(F )FFphPI"phLK "h0n+Hp&Y = RA&YRC&YRE HP"iF Khs K\A F0(H!FHlFRW&U@ = R]RqF K!hP FdH!FdHtN &YRtRy K|Al#x[ FK!FFh = &W K7FLA/! FHAJ# F+F0!F = RF pFx# + + `F+FK , ,њB10 kx pSFB-CFMFF  +hkhFh!FH$FX$ 1C K`1H-1J! /K"&IXh1F J Mf(#x+ + +p K>1+HAFJ@[B"F|BHK"`~&W&U<&ZR&Y&Y&Y&YT&NYR = R&VD&YRpİ*HOr8(Ff %HDp"H*!HOrF(hNhh ! FxI Kihk1F (݄B!F(h(h| 4H FRRRRY = S~K-OF,"FFXhzI&yI `vwJ!0FuKuI"hm=PqKhqKn1;" mNOEFFO ch;c`+ F,0+hCf(Ѷ1F} f#hZ"`x(Ų (1+ % t (k+Ѷ.1+  f % +ж1+ж>1+@HAFn1+#0h6K"h 4KC53H T -,K1 (?p *F F F I>1 "K"IXh J! +џh* "" @BяJf HcH&YR-&YT&Y&Y&W = R&U<S&Y&VDS3R&Z&Zp°9HOr(F(@6K"6IXh! T! P1J!(F/K0I"h.%,H.F +K>1C `'H'K""IXh%J! ! ! Bp (FxFF(݄BK!hx !F !F H F R&YR&YT&Y&YR = S\&Y&VD&WSJp°;HOrF(@8K"8IXh&! ! 3J!(F(1K2I"hN%.H.F-K>1C `)Hq)K"$IXh'J! ! ! Bp (FFF(݄BM!F(h!(h N!F j!F fH0 FR&YR&YT&Y&YR = S\&Y&VD&WSJ0MF(hI F^I hBbCc `!(hJ! 0"b#c&WSf&VD0 MF(h| I F0HC3(h!n 0#3&WSf7HOriF(a4LhFdcy#cq0K"0IXh:1 #10D#00#01 1 #11KHk1#!1K`1# 1 2 #223Ht@HHSi = &YSpSf&YSr"LI h hI"@-&W t{ tzF,!@ 8F F 8)Fg( pmJM `y h h mp(pp#hOa(F:K(hLA8K,F hhthh #0J!F F| C +H< $IObzF0FBx3`3 +IH,HIHoIK`!Dx *#CpHwB8R = SvRS&O xSSSS&NIHP"KHBOr@!L ( ` IH@@h HOriF0 H@KhF!hkx&YS&ZSR = 0P"MI HLHQ(H M0@(55Or@!H M0@ JOa5hF J)FhF) M0&YT&NTST(T689P"IHFй HI:(8@ I H߿ M"FlVn1+Kh8@8&ZIST8T: = &WpP"m I!H MHQkF(H mp@+kIFF8H1F mp@J5n!jJOahF IjF F mp J&YTL&NTST8T: = TkTTsIH@ xU-O( K&O~OO4$5F`OS`;`KO J~AFѢJNh w)IW *њIHPFNt+ `+ F+gH9+8/+Ҁ0+Ѱa;+R#)()(*Q*(*I((()()5*W)((* *_O8E+wK@F(tI P+pKqIh(F(nI(F(p(FlIF(?niIhbK"gIh F(ndI" F(i F]IF(?Q^IUKKJh`IRKhZK`#B0 WILK/!PF2RIRFRH4, "oC##"#"F F9`(? CIJ BK"` AI|-%+J#O1``$$O4O5 3IS"PFR -J`,K,I *I (I &I ;h%J !%H#H(O"I0K&Y&XD ;DY{ &YPY xV$'0XXXXXXXX&YHYY &YY(&YY\&Y&WY1Y&T Y&T(I"(K2``p0&I&H!,5-"H#Hb c\B\A#J1#<1K Blh#13h8hMh:h IJHK$[h[ \I 3h#8h3( &Y&WY XX = &YYX&TYH!@&T,6I Bs(2H#`1Khk 2-Kh+P 0h &Kx+ !!#K`"L h(HVK"`Kh+!F h+O3#`dKxCC L! hV I h"! O0,Q&T,&YP&W&WZH t -AF`M.h.s@^HF]I \H[J x/)@= XI"F>[;UODW)@RO;hCQI:F>B0OS;`NJNI>8MO0JJOc`;h+II:"=#& >` *aCI"F 6AKP``@N3h+)2h?K`">K`>K`"6K`1Kh*-1KOb`5Khk`+h3+`lhT,! F#;-Kh`` F#x/+! F4`(к{7 ZOR`"H!F HHX+h+q>m.8Kh`KhI"F&U0ZKZPZb /I0+J#`-J>,I0)J#`*J>0'J #` 0[&YP&Y&Y&Y[ = [[[[ [#[&[)[,[/[2[5&W[8&Y =&Y =&Y[;&Y[>&Y[A&Y[D&Y[G[J&Y[M&Y8IFFHKH"F% [t xJhI $ <&U8t HCh;C`+VC hZ`xK[h+ ##@ &U8L! V%H`6 )F&U8[J! U&VDJ! M&Vp0)MF (I#`*! &!H!F vhLDch;c`+ FB"p  KhXBXA0#hZ"`x (pB3 &U82=[ 9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+&V[( K @0^"ed""f"HpG(? "de"&U8&W8FHBLM <8 <Kh2ùoFH,  <T< "*"FH 4[ :x = &U8[[0!MFl!F|!F|#SC@rp"CCI2C32""bOr$ !b#sCcl!l 0#c&U8 = pMkh FB H(h+ H<#x+Dq2;p@Hp&U8[[KsnM0FKhƲF*xZ Bl "Bjxԝ$F Hph0FG Fp) 5 = :l&U8[F+O,MA #xc?0FF#I F#k` I F#k`FPI F@I F0I F8I"FHtH#!FN$M+4,B+! F!#! = &U8[\\\ \\ x ;&WK1#Khd > = &Z"KIXhdKI"h@&Y&Y&Yð#O ")F8h&F+x +M##p1㹴B!#1y#0K "Xh0CB*8h")F;`Kh( I0F K`n#y#0#1&Y = &Y&Z] J0[ `pG = -H!M XO! WI hTI ~;h#`#0`##O2! F(GN"8h1F(3xS+W+B+Ob)F O@ &6Ih+  *Kh++F!!E&NZF)F |1+0+жqZF!(Fx @+o&H  Eٛ ^+h;`+ hZ `piB (F&Y6&Y&U< = &W&Z8F L hF F8)F(Рh )F(4 =  #KCBAT@  F F@y! H@w'y;+&!0h&)F0F蠱P0F?(F`H#y#P#qcyCcqhB`+x !;#B`+x{] ]-AFBL%hk!+@OO #h"+%`7h8F\3y;D%`+O4NGNNNX;n;;f+:oBۻmZe-I J0{(I5%` n; f+ oB ۋmZe!"p1h!HX1! ,H9Fh#h3#`0F#h)FD#`h9FH5%`#h"+#H#`A H9Fh#h3#`(B&Z ]']*].]6pFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,]8F7I(9 ! FF6=! FF(8#p FF(Ny5[!(F&F8Fn4F`y! F4#h+L#h+H(##`LI Fd(FF)F?! Fpp F]F@y!oh(F#x!+ ` FK!F!FH]C&Z]6 = ]G]Npm$L%F h\1Oa!JhF IhF@FPN"F@1hFd F6u0#u0 mp#y՜`#y4BT<hD<3h HiF !hFJ#phF8 = ]e]o&X@]qpF FFy[ FjF(F pI0F FVF!F ]G7$MI"(h I(hI"(hI(h"<H< F0(*I(h("0!HX HO!( HK!( &W^@f tx ty^&Z0!I$ 6K,3CLF0 & 0KjK "h FPP"B +! ]4B?&Z = &WH!H,0@p_&Z"%L&I h| #I" ht! h{?@ ! h{I" hH}0(3(HH I hLI h" h!{I" h: hn&W tx ty_8_>_A_X@f_pFF(g1;HB;L;H h! hCC! h{2I" h1H/H/I h"s,!/0FZ1FF h%I h""H("H1(F h!{XKj˱G=*pH0+ HH%(F pHHHH2F1FH = _&W ____&Z_______"KIh8@&W_Q  Q Kh "`]pG&[Q Kh "`]pG&[oDBF FF(F 0F"F)F8FCD$-OFFO0>HO0>(0"! &O3FF TF5F7FF o ,𱁻@ 2*W rO O O O O O "F2 ? tHJO7F ( DOX FvTк#fHAO x*"+v#_H0>k>h"`Z`8FIFVHVK"`O7F"3FF < mO #e x*О*IH3@D4` ``,`G`d&[`~```?4,"Fm"F eB4H73HHO7F h4/H/H/H.H" GwD+ O hO2 ,ظ? H hBH<3 O d, hBH3 < +H?|FR?{aB```a a!aZajaa-OF O0>FO0>FiHhM8$"F! &;F! `I "Os&o hmFHp4F5FO8FFFFm2%FF&FF# O29F?HHO4_%FPF>8F>E@F1F5pD ùO2 QF6H;HFQF m Hx F !k(+H9 !k(9F  >C #ЂBRD+FO2 lHJ3O18FC#OcC#_ "9F(H5Dx` ?Haaaab-CFHFF 0DHb#&O2` Fo??" F ??4H&4F8C0H$CF-H:FdH;CJG@@p@BgGG/7!KBv)&C2Oc!FXCzs!J *kD I, ,."H,.H)FC@d@pDtv K#b"bUbob~b b ?H-AFx( (H%(F*A>_$pCO !&,$ F>DFHK[h;K"8F3F%oFBF(&FAF2F8FBA6DѣZ H+ HJ8F!*Fbb&[bbb-OFx]-+@xKh# ]Ov!F ]l,FO 9F F`0#!(h+ F\ FXD0=FHl!F2F  LFH)FeIhpCO~H!Fo>xOOh@Z)F F !FtHFl)(F$*1F8(FlH!F3h xOb!FpCOF@Ft4@F 0B1F0Fz"(Fd(0!F QHhzhCOH!F NH#"(F#h{hOr@!@FL(F F rp:HAF&{hS"SF(FO6F1F(F4F(FFT0H.0FJ-H??h@F'H!F@*@!@FAF!HAF(P1FHAFR#EE #ZFHSF(F@FY F, FBF"H!F&[bbbbcc1c`,c?cTcjccc ?Hh4M x4JOa@Fh#Fohhp20@Dh۹Or@!@FCF$HAF#H0?tHF ]O>b%P)F0FL0Fh+(F0H Fh0B_г_г@O ! FR H!FzH!F ?Hdd cTd%d.FF+ * *pGF \,\&FRa/٤A/  A, 3B0O0KOh`Z`I KhK Kh3 K"`a v  Fd&[&H&i| ULH! ) e=#8F0!D)FFz\ F8Jh3`pG&\P8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F!0I"F`Pshu`+`hh!Fhp-hFJ@!hFhF ?x&\PeeF@uKh# F@O0&\P8F F@Kh+)F F8@8&\PFFF1F(` +`#` 1F8F `(H1F `KeeFs(x08 Kh+ F@ &\PpF-J+x+G$I(F@(!X0J1F(F^$pe 0FM FkhB F!!l` 0 ?xKhB!pG&\PK!i Xii&\P-A F xFx9 KF!a F M' J)j/`^J F)j/`^+hCE4F&\PN-AFgNsjB$b(("#b #D!wb kc<#czou>؆(i*K(c"(Y2(ZН0b03c0sc#s#xCOs$0#0 0"0n(4K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo#K "_ K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕH&\P'Z&7 (IjFf'LH%'H(1Х b0P+#b HHt"(#jK b`#j+ܿ##bűfH0^(nfn+ܿP#f0H( HFf H(@th&\Pee ?xeeee(&Ll(D8(A #&)@@@@@@@6((O0HHHHHHHHH(#ml0HH(# # &\Peeeeeeeee&\e-AHNOkL@ 8`HC#`K(FF_(H#`w#` vHmHhHcH^ aHZHUH(#FF8K"`KH)FxKp)FHN)F(F3F<)F(F3F<)F V)F(F<g(F?? ] KhB@2?? C 3S Sh>Eli $ #S``<0hB#+bPki  (i&8h,@O3a<K!F<`h@^&i&\DKh@@ipG&i0F hDHh8#hBC!B 0ZrR@hBQT20BS -CF-M$w?+)KBKb+B..+A0; + OO ! H!  uBH!  lK;+#c+$2x0: k($$K&i&jh'h7pFFxM)h! FhlhM)hY6H1F  ' 5 F@hvkh "` p 5 ? @hOFFFFرK1A?+x2*+!kxcxSn!(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##&i I!hdhe&j&j&j&j&ihthhi A&jii!&jhhhhh hhhhK\pG&iK1F0J FH !)I Hx HB@FFJH F !pP,&ii+&ji.i2++++(   pG pG pG pG pG pGFx+ FB((, O3@۲B SD)ѓB Sx@,hZ`B [x*+pGpGFxF8(+>FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p&iKpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF &iF I I Fx I FPKh+ FI@ &j&j A& AF I I Fx I FPKh+ FI@һ &j&j A& AJ Կò\pG&i(7FIHx&H0(@F0ӲHJ !H#FT!p ! FF H#FX!KOq$8!Fpi.&ki2&iFIm( FI@f&j A@DcB ѡ"c+ !@%cXBXApG pG pG*-A FF FFF<`@0FwF(Fȹ(F;F0FO1 J)F((F( $$$&k(FHFHI*FFK"0F FxHuI*FF*F0F I@I*FF8F;, Fmmmmm8FHMFjpI F옱 I Fp F8@Ž(F8@ (8nn n-O F F  FF8)F(!pCO0I FF F;<(2FOa(F 8)I"(FF(F0F F+* * *# pI(F@I(F0I(F +x"+/t#h+ ;#`2FOa(F(+F 9FHFGm+*F! OTF O\FFFnnn/n7n> Q Q(Hſ&s(sFhF(FJ!* F"h#R3FF(FppF F&h "ap#i#I(F8&a$hnD FFO1JFh+FF h:&k(L (8B8#D8 HiF+2 8 8V&k(&s0pFF F):hBAhhK`hB%`JM+iKJ`hah(hkjӱJ`hahhip@{3BJ`h2FIp@*p Qn/n7nDK"8p ((((O2KbpG&k( QK"( ((O2KbpG&k( Q-CFp|O N'#x:F!FB0# (FD ((D( (F#)FHF((F(#&k(&j7% L F(Dx(F0"F!5&k(FLXN8xJ8x8B&hF 82h;DB8 8;D 8hF+8 &k(&\𵇰)L#38B=B+8 (+DBO&8#D;h[scڢBh(0F8 8[ 8+2 "[D&k(&\%LN8#Dx3h[sczx8HG F>pD+&k(&\sL8xhFK (h2DBF(F8 83D 8 +8xSp;B8[x+hF+ 8&k(&\pLXB"8^]k. KO2b 8B x@ p 0F&k( QK8x#@&k(8 L#x%X8O2pKb 8 &k( QpFM F(F@sB p(+BB KO2bh@ xU;;;&k( Q7Fh% x0!*F F ( K$ `pG&k(-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@F0Pch@F0; F;LFh1F(#h`&FF"FF'pGL$XKjB"!F$8"a&k( QܬK-OƲhLF{'(hh.M#8H9FO*( *O(h088x#8+#+(F'8F+08Y#DB0(h(('#8(/$0 B1I IA(Fr(F(C+sz"<(oWc1Fe(#48v#48#48k#488x8x +#488B< + 8Bm< +?h?<#488U#488x+?M#48E#48O#48O"#482#488B< +8B"< +8B< + #48#488x + 8x +8x#8$#48 &j&k(&sP Q(pP/x?(p5 .FE :FHIFb(POmHIFwH8x+?48(@8 ;#88<0F5ѠEMmKEF7EF@&\ QKhB KhBKhXBXApG pG&\|&\x&\pM(h0 WF, Fpd.`:Okh+ +.+7+g$ $&spL#h;KhKh 4K??h"@! Kh "hM+LO/h&h*`O"`/`&` ?&&\0&\ &t<&&i 3@9-CFPe FF$3F FMO`2#;`0CԱ2Evt#;`0+Л, 2 8 O3Fo"F &up&i&-AF F>!LhFC`g80FA5h#c`'*FhAF h#"0F/нAںO(H!&spnp[F@]Mkh%+>+; +p; +R#31111111u +R#11111117+E+Z/+ѫiF#+biip@Thq`p@ #x%F4++ ++L h:+x #`(F] `Ax"kixp@x"ki@xKh+~p@ jx!+hj: FhbKh+ohjIp@̺Kh+b I Kh.YF(1FHp@0&sp&\L&\nnnpFKFFX`^0F)F Fp@Թ&sp/#NMis`@4@FA(Fj(F H, , K!F`@HH&spnn&t4nn0*LhG7#c` Vh%HbhY#H\h!HVh[HPhHJhHD%hAJ+F!45-ѣh H+K"`0L##L H H&spnnnnnnnn&t4nn!Kh@ R KXhi8 pG&spCOppGKiFH=] f!n!F KhD```&spK𵑰hd#xS%oF;.FG%B W&>#x5 &i !F J#`hD` `Fh&spDF F-G#-Le&O`Kh3s[;`O ch 0 C KhO0L&#hOHof ( PP_ԁKh( 0kePLwKh0 k+J xkHD80+e.-F0+e.@ch+s/+F+N++D&(@-y-@k+7666666666g666 F EH;К0KO`: PFM7+i+$ -@>,0 +@9.-6!(Fd(e(F+Hch #c`ch+(F(À((#Fi.@chi+*0FI#"(F#jcHi3@_-##b>&sp&\<&\p&[&\Doo-&sp&&&t4+-@-&!- j+| - Y -W=-U(FL(|--)##CaIp)#@a(@\(?_xa;+##a b"x(?Ei#a+ 8U3+?4)0 %(?(rH e&>#b}i#@+$УikJT(F(#j+(F b0(F_Ha+##a j( j#FF/ OShX@x`_*-9@-E!-o -?(F(ch+f+ƮDKh+?F(?>N+x+Z :Kh 3Kh+#7*#C`Os,Kh+ch7+Occh7+##%J#!n01+ 8#@ch7+OCOs~#;+?^)(YJ1H")F @ (ИhFP0fo0noH&h R ?&\o^>c+R#/+mEcgqeYM)'gA}GGYO IMKY)YI#" e&#+rJ`2*s\0Kh "!`i#+rJ`2*s:0q"!`i2*s#"#_Kh+ 2*s "2*s"##C"?K"Fh8~K"Fh2*s#"#'uKh+*2*s$ o2*s"## "!2*s0_Kh+"!j\Kh D F #+r;`PKh+ +"8hFG#+r;`"8hFU v |f?2=N*s#"##3` '#*  #ck`ie+rd;Ck+d#"#{)p ;p)pb( F Kh`?٬LxHDor&&&x&otKh+ \"l K`blK`lK`](?xDKhC`2*sج#"#KhCB`h`2*s#"#ai 9nhCsh&LCC`2*s#"#ai `Lh&s#CsFPBPA |=8eKhHh`dK"dh`cKbdh`d|%bKh+@R`J `IhW]Kh+@H QN0hXI<FWH0h@UHIFTJ#TI h hPKh!x KH!0(s #"#s(?ӫNH0k2:H*s9K9K 7H!0(s #"#\(?2,H*s'K'K0(s #"# wF(EF H0(s #"# FFHl&\D&ux&&4&Dow&\ Ronoo Rn&\oponpp!p4p@0F(7 ???.Kh)(0(s #"#(?H!?Kh0Fm" 0F0Fh#&abF(?1F#aR#wIF uKhSuJuHh_.F0F qH!ɺŪmIF F( -e& % -??.O1(F!sb#^IF> F( - -?(FK#TIF nhFs( - -?|(FuAKh+FIF% QKFV(d - -.%(F!F(X4J% :I(Ph.%#6IFw+q3J`3HhBOvvbF`-K"`0h+߿*Khs[#+r J` I hD `h+߿Khs[#K"`~K`Kh+?#c&pP&\Dn&\ Ro op]phpupnp&&ux&t<&\&Kh0pG&jFF #O2B@# 3-OFFFFhD,FW E[լB< +4##pd@F>2F!F(B'J;hB Y)(*B8FHFFBFIF(FQHF9|HF9ZFIF`[K# &j-OF'ѽHtE0 *5"pF*xc*"pB#ҕ0+;+hx]DFhENF>/#F*+N%F{ppF FFR ! 98+hD`4D(``` pO0-MF'O O $ò0 *+pO `& \4O07F e 00;+ (ݝ0;+ A-@,A, Kh+ C B Kh+ B C 0m+KhB# &K"`&|&\p&t<F' d 4F<`E$hxxBD-XXx](g(B 5`@(. @,A,,e !Kh+ C B Kh+ B C K!h;B# K"`D(ѽ@ _Xxg(F;+xF0-((H30d(f(i &|&\p&t<L h`hhh@&s FFH0ѽ@!H&sp FFH0ѽ@!H&spVK-GFh/@9F>)Fx F0F`O78F!(F8F(#"0F?? F9*F!F0FF0F:OsCEE F9fS #xCcxM+ѣx++xG+ <<+)F Ft@ hcFh h h'F(F h!H##`K  0&\D&tKhSL h8; h@&8&\DL h! h&\DO1pG)Cѽ@0F) F|(!Kh HGa(D(O(A(H!d( o(Oq FK`Kh+0 ! FNM#"(`#??(hnO3+`H&\8r?r} ?`r-OF(0B"x0F80F " HF(HFKHFe 1@FN/F@FoF`@FO3sF(@%F&I F\@I FX F %F=FI FJ( &&Kh+g(dJ(`ЃH  (%F K&iyI(F& O3&sI(F O3&(FFqH8qCF9F F (F|( F`Kh@F&L(]H9 Y(FtLKHF9F@F'FIIFHK1F"`EK`EKhBSCN"CKh3h 5I(Fh (F@3K 7Kh(qO@Y3h#ky/KI F"`r鈱I Fn` Fw(K"FFh(F8$Kh L F8 KhHFQF F??Fd0s7&\@rrs&s3&tqs&\ &\H&$&<&\ &\4&\L&ux R&`&&\D TFFбFXDHZEF, *F I"0:!LJE!FsX T@,KhF&\DKi0H! 5@H&ts]s-AFO FF.@F=F\ @F(ѽ;hѠF&KF"h&\D@K" `@&\DKFO2h&\DK" `&\D8F$ F~F@>B F8@ 8pF; FjF FrF Fh.ep@ "!0F(pO2!(F|(FFF FA F1Fj F8(FY0F8B 8F -GF!F$'FFhF!FhFEF8G0F %FF)F/F@F8JF('FPF8: M8F)h@+hB0F Fk8FG&\DKhF @ F@U&\DF xpG%*Zx%*33s*0@0pG8M(h0L(`8 F,`&t$s-G!Fd /Od O FFsh;s`+ 0F* (F'#8F#p3hZ2`x - 2BOI !HF9FFtp8FGF8@F6[CL,*4i( Fs-AF!DK"xxBFI4F#x##8F3p xBcxB44;>FFF#x+5*FAF F,D;; R R-OF8$F%FF,K,JF,K8F!(FF=!K)F!JxsKx Fx5BxBDKJ(5D$O 9F (FIFt5D0;//pF F R Rs-AFHF FF0I FA8FXXF(FT!D4 F ;F!FF:(F8 0FF0F8 Fsss-AFFF %(Fx+F0F!D4 F7F( JCF!F:/!(F((F8vtFH3!F"@t-AGF=F$?s!`FF?(F#p#+%+ѮB,B4jxB%+ Kh(D#+%+ѾB,B;zxB%+ Jh(F Ft FD&\D&\@-GİF~ D$#"(F??Or(F1F(pl5>`8hB,Կ  0K)()F8F4*F!8F0+F F8*F9F0FPF,(4&j&-C?:KhF+a7Mx+(F9F(U TFq(FHFF FD}7!0F$K1Fx!KxKFF@F7__+F8F_8DݹI"F@8F_F8F7G^0FYF0F+x[(F7: F*F$ F,F7-&\t R Rt>FKh#! Fb3F!FJF(FgFp)FFF F4F78F7(F7 F$&\tDF I`I F8I F|@  t tHt_mF iF F0 F m@hF mHK-OFhFF3EKhO0(BHsFбFxFF3|*-* F(F(F 9H!7I F(($C F/F(F FXFQFD4 F*F[F!FFXF7rPFFPF7k-й *е@ "c Fh((F(O3H;`F FP H<`(FNF(F~#x+ F7.&&\twtt t_*K-AFh F.IO0%HF(?(!H1FAs(FF FF8F~F(FzF0FvDD4!D F5!F+F:FF^0F7(F7@FF@F7, FA&\ttiF( p@CXBXA'] 0FL#hx(F,!0)FFtXI Ft iF(F`((F F F'0$hpCO(F!*0)FFt2I$& U U Ft((#" F# pKFh FiFK!6BBK!6BBѴ??BA &p  &\D&t&tHpGsF DB F,C/*FFO`4KhB 4Cн@ u&Xc K$BB Kh@c@O&t(&8Kh 8??oF?? FBB   &iX 1@)p4 Kh"`$pG&t(-ODO;h+-}$%F&F;hB 0+on$%F&F8Kh;Br a(F1F"F FF4X ;hB FFF?? 0:hcB0|Կ""00h1FD(F0#00000F FFw( &X&\p&T&\&d&ux-OFFF@Q&KhB@$Kh+BKh>&??@.BD0Kh;BBB G(F!FO GoBB3(F!F0+B1&O qKhC@𵀿gF(ıFeԹ3ݹ q(F!FƹcJ0hCbKhе??b_Jh*^^J^Ih h CX"` ZKh+t(WKh+VH(F!FF?? FѺ!F(!F(Kh+! ("! OwMFLFt+K"`1KhX )K"O0`OM~[???&!Kh+D K(FIh hB@rB) O1!!F(F!FF F??O,&\p&&&\&t(&&& UL ?t&X&i&(&t KiS Kh( Kh+Kh8pG pGBppG&t(&&&\p-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhABOpu1 FO3*F#Fu&`"KhCѹF (F!F F?? FѸOE7O0G|ae(F!F. }Fy &\p&X&(&t&-OFFFp,  X FOoF?? F>!KhùOܼK h9(#"F@F+FFLO F F (o??0$%FF F&i&\p&-AF FFF?? F &AO0C*F#F8Fh8 MFF+hB(hBԿ  8??4&\pK(FFhB pG UPK(FFPhB pG UPF @F޿8F(Mc+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8&\D UP&t@KhpG&t@-GFF,O=hFBh F~(G0FfFPF`EPF70F%` F7B-8! F0F`0F#EEF=F#wa#a 3+h 5`\`ki,`3ca#hB J F%Fh3`(F-hZi2Zah UP&t@hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7^ec8@kpG-OFFFgF$??#(F[FQFF0#!2F1@FIF;FF ,-O FF ?? O5,F(F!F Kh+rѱK(FIh hBEr) O1!!F(F!FF F(F!F(ѣNF'F3hB (LpHF9FFWHF9F>FBx>ZDF (e 8 K ,O5,F0 .q@eF$.F F +HKGTzKhCў?I9tKhoBF3FF6H mJh к  6H ( (O hx ,O (з6FeuT VKh;K` NPF"+ !HF9F(FKhk]T FFHF9F@Kh+??7L ( (0 O}{ .O  K`0Fmұi$L#hͮx (0Z"KO"`F FO JG`uy . .+<F FP ( ( (H (,F FOFk&(&t&i&&ux&&&&&??  `u9 Kh[ . . +F FF##hPU&7F FpKh*Կ""#(F!F#+0"&ux-OFF.w O33 vKh+ћKhABOpw( FO3:F3F(KhCqg(ьKhF , ,хLqg#h ( (0|L#h (R_K@(TO:TF# U?F?ycKh rE (DF"f @YJhC@ 3WJh*I ezg0 K`HFd  EJ h*DK"X`#F "8(-6Kh+?#T FF  й # ( (4E ( (4E4E (дBu/^FFXV??фKhS й  +FFEuF X#  T &(&t&&&&ux&&??pF F"rB ( KDTC+& O;h;BTZx=* јO+ Zx=*јO- QF "FFEOIZx=*јKJKF!PF< ع+й- kiB!! =kiЙBolkiBԿ!!)dkiB̿!!ZQBQAkiY!dFFF; +7#+Ѣ +<\+# p0+?;   *r=!PFEF:,+*6  XF.0x(O!h7H@&tD f! U!HFU@UPQ H H H HP8hT#iiC"Pi3&t`&t&u&u&u &u,-CF$ F0+3gFFF F)F4ر#JOa *L(M  +hB! I!??ЍBtI!BA JOq$! 5 @Q5&\&p&t`&l ?p ?h&&KhKhKh+Kh3pG&&l&&p8 LeiiBcia0#`8#iS%0+hHY]5&t`&t(F FF0@7Kh#FQ(bO4 F1Kh (A(: F,N=i($$+2io@G;D)FR#?8iD3iS'D(F(гi (F'хBJhABJhBJhD$b(!F0F2iC;)FR#(СKho&j&t`&e&e&d&e -OLvF FF0??t1+@O`D2C?? з??вBADv#1-𜀣ih+@O1FiPF+ÿC!i3#ȿQ#0)F#FrKh+{Ѹ@ O  1B82??08v+HFFFE} 1B~ )s8F1FOG(QKh#(z1+#1F!O HD" #C ZE  ?t ! "v6  "qO #h(F  a0KhDEu Fv0"!]60B$H&{& ")Fv-H_62BuZF#aiBܣiN a0 1PB`1h" =h\T!iQ"2A#3&t`&&\&\&t&-AFKF FFh+ 8ȱ")Fg(2 Kh0D(FKhDB &&t`&\pFF#*F#FOHqp@-AF MF$x$1B  2F;F $4&u|O?h/@# F!P&Ki(!h,!pG&t`K(!a,!`pG&t`(FK8  &t`(F HK!F8  &t` ( ! ]#3` Ch F{)2Ѓh#\)   \B\A` h+JIBk$) 3`DI0+#C`O3` F( F0 pF FF!*F F#hBF0F(p-GFԢFLFF0P+ 01;0#10#0({1F(FA-JFO0F~ 01[h#0H jF(05mHN0q0 ` o)F0 1B xHj 1BFۣitNh0rN+D*FO1*B ([eH3`:05 #01.gcKh*bKh):BF;FIF Gi+`iBhD @%i@8U 0BF;F GYJ)@ F \*h;hO1DFhBO1a!iFi2FQ (FS<*#h(#`#0;5F-u0Ihi hI\iB"iR#PZ_./ѫ%E'L#h+.@0+0F(0FBF;F !GO300 CEE .Kh+ Jh*@+>BF;FIF P&t`&u&u&t&tx&u&4&&j&0&_.hEF _(E0FhPihD[1FF($I0"h01+0݂B4A!FdJ)F (~<,yI;Q#B;8A{ BF;FIF0F#h+PJF)F0F)d XHU&u4ҿ-AFNLFFp . (#! . CKh+BJhC0+ #x0 " F0$+5M)h9:FCF0F(R Oa$1+ +0FAx8FAF+ $1Y#DB$aHIXH#I#0$C$1#0(+h+?w$t&t`&,&&j&u|8%L0+P8(F&t`-GF@LFF8 (%#!J`8O8쐙0+2;h"h3DܠB߿ch#`ha;h"h;3DBOܙ&Kh;h"h3DB#" Fs"iFGV i#hZ;h3DB"IF UKh+Kh+Kh+ Kh+и"! ;O2! &t`&\&\&d&d&&& I0peCiB0T# poCD# 3&t`KwYcpG&t`K zKh+~ # `8#B ` F@BDRk `ZiDihP"`\&t`&K" " pG&t`??-CFFO0F-F(AF`` -j0 0"U 0;`.4`0;BH(9` 0U4F&t`&)-GFpFO0F9`($O@h<U (FU1@h#D3`-0;+`ѹ? ,( 1h:D DhB@ h<F&t`&-GF hFhFO D/0h3`+h+`"F!ZFCF`"F@F4TO BFJFFPFF?FL#q1n8FFiqO3O2W(13&t`-C NoCL$L'F5h3`F0BܬB5` ??07BF`&\&\p&t`8 FCFO08 Fh0 (#xCH!F0q " FFl( XH{CK 0 XHJB hB Ah#A[b#&wKj+ KHh*J!`!`pG&w&W&t<L#j+3d+#b ''b]@BvH9F3O3&woK!F9 K JcbB  ! Zc3 pG 3C <&w&w&-AF*MF,hBsEA+(kxh+c.aH``n Fk@Fhjk+hFEѼ:FocK``BB$hhkO 4dBq;FFFFO 1F FsF&w-OFXKFh+iа??c)pDPUE2кBs ۘEBd0F!F-h1UEO 0  #h bEA:@dذYEu*FKF0F!FMOExI hB#лBr ېEBE F)F-hB 8hbBA/O4%FEBy"F+FHF1F# FF)F0F FѴ??6I (DEBx # FF)F0F FѴ??>I9$&w&-CFTF FwFF??.0B#p JCc`Kx8HxH&&08(H!bK"`pG&\(Kh pG&|0L#h+ `&x0 L#h+HiF#2##`&p0 L#h+HiF###`&l0 Khs Kh[r??ѽ@&`&\D(0 x J^+pKxp]KxiFH e&p()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhH&X&T@G_y(0Z09$?+0GK`0R++D+++BHiF0je *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piF&DKhSKh+Kh(Կ  pG pG&&T&XKh(KJhhDpG&&\p&X-AFxFFMHiF,F F!HDF0`&x0K\.cx;4F4k$./1F8F(#+p&x+ Ch*!J HhH]Bh*!HhJx&!# `](KiF*FQoIFHH*&(hS@ pG(h ЀipGHpG.o( H0Kl8 pG&KliFH ]&Fh FFox-+0''x0; +"(F!FO0 "1F(" ##`/@B-OFpNlȱh+ +Ci G#d @l"iF `FFx*\x-(^/$( (٠ ۲)F(+(#3eG#F F(#x++K2`a F2 9($/(z$ 7 Fa O O F FF,S+KQH:n(0+Xx-(3+(@3% FKO@3!xF=*phOr@5HK3a O O -Hh;+ :&2U`ci!F G,o7[ 2-ѻ;#;#[xd F3x *iRF(x+"QF%&nD&$&\L𵇰#@FFF(FgH-hZ aH=^Hor A-x* h;+)>ic-ci+-  G@-h|Fh+`+f-Уh>K"`-&--"ih[ `2[ %`---"ih/;#`%;#[#%`2;#;#[+H!c-- -!+#i`H!OF+#iih #ih+H!#i!h3T#.?~2&t<HlFhFF'xF0; +#O F"x!F40:ײ / "+1`M#+`8F")F4O0+ܿ3 PC3KhKh(   pG&&$ H K"` L#x#i h`h!ciFG$4&$ YFHx FpGBЁh ;B$0 Y-O$,M#FF'FF*xb+A#`O XFnh$5O 1hRF@F, A8(ټ- IEIE 0h7F F#F@DBDAh O )vh# `+?h` YH:((ĿK`" e pGZKhYHtVK" "`"0SKhBQKh oo F WGI# `GKhBIO3 2 13BKhBKh+AKh:K1+2!(.0 :J&0h"oO23KxB ,JohC`&K"`_+Jh**J#`!KhFk,KhB,K"!J 1 13 1+ h+?Xh#+?RO4ool&&&&&w& e&i e&@H!&hF\]Fh2JF(FF0F!D4 FJ+F!FF8F2F2<(I"FHLH9&(-CFtF#F:FdD:F#F(DeREu&IBBA4!!@#d#"F]7L3EE0B@! K2#JKXChF ]bMB@K IhT "FXh`BK"` e&<&t<FK\` eK$""$ipG&<8FM K*hB+h FZ*`p"K$8 e&;&<KshK"`pND F"FN-4f4(F&&t<&<D(-CFFFIB`@H Oy#0JF3FtF0F FR `F=-8F-#<!FnC˿-AFDppFF# 09F#F -(-0F-",!FnC-OFF FO O O :F;0 )٣a)أWB6#V4#FCK A)أ7 O1O0-OFFFO O %BF;0 )٣a)أWB'$FC5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWB"7"4F_C5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhFhD #jFx hFFF (CFFFFFrO`>9F0F(FK FHEK"$&<j Р *K@Խ@ͻ@ !JpF 4 F3 4i@)F F]p@ ǽKh $O`K)F FhEDHKh^ K44DhBp@޿"K`k&<&&d e&d&\&t<J2m]C7F F0)F F0@KxJ)F:F FN0 et8F F)F FF Kh+޿K"`Q, F8 5&\&t<F'KQFFh+ѱ^!hF ##F)FFtB. )! K)FhK:h"[ CBF3`0F1O0 H! h h1&` F1&&h&\ЌFh h1##`@ pG-OFFF(V_QFDKKPDE 0`(`3F*F !FSFxѢA 2ҲEјBЉE*31B%*F3F BKCO``Ѐ#KV#U# B 3+4+!F:9 "B"6K   "F`pF:/ک *FE3B#sr  /F!@E! \,E!@F! 1&HpGМB KhpGKh8Kh8Kh8p@&L&\p K"hKhFBCg2g&\p&L K Jеhh\,нSg8 2 L `;,``'`8,&$&T f-CFMx..`;'#xC+hBЛHH :+8 %+7.+Ѝ0 p4?+ \+cx+Ѝ0F# 0#ZxF ظK ظBꀸD FFL,S(c%%%%%%%%%%%%%%%%%%%K)55%%%%K%%%%%%%)hB!!)f??!!>Kh+U}(Ow9Kh\8I8 6Kh+?h6C 0Kh+?\??)QZ0W(Կ  M( KhQ???4)p+C?'w)p Cj(Kh8&T&X{&ux&\D|&&\H?̮#;BF6?S(GKeo!7m}5)h"B Fπ+`"pB??, #x2iKh0))peKheK hE9`;1@??H Q! b9`)pMK9KJhhKKhKKhHKhlEKh'F@F1{  ;KhQ0?J@*sp)p9`(ySuFF ??F F+rHFAF^FQ F?}J@*ss5F F7 9 (+"$ Hi HgKh(tS&ux&X&\p&\&\D~҂Kh* f Kh Khd U K KXhXK"`&&$&T f&\HKh fFhhX $ i<лB`r0F`WBrh.ƳBr F FFBrDh,`%FBrۄh, (F`0Fh h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1T# Fc`@ùpFDhcBv! 0!F0F#3kh&``[`#l`h0 Ya` p&,`-AFFF F`"Kh"K`T,`hh1#k`T FA V!Fh`m `F'B#J`h+* K"`+FBF1F F(O0:F!1~(#&&h-AFh F~FŔfFRE|!Buڱj iBRrh*!iEj|EڑB)5BERE| ijB 1RBuڬFFhhBaEpE58F#hp`Fa `a`#ka.`Ɣ)h9iaB!bEqE##2iR0BB}8F3i`F` a`5aKi+?n hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAzKhXhu@ h8 &h-CF FU#@@tE+hjhXBEњGs2CB2tAiFHAElhGt  5&-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fn3hBB4 0"#2"F( F&hK""`ZapG&hFKh Mj>#bKhb FI?? Fkl4;h;BiO$&t0&h&i<&\p2K-Og??W-J h,KhQh #O\&Kh W%,F0;B,(C2O FF??F@FSEs ۰??ЏBv XFQFM F%%DF ?p ?h&i<&t0&\ppFh\ KDD  p`0j F0g4F&hH&8F L 58@ $i!8@Hj[ b&h҇H&8F Fk 8H"F+Fd(2BA &-O FF #dK2h IbKhaKhU!FXF]KhF\KhBOrr 3OxF@FF F??': #?? 3^F%F # GKh@ #??8՜BF{ ڻ B s 4+6 )ȿ4XF!FĿ342mSFF3H??G8[\F??F$PF??F6+eSFF;H8FLFO FPFIFe'GF&\&\p&&L&X&Khk-mBoRFKF@FXF!F({ђKh3Kh Kh 5Kh*ЌKhCEKh+ЇKh+ EKh+E)FFF B0FFtKm-@!?? ЌB{ #B{,&hb"!GLE{ `H00VFMFFLF-i-(PH#"!2( KpV ; +BKh+ KpV 2F(p+H!*E%XF0J[!F`R#` Kv##F7EvXF!FS(PO Ku##F Eu ڱEK `"K` 5E00 5 # X&&L&T&h&4&&,&&&(&ux&t<7+!+! JFWCH7_FFR#` Kv8FAFEvکEO7F7x5FFO38F F H*F#F(2Bu(F!F8Ti&8F F H*F#F(#Bu(F!F8S\hB5FF&FF#;`#Khӹ"J2??^Eu ۴??(ЖBt$F FH`??2BAڀj /#;` Kh++Kj+Op& ?p&&(&h ?hpFF +xKm,K"eK`p%i F F0,F! N#2F)F3F`a#0 Fp@0Km#a&h&t<Km8  &h-OFOFFF;kh{k(OJF+FFPFF# B@2??е??ДBuۊI IE|  .R??𷀁KVF FFIFhCEu??а??УEpF\FB|ɀh ( O #C#A#oC#C *F`F #F+(5 2 ??yЊBsrBAsBpm9`(f#FF?? F{L*(J #YFF 3FOO0FQ??dСB|eNEuEzk0KhAEO|z ۹j FfFY&FF1FTVFFFIFf5FDFfFF#n2??АEvڸv0FAFs`#0FFAFF??h;c{cEz*EFzF&h&t0!XT??o FFO1(F!F :0"KbKh+ѽ@&h&(8! KFh|F M#"F(CKh+ѫj  8 R &h&(L#iKh#`Hh@&h&&l-OFF  x+NGG 8Lh{@ՑH!8FFHf(O9HF M+h+ЈKh +h+ѣj#bX#bF(5и@F?? Fu[F F0FF F#FYF FWѰF??+Ѹ%@F+FѸKKFhFFF0FF F??06BO4%FEy??FFѺ?G.Kh+-Kh .H!2&4F5F FO;#O2)FO3LFx#h+Kh+? { ?? ZFX#h+ Kh+?BAE &hҦ҇&(&& &\p& I:JhC`Kh@'2y&& I"JhC`Kh@2&&  I J!FhC`kKh@2&&FбI KI h+!I ! I@ F !F ! !F !F2&\22y2-K-Ah,SСO`B! DI(F)F )F <!@I  $K"`MN7h|*h3hBEџB 3Js[`d K"`b Kh#A &2&t<&\&\p&\<&-CFKFFhHFR)FFFHFFp3+] +@F9F &-A!F FFF0F*!D1F`lV#wa F(F!D)FalB8 M,hB K""`8#hS``/ui/r F/o f&-OFXOMhUI `F h/XPMXF#  `F BFOaHF,Fp@Fh+~;h0F+`#k` M0!+RFIFXF( 0 + + `Fx+FF#` ) !p h `x+! FjFF0FB{h`C``hx`3`F#hX `Zx^* `F"hxEa,$*O3!!pF\)12B#`Q!`x,  f&)-OF M F  MM,O`фKL `O  "FOaXFv(f}Kh.PzKB Fw >F[( 0F (F7F@FFPFF8F\D4! D $SFBFF@B8F/H^IXFwZFXF/@,VJhB+` # k`XFб80 + ` XFF;IKB Fwf(#3`l FoB (0320[#; xFF1+ 2@xF0^20^F;X2 @320X0FF)12I!xFF3)12IF;+320[O 0+3x+И0+0FHE0FF@F{h`C``hx`3`& f & KhI F I FI F 騱I F鐱I Fx! F|(     f  FF FY( ( H!@H!"/;K-Oh{FV F1FO! *аF F0 F1FUFF5G??#H!fO4&F Kh+JFCF8F)FKh+ "F3F8 F1F!jFoQF #Fr3F"FPF/PF/+LFFF&H&&& IF%4(F O* 4ChBаh43F%: & f IF%4(F O* 4C^hBаh<3F%: & fKhpG&KXhpG&Khh pG& u8H!h( !`([K`&pG pG LQ" h 0 ( 0+#(F&)ѳOr` )* #)O1BA #3`pGFh/#3`#C`pGCh#h;C`\pGO0pGhpG!Eg[bA(!g pG#BF F0F!'O a|!h!hF)bh h/&`#Ya`TFFFFF$B9]0F4"B`-GFF# FD DS FAFBB"FCF8FGH F(@(7(/(? pG8+)08pGa+)W8)78-AFhFF`x*"""D?(F4BF ?(+ =pF hsFFx ha;+!# %')"!F@ p ""##p4 4`+` # # # # #[ \-=H -!Ix,[,D[-e pDx^,00KLpx])0xa])p03F*H[)ѐ.ɲ)'FOFksF].kѤE034F.H4F\,FxK[.0 pFB0 Fn. $0 p\.B FpB#0 p FdӌӺK"pFhF;##p H=d4 F9"F)Fp@f +36 @ ;K-CFh G $9I3FF:F1F(F0+(K)F$F*H\Zxb\hF3Z x[* آ.۲+(Yp3]*,[,KF(=H\)}-B@ŀ aU `Rxz R 2hQ2H@/J(FX"+ID8 #(Y" h#O2 0 0-𗀚F1h*FF;+310[)xg)9)0)) )HNW&savՃՊՐ՜ձ&&W&2 x9)/)i&)8Ш(0%\)%: 2 8XHH \ px0Ҳ @hBҦHB X,PH xpX,QH\!p )љHVH,kFs;)zI)#0p) w)0i)ЍHO #05H\H "X Fh"+-|HPX\=1h5H\*F;#310X S 3 FH, * H\,++* U" 5pBeH[(FcKh [Or@ a(F`0?ǭX\ dihI`a-61h;+?&Z1 R;+(FOp 8#`aF@30 \+DH d"HFAF)?H [8 "YF2hxF0#320[Ԥ# 0FF.?F! | *H޻#FF.AЁE"H̻"Kh+D#T3Ѥhx1hPF;+?Z1 R;+}+?H!h xTh3`#h3#`+օֵ&Puך Ĩ"!FO.("!*@F.;0CF#0Ѥx+ !.%F"U! |t h( !.F0x ( "hxT0KD0#hCD#`"TH"!8<1H"YSCJF @ ^BF!hD(0@TPFix+x ]$N!F`V[4,Kh+ XC8K`Kh08 K`h/h#h Hi(F=F.&&&L&`&\8F F8`#`KTh``8 gF 8P"B`FJQh`CKS` g8Khmh (FI(hHF(Ch;C`+ ڻC !FX F: 8hZ`x F0&-AFRLFF"j*7*[%(Fcj.3`bZh*JhEIcjhbCI |%"c%bh!?J?H>M(=Ijcj%c%hcej9F@FFj3b+ј #*ј n*a.j[{@3`cjjhcbjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?kpj3b.#p"ceBp&& Lmchh Ch;C`+ڻCСmz hZ`x&-OFL Fm#hhkchI {JKeX2#c9;e#f#cfTMmرCh;C`+ڻCСm>ImmGF@"k`hZ`xmPE p` (;лp0۱H~I k|I kXzHp4tH #p0p4m@HEлoH!k(F#ehHp##fcn#h[h#`#h+hch c+9F!k8 F]I {4#cfh YH F   {chxObMHahKHOb8o"k KI{!kOb*!kOb `~*|F `|>JOa[F(F$o(FhmHEл^5I(FVe(?=BVmh CRh%fb%I k4e(!kH*#aK\#f瘱nD< + E CF`n0F*Fj 3b& #&H&@&H)2[sمّ OaM cS+ FvK JIhh{F&&ٓOa M cS+XJIHh h M]pG&&ٓF N F0h-)F# Fm&F8;F)FF0` Fm0h&H])M)O&khB&Kh@>$Khh+5h.zI"FF { #*hsCX+6h!;h@hI@hRF(OR#F!hFF FF;h!hF 3 ]&L&4&8١ٟFMF(h I {`+i" `` libF2H( h_IF {x  &L٨-CFALAO2DF[ij2B Ajb88iDba"p&--\-Jx8h 0@0՘ \*&*Fij2B Ajb8 iDba[i2aAF!"iOR Jh????Эij2*DB aj)Db8iDba"iFJDQh*F1Di*DF+D&L FBhFAiF*DFSBAAai8 a `/*F1F#c`D2D"e`ZU-OJ#L`H!3#cKh-E#dXf 0+(-h.bh*43h+ ьKhrhB#` +bk"!kphhh*ZhKhB+|KphhxBxAz8 #`#d(h+ak!k@h(Ыhh*ZhjKhBhKh`+eKBhhBM*[h+h+bk2F!k@h+WK@hhpBpA|0y(?+~=;>+?zR#` USUSUSUSUSUSWUSUSX5XOUSUSUSUSUSZUS[USUSUSUSUSUSUSUSUSUSUSUSUSUSUSUSWa^/WXUSUSX'XEX_USUSXkUSZUSZ[c[[^#USUS^5^}^US^/lbhB! hYCZd7h `fh #"h!sC(i6Px``f`&&L&|&# 0h˹K(ihpKkhC ўM!bk k+h4k)h Ml+](k+ek5&kj !0Fl#cA0Fbc#HE#IH">## H#IH"1#yK(ihs uO:hwKB<#A tHJ@x3p# nI  (ѽ*0+0"!&`fK;C06B9haH9h$ 9h ;h[)ZKhh+h-IUI"FF { QF-+FP ٚ0"! O $ 06B9h@H9h$ J9h &FD XF-XF-0DFB9h^F/Hx;hJF!PFB"XF-BF)H(KF 6B:9hX"K& J 8h[DE 0O B9h^FH> F+ I8h[Eџ i&4&&|& @th&8١ٟ goKkhC nN!bk k3hk1h gH!$ L#cIbI`H#"^H!(;k+6WN!bk k3hk+?+1h %k+" !z@FF@k"cccF:F!@F0|k# \.?ccc7KkhC 5M!bk k+hbk)h B{lbhB! hYCZd7R `fh "#h!rCki'k hJiRhBi K H`ck9FXF#FF(#aFkifk+к"i @̀#i!kH[hz#Iki8Fj#ih#r9D&&4&|&&dF#i#BB "i#H9FRhki8Fj#i!BB\DhO FjڢN H 00<Ϩ H<jaki[hcO!rk0k;hk9h poih(qгk+n;i3ZOr@ a~8a0Qkih}I {BrvH9D#"#iFS2ADhF#"9FXFF(_V2F9FdH`EBKLDhF "#9FXF(O ki irkkiBQI"i(JJhC `h+?#`mi}k+ki3 (iOr@ aha0*i{ hickB8I"hi(?l"m"3I#3H3N 0 <Ϯ 0<6Ɯ?k+;4?5J&kh* 2DB(3x0;f3xp(p?1B#"1F #" H#6&d&L&4&&| &H"! R BE 0F`7BF$ !H (1S 0D|0 h0<ǜΨ H<h x0h0KIhKh&&&4&LKh#"I#H;h`~{) Rih&&pF FO6Bp#~w+{+s+ciiB (cih I zcia$h`iC"ifa!h`i-CFFF:F ,FBI z#`@Kh`O>I8F \`dX.U(FC,{Zh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F zC`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HFF(#;0B+  HFN a& '8F!Khı`h )F(7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$h&'Z"0FMFI*F ziF ~0 I zObiF F F M0DG K : * B² *I QppG x I0;0+ B0Z "ppG1 ĸ  2L!F6h!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@v&K0hci1]xx(+h(#H|~C}0#+#F۲t#ɲv!ҲBu"'x&Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p&'xp1L#hZi5kC#h,J![ikM *N%3hB.#'Jh*B"hRi( !J!M#"hRi, J!M#"hRi40HVp@ #h[im)FOh J!M#h!J5[iMIHf+p'xb&0&, xW8FH`3I  I0"FHJHOqM, F8 !(F#p+x3,IH$L x`&uX!HV( sFHx?+Cx0!FO0 F/!D Fw(Ѐh;+ H!Ft H!Fh#`! zڍڅڒگIFH  xKD |<0BєB4KFIHKh[i1cxB [x;IH@K,IH,؄@I@F H,I H"F I@H& x'x%1:MW$IFH  x7F FV"` F#xxh"+ 2?? O0 FF*hiF F0I"F zd<#DF%pBݜi*5XB2DB<#? _ 5 g2p! h3l@dpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3l dpG2p! h3ldpG h+#`pG H`pG# K`pG`pG8F K Jhh@!B - ,O@}C#8##'*'#pG `pG# `pG# `pG# `pG# `pG# `pGK J`pG'hK J`pG'hK `pGK `pGK `pGK `pG K `pGK `pG!!L0` '# K`pG!L0N '%K J`pG'$K J`pG'$K J`pG'$ `pG# `pG# `pGK `pG$K `pG,K `pG4K `pG=K `pGJK `pGTK `pG^K `pGpK `pG}K `pG݇K `pGݑK `pGݜK `pGݦK `pGݫK `pGݵK `pGݹK `pGK `pGݽ@s @O@/g b # "O1=]" h@! IOb@r  ',(Op h%*O!!D IOb@k  ',("I@K w'(I"Op 'OpK%*O!!D '% h"H "I@{K w'I"Opm 'I"@ a 'OpK%*O!!DM 'I<"OpA '$tI<"@ 5 'qI<"Op) 'I<"@  'sI"@  'sI"q  '$I"e  'I"e  'I"e  'I"@  'tI"Op '$I"@ 'r"I@K w'!5I"Op '$tI"@  'qI"Op 'I"@  ' 6" hOpI+##Du '8 h I 1("d b  F#IOp"KO1h#|1 '*8" M F h(h|!(h)1 8!hF'*K hh '*p FN0h)1; @N! O0p$ h"F|A)h0h#"0h)h"Fy F'*p%N Fh3h|Q!h0h*F(Fp'*F!% F! F! 8 F(F!CF(Fs"!F9 88 F(F!CF(Fa!F 8FX!F( "O1 FHF  ?K` '#XK $`5 F&K $`)E F&K!jFp #0].tgzK!jFo #0].tgzK!jFf #0].tgzhv!@JFc K!jFh #0].tgz$ F `: F $ `2 F $ `* F$ F `" F F& `  F `  Fh `  Fc `  F `  F `  F `  F p `  Kh,!F N '* Kh,!@QC ? '*OK h,! 0 '*OAK h,! " '*!  !  !  !  Hh Hh Hh   K"`n '   e  I z 8" h@D!F4; HhHh 8!F"H|"!FH|"L@I4; Hhz Hhx A"H|lA"H|f'%')"L@I4; HhR HhP A"H|DA"H|>''"L@I4; Hh* Hh( A"H|A"H|'8'"R I H0 I"d  J#IOp'('( I H0 I"d a J#IOp'' I H0 I"d C J#IOp'!5'!SL h( h"O1 '* FN0h)q? @N!O0$ h"F|A)h0h;F"(F F'*# `pG# `pG# `pG `pG-AFC| FFF@0B̿iOiĿ 0ȿB-$KBiC<#S)Ѵ0iB"-aҲw*b1ʲI7R﹣k۱2F)F FG0BiACKBb(1x"+ Ii748FiF0FA%)'.-OFPiCF8@`h@ h(} FFF ! Fi^AFZFB|>3x+sFO2# iC 0Bȿ8FљBEF BBڐBFDNFBE# FETڣj2F FSF FF0BѴ0+#K*Fi1FA"iF80*FKDiYKiOsFHBF悲"r₱FEڢi 9[hSX2F9F FSF7^FF2pFFF.F0F**FIF Fp@2LF)F59E< KOq%*""Di@J@ JOqJ@IHXJ3K@ FOqJ2J@h IKOqF''''''F)J048@"KOq%*""Di@wJOqJ@IHXJ3K@ FOqJ2J@J@K!h+ ""KAOqF'%''('(')'r'#XF )M"&<@DhOq"J+##Di@J@ JOqJ@ JOqJ@IHNXJ3K@ +FOqJ2J@J@K!h+ ""'8' 6''q'$t'!5'!S'"R'r'#X8F)70hOq%*""Di8@J@r!h@"hI 3#2Oq@ Fh@B8',()  JOqiw J@ JOqJ@ JOqpG'$'t''q'$t)  JOqiP K!hJ@K!h+ ""pG''h'r'#X) JOqi,JOqJ@ JOqpG'''q'$t)  JOqi J@ J@  JOqJ@ JOqpG''$'s''q'$t) J@ iJOqJ@ JOqpG's''q'$t)) aJOqiJ@ J@i!pG'$'t',()) aJOqiJ@J@r!pG''$',( H`pG H`pG H`pG# K`pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pGK $` F&K $`y F& h+#`pGI"Op 'I"Op 'I"Op 'I"@  'qI"@  'qI"@ s 'qI"Opg '$tI"Op[ '$tI"OpO '$tI"@C 'rI"@7 'r K` '#X K` '#XI"Op '$I"@  'tI"e  'I"q  '$IOb@r  ',( F N0h)q? @N!tO0$ h"F|A0h)h;F" F'*-AFh Fpchc4ihF(!0F.``&0Bܽi7Yihpi BY!6ǿFi7Z j8iDl j@N##biEi@F#aJ'F`#B7<2*/i3aд)FB<#>^5 g! r@Q! l@Q!@ e@R! _@R!@ X@S! R@S!@ KIHT xX8!L#h+87^(6==IpI"! IO09DO0AM(hB``(hB!`(h7@ !`*I ap J0C/B<##` 8  &8' g-OF,򇃞KhB@iS$@,|#! +(Os>Ej#i FG#k FGi*@D0 P.O O i* 2B3QZ գFO `hX   h0x+ppK&_F&`O FB3FF !0F   (0F BFF #-o mBBF 0 D PB+ݴ D %u@ DB!I"+>0 qQ ;I;Ht%#7RBF.&*VF  0E&>,I2F*H0KFL ViO  HhX+ 0BF  0E?"ѣ Oc 5P-um8DCF*FQFDa>r I;FJDB &8ޜޥ x ;!6XIHO1i9,iO1@V#մ QFCF*F8DD bEX!jKhD2 F$@0%zs C+, F X@00h3BۏI i(F<(y(FJCh20񜁄I (FG BТiRԴ DBDゥ0+ݢi;RԴ Bfj&kI hM(hBnF(hBr#FF8FDNF(bOEAF(hD8h>z0F-&FF+FF+ E?8h@7x"FSK8hAf+F"!8hA`"!8hJP8hG8h<:'003x(q(>(1d(/<(!>K[h;NE`jO F *  u(XEа ڰoqD(*I H@SB+x+&K[h;D=(EJ0+?  [R#s"ri7 0PAB `p3D7D!qB9FBֿ2Rؿx(хc' x '}&8 ?Ѯz(`(x(8a80BĮi[? (8?o|`D(^Z?G+?R#I;5'ڰ?(?h?<(@0L>( (uO{pD@SBj(F<$v( a@01@0.z+#P i76 jiDJiE0B+# i7$ jiD8iE`h*@#c`%0BRck FGi%@ ja@%b i 0?=h;pos[v FGB?o(дsi7 j0iC j@%biEDi@#aKiS'@N8F(iXh *i3D]`3@F>@FE@F@8h&8KiS 0YpG&8(KhBiS pG pG&8-OFFF*$ PB*}F $ FD!Jm PPO U$()Ky.FFh.=320[ Ը 7I Z.F=HEj>>.=320[b@d-nT ѹRFIF8F8FFBnb"D<"##[#C RF9F#;U8F O* KERFIFF&L xFMh౨`BF0FBDC4+hB F)Fdhh)F"##8F&LF M(hAKiO3+`" FFBFO0p#"#pN#F a (` F,hc I F. 0b ~T&L@u#BpF M+hZЀ N2jB 00iB,hD Fplh ~T&LLh62"##&LKh&LKh&LwFUk F1F*F p@pGSK!F*F @pG R]pGF F@FHu@FHٿ-C 0FFFX F8F ZIF*U"F!c+FcL-OFFF@A`FAR-F@%* )FF(FF+x+|CBw5'D3DB~۹?dtd  O !8(kѸ*FO.ؿAFܿvv[Eȿ3FCF(P+FiKIBF%F5F*9F# F6 !FPFCPF? FDv(F0? F?'kx[DB4''%F'}0D FC:F !KFhC8XF F8?F F?"F F6 FFb sC`F F80F0F8 F`?F0F?[p'&LL   𵅰F F FS{9F*"F!c+FL-C 0FFFX F8F IF*"F!c+FLSK!F*F @pGI8MhAFhA D8&L 7hFLH XD=%h}hFIF(F h h##`L%h}hFIF(F h h##` KhI H.0'lSS'T&p xT-Oð5IFF(R,` G*F!G.IFF-HR F) X*I(F,)\ 'Ht옻@t F,!FFFXFF0c 'DIPF =*4I FID FJF!F'T<2F!(Fb(0F2CVV xVVVT80Q# -C#M`F F\F(;0F|F 5+I "(FT(h #`9FhFf%IhFf)FhFf~hFZ( F(1BK@F`)00F Mh ``h)(``hF I((F`I(VVFKhKKh@~ t''#\HT(H  @n(Op@ SV-G -M$O3+` FV(? !F+h+5B'iF +Y!#]" F(@݀ jF(@ր ~ W \!F^ 1!F (,`6qMF>!F(h0(!F (h!0(!F eKh+ F !  kB+h"$!(6F *hX VI2 (v+h)(k(f (?r_!0)VF(VB"p"6B.&E<F.FBHOOp EGӡE1Y ,((S (!AEE(U!@B1Yk1"BEE(p3U"B2U& H'(F)/Q86V h0G( f3kճnczRnhR1 [h ''*'[e( FObF IOb Ob `I `Ob  (  ` I#F"F DDDD!F a [[h[o[t FObhFIObhFfObiF Ob I X ` `iF -  ][h[oKK0$   ` F DF Fɲ/(q(9#H*(4!H%Fx XKMhF"F!F(hH0(h6D(hFiF #_"Z! p! ^H HF HCqM#0''*[[''&K$`   d  F F Fɲ(#Kh*!$FiF AS#`"!F Fs#0''*-OFOE 3x3FxF3 **O0F pO J[E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " F& B $B5@5H`\+ 0+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?z3P,hC) ThPziS)K 7hFL%hhF@IF 3 h ht##` 0If `xI(FhF#IF(F hh)] J F[ D'[[[[[p i F Kh;#+ *FIF0Fp@K'['l7hF#L$%hhF IF(F hX h##` 0IF `XhFIF(F h>Khcph)JEF[ dh) IF H 'l\\\+'\?\H xsF5M F(h5!(hAb(h=E g!F ?@ ]? @< V!F ?r@1F!H4R@, H?a 4E(h@B!"bC(hBF0IH L!4GKhK` F<!FP C h C`L01 T TFė#QFOpF N(v+h;R(`'z O Z" B <"8F!FH)H7T/%K h3SBF"FhK `h vJ' ,tptb\@f'l'\\\\\'r\\\\'#\]?]*h+.'#"0F!FB#h*OrB CKhBK%`<#hh -`x ;Hd@Lh(l6IF F.'_FJ#T!F`)#x+?UQ1 F+h#y(` FO I #(h!F>(hE/#x{[+ ̬ 0<* OrB ` h(F'l'#\]$]+]D0#"2%K!" S#1 #IO3e I HT Kh HN )FE F 0@ 0 x]G'l -OrFF(S+!@"(!FHO0#0iOpG5I(tF2Kh(1J(R+I(pF(O OW 8F(F@%0Fg?F #cU0F-ѶXEKh(J((F{Bػ F(#0O5 F9F(TF(5p]f'l]h-OF'RK !FF.@bI"F v'-6)F !0FF0F5 FOAF(FI2FID3F@FPI0FpB x%+@+*!:0+x'+5<*+//!PFF#pPF F߀/#;@FpC XF(@̀T'0EPF(XFLI(FH7.5x-D'P<I (F(0#(0*0P#*0oɀtM.hp"0FHf(hE(  !FKFFiHge.@@ F(F^O@F(F@;hBF !F >;h.𺀝BѸRH>? >O?@EV@ @;hB(F@!8G >jE8:HCh;C`+򖀶?I?`H>[h3`gE 8a<%F(U H F(0F^Щ(~.? OpG]p°@(FFp+xc.!(F$F0H")FBp")FkHH"!F&t&s-CFhVOFB# F#p_-и/-у k20#)F@F[#1) FJ+F4] F!FFF"CFА"!(F I"(F/a*F1F FF F6,F F&rpM(FjFd@)FF 0˱) )D<.+(`I@H&I@p Hp&t]&q&sp,I "@0j"F'H`'I "@0j"F"HP!"F@CF$("!<I">I FF FM1" FH(1 F0p)F" H5F H"!Fi!&ri%&ǐ&r(i8]&Ǯ-O6]LFX6 +@𩀀J© >(}Kh!}KMj{I|Hf Y'+j pF;x+XFD_E 6ROs82#"S,:iI8FB9FF0FxJ#cIp8F4aKh0D[Y sOp"1F05F Z F 0FN ( \23 P-0F+f'0h'5r!(FUO3&%ѩ9OsBH0©CFf02 *s:IP 7POpJ(#X6# K!(F'F 0Kh .NF r!`3#rClB&@u*FcO3u AFff5Ft Zt tWO3;`B9F ;hY( @F'= 6]&t^'l] x^P^h ^k^}'#d&r P pOq"O HFXI"HFF(I"HF~(8ѫK_FHR!A`@!Jn#A0ЪWchK@-JI0 ("#AF0𵀖HAw1s+@Ā1l+@𿀐K"hBxH©}(@𱀊I>F(@&*OrFVJ#x F~J#w FF(\8# \8.@tJ#y F-pJ#z FnJ#} F\8jJ#| FfJgI:x+ FcKF< F- 9FFFW  FFKAF26K' (? @F'AI /4 j%G-@Ev ")FHP!")FW`0I0h W"C`(J~ #FG(I$Hd&I"H^б%IHZ먱#IHT뀱IHPXIHJ0IHF(@#:4]]^]&r^^ ^^&t&s&r&ȭ&'*]&Ǯbi^__`` `HOA+(ЮJ# F\6+ЪJ# FIF(?xIF(FI8FI8FI8FI8FJI8F[7+=ГJ8FII8FI8F8FI JI (IF &gAgE8Fi F[Fh F#`#8@ڽ8-O'F FFFE!8F&F(6&0F&K@F&H`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F&F(FO   B;#4K"1FOp<#2#:FAAF< '(F+ah h1&(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 1YK Fh/ ,@B*аOp( ))@@Op()@"( K3(FpGHpGHpGHpGfgHgNgR8F K)F r k|!F O3 ],ۀcOr`"ZJ`cO2`" Q+  xO (# # ` &1FFF) B󱀹 sЦcOwP#KsK`coC"2ЦcOwP#KhK`coC"2#!3'1 7:#O3%?F?~ gO: Y [TI }@FO300X?dbR#(Ѻ?#"!21 #~3*FSF?FPFO300ZЧGW#LF@F1,Jк?GOp-L"F"2*K`#"F1 б OOUHH  @%05,3qO +N p ,TH @"02PFKh*"`o'' gE '*"E` SEªOsM$ #'F BKh+>ªOs$K@ K"!Fh#T }1(`0U (h""0"!FH,1,1 101$141L#(SR#8 1"YC$1KCR#,$)h1(1)@.,L, 101$141(1RR81 !SC$!SCRÀJ$1+Հh.^΀RÞEr ǀ@À2vI P O O ! X "HFm+hlI@F$1h#!RBR[meKhP*hcI2Qk$1hh+h$1hFXh KF!Y PO :  O30?0+<@_(?$h0G$AO:!F8FvGF}1+#}1$1GF418F,1L#$ + K(hh( (?X T+?R)h$1h#R#M2SC<1Kh+?CL hz J#hh_`Op%vOr! `6'*''#`''hk'li)#K3M3#R (1!!1(( K@pGsXBXApG pGB-O L  O30#3`#h*!*@𯁓)Q-AТJOa3 `I `"s`Op(𘁙I b !'H#hJOa3B|JBpFHK!\ Bv!F@F p"FK h@h$h[EOp" Yh#3`Xbh4 C𜀸j* @F3OcxBkG({0O "@FoBkFOcG0"@Fx bkOcGcm!@++;+h+Ā+?#m@ڀ2h*րDI c F0h%Yg#mYF##ei:K#mե4 FB"F(FFH#F>B(?|  Jcn#)J!'I0FNI%cn##J!mC! Jb^#nC!J~bRm)K)FI0F lYI%~J'*ifjhjj'j,j2jAjHjOicjVigm;"n*SC"J!8!I0F I HI0FIAI0FI9I0FIM2J0Fm+FFel5#!!1B"&F%F#OOjojuijijijii-OM+h*afHeIOFIF0F+hI3F@F鄹 .9hHx!F  FI(h)q/x09F(J z|aPFaI F)FPFF#hFByI 2 2 (n 8FaFFXF%Op]*F!]FF0F%%fI:F FJdM+x!(F-bI F?aI F;`I F7+x#ZJ F]I0#\H#Fp8F1WJBsjUJVI FUH_TH\THY+xRHTRHQQI  FH Q3F~Op  [ khC j+km+k +m7hB؍+hk z!#h1OcxRFkG(SF# +~ km + +Q#QC     7Qt '*kk'lk)kBk]kykkk'llllmkmm;mAmGmPmWm`hkj|O KFSI@Fp()mOIFlNI@MJ+ 32F  F5F5F5F5F5F F RF 0FpF F'+@г.ȰO KF eX I@F O KF z5 `[ Ob"K FIK[ kh*[BIbB FIHO LKF`#^KDJhjjjjkhkll?ldijifi-OF|$M,@oO&=FU+I 64,ѱJ16v!60F$_F0O4 F $M̒L J{ @rI h` @f Clcc( @Z,eT#D WIZFIZF"K "Ioh2!Fa!F8h3F*FO F8h$' 7X$B(F$$mhm|iqmmmmm'Hk'*gEjfhkkhm#Lp%2hBAhj.њB3Hk"&%hRf JoOckG(I*F0F(ЄR&&K"F"H!)p F@&L2Cq" \#2&-O"FF LSOj $F(LF"F <@@Fk$ c F=0F$ F I"PF(:FAFHF FiF 21 z * `QF CO4$O4h F#F#`iFkP) hK"O0'-OF{O] (`rFD ЉdETAD !LLAPAi5#F IF(FA=0)2BdF0`H!(F@ mp@F0`@I0FF F$ ObVoIOboOb)Fo!f( F$u ooopOp,L[,HJ@a d)HC@b ]%H< hFHFBF8F(F$F7FK!B(MFF@@FGHK"K"p8&pGpnpp$ FiF8p@XBXA& OAJxI K"!H`KKK!H KH]ڿ ]'po'$'#p'p'q'OApMdp)chC#K"F#!30F$chJpA  C1p&p8M !FwHFpwp K F F8@#o?FR[)F" I*F qI#F (#0@pGpp O3( K J L` J!F HJ!FH '$p5'rp'#p'MHiFyꈹ I*p I*@ M O0 oqq MHiFy( M o0 O3I+$ F0K JIF(K"M!H`KKf K! HS K\''$q '$'s'#p'p'q' O3( K! J H K4 KJ! HK, ]'q7'#p's'q'J#\3!+pG pG&I"\F (FpG&J #;!pKD 1C 1pG&&0Q#0Xh K) !ؑ D !&KD 1C 1pG& v}2 :OL#h+I p##`'$qRH}L"FhF~x"hF( D# Ix9x/!l0K`@Hqi&qx',$qe F"Kh!F'R]pG7IS[F IF )F F FI 0@pGqqq7IS[0F IF )F F FI 0@pGqqqHN!{oHV@HR @HL r rrF( 8I D" @  r&FIH FKFH)FHr*''q'FIfH FKFH)FHr*'#p'') F4 F$(NM( BFB<"9 BO10h2nO1(h2hO10h9(hO190h7T(h7P0h@ (h@''7FtFpEh#<I+F"FHH0rJ xr10 Ű.F"F(F !(F #pKhKx:DjQ IE0I',$&rsrq };H&:L"F F FP4Kh#F3J!x | "|!.Ht,I l< r#H"(K !0Ff&K #2 #"1#1F3 O1FR(FO32 r! >-x:!JJ@H}"F ~ J( }r|&',$rrur XrqiFH0iMxzX8F1F$ȱ0F"F@8F#J!xj| V1H|!"tOs K( i, F7( F@ &rr X!F@< ĽiF O3]iF O3r]hFh#hXh"## W8FLch/+ !h)(F z84 \KJ(FF'p'$t-G-IF̀_*Ns'O =F(F&I"F HF(8 K 2h%IO g(KO BF FKI"FS%@PFL(ѝ0Hy+SD0a#0030r'hr'r'$'rsrr-OF-FF%L$!F0F.F+"VF({$!0F @=FF,;3x+h1F(F_0FDEE_6K@%$   " F` V+ щE Z! $! FF "XF ` F V*KEҤ1F(F"F,DH FZ#P)F_(Ft%$!XFF,p8F s/-CFFF!FF"<Fб%B@F@)F"F@FG(F# FC#Y%0D%05-pC F-$!&oIO`蘱D " F`& V+эB p$! FBFHS+]pGFHS+]pG!-C@n OpOF dF\IFF*@o#@q GEF%~K^GEF xK3@3/F@F_)F& W+h+;+50x8 T+)F) O3+`A+h+GeO;x+dM+x+И0+^K F_ Fb舳YICF"FoBpD0FUI;F*F1UKh+hJFRO!\@m cB'ucA7O3TJH!F( + CJ)F F7@HQ:>K`r)F;IF 4FF0F_H@ 5J-Kh@JF!OpO3+`(H^)F' +h+)O;x+?]'M+x+?X0+?S#I F_ Fbp(K"FI0FDI+F:F (:F2FI I"F FF0F_&ss''$& Xo',(t stpn'$'tt)pt=tWt`M iFH!hF IjF M]tM iFH!hF IjF M]t7p%0v% + "Z H $` {ZH<IT M 0 ttK|+H"|+K`HK`HK`HK`HK`H K`&t',t'0,t',t'0(t', t'00 FQ!F K@h'}$%!F*F D#! 5 #(^H!F ȹpCOYH"hUI"VHVIVH" }Or! QO!"F  `@A"k@AiC"``(ۅB AKop@'! `=I F `h"h)i 7K"pO3 !F#` h(@())I,H_v()Kh+!n N%H@"%2`B] t#!Sl 1@33O3CF nm y1F(F(F.3ht!q't'#p'q'&Xt ''$&h-OFdðFF3qF0IH.h0FwF0FG#FDJ!`!Fu0F۹<;Jh3` *F!!F F"0F"$(hGF( FC+JSh3S`XFkh+%I #ICF F0F0F"Jh3`I !FI {0;Kh#I FojhKD !B !/Ji3a'ru',uuFuuo'#Xu&'$p7FCh F+ + H_J#)F F#40Ib2+ Fuo-Oװ@FHFRKhHLJ&O1F   Sh/+{!`N#x /|(F"h)@B@ < {N-AЌI ( Op& I I I $1@ـT-@׀~I |H1FzH0 01BBsHsH@rI oIK0hP;D 1+1&2q3h+I  1+Cchh c)F0F( 6>c``0WK!WOh;&6z?41h#a DNI"h\ #;` #** 9KCD !B !ci3ca6.*$`i7FFFOi71+j";h@"6-A%Fp'F#hB #p'F"hB"ؠh"$`hA"ch35k՞n.0Fz h+FBbh"3nBhbh]"Vk+F3h0 0FG h+FBbh"3QkB4"-AFF2HCF ZlFZhF+HV*IFF FZx8F\@FV%IFF0FZl8F\2F!I FZd0F\J)F FTF F\(F.IZWCL\,I" F8 IZ(IZ(VNFw]wiwxwwD}wpnwwwpmOc FF!-CF2F)Fh0 h F` mp F p FF"! F& I"F(FXB qC ha`!  ` h"# pd| FI@dz M%OcF)FF-CF*FF;F0F MF FF-F` M FIAdeh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp" pO3 0pGo 0pGpLk, ыk+#p+##, ыk+$#+Ѵ23"+БBK+ U#`.МBт##"M#yp+ F!j +Ah#hhhkGb0#h hh[kGbhlbbkZeke$*!аP#N!B٩)V!XB)тB3 !F1") p!!!"Oq" yKk+ ыk+#pG+ ##+ + г ++#3###jF Fh *!ac#hchhkGb0#h hh[kGbhlbbkZeke  :*K"acy# 00pGhp!-OFh!FF&Op hhBؠh!#h`hc`"KhOh1FlGch$#B$Сh  REXEъl2  kѾJmE jBp"8Fc6p73'#d-OFNk FO YE ܵ0+ۙBݪiRbԽiO  h)Q.AQ+IB +IB*IBв *E  &JBjh+ѫi;DhCE!p ih;D"kQZ"ZJB0F(Ѣlm#e#hhaihhnG(hJERE IBѼ3JBѻ e   s < A  8h-OjFNFF3h %0`p#h^D3k/ճk3,ѓK"hn\hniB8$FOpFIJFCF@0F-(i(hI 0B C#S1/chBұkK hhlG(*hvKPBѪi 0ѡhYD k@CS"  gK h;Ff";F PFIF\FQ } "  ;F@ N:` p2 hF[Dm +tqh+m$03Opx0 qp0 @qBFx;Fh[DkOpcBFx;F h#0hmFKho3BFYDkDdFkG8FR*K B,ٝpI x)  #$Ii-\@#e(F3 4  p iIBxL-#F  ' I #-"K&'y&yyy-CFLFF0+@@OO 0BOp0B@0BOp0BOp0BG 0BH 0BI sx0BJ fj0B@X\0BOpJN0B@<@0B+hhhZjBE'030iS-/kk+rh]IB$\IB!\IB[IB ieCj X0B/[/Y5D () Op0 BI)@@=K"hIi- ll;Ii-ll8Ii-ll_5Ii-ll2Ii-ll/Ii-ll,Ii-llZ)Ii-ll%IiC#JBѫl30h P!+FS+hhd:FiiG+h "WChhjYF ,z> , z'zGzJzQzXzazhztz|zz  -C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"0Űh F!F0GO1#OpC#"(h!Fh0G E0𵋰Fl$"(F1># S"#FO1Kh#F)F+Zpl4'x'I F#+vlm# e 20 R, F FF// /#+vl"!F0lmC"!F zp F&Kl J !(F"O1 #OpS3Fd(F_l`dXf0FpzG-C% F! tF(pOp9Nx%` `@oa a@i#b b$-!+#Y#/+Q`7 5!Op> #Q F3"+@O<$-D `K@! #"2 !JM 3"2#%"1#!FAF(FC F! Iz yKk-C+Fc+++г +[! F(W.O`FW !5(aE ˅Op `@ a@ bOpK"!F0#M 2J3"2# "#s1F`(F F!k+1F y   9-O F h%`h+Fp&(B-πhO lNO  (2"!8Fi#hh#,0!@Fix-@EP"F0F#hhh0:P"F0F#h9h/#hhFXh)F@@ +FJF!xA @ B ?L ! P "h#" h"#"h0G?F/ h"QF"hlGO8 7eFŖ#%"$ E ;B2E #1F(Ft e  SS E@ E8S(E E(!hS E< E E2O@F $ &i-AF F+bhhmG+hih W?Si+OzBzABN(;khp!h `+h1`i h wF (D1F@q  E0#sK`ca3c# FA? R :31Dc;(ѽ + -Oϰ FF"!(P\ph/! WET0+ + # #3WEO3 Rj FHKh O#F@ =P heFžžŞ @T0+ + <žŞ pWEO# 0*F~HYj#B%FWE80HFlG(B@F `32 05HF0 0 lGF h FO1h ##" 0IFG(F #!###"#hFhkG"eOp "JF$ X @żŜO % #S=KAFF ;K7#<## F@F XF2L+h"WE h 8Xc";m#;e h*Fh0G"ckH(h hhlG"hbZe Fed!F0Fhp+FG(CBc[B#'#d A E y{X{{|Z+WEh ghp3D  i RDDs;sch;c`O0x$JF8rWE?p3m h :Fh0G _h 3_kB@5 #i@#p#h[B#p"ch[(DZC)D i RDDs F;s#hh[ ch;c`!F0FmP% B5-A FIhp&Fha \ +h`hkhp `D^hp"!@Di1  :F(x 0DDAF@K F 0 ca3bckh3k`#)F F} F)F O0 &-OFӰFFF±?5YF" "< :_< :O<:):: `!" &O E$#2F'(#@F DDG1)F0F FS*[F J! wOK 68FFK"D|$,D<8F|X =#F aORO3Oq#-A F aklO@ZkVh9FBu9FOOzsCCBu#XCBuOS FA@ZOCOC@Ch-OF+@ A"hIF F  l G'W IFH  hBh:E"h Fl G(s2Rnj K B{B{EBWBx R,L"@F)FKF:"KFF 9F20FF rJP! n'h"1FXF;F;F"F FPFFFN JP!vT,L ,!N Z1xO x'|\'-OFh FFhmG+hh F*Q O h!DD@F Fb(uFH#B8тH"P X22S1"`"03@`vJ 3C,@uC,"#,rJC,[#$oKo~@lq?DF3B @qa"ZeJ 3C,@a"ZaJ 3C,$E#CO|]KBF]H\KJ#,.IB:OQ!1B5+IBє *#ۨXX $$ #+`,"HR!IFF F(c]b/+FKB KB!EEL#3`!EEZ #+`#3` L L&|&|&yT 8T'H8 T&||-OFFFx+O0F "]FF#;p"+xc+8M+.C+2G+++/#;pkx+ FQFS+* !m+s+g+*BFKFOA Z5"*BFKFO*YF-OMhF! #m#5(FJw (##h FlG &h"  KhBrF F F# *F0Gh+޲`Ҳ F@FJ!N-@a6J! +D۲ S !F=T !FU ! F.P-E<SlI3F:F8Fs0Fp(Fm@Fj0%S + s+F0" YJ!-'*x*#RI*Fp#O1& "F#B-)F(:kx+@)x`)@ B#h0a9 F*FlG(0c2F#"##h F0Guj:CFnCfDBFvAF0FfEv  jBAVFF#CCEFA8 Ja#I\| a6J!4 I\j# '|} '}}}B}}fI 0" FF`Ixh"6 V0AaF FFUI&b0V" FFNIHFT&9JK!hObF * F("HF& 0FM+h'(`r#BA#-hhB##" F  \h B 4#+a\)3B 0 '2<#`FFFBܔK#`ppB,+$Op ` !t&!PBBt R`ER1h;` 532@8OrPF!0 #P`08$ N MV; F!2,]#",E ;' Kh H' ' -CFF FE3F*$+F"Fpp'B2B43LE۸@a4 ؼkh J   Fih" JkhJJ5?DOF@K@Q (@h; F@6U8FKh aJ#Bز83 2"+ K"h KhB (4Bx2F' '24'28-CFFF0'60'M+h# '> (`0' =FB 6I hB[+@{)\7 h-D5-<)( O1jpj$ D"[xK@ pz5D%0h3`#KEr ۳ b #8F-)-ѷYFB#1"F'2<8FM+h'(`2 IBs IBs ڣh#"r#8Oc@#'2<8@-OOfq-FF$M PTF%Oc)Ft (CF F; $M\I0B( F*0FpO1QEJFu FF\*Fy!`  X4%F'F+O+  e``` Fo0CE&0F:F"(O2)CF@1$h 8 +hO @ OFXh 0h ph &K"!h PFcO@C"!hXFcoN AFOp2h 2 KFdN3h$1hh3h$1hXh@"!FO #+h0+H"[HOq`!Y`@aWHYaVHh(Y22TI b@b#@u3133o O3FGF 3EKb0F-0F+++Z&7F,(FG(##z07K" O4 F-+h9F(FlGp#C !#h;+67hB~@ m8!Kh) H(FF @4+h0+!(FG\B\A+?ή!(Fv'*'' g i80 eq ey'2@ e ek'lh"Ohh0Kh@!Cb@!$ 0F+OE&O$!(F)(?(zaR hR4 Ch(FQ$4 YhB0F d 84hB$$('*-O KհFOz !hO2 FP @! FJF@ O HFU! F; (@8FKhS+ + 0BY+Nі(1+b#Sb,ARd cErUO !IRBR F[!c4FOpBFIOFjFG% * PJ` 5C0+0G(  rKh[E-؅$[BO6 @BFPOEFFPFx6FOp(!H1O 1F  D! Fc@od!FPFFHF 0F #D 3DFQFFWPFO n! IFFWHF` 1F  W0F FNB s s @Q F# "32*F33#O3AFFB6 O R#EѸ F8F  s?0F1DFZ v'2@'2D1 e-GmF FtH!O#`*@20F9F(;x/+ n8JOaF F\Ob9F FO0F(*Ob1F8FoOa FnP(#x/+;x fx&v  F8F8F43CDDoFIOb FoOb9F Fo}(F( ڹh(F`/(F F mbdjoF8(  O F!z "iFh ( F .(ڀ@ XBXA-GFFFvTF(=иO&(FwnF0(Fu8Fc+ 4I" FF(I#FJFH0H7 3FIPFO7qduOp! -AJmH"F@‛H(oH(j(@ۀHObF((F($I( 6(@(|F(цI(=ObF `dI(2 bIF 9~I('ObF `NyI( btIF #pI(sIF F(@oI(lIF(F F(@jH ObF ` aI(^I bF(FF(@RHObF `QI(!F `TIF(OIF(FF(kOHObLF `HI(FX; `EJOa c `07I b;F 5 -$!@+0F Jm(($1I(~ObF ` `FX)I(lI b$F(Fr$HObF(!I( d`HxI(F FX$J cO(?2?CSad `pG# `pG# `pG# `pG# `pG0Fii, FIBdDK"hJ!(FK,h6 7 !P"FFH F< 0'('' -O@F# h #C 2XchC#k;գk3$%ke 2X ++O cCFFK J!ld %+[0hkh0G8C %Op O3cshBٷh wk3 ! 0BO1c50@FlG(2EE1cmpCBCA  _K"O h]JF2!  +@O3FRKh #FFMK O # KK"O10 ## + "X>KF Fx*b >@X%*Ye)pO #;00hhlG FF#YC{I2D H;FJFQF@FDh#kD##c;0+ʀQ 2XbhBA〩BpF F O |O3Fx3(O .2'-'9 jK ; h#gKh,1 +(6shF p"IE8ѹFOp IE ّk1^ PhsBBhhaN P`hhAkOFD#;0. -x 2I404(  h 3  k"cE#kC#cUF=FQ>#k 2XbhPc#A#mBhH 20FCe`>O Op Z?jQFjZ?bQFO ''*>C-CFFjShBgp&h~C" k)p [hYjK@hhJ!JhR\h[mMѹ>dB_JiI &!44h4Dj+H@g-WJ(!F&O h3DkQ񔀛kZ=# # KI&8(F# AJ &!7K"HF!Fh9J#k 5J(!"~b#m4 @,J#F  УnOp\h&J#F`kh[o3h3Dh3Dm\@J(!KF F@O !FkkJИG(+#p@#n'EM\xT2aiq) Feh#p&FFB9(G+Q+ \F, XP!&J#F N#H* J!^H- @JF!hJF6. 4J!:H*)hkԉk?C2 ++ P"F R, 'a'Bh!-A2Fj.j5 :NO FB=8HO@P"Z5"a2Ja@b1Jb1"c0Jc#hv#g hhCE$#OpE0 Fvj(ۡji kj /k2p50L"BlhjFAFlGHGF kRh\gF3  E-OF7FFFO p' E6ѹlp'q(a0IF:F30 Fi1 x#"kih hb####ice+je8@ii D hjB6* Ѩi@x10Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  gK-Oh FF8F$(th! XFF([I #[E$5FOsO H0t@uO5"AF@HKA#2ZF##fT@F KEkqhj1 F(bqhOp b  h0(Rsh` DAFrh!F  ZFIF F  # #ccFf8FfE3hcc0F[ 0sh3s`,O03PW8F8F '*k %-GF FOp 0@W"O1+O / #30 /+ "9F^/#0ehOEEAij :F(ahOph/(bh`!bsaBF  F"hO59FFBcc"b ""Vch F3c`(Fh9F 0xOp!Fo(Fy'-O FFF!4"0F #%`Br i IBEA  bB! p!``7`0KhO$O(rIbhpӧh#Op B qj(Hm3'#d  K'hhO333E򔁫j+@"O WFh+hREl(FGp#E٠hXDk3ќI#a)v(B#I#+:*@3+#h ˱E@p XC2k3Sh1X3A1PS`3A/z-0V Bz%E@ QB<` L4p"F pF FBCHC 1DP{`#ugE"V 0FE@فp HC10XIhYB Fg"E@ԁ/:E7!)p1p#hKD S [h^C8vhF1F@FhBzFuHjC ^`chB7;B6@QPYF FQC2DBBp򊁫Brڦh V BgF F zWshY AEz 2kG@Ez? '*'bhBAB@cp"a +FHDIqC` +q!#IC`##3k#3ckCc##p#hO3BDjUccPQmA+hmkGhhCDb!hhjCDBZm**kB cj+HhXh@QPCQ`h , *chB:F7* vIF8ȱtIF2HS )r T R"T "X *7jhBh 9FlG(h+++# 9Fj#Fn'l QF(FGh+ #Br  [ BEs #FQF(FF  f#E803 V 02CPАBAF 0 F pE,p!a BBгk3 S1kgF2p6F Fv:@0a @2p"I TC"FLD FiCDIa`I C>-O%-FLhF(Fp& #B%-w(Dp!F(ppFO p70E$ӤDPԨK$\CBVЦK@]Q0Ah03nJk՛k35Sh0pBp" Fnc#k)գk3&ѧpO p4 p" Fn.lhS8IhhlG0##W<[hEp4  p7+`0! @uKh;O'hlG4 1 BBO3 F&4F0BqBHSOp!e[e+ Z whu T B2E 2!F(FeC'F#+rDBrv[bJ s` %Op 0Bs (`+ sO3 3.@ O 0E+ 'Opp#{Ck?8F5UhQkJ[BFL(XFhlG0DkX#j F-z ;B2]J 2)FPFtj -F ,F70>J0w`m'#d pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504R3h0FlG KFFH#0BPp"0k3t+kqYkh+rj 1h b0F#"0G(R##ihY#BpF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c2uG3H2GSFBF)F8F g 043tA#[ BB sŮp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   Xch b#"0G(9,FĖ##)F"h0GFHH*FhlG2F D ;B2D 21F F d ' hRB   o" DXchB#"0G(  05Xch+r h    b#"0G(:##ahX#BpF F#0jhkGacmam+bmkb#nbcnbcmha+?^j+?Z#mC"e"~*?RC#eMo h   [B3 DbhYC2"0G(yk3=#k9щXbh*q3  +/hhBkjGacmam+bmkb#nbcnbhah0+")FGBFu7050B#p!O0 B$Op 0B p%@#h[b##CE@p!0F F08"O0'hp3B'Op E@,F' GE$p'0Bрte;l1F.G6i1. BB10 BB*F1FhlG0cccm+?|j+?x#mC"e"~*?pC#ek`)FFGb "3ch0.!FXFlG(2!`.| Bk5UhQ-q wEEicd4@300XHhCЊk263F2Cp C`|O kCKkB k  +hB Pp"7g ^3O20`#DFF$O<RO L 5@ a382+- ` O@uOC4O @- 2D+F*F#3O3?FO0 M87h@F:hB S (IF F@? im%IF#n+#J!iOp@A icnFn+J!i@B n+J!~i@C #o+ J!riOp@E ijcoF PZfjtxpFOpFFO"FhF.2%3?KD`T 4#0VJ`k;+إhݱ1{"`3Op p(^#10K`0Kh0I*.k#:*  ,0=!F 0!F $J $I2h2"K#J#K"J "I2h2 K J K F{J I2h2KJKK JIcih#KKo''*'l'B E 5  'BX   5'B< a 5 %'B u𵭰FP"!##`TKhSTI " RIy h0:]hűhBD"; hP!D 3kjIJf" FL -H0H3AKh+9@I "TF(1=Ny3h0:YhhB D";'1h)D41$#h7'7P#o8G3h.J+DP! 3$usoѸ&Kh+6"%I퀻#MF!z+h09^hhB#`!+hDeFmX`1,2BP!J[j""0bcO}O0{',8'B '0,'Bt','B$-AF$AF,)'FO8lG!2(!F$6$"(Fe$hB/YFFG/K@QJ#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB 1BBѶ?>F7hBs!|2O2F(F}J#|1`'O6<W'-O}FFFFJFbF(hI2F b(  eI@F&ZF`F(F(F_I*F@F0ѳh+ZHIF a :E~#71 N B,ucF8#FE9 B *FAFHFiErCF*F#F k J EEIBADCEr 6Br:B F{SA,u8E9B #FAF*FHFiErCF*F#FBr hOFj EzFFؐd0%###"U#"( (F)F 0k#pGB3D0 D0pG0pG0%k#F B05hEjB %jjCX@Bl"d 0#lB C##d@, pG& L<'B##`36hhh'(pF@K@ak=`h Fp@ڼ0[`h`(F5FFBh I_ F@pFk%O5(FpD1F@( 1F:(@5CFeK@AxiFr H! F(K`8F[0+e #8#c3#dff# c`eD0`` F8 FkF# B@3hXjB jBCXD`" 8-OF1LFFcB[[EF# 9B3hXjB jBCXG"hF9FhFiFD1*F F  @B1*F hh*F-#p@B l   *FFFh-A'F:FJ TkkENkB ktڸ k V\kBuF70@;0 h TkkE^kBkt0*`p -G FFFFĕeF#0 0F ##"###":P%@3(`O0hkB-@{ ! DEz FF F -K+`00*FC!F0 G ;i h3`#[b #0C03k+УB " 0 FX$-AFkFF#FB#+i-A; 1BBM! Fй*Kh;` @3B0#0!"!F^04:F#AF0#(0C0#[ba F)F0  qBBL0'#dpFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`#[B #0(FkFh  " FF(-OFd]XF ЎK@ P^KhCKo`Oq P IF(@ȀKhu J)F `(@H! F(zIP D4sI P(EFFFF'`p kIعV +CfI(Is J <0k@08Px+П,;F F "!PFCF,$/ "!P F7/ "!P )ѝ`0DI"8"4@I`8 j;IT0s J y +?v4I "*踱! F + sTXF d] kD0`"9FL 5PE0[[  (EP#C0@ 03 0)@', '(  '65$ 0 !X0  0 0$050#D0Oc0WFF׹00s+И0l+(O "HFH+K(J"3Yi2F(FC.#KO F " 0 `J# #i?01FJ(Fz >0=0<0;0:0 #Fn2F(FBѫ  3Ѥ  L-C FFxk  FIF>  7#I"F 6 5  3 2 1  . d6 (T'EFȱ1F,#S˄0 00**+7/O0}pFL&{@!J 6 {c{#{zzcz#z#h 4G. pL-OF0z;CEx'O`.{("ЦVBVADD EjcEa`DBa~FFEB,S `` &.(J{O O `~ .gD afDBмдE(FcEDcE 6FE CCF dE(dF  O0 dE(dF.7/zy y pG;hhB4O0 pGO0pG#4 ;B2#bF#`F!1;bE),$+"h3`1,+bEO1AmAtBw  16)"*gt(؃( C +ER@   pG8(4  pG(  pG pG pG pG-G$xFF#F ʱB 4uD$G4-*8""3+ y%.= оСB v#D+F45-"(r` pGFJ y)+0@ pG pGJ# 2J] I-pCFFF!"T1FJ(FhF0 K#`0F p#(k*BO18hG,# @pG-C4 &FJFO Fx$!/)pDvEB 4,"O *FHF)* ""2i0O!-OF' &.@&r"OEsF 3)p FO3 #!Eq] BZ" 42 [F0L V  s4C9dI F!FCFHFi DEy DFeB  %F Bs:!7PQ`#%FF OoABq8F#BBt11"  O8 Fh;/ * pG BJ# )# kFJ]  kFJ ] QF pG# kFJ] [0F#hMFF3"!")F I h M0#6!Oc `0d{4T-G@4FFF)63B6KhTqD'<'B+#Jf] 0F %h"hjjCX@BѸh"BhQQ2*0 h 0hjBCX@B Ky+8 pG pGpFpuvU8B Fp@1p8Cb) F1)sKO^q2 MBBs MBs#4"8Oc@#q8@ F*I@6BFh5F&@Xl2R1JBsڣh`h" h3#h1F FlG ¹Ob"@BqZA0@@C"Bq2hO'*8@8uF8a@"(FR2 F 82F82DCFg,KOdq f`O2q F(D$K`(FO3BO9F ``0FrO?FFK@2#Os"`#cCcnO3(F21iF!P222`! F F8F Mkh =khB K!"D B021l* 8'<'BH8 ^ pG'R8h  hjCCX@B%hz0+  [bhF(F 8 -MmF cFF!" Fz+F(v!*Jv.#(F08!Oc^ I"F0(F m"!F@FR dy-GFF FF8=J!F8FJFxdx*J6K@1pJ;k##xh#(O+48khBh!FlG( 1BB 1BB8k!F h&*Fo3FGF@F غй J1F(FѹJ2FF(FJ c-OF,MF'FF!Or@FOc F 9FO4"9F  #  / k1F#ZFMTѶ1JU"[BF8Fn+Fdp@"!^U#1oU1 F ,MXFF(#ZF:FM#FBE  1Or0F@IDHFuOr#BEиy1*+Ж1+*+і1+і1+rF2FRuO  s9"HFTF%FF ) #ERBOH B )"*)")CЅ)5  B,?UB4"FFOq lFXF$"2"2 DR"xFfEL""D""$F-ACFh:K@1KfO2q %F`(FFO3CEOAF ``0FrFF?"##"CcO3 F2`1!T4#F9F(F0 Fx h+1"Bs#hjF!lGPA J#B3D2 F+#h F0G'Bpp2ddBu&aQAFFFFF-AF0y,h..Ѕ. 8b.9Ьi$Op ` Ohb7D&g'Fh`SaaaXh /hF82 Bт+h1F8acaq4FB!Fع22P+h43B(2+ѐ=F4i+?dJ``F-O$m FO!!FOcO4 F $mqI\0s@"!2Or!Fs2[1CcK@!+"  v [ 3psppqsqq6 #BES2" ^O[+FXF1F, `*F8FM(B,8F2XF`PFL6`+H6+XFH&ZCFvFFr@3E(FO )? 1pp? A 8pFXFFT@3E(FO )? 1pq?A q(FF8F*F8FM"FEBh Or0D*F1F8FMF0FtOsE]E?|O4|@dFRMKop@ AB)FFFkCK@A;  Bp"fa4+F@ @1TzFFi$MB4D5O4uhh G/ܴ Jh` qi ``B xc p'B'#d-OFFFFFΟŖ4#PH !B%1D0!uFu]eEy1.-8R-R0(K;`'8F!() &~F1FO   м FNEF61)- ؅B /@8` FRn+FB "1FPFjBr3F"+F~&O  >  мIE16.R F  B}()8O)2 O (F  2Ɓ" "B<Fi0r/?K5KGO pO  8 $("ЊDƑD N E~ π @ Ey À  OO\ ( K@Ta" Brn/?Op'BFD HSE s(93q;F)DTKF(?12k @B\ # E# 6E&0 B1E Kp"! F2EO3"\( )2*K@la@rq#D !I DBEOr ڨ/?P@K -OF FFFyFĖi#0jiBK@+0P!)JP# Fyw6CF+!K"hO3R[Er FF#FPFYF+F0FkCEE@31BFF@13h!X*FpQF#FGP@'*-GFKFFF"hO3R0ABr FFo4!*81?+ Cc"@3"BF?# F<` 03h@CF !F*F,F0FdBѮd7#`O4 FppF F@aF"CF)F2FF FF,F Fp FiFC# #&-CFFO4h,:=h ! F*FFFF*F F>x"F=`xF2 + ++ +#+;+#F!x\*33 "*с#*)p FFMHiFeC0 MCFFFRlF !F #Cѣh+"1F FB,m%(Fp-AF FFI" FCFj"! F/OcpK/FЭJ#h!J+F0F LM J  L %F#FL%F"F0FpFCBCAGF F  Ft0 FD O4 1F0X2ù! FN0ж ! p 4"-" FX"F 08F$`(F0Ѯh8O08 F8F1h2[Z`bh`eiUi F8@𖾡h!+h jhZ`jh`hh(F+h jhZ`jh`hhx(Fu-AmF FFO#xS4=-Ѹ1'I5 *F! F`!I#` mݮI7#`#,CFK *F",#h3`BF9F20 Hdlh+Юfh#+8FdFm@2FiFhCF HA FKO0 m( FiF| F@#BpFF F4Ip@,LՈJeih1hIE#!R""H0Ѯh + Юh9+I Fp2#Z`jh`#+`#jk``ci%b{h"KhI0 I Գ Fp@Ҿa Fo0Z 4=pF$ FFaF#FaB?aFB?`1bC``p+pFF FF&IO Fj#CF4!"tA.@! Fl0&"! FdB@! F\0F!F(F"h K0IQpHLc FL 4= F" F"sOsFF FB,F"K0I$Os)F2F FCF" K|0I$p 6# 68FMO5O3p10%J(F8FO3! 1CF FFCF  F0 FO4 F)-OFM FF$ݮ7#`O0 MX&XFB o YF6TFB"FiF$F&FFFF:n#`O0i$;! FhhBҲBFh2Z`bh`hs`h1F0h F*bB2F9Fh8*ihca##`i&a2c``aKh 4=FH!@P-CFP44T#qjD#SD<X#C#qCCD#hHd ԶD BB`T0+3D&0` HF(F5FIF(F/AFiL1pFSo@E+P(H#P1T1So@E+X%:#X1d1So@E+h",#h1tRu\R->p+DP#L1;L1+DP#T1;T1+DP#d1;d1(F,5x2;x2xb.ttb(F,5`2;`2`b.\\b7F# FFFF(AH1F! FD1/81@3S,B@C,𵅰Nc F]G!(FW,D - #"0DI:(8 ((<(D=H)F9(U(:JL@04H3J% N2QCS813 CA)F'J5F $J5F'  J * FD!\1)FH1xJ; x"!O0f(܂2F;F F(zIcF F%I@", ^AFH!ȹ81I,L,xO3,1( I#)s81H!FajFa!b#j3 F/ F@ ?-CFFF)xFF06#`O4j; KH F2S`h F`$ FxJ`81O2iFF:H!FtFO4#`8h(U8FiF0F xIFZFj# 'Hcjkb> > *** jF9F0F`+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH[ F#" F2+`h`Wz`v "F+FAOq0KIl#+`)h%HHsOb5&OzqF(FF?H)FC7ѭVh7+ЭRh +7H)F2W# F;F(/H5  x1h%oh 50F)F(*FO1 F=F2[`h x`FK"!5h-0Fxx Fx Fr`x1h`Zh``*Z`+j+#"(FEK:F3 F F) FFIDP F0ѭh7+ F@1h +ЭhV+ Эh+н@HH-AFFFFFFkx-٭'I7# `A%"B#j+H ;FL'>Em**F1F@0#jñ<#AF* 9FFH/)F<#0Fz9FF H$>PF**F1FA Zu-OFhFIFF(F8I"PF OI(FtH00A FZ!FBI(FdF(𷀥I(F\(g0C0 V(5:DE(F F(݀FOEKۓMOIFH FHFF 1F8FKJL8ABO-h<1FCC<1#x1h/` ":(@x1h/s<1#C<1%OV(F*F=XF DO  ;k(N("4("6(O U(KKp( x( n(CK K[CSOO FF;j +FCEۨE V#XF3(JF9F 1B!Dh{;j; +FEܨE h}V#XFt3(JF9FPF0<1#C<1O0 0լ#`  SCvЯBѹ81 FCS81[F(IF,x1?׮ : FGE Lj-V( F(@4RKC PBй PF!PFBI Ȁ0ЯBxvV%xj 5Be FG3Fx:F{Y8F> Fб"* c K Dc`> F*H> FD8ǒp1pFFcIJF(p1tAt&p@J!# h+8I. (4H$p>00H 3hx1hll1+*H"1FF>0 dh#H &Fl11F+""r#FF(C  "!,jDF IOr(Ft0Il1+?yL%h F.Ф'dt &e"FB@k&` faFBO%b3nBC #,$gG F-%FE@k'&` va,FFp FF(:33Ԁh h 0F#FC`i` h 0F#FC aa#r0k k h (F#FC0kcc h (F#FC8cp8FndD@hn? ӴoӬT#`O08$ }( -AF FFDllOD@?Ӵo ӬT#`O4 FO fF(+F2F%!S˃BB@B BXB4B("F8n#1F|F0F MipG-AFKFFF@#BѬ#`O0h,6li,:2+4Z`bh`h#`+6\`+FCOc`+i3+a`'#2F!F(F #a( _2Z`bh`##`ic``a#q0hB $ha F(ѳ`'`0LFѬ.#`O0#0h$#hB$h砊#$"# "2 `a! !`#3(n0*O3`+i q;+aеFdF.`''`kg`<`c4Foc#fp0pGpO3F Ff)F FjM F0 Хh&] O f0O0ph3-h窊)F F0F" FFFFC2F)F FVee0O0 F&$DDklB HiF 0O0 p+lS$0;>+٬L#`4Z R CB<Fx! nC,`n F@ ۺx! GFH  T0 F $ F"F#B?O`"FB?a"FB0?bc"FB8?#cf< f0 F F0O3#F!hFI0C+ٽ0ZH@H@pH@pH@`]-MF'oKO #p0p0Sr r0qp%k#in Fh#*h),2cZ`jh`0G#+`kk``cbcq0ӱh hh1 YhjQ`Yh `i`Y` `aF2h`q0"nFcn nBAF4enF@5ѣnB FT#o/U<<+ ѣmmU@ G8@5瓱+!U8<HAq[U( "# jF F m4((@( IKF H2FF4JF1F D$ $ xR]pGM FFF3F*FOahhF8F IjFF Fp` MR]pG R]pG R@]pG R]pG R$]pG R]pG R]pG Ru]pG R]pGKpG $K0 pG $-CLMOe*FF!0F>e "!#(F   *@")F8F# bCF+ ( ЫO4(#` F LM3OI2F \04T $KpG $@L  4Խ@  $8FMOcH")F^4O %%ի")F 4PV#`O08 $ x F F Fq ho F@ ޿F0O0 I" 0I" |0O0 JF O31CO31 F@ѺpF FF!"hFH "hFJ+hIjFCн0C$ B I#(hjF0O0 $p iiCjFl3 P00 pG pGF>PEV#O5`(F-٫7#"F";F"=2ѝ0>#C0<# F H >  FfF(є> *Ph F dhhpGh F odh#DFB +:*#+ ,F$p FF#/x+F" F~( "1F(Ft(:!(FpF(\"0oC !# "c;`O0p3p")FJ!Kh.F;#Z1 R4oC"# "0Fl#!c3px.+i+oC"0#! "RacO3cc O3c:+} 0 FF1$hd#`(Fe0$E ( F0i+dh-AhF FOh۱ah(FhSx+ai2 ich01i *F0F! $hh(8#` iB@hx1hpGCj@hF"!hF "hF hI#jFC$i~-OٰF F#!Orj OC F8H'8FY#0 Fr0іH8F  0[x+gF(_ 0D<1%JB(F0"HQF~++ѹHQF+$$ # #(FI(d(FJizsdD(F0#P0lcd,b(F#k`{h`d`5}`@X-AFF - i#\x!hD0#` FRzh* - -*FhF( "052i%BD!DB,D#iBdh04 5!F1QR 3B۲ 5D#0 1ARQ2"bA2^#3"bA2 ##"B##22*0FF FF(H(FI~0F H F 1h"(F1]HH F J8F G3hFZ2`@#pdkF FF x+#;`+` /!FF!" F # # "F;H!F_O0 %)F (9F0Fq@H1F/#<-8h (`n-GFFFFFj3x"+ <"+@Ѐ?6@΀0x #; #0B%ӹ0E ##p1F QF(hѫ7#`O0 (FEE1F F: E,2F;\+@sxx+m+0+[b+ +{ n *Q" kO k k k kW k k_ k k k kg#;PF.F, #, #, ##0(KhxY2 Ս0xY2 J050!,": 6#0+FxF30 سBF0{"!,( ;FF?4 6 XFxF2 + +pG+FpGPx; + +pG?FpG-OFFtF(BHO=!FX=IBF (FO $pg(FF>F[{Ϲ(F @FHF(С"HF]@$P#c``=!8FZB:F)F8F s@F FH8F }@8F6F0FF8F L( #U4JF1F D0CDZp4LFpFh% Ji#jBi% BfjUjB `j 9# 3p, `5, `5-OF1;FFF+9g 7 7q 7} 7 7 7 7 7 7 7 7 7 7v9 7% 7R 7 7 7 7 7 7 7+[n>Go 7t~ 7 7 7/   7 _ i s  7   /4'-?(FF{ *F!H([" 1](N7 Z' @# 0FwFh$h,: 4-#40C0 )-40HKhB 7!#*FFEFG #1HgO0 (!F#*F(A0#x+I F( F #1@@-0"p)F 450C#0*Fp#!EѐI!(.*ьH4T<"##Dp40C#Cc0)lQI(F#l1I(Fz#l1I(Fpй#l1)ESVZ)F8FPF(?fp H\)Fp>tT40C0K-41# 2DI(F((4# 29I(F(4 # 2.I(F(ФI(F 4 H)F'40#040CS0 m0*F #!bFFѐH"40 S#cC#040CS040#0ٻ40#c0ϻ40C30Ż-81?3vO:041F8FBFKFZ:(0BF1FKF8FZ,(֬#P4S-81?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ-==!(FX4H03I "F(FF4O0p#0)0 :F3(F0#sC0I "(FF4p:F(?$I"(FF4p:F_dhmuŒ•°¼I"(F萱I"(F`I"(F0I"(F([w4!p")F8FFH O  :FF 0 #0 RFIF0 #0F0F(? 4  82F9F[(?epJF)F]I"(F&(Bw4!.p")FF :F!U0?h0FeF(?a O( 4 82F9F(?pBF)F~tI"(F(rI"(F/?? "D##" F8FH 4+?cH9FbI "(F`H)F빷0p)FR >ӹ *F(/!(FO3 4"1\d(?ݩ7 @#  'C` *F(ȩ/!(FO3 4" 1\6(? 7 @#  'C`y-j40?oX*FpBXd40CS0Z40# C0NHʹ40C0A40#07 (BKZ_n{Û40C 040# 0 2!R0##C0# 2"@@0OR!KSP0#S0#T0KsV0Gs^0۸4#0Ը-ŀ81?̨2#4S470'O(?Rh+H)F-4$ (F$(H-<1 33S<԰H ?" F(F  Hb S`40C30o#*F!( (Or(rcrH)Fc40CC0M40#C0C40#0940C0/40#0%40C042#C#Bb2#- qHQF40#C04{t#``-к$G4{t4{t4{tXHS-hUHK$ (4(FFPH)F̿?"p F (F H FH)FpF0(FF#;:!(FFб" +oA HF FHj F1H0H=!(FF,I(F F00FFF0&HῘFF'"I(F yF(E0FGWFF(8HſI(F dFh0FFF(O7'÷h=Zmč~ĦĮI(F ,Fp0FG_FNFHzI(F F`0FGwJF9FHeI(F Fp0FGG7F&FHRI(F XGЃH)FFO dI(F GG}I(F GwTzI(F GWwI(F GtI(F GgqI(F (oI(F GlI(F GiI(F GfI(F G cI(F G@`I(F G7]I(F G' OXKBXH'w9ոTH.SѺgQH)FJPI(F \GMI(F T GGgII(F JGpFI(F BGGCI(F :G'I@I(F 2G'A=I(F *Gg:I(F "GW7I(F G)4H)F0FIF8#p/I(F Fp(FF(>@#OP'HQGW*4NXcjns|łŇŎŔśšŦ@0KŪŰŷŽlu!h1,"[$H0F +hBGkh+D  ,5EFO %h#j"`,"3 37'@F(FٹHAF$"FAF0F0!<ܪ >)`%(F к~`-?H4P7#P740CC040#3040C#C 0޼40##0Լ-?Ŭ(FF@X2+~}H)FмhX240C040##0-?(FF(#;FiI(F8WHdI(Ft cI(FpDeG.>^I0Fd0\I0F^(~uIC25o$e40Cs0b40#c0X42#CBr2#L40CS0B-?30# 0*F!C:HZ4 ,40C0"40#040C@0-??" F(F 4 H +>H)F-??" F(F 4 H +>֫ H)F޻ƙƴ 6-??" F(F 4 H +>H)F ` P-O LFF${&FOY 0^@6n.81H  (7+Ѻ HOLD'BF07(F8Otdwh-OF FFF+I&K"`Q33S,S<IzOO 810FLZF:FKHBF# ""J)F@Fh"F3(Fm22!q @A @ 2 FF # Lj'0-C$FF%FB< FDOEܱK@1>3#Y%45DY("F8FB(F %(FCE(pBDK@1<$x'-AF F)4 1+X1+bx166+]1F"8F'   $ 0g47+Y0 8g<7+Y8 @gD7+Y@ HgL7+YH ( (FA 1Y6(F & |1Y6(F s&"F0FhF(Km T"0F,6 47;470F,6<7;<70F,6D7;D70F,6L7;L7-O=FF I F(HdO 7O IU#CBbE##"-/#0O3`P7CP7gN2[BUF8(F!Fg~ F 𵏰F F"!hF"! 2F)FhFI!F:FDhFSHkoZco[9F0FHFFο8FMphg\xp8@1\F(@-GFF<"F F9F8B T <"QFF@F@FebmFj 2co[ո&I3F(FC#J#I3F(Fz9$ FhI3F(F(I3FcoIy+Fi13F(F H+F3F(F +@F@ KOq pp p@ԓ8@K@upu"F(Fg6FHF(Fgx"! F F(H@ F8ԓԪP Ko|@  AKopOq AeԲ8FH KopOq hF!F(F8FH KopOq'Cm@ h@pƸԲF FY`pBKOqpz"(FFgF"!F(FgF6cxBД90B(F!Fg F+٧#`4Y  Q@,CA@+٧#`7Y  Q@,CA@<3FRCFO4 F0@pG)F {0pF FFbV?  I*F FCphFF F&B <ñK!?/ +*ѣB x:K!$6 1B q"Z0(wz<FC{B"`)C+n-O {FAFF,@TqpGF(h3h<1Y@F;I:F F^0V08FIР(N8FFP 8FF8FF8FF-8FFp58FF8q8F%+@I3h<1ZZ FI8X<[LJJ0l)aK )FI F0進l F~I0ဖP F{I0؀rj FxI0Ѐ0F-tIF F0ŀP0soOr!Q0jI F0𮀖0+@3hO:FHI Fk0cFI:F Fd0\0FE%(F@90hi%(F@:HB:I FL0D-@𗀺0+@<0+ F.I2FQ0) F*I3!A0s F{$He#M>(F*F F0 `FF F0HO4w3%'"بع՜ n$-Vlp0I  F0T!*?}I F0-?r; 1+@Ѐ F FZxCF@ȀmHlJlI F0ᮈ 0XFF(?|mBs"FfE T FYI 220?c"YFUJ F&0WRI8F&(?OI8F(?ޮMI8F(?׮JI8F(?ЮHI8F (?ɮEI8F`DI8FP-Ѻ0>Oz>Oz=I F03hx1hW%*?6I F08F%(Fh F.I2F0? F)I3! 0-71I F50?ٮ 1ZY*/%CFHF(?Ʈ F'v؜p"19]AK8Hh8F h(FCF F8@8FFF *lKK$)Fm1F(FO40$O FJ$*O0+Zi*Кl*E1F(F0O449A8FE<#`O08 I" F4 Fn F0DBHv y FhF1AT1F:F(FAF=H F;I"8F8!F@!3H #;F&lBF,I ^a$.3i u0F0:IyJ6h(" F`0 ѧFh+I5# O#I"F1(OsBI"FF%$~ُٔ٩Fxxk$KF &F;F+Z[X#` &F *ѽB Њ 0F (ѧV#`O0@((яBѦ"#|Qjx C   B)F+* FBDPHE٦7# F#O. 9D ;B@BE٦#O [FFFD,B ",+F+##p-OF FFF  CPJF'OKE)Kͱ.ئ7#`O0D(FA>lpF7 #զb#`-k.O+pcAFPFB(]ъ o!h 0@_h 0Ao7\,  h 0Ao)/, ,%Ѧ \,OKJ`-.(FK獱.\ (p >00hp0004p5L7n-.?t>K7e8Frڌ -C,]FFFLFHuFBF(FGV0RЍIJF(F0и )F= zt0 (FGv=h(FI0,`rh#FI:F@AD(RqhI(sII(FP"F9F(F_ ,]"F9F(FiKCѦV#`O0eK@KI;FOa0Ѭ^I(F'6$O1(:xVI(F@0<)F z0 (0(;x#A)Fzx1Fp@Ly"F1hF xiFl*F(Fpy.x1h#>0B*2F!Fj(mh !FSEi!F(Fb(Ѧ`/#@ K@! 9K@!9/@ x*-AFh FFԦ^#`O0Fx+Ё)F#1x+x:D0А"! Fh FcgAFhZ#h{x+ѻyoC@ghXkkgx`eȱ h89Fh0FL9FAFx+Ц#Ix^`e(-AFxFvuE5lp2E hAFdhp29FD:xFF.8x2F!D(l2 +Dl2%O0𵯰FFF!!"8F"! "1F I V@@= ,٦7#`O4 F/ "F(Fi pG pG pGpF1NUY]  p FO0p"'I" RF3#OBOq#t0^p4#@"Oq#`0I ! #""!P0 H"! (`0 I308FQ(hC(F#h18@8-AF>pưFB ЦO6#`0FFOr!hF B "hFOCB:F1F@DBp0+hjFIOshz> *F@D+hIjFOshfiiF|`LT  ( 8A KOqKh++P@B O0XCjFlCXBXApGQ Fh scgD#Q00F F("!hF")FhFjF IB + ")F F}CXBXA 0 (i8pF"!(FT k"!~"!FI *p i:-OF<]%FAK@! Km;KO2q шK@!Ob)F8 F8#pXF1p31caso`#`1/FAHhB`hC`FXFVxsmXihC`hC `hC`hCso`oDCc`2#jC#b# 2h"! _T PXh}pXC}X`5x.1FF*FXF-c=E5DhչZоFBF; 5hY1F(FJF0W 9I  MDh B;F 5h 1F(FXo2F >F65D*"!F~0O0 <]Cj%YFbJFF(F 9I  MDO O &s-C&FF"#Fb!#6"!V0bD0F[ F/.F!F0F3F(PF!:0 ѥh +(F :SF0x+!ij"8F "8FfI:F60нX0jj(FlBAKx+++xKh0#Zx* [h#  0#Zx* [h# 5@"!")F AX0;hCI0wѥ$h+Хh1+;Ix)4"ci0Fy+F&*+;+ O1 !0F m*xF(?:(d(FZhF(Fx(?h@/"i#%iB"x+ޮ xFByy(F D)#Vx)i@i KF#!3 F8+  pG+#`$`zV#` F+ F#` F$`jV#`FF+I"O0pG-A%FF )FF"! lF(7#``1I2H``0+F/J !d+I5``0ѥ*h+`hB&IjF0 нP-ѽ0c H`hC F$' " zI`h 0I`h0AF FG(I`h0 a`( F.@ @BqBlBp@Bfh-OFFFO#`eiU`hzCF+Fh SFh3SsEF*Fh(`bi cDB.ؽBD*F h(:FQFF%hJFCQF0F`5i]D%DciaB!hC`?HF #O9!jFI$]Bgh-AFذF+)#L5FŔ x"Dhш4(O3jFO!8F,I#6$#`O0X4(O"O31F,#8F"@B0h%-O5P*P䍭 iFP @$#"@hd 0! FF@hh F@!Fv0O0! Fm0I`h0O0 B~𵺱h!NDFBD#`@@CF5{;DFVű.إ#`  `(Fmx` hB٥z"#(F#;`BhhB9`3,1-OFF *إ\#DKB ХTV#`O@F$F#F&F"FB  `+dAFF<F˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAFFDZF+2Fѥ#`cSc FFF0[8+x #pO0 FFF0E8+h #`O0 FFF0/8+h #`O0@mShYhKm#e@!nK h: nhO3#f03F$ F@ż8F0P33S< Ր>0+ D&0ke#hx1h"8vheB0YmkmBRh033S<Ք>0+ H8@ 2 pF F OqF30`X+ha K0#h+0#pOppOr0 0cSc-OFŰFFаFF3 =H O0E 5HOs: S<VOqF(d0 `ñ*/h( B " JBћh ћh`#+p(0> kpS+ *p #@hOCk q"? Fp(Os+8FcSc+ T0k`sfCQpJ.D $(DB/ /d9h0щhB2#0#0$00#$DB/{<0c3+@6##p#cp<04D</@3+8##p#cpmKS BB 4(1x23B=#;( F x2(1x3DOs@@񛀘W0: 232B́<#; "1 F 12 23D/0<1Ԙ0՘Z0 2*@"FP!cpFBF!; 2F+q(j!502BQ#`p#p\ 2 Cpa#p#qlPF /S((=6p(1"Zp(1  +h(\0>`6p (p**(1Zp(> 0>! A}jF*@#w FHHHO0$:N]p# `FFi0/H.KBBABF!Ѥ&h+&Hi '8F ] i H"F(hBC!F(FJ  (h<1E[ 5# #F 0P F0`H"FX o8#cFHxhiF4F Fp*F!F#sU,FF-OɰFFRF\I8FF(m(hZF1FF(uТO   PF6F@OHHFIO6OrKFQFHF,  6#2FIF(h[F 5 4#2F[FFU 0# p,0+FкF xܠS @#0JOqXF,H ;F*F @F0ihHzF(HIO$H ';F*FJ @F{ FNh0tHI;F*F`@FdVF NH I;F*F`@-GF"M FFUtb FO, ,6x2B$%B&F, ѽH V,XB3BѱFV ,Y,HFHFy5,6#T ,5T,HF0Fh*-CFFؤ#`% FB1F w.0 B O #DBҤj"#1F w0O0*O!FJFLDVH& ICFF0F0T HIF0F0*pFmؤ,#` $ xV+ѳ(ьhHIF(F^0.)F wJ3F@A0O0 mp I(F{0#` w0>" 31]aS0[#hf +D(8D 0-O F+Ph@`_0Ֆo0ZFIF(h#7FK ZFIF(hy#+F(ЕK+Aؤ#`T0@$P0RZFIF(h# F(GC "E=(F@F(V; * % 8 9F(4$B66V<0h0  gHV#Or@! lYI ZFPF0*0?)SJ@#@! ,OI ZFPF0o66#60W,<&P @<0g4bE9ј)FFh0ZFQFc3K,  hW,<}+*0h!F6QFS0ZF$K  h  ,71hB2,63h PB)F hmh0ZFQF Kc  h_7,6Nq_@ ǁ8FP5 F-#d8p"$IF CF&#2FOq0 FO4 Fp"! F0OBOq F0# 0D# 0 +h" F 00FhFP<12:033S<C/iCiii iBղ$ Fhn0CF(fH F@8" K0I @ 9-O&@Fh$ hdciciai#bhca#ifa8# IF(F AZ<$`jGFZF1FFHO3#cKd<1@񜀙I(Fd!OsC `jG1FFHtO3#cK@0 Kd#kZ `j 3Gn1FFH]+؅H"1Fq##ckj :g{' {{zck#k:{{ z#h+;cn+8`jhB4єh00G6#k1FFlHB iH:1Fg{' {{*z+kB#k1F_H:{{* z`jG#k1FFSH^li+NДh Iaii iBBk+?#h+`5 h#F"1Fh0 $7S : h1FK21 r G1FF H F@sHC1FJJ 8 PFHhH# F3d8@J!. 8FP+h;+h#F J!hjGF FH# F+` # Fd8@8 J! PFN9FP/k*k`9F hJ#!+`#FV#c Fd032"b!2@ J! uFP`6h# 3F F(E1H #h<1V-I Fd@F6 F2F9FpX#h<12 !H@ܹ9F F]!2F9F 2F9F(a FM@K@! PX  #hf+` (ah FQ F#$ F@W !h0Ch0"2-CF` F hhiBrjBX0F(h3Y {̀GFIFF&Hn hi3і@0 F)F" FF!%H#F"!kI FdN##C"#[ [C#h!s(F h"!K% 0Fh<12>#F!*Phih" F# F+`#U F[ 0iZ#+`i FQG FH F 0@ù8F0P3 FBFȹ H~I Fd8@ (aH F8@ 28W8 PF HT Flh0 FCh0#d8@J! -GFp7X<@hN#33C|23 FF|ѹHG:"K0ѱI{`,81 23ѭI" %0(F0ѧH G@ &qJdhfX6(FG7v2C(FG޽33CE (Fh a+;i2F(F8fhFHEXq1C+@$#i(F1F&#@0ci1F((FCFPFZ`a(JhRF#i!ffah0Ch0(h@h0KE@X<#k3(hiTF(@ۀ} ?? "k `rEvQH h#3cbFHXS#cck Dcck Dc 0KE@0@,#h+p##`7dX<C (F~8/H GXl?v3C `jF F#H0+ch+`0KEb`jF FH(F(h+F2F!cX<2C%Д@ K(h !(FGa> A0JXu cSc(hK+iHEX<Fa#3h+Q(FG y8 0FP33S<Hph0Ch0# Fd8@H| FI hi=@Ա"h±1 rdnDhB"I]K]KpG-OF#FjFPF+@ 9 S<r3C3x+@jmshBCF:F1F F'O> **(7 cE85# 2F h;F%0;#0 @0"Fx;33FII e" ^"\" B2BF FHQ#Rh B3S<ՓH 'OW+h+яI3F"Fx '+ыI3F"Fx#O L  pB:F h1F@|I3F"Fx O3+ѹQњ60Y6#2F h;F0oI3F"Fx3FlI"F x1F h:FzF@F eH+0F+h +#h<1_I Fk hi h!ZK*m!+m##+e'[<+<##F  0B"1F:F h06+7#3+њ0l#2F h;FM@*h*@@ ѹ@O !2J0 #:F1F hP#(-I3F"Fx#B<0F FH'O f# m3EVs-AFBBBF hF "FAF Ho O . ((F""DA-OF FFF=B AI +F O-! F*Fb-bٔ@+\cz+YѴUEUO.OBK T(F½ *>2DB;ӽ D*7h1F F"0/T(½ 2h P"iP" ʃ !F)FXFXF. F HU !DkFHFCp)`]F FmI 3h#`hBBiF FUAF3hK I z (Fb ]phiF(F7`.m,6-OFFY ; F Fx1Fh B0ӱh±[mSEє> **XFXH IFCF:F)F Fdh_-A"hh}F AHuh- xhF *FAF H0+1h;*FAm+1h;*FA-G!]O0 eFdO RFFZ`!RF` p L "a`"Z`$`"E`IBFoa0n "FC HC !] |dh`0Fw FFh F!7FP50d000>3)S,&B"C,"* *S,BRB"C,SDBC,a C F0@~)B"BbO`z  F Hgjz R0;~ hK*F!0Dz 8FP#Fh!JEh0+ h!8@H8 -GFMi@̱!h(cnB  gHZ(F#(FdIcf(F0F(ѳiZY)h˱ihBFH FWH033S<w/(FE+hN#3C bjhBєh#(Fffh03 *0r"#h ++(F(F%033S<s;C(F(&Cici acia+?}kj$'O F/'BD  Bbi0i2Fx)њ2@*١ #`7/ K!(hdrl(F$IYx1 Dpq pGB F*pF١#`O0p&F`!=dB*F"@rBU0F( @CO `@@O o pGO@pGHpGXhHh hBhhBhJIpGh@Bhx1h F" F(dhx1h F h[h hhb@h"Bhx1h F h[h hib@h"BhHh0+@n8 pG pG@ 2O0 ciPiӱ(Дhh *ñ( J0B O0( *XBXAFcScx1-GhFO   3#jpbj юI`*F)F0F`F(@ـdhh0{nCKOq :I`{nh FmF znoCg2@O{nhG#)F90"F00`@("F00`4F(Ycj%00 F(F(#yn81 ynX1)F FDF"F`F(?e)F`>oxXyn\Cgh01BoCg)F0F`B+(F8t( hF(?b")F!FHFIF|S")F}!F0Fkx+ (FG8 PFAFF0F`FxBQF8F8< $B")F+  ЙB"9F՜􆑹hBC,PF<"^ F=Hm F]F(?Co<CCgEiFO3=iF8#6 F{dg11X*"!0F`.FHIF0F`pIFME9F0F"!`F(9F`ZYА0`j3S,ՑhBC,PF<" FH#c\pF@,K@! yAi 'H 1)F CFѡh1+Сh+Сh+ Сh+iiJ 1(ki hܱhhB#hhhBaiPah{Y`bh F`n5knB#h0kf0FpQ`F5(8F@L FF H F8#0W-GFFFFF8AHx$ F10 hHh;hhB!b F"9F(FF(P4 F(;hEa`#a#a 0`0#a8hE $J!F PFlkjM /FE;FRFIF!F 0ѡ h+ < i Fi#i##`shc``t`{qF@ai9032 SPORBBДh0;`n(h!zl(F,&0F(h!n$"gn1FNرhjBijB  #He1F"(F9FH k(1F(F#k, (h+п0"Xfh ?hcjBF8F|#!h0ff(h#h+ѡl(F(hJ0 hpGiBa-O FFFFJx0N#`F(F>#"AF8F-F-(2hhB!*YQ`ch`3h+JѹK0#ai#a0;3!F(FeF- FO4 F(HO Ga`2h`"a` B``3h`E J!F0h  hBѰ0-GFh O Աi'h.hx! RF4CF0F=&cKh/ZF'I="(Fp(OFxF3*:*O2pF  , \4IF3[F(F F(ŀCXFt@F)/FO`F(c#((FO7(#"XF# 'FF,FE) ObXF"XF8+SС6h(F0`j"O ^#  F; +/O<'/@ـ:+@ۀLF;BY(Fad(F+?/XF*F'O FCDF#O; O"p+x+#+X(F(4;F^(5F:#'=Fx3:*2 KD<:+:# 0  B0@F De)F @F9XF|o/z #`'P 8DDDFB 1F(F=JFPFD EFXFL aK`B(F(FyF`{ox:+?LO \+?B + +?'## FO38]Lh#` a``a'P-GmaL#F3`F#i!ahcx'#h+6Тh*3"`2ho' e'F;/*lh1FYF(@h(@ яL`/p\#iFIh@`(O0 mh1FYvFйh(Ѓ@я*#i`"a]h(F2I(F`(2hD|2h*gaxDE1@:(#(ai1<\+#ca,\*"ba:*#*pkp3hoF+"HFpO3BFxF+=h\*?o+g2hD|a|*:*+'P 8F F)F F8@'-AF="F(d (@𫀠$ #`o F^+cx:++4 pwN(Fd(k(F\+4cx:+l+jУ0*"E04F;0ӲT+4F3A+٣B*V" Y q  m i        u    y  U ##bֲ.ّ ##:# # #FOd F#xA:++pO4p(F(?x8`ZFOd O4SF="6Fd >Fd#/A:*в+O4p(F8`N #`o F;p L(Fd(FFd#FO4pF#"Xx0+CxX+00$$8"0޲ .١a+ءWB 2 $A+ء7 *`pO0#L`h#`t I```8 'h-AFBLFF#h[JxbhOa>Htt0 ##`  !@F@`hCh;C`+ڏ (0hZ`x +-IhFs(-&1F(&IhFs$I,hFs( "sb(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+'h'#'pK[h;"FFg(HJ( 'h'F>K8G'h 8%L`h%`e`8'hF" "F! 2K87F ,H'h'8+FO*` Ȅ ,`8 F !F" K87F ,H'h'-OFFFFȿ`O̿OO8m0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-CFPOF(FF;hCzhHF s0 #;`  !HF쐹xhCh;C`+ڏl (0hZ`x +0"! F7IhFs `-&1F(1IhFst/I``hFsn( "s(x+Ѡ`E$IhFsZ( "s(x+`hFIsHa(IhFsB(IhFs:(IhFs4a( IhFs, b(?y IhFs$`b(?q:!b(j q'&)#L`h#`s IB``8 '+ K[h L"OcFF0.80( ''F KFFF[h["+FFFgH %`(  `'FK8D' 8%L`h%`e`8'-AF FFF #F*F! gK84F P @'JOc0] '-AF FFFF #F)F" gK84F P @'JOc0] '8@P@@@ @@0pG-A4F N# u(F !T'F09+F% +O8F@hhpGHiSipGpG-O FFAFG@?F@D&WKOz hZhFAFDCA9FCD QӢB ӴOغ_=#cC ?XFiFFF'FFFF9FF 0F1FF (F)FF Fz!F@F ~O30F FA Cc"BFܱB)F0Ѡ@"h]KhKGKz #F0 <K'-AFNh3б3i( 3iwi@FB8GD8FB` TF0 i"FD$!FF(D'8? M$?i*j#DBiDa8 F( '-CYM$0+WLWK&hXFFGTK&hA"+GQK&%p 3(zF/rF(9F&hUG*) ;F73(;F?:F'?&h9F?8FGjiF&hc F3#FnGiF &hT#FuG(kiF&hG#FGhkiF&h:#FGhiiF&h-FFG`hiF%h!FG$hFFG' <niFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OIMD+lD(#XC00F(tCI0^.h$4 FO ,@kBO( O k ( B%O( O D+l ( DB/@FHF-II^ 1F04 ( F 4"I^k+k 01F4F30F 4I^sik 0F"D4@1FzF Kh KFG+z kl'HX <p$NjulB(hpU$0RE$4'K[lhpG'-OMLHP-@"#!O NF#,#;`;FUM0#bR(3a `O3dHObpC#T 8?+@  џ$0oHlM!&h2@feB`F`c@clc#c:"dZe@Yjh#e@iY!a#af"fca1)B!f2f@c`'0C#QH "9F3`hNI&NH^ "JIg`JH^ Ej`{F`d(@ M@H^jF (?z`tPqA9*%,9BMoz")0?Fhw~&rK##rH&`E#&0A%`>#%0:lkh2B5;k`1kh+?.3$`(#$0$h+!;`lh:B3' < ]'P'hh+;`lh:B3'`#'0(`#(0)`#)0*`#*0;p~p< K:FGj1F(`(?7#H0 2KH0h pG'K h pG'F2LFoB40B0 0BѪBpB0BhBр`"1F(F'6BF(`ciaH^ciD1F(F0џ @"iFh]KhKjFG#z ciBF(ci`aH@''h <K-GF9OFF=il @#i@"#aO3D  0 0&0"nB 030Da`{nBO jHiDaVaciiB !F@F^i!F@Fca^ziB#ia{h!F0^&0K,yi#,@yi FG'0$BKlD0v44'KpiB lC@.j& DBЛ@ DhXipi@l^ri'Jpil  @@@"iuBeO4 D0Da bTiDap2'-AF_O:iB lh@% DB{Х@Dh!BFZ! FB2{j2Ѹ%FKD1@*iC !P+a@i Caki3kaiB-:hB##;`i)F0FAO1K#13 ,KO42CCX AF+8)F^+9hB=`BKi+8^`8)FAP@*FZ!*F!Fl^FFl^n%0#"iZ!h0@#`'@-AFki+;!F(F5ji:jaF+fЖ%)oBF!F~F\ #B7J Ӱm;hD!(D(#t04Fh F*kO4DD< "FHF^F(FHF^%`i8FF`#O0!jBi3 O1!E# #+aika3B `#FiD!AFF* *BF' <O;iC 6FH FUF80`3`%(F1Fl^n%)"F!(F*0+"F'KF[hBb!F@@'FNH(0+%(FF)@TKhK:qFG8 #`'0C H "#5> Fp' <-O FF(@8N-ؖ)0+KhK1FG/(0+@ 'DkBGEȀ4hE٥B shE AFF~ѵi%" B,##𤀫EqhKBxl%!FFF(1i < l Ѫ@3E cBD@HF2ZK%*F!2C66   * E  "HFGK HFl$F3*0+*FPF$:K'0K;H "#7` F tiE(F_3iEK(DDFH FF0P+` K)0óKhKN1F 9 Ѥ  D )FH]% BF^*0+?BFF$FF $' <'P𵅰FFn0N(V=FeCі(0,9/7Ж)@,J)Kh|(K1FGjDo+9F(FBshB)F_F(*F! '0CH "#5 F%(FF(Ж%)oB0B*F%v #`' <-OF0 F(0^%'0C "H td(F $/ր8F0BF_\ B0ҐB FD (0FO38Z (O33BI!FF(𦀴B"F9F8F 40BؐBӘBVKXhbs"#@@B #B*0 B=F!NPBo cBS@  ј%0+дB28Z!7 )|0B0B!  J2H]FF/H]`0q" 8FSFCF&HIF] FF@0B?~2F~ IFH]|%0[B Ҫ(Z!-! *0+дB٢! h)P} Kh$ KlqFG FFZ #` <'P'F K'0CH "#3R, F@8'޹pGpGpGHpG LHpG LK0h3pG K0h3pG K0h3ppG K0h3pG K0h3pG K0h3pG K0h3pG K0h3`pG K0h3 pG K0h3@pG K0h3pG K0h3ppG 9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpG ¹ghF;+`ڌiB (]KB h\ `p]KpGipFN$V4(Fb Fp4 , pK +K[hG pGpF0 S pG0pG(h9!HBpGXK0h30o O0 pG @FFR;BpGFpG#BQ#@@#@3K0h3pG K0h3pG 7Fx M+=h'I+F"FH0L%F"% x!(9 xH+ pG pGHpG KF33(FFpG<;+A,A 3۲, 2ҲBГBO0 B+F-OhF:VF,FF:V1OSK@ --+hC@`.@TMF;F$s4,Of@ 1F_-F`"`=F`3J=+hCV`.TF&"!hFf ihB \( I"^BFA "FiFPF&DD-A&K ` E.-$`O0"KFXhB+6`3.-$++$07bl8FJE(JFfl{$`/?yEv #`.i`#^CYak(HKhBKhS HpGr0 KhBKhS HpG  (pGpG pG F H I FpzHPh IFHI q@H xR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBО#` I)F`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: ( '|FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00Zp]h;iP!0xCC@! pGh`K3pG'|8FCi FB "iPF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:D#iQUiFFAi)DlXi#iZi+Da8FF FFFhi.ݶ##/ݷ!! D+>n{9Fa2+FROA F;F" FiOA FR2i)F FR"OA F&i" F9"OA F@V+FrOA F?ZiOA FR i)F FR"OA Fi" F9"OA Fi2F F`&Fz2OAR+F F+iOAR)F FL>?Fe)F FD>F^ F!@F(N FF3h+#OsB3#@\ CTkCK52hh*"Or30B#@b\CcTK2hh*"Or30B#@b\CcTj"j1Pp 8F !@[jbZb P  -AF`2FBSBLB Tx], O ,0xF+`!(F+ "F1F@FV8@FXB8y7! 1BFZB "`xh #`KZc`x[)Yx.)3`2Bӣh #`K3YBx.*Zx]*3#`'|JKh20')`) pG pG -AFZSBF FSA'0ip0iF FG2BҔtu(J)8YB;x\*GZx|*D0iF FGhKiBѣh #`t0+ZДu!bh#hpB5 bE1ٓ\,ѓ|'31#`x|*xBoiF FG3)YBxB[xBBғ|3Q)ѝɱB! F6+  FiR"iOA FDc Fi DOA3OAi F*i FSRi"OA F3@'|pFN$V4)F64 p , )KS<GFpGF)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6  -OFhBh'kB"I(FFPOA F#h3#`"I(FFO A#j@"hh1PZ( ! FOD#j@"h`i`!(F#jiD#c2Bx^)3!B#`c x]*3)F F#`t-*nNB x]*HB@-*@Kx]+@ `)F FW2B@h+\K3=1!`Bأh #`1Ff x-+]+ѣh #`1Ff FcEFҙ 320 ԩ ! F2Bȁh #`fh #`f#`JF   O F(F FQF)F F  0+#OsBij"(j1O !kj(bZjb 1!`Bأh #`1Ff x-+]+ѣh #`f=! F)FF F2BJh #`fh+#ho'|  x-*@*ZB@&Yx])""`-( F FEKh*7Eݢh "`fh*"OrJEEZF)F F  UK3#`E߮ik"(k1O !kk(c #3kcQFHF(ݣh #`yK3O YFHF( QFXF()F F  ѣZ"`x]+h+Qk;#jiBkxCkp|OFF0+"OrE5.j+ckk+`kj+]k+Zѫjp{U9F F#jjg+(k'@>(j#7D@"!(FB "jh;`#`i+#OsE O\ AkX@PkQF(Fñs(6WF6.K  (Fh3c(*K(Fh3Z#jO@Q FhOA-* ! F[*Jx:*?"=*? F1BFҮJF)F F[YBx=*Zx]* YB:x:*6Zx]*23#` '| j FpFi(KI h1!I h10Be F#`]#0#0 c` =e pIOQ F p@Ź h-A^`Fxi\-[-zChBӃh #`Nf`s#`2x@)BuB@&!O*-.-MУh+@#hՠo( FL}-ܵ"ڵXt<+|Т0O`Q F2FiXXt, F12FOA F[#j"Zd""OA FK@{B ! F(ji;` C`_Kh0BF*)H"`;FiOA F2jiOA FiOA F2;FZiOA F O Q"O Ah #`=K3! F i+?Wh #`5K3N!B\\)ZZx{*W3 F#`1BF0x,*-Z"`B+(J[xh320Z# FBFݢh "`J"*F9F F<2B"YBx\) Yx})3#`+FOs#`B3B\)x}) ! Fj~h+ #`$XBXAt'|^ ] ڮ"jOA Fl^d .2Fb^2B YBx\*[x)+)"\! Ff .OA Fid2F?2B>YB:x\*6Zx)*23#`h^`Fxi?) ء$ڲ * +#^)׀ [) \) h+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! F .OA Fid2F2Bӣh+~ЈK3Z"`x)+ 2Bx*.?){)^B |NZx6hW6`v,*Уh #`tKc`3#`0h #`oK3?)ހi*)+FOA F@iOA FRkiOA+F2 FRiOAR F[1BXx*(?*{*NZBJPJ[xh320[A ! F;#`}! F"OQ-#j jBbZj2Zbs"OQ#jjBbj2bd !ji Gh` C`1KlgPO Q FJaGChBӃh #`$Nf`s#`1x<) >) РoX F/"OA"O A!iOARpi+FOA F2RiOA FRi)F FR"OA Fi" F9"OAJ'| ^ ] F2BF(x,*%Z"`J[xh320Z FBFݢh "`I2F)F F2B x})3#`3FOs#`BF x3}) ! FAh+ #` '|+-OFFFN ІhBGvL F KB #FHF&!V%0( F)FP" 7D(u^O&a H)FI+FH%KuPO5"" " R""tpOahF!+Da`#B #~K32BJ"OahF"KaaaO``@ #qK3c`@chIFMFF OF0XFPkxB@_->ز_!زo𖀲_kB)GFc#k!cO1ZhFx*F)FhF_tв _kB@)c#kGF D)F#c)1OزOزOуFOOвOOI;زOFXF&xFhxBO7вO4вO#jC#bk-@怹@!@&`c(r!(FF({Ѡc`k(΀#cc0O pF OвOnkB+)GFc#k!c[)F#co$kEO3#c8Oв@OUUT Eu 9S H 9)'|-F5F{))DGF!c%s))D_hIbcW+xF_+B%u#CUAFrC_Bjk@!0;|!(Fc0F%zk;9FBA?3+F*F<WB9`:`B2V# B+ "F,0Bj \E;bFP#B@#@# V#09h3EGGB7ӝB0F*@ehFF5UxAO.бO-бo#jC#bME##`#ld @0Oe#0#j[ #K3PFOBV" k+?3B8F; * '|F)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6  8FK Fh+) \k AX@8k˱ K4(Fh3(K(Fh3y8 8@q  -OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𲁱O𴁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5_,9a  +a*ѝШb~ -OFFFFB0F;hO YhQ% xCOгO]гO FOrس@_Qس_г _|4F&FUF"xHOD JFO +F1F8F9JFSFFF8F.E[b#xCDQ(0xBO JFO+F1F8FJFSFFF8F EbbFOJFO +F1F8FJFSFFF8FE*bOiгOгOѹh"xBh PS`t5"F1F8F+F(?v+F"F1FkF%"F1F8FBF2FYF8F(WF:hk=ORhR "xBD"F1F8FXB:hiRhR!P%xE DR% xBO=h"xBh-OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𲁱O𴁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5Fi+kh  h  EJj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DF<7#k+E8F' RFYF(瀸cl+? ' RFF(83HFF |D [\#0R B,?qEO[FSEF8x3 xBkB8F @ (ѺE~2Fzcl+B H l0 (?N 0l#B\ blcC\ ZFعFYEh 2 F([Fw (и?{ ¸OqOr#?h $@E( 6  =F(EL3lX#3 ZFu+0( >F'& &&pGpG pG | pGpG pGpG8#MF`+x %`8Oq(FWL( '7FM+xD 0(%`'Fhx[@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!H||HH' (  pG pG$P0/ 2#0/O-,M@PPpT`X0$p`T0*$0S$00e 0Z 0000\00 00S Q^A 3 # Z20# TP@PY*   T0 B2@TPT00#03R0S0 YR00J 0S1\0S# 0, Q 0S Y0Sr 00C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S  S0#3RQ  PR# 0 B0 0Y00S  000C 0S00 0S  AX 00S 00J 0S 0 SEH S0" 0{0 C R9SB0 S H$0 0CR20% L qM1000S 0!03S 00C 0t0 S 0 0K P  $@$0S$0C[0SW  00,Ѝ 00R3ZB\\00S SC @PTP>: 0; , $ 10eP@-QM@00(,4`  P"U `A0``o0# "0S o.,^U-00ĵЍpFW`&,- M zЍp@-QM@00(,  P"U` `A0``o0# "0S o.,^UU-00ĵЍpFW`& O-M0p`@0W PV P'Z P2Y PyX PV P:$ P BQWr  S JM+;  8"` `P!0 P3 P0 p+ 0p 2dp@ dp@   p@@@d;d d5d3d 0P,dP`Ѝ'd00@ŸO- 1M MP (@`PD0"$\"Ġ "( p -FDphp^ ;@D@ 0h@u 0Ss pءp 1 0` 0 0`00p@, -0)@t0p )0? $P"P 0S Rc001ݍ Ѝc0S 0F\ R Pp @`0!@DD4 [@ 0 0L 0V   0* 0p,R gH1ݍ Ѝp\0@-M 0P Jp Gp@ Pb ! Ѝ00 0YЍ0@A-@@0s- PP0P0 p` `}`;0`07cpp0X`p -c``$0`0!c 00 thp@-@PCM1 /PSP3 @@pP@ ` @c00t1 5 @0F F 0 P@@W0S VS00 SCލpt@@0Sb@\00P@0  P@1:b?00@b00p@-MQM@P4SZ TF /RPC QP0s+ ]P Qa0P `MpP @0@ RXpqG D p? ۍЍp/0si/%@@d00p +MOb@0P@0  P@1:db?00@p 04Wb0#S6p@ Nb00Jb@Gb@,@-tP`O-$(pX,1R`P@.Wz00Sg [0 0GQ:%"K Y2$> 4"0x""2"2BS"2"2@0*sW00Sd [0 0F Q :!; B@T"#.P@P@Pt00{ Qu w{a F Q :%"; Y# [0 0FQ:u' 00{S( w{T n 0FQ: %": B@T#P@P@P[0 0mF Q :Kz'Pw{ 0]FQv: )JP- -MR= =O0j2 T$> Pw{M >F Q W:5# B""""BR"2"2@0K"20S$. 0 0P@a= =MS= =O0M8 """""""@-DM@ P- j jBp S 0q!S1p!R 0SGW= $X87P.Q  `OT dႁ$.0C 3S 00 F  P -IAF P?PUP00W%` W P$0SP Ѝ\q Z`F*0I 1@0S, R!0p1 S 0@ St00(lx0p|`)t0l| 0x00ppD < `0 8W  PQ0 =Sa 1 .RX, 0^ 0Y*@<P`01P=D qR !pP8Wt00(lpx0|@t0lp 0x0|@0pP SA00p1S) 0Y 1:t00(lpx0|`t0lp 0x0| 0p $`0\8WPQ=2S Lp  ,0\0J <Q0E 0 =S,00?,0@D\00X h0 ` 000 F< $XpP#Sp F"x  SQF#0 SF Q\0sF & 0 Q0* ^* V r0sP T 8<0 $0 h0  0S 000000 00 0$ RQP0"2"2BS"2"2@0: 20S Ό00"x0$00$00S <P X \  LRHL@D0hp0 SAP  $ha `&0P 0 v> 0d0?`000T0?P00<0?800D0?@00L0?H0?X0\ 00 09,00,05L0P dSl0 F&00FFF 0 ` (00(0$0S'"xF0000 V  F!0 !0 0S(0S @2/0 S *c0 0,U\H040"0000),"L8 !Ό, #:<E06\S00R 0Ϡ">! 0# 0c 2<0S400<0 00,S4 8 0#"0 0"!/C1 ͌ 0 0, ^<00S4  #$02t rt p p | 0  SB  0 & F%i F SQy#\!F SQlF# &M$0S00(0,00_0<P Z =RUH0LL^X\ P,0h@000D0. 0)'$0S="x(0S  R $ R 'Q !:6\HS Q00P$0/! > 0E<4 L , 0<0$2#0 0D 80@00,!ςC!, \0 R0.*,&R 0 04.>Â0!2c,0\<8,"΃0,!/#148448 000S,  %7 T00sssrl|rqHppo 2/00 S *Q00 <S$0 h0000c0,T)L80E(\/H^0402,!><000#:6S00P0 >!0<000\H8) 0L#:6^S00R0">! 0# 0%!E!2c 8Q, \?H/)L0 0 ́/0,0S400#0S >!, 00 4  .1@0HL  h00 000, C00 00S \< 0 h0 CQ0 D00@ h0 C0000S \ 00$0h0+;  +; cqp;0 = =MS= =O0 O-M@p4:Yk`005Y0T0 W( <000/L 0PP   0P@v>P 0d0?`000T0?P0 00p4 <0?800:K<[01:0+2;4 04`000  000V :0x0PO 0TP dP@ PA 4`P0S R~ R z R v 0 0H 0S0`d@?@$ #@TET0}N0`d@00X0v^D PEDpl@ C 0'0@`PVv x0S BXpt000@H0D@0 x0@0P 6 ?O 2 0SYl  0!" 0#/!!  . /J㩐 B 0S!0(0S00#0S>0 Av.@ B Q P S000S Q0W00yq  0Apq ` VP@0 ?oR20SW00 ߍ 0W0x09 0 {q@< Q"000X@0NS- x0 P0,P]000 p0  ZR 0pS 00@ |W0 0x`sW0S 0 0W0ZS0  `xd ?TxP0 ?<x80 ?Dx@0 ?LxH04p\XVZP Op,WT00)W0S(@T"W0S@ 1)P L@(㏂@"bX02':"  @b"R0 \TP'hLPP00& @ @ ߍdT0/ 0%)$B@C "!!b0C0/,Y0U @p0'"0 S;A^ <0 Fhpq6  @8@Կ^V#00V0Sp @*x00@ pW@' W!Wʬ 0qV 0 Q  sPcVT00`V0S_ @0'"TV00S< 0 "2#@TÿGVT00Hy@-@ aBpT%L00P 0 0R/P/ /ee  DP 0 H Sp@-`P P 0@ #  TQp Pp/deeH  P/j.0 0# /P/x000@-PP Lo>O@ 0" P0 0tA-@P @`pP0% P @PPA-`X@@P jNpP0& P @PPԈA-`X@@DP H@pP0& P @PPO- M` pP9 `젟$ nPP P oN & P @P0S  Ѝ{ ,/@ W N y;0p0SbӀA-PpQ `@Q OP@D 0DB(000S  Hk@- M`ppPP) T  E00S@ T0"S# 0p000S0 07/ ЍT0"S1Ds`0pX000S @ Ѝ1Ds( 7ͬk@Hj@-@ @nO-MP@`U  PP2SePS PW Pp B ` Ta@` L`P) 0nS: P= DP 00Q Q P  IPB"0 S 000lP Ѝt0 0 0S Ѝ0oSP  iLhO-BMM@pT0d `0 05KP:NDPP  8(KPq00MP C JP@P`!  0PPEp 0P0  0PP7p t@P% 0z40D0 t0 dQ`k`V`pP  'pu ᾿0 NP~ @PP0 PpL t⺛P YP S 00BލЍP/U ` P op8S0SL  >P >0 PPHp=  w>hSX 0 0>PH! 0 q0 0USX 0 0>K0P`HS  x 0 00W;JU00)/S 0 0c>P%Sh0 P0@   W>xS@ 0 0N>Pohhth0gfeeXe(d-M 0  NPЍ -M 0  8PЍ >-M  0  "PЍ ?-M00 0 BPЍc--( 0P    0/ 00p@-P=U@pR,0,? 0`0  6/plcPp@-P=U@pR000? 0`40  6/p b@-@P 000l3/ϴb@-]@P 000l3/pbTp@-PU?o@20Sp 0 003/ap@-P`UV00P00@Sp$ 0P5/Πap@-PU?o@20Sp 0 003/<a p@-`P@PpQ000 00@p@/`p@-P @P p$0 00B3/p͔`x-@- M  lp@,0(00G3/ Ѝ@ Ѝ/<` @-lp@ 000G3/_G-`-P@ M 0 0vF0Sp ЍQ80 00MP@:/P_0G-`-P@ M 0 00Sp ЍfQ80 00aP@:/ˠ^@20!P (///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ /////` `(`` _________|_l_\_L_<_,__ ^^^^^^^^^|^l^\^L^<^,^^ @-@$ MP05A05#05!0%0%P$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 C$ R*0#$00S$0 537 $05, 00 $0(0!PpO-DM0fXp0  0 R 0 a  < R Ro:#5B$0P$0 @X Q< `@@ QQ3 Q0 S0A1@ 8,0Q i S40 5,37,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P \ S 5>37 ,05 5Q0,0S 0 CQ * 0C,Q*0#  ,0 0,0S 537,05 50,0S 57,05 50,0SER0#0C R800C 2x:#5B$0pS 5<37,058`0,0 ?R0@SKO 00,0S 5#37 5,050,0 QS 57,05 50,0S R0#0C R00CP,@DЍQ~ P`0 pFQ)Q* AR  bQZ fQ ?R0@SP  b@S; B88 C#, 0c0#80 S ,0 S40 5,37 5,050,0FQ0 0 ,0R S5 7 ,050,0 5RS@fp 5=37 ,05 0,0 0_t`0GuP L0D  pp Ѝ@0S 0D  p pM0S Ѝ贠 M0S(D 0@pD 0@ ppM0SM00M00TTlTXT (@- @MЍЅO-EM MpX@`PFp+8 0P0P@'T 0 $P@0PT 0 Q` 8 8VEލ ЍM00Eލ ЍyM00S(@- @M`p PHP+ /O R rR  P   0@ P @iЍP  rR 0rSX 0 @, T0 Ѝ@y3M 0 R(QQ\A-`@#p 0P/S /pOP @0p S 0 S a3  Lp@-IMM@`PP 5p 0: S \0 040rp IލЍpLO00@IލЍpL00Pp@-IMM@`PP  p 0: S \0 080Fp IލЍpLO00@IލЍpL00OX-M 0  PЍ P 80Q 0 08080//p@-@P P`P v PP u W>P  p@*PPp-404-0 M  0 ЍЍ/t,P --M  Ѝ Ѝ// -@-MRO<@@P 00  0Ѝ@Ѝ/,0-@- M@`OP  Ѝ@Ѝ/O-`Pq,Mp;  RP$  Ppp @P$PX P@ @ 0 PX  O!,Ѝ000:Q!0P00,ЍL8p@-(M0P `& (Ѝp0 0 ,p@-@`PNpp p@808 0p@-(M0P `& (Ѝp,Hp@-P@0 @  0`Npp p@nX,0@-,MP@Np  &8 ^,Ѝ0Xp@-PP0 (M@ 0`Np  & F(Ѝp,C-PP@,M@/ `  p`FV`R V `@0@ nT oN] ,Ѝ00 0:200,ЍX8p@-(M0P `4& (Ѝp0 0 4,p@-@`P>Npp p@808 0p@-(M0P `& (Ѝp,Hp@-P@0 @  0`Npp p@z,0@-,MP@ Np  %8 j,Ѝ0Xp@-PP0 (M@ 0`Mp  % R(Ѝp, P $ Q80 8@-M80@08 Ѝ880/LL0000 0<0R 80880Ѝ/hP/p@-@0@00S 000 Xm x PP d00B0P00pDBP0tu ,EEO-@PM3 00 PTE `]7 ?O0^0PSppp0 0Cr Y 1AUU V00- Y^ 1AUU1 0`Fs R30< ppp0 0CQ U 0U4 [ 2 0000i`K #M 0Rs M 0 0 B0SH Mu0a Ѝ V00 0 `L 0 y0pHX20S) 0 Bk P 0 B`Fc  BLuZ 0 BT  BL 0 J Ld 0 =0S B 04 0 /wЍ0S \EPE U_* 0 L!  0 0 0 ,p@-@PxLpp p@0RS00 /H0H0p@-@  @P[Lpp p@,40 Q00 0R00 /H,p@-`@PF͌(Y P6>C͌ X PT>JB͌81S P$ >̌[ P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@Pp@pP@P@P@P(@P@PP@(P@Px@PP( @Q80 <0x100C00S000C(0h0P 0@pDP@ 0ApP? ,  ` 0Z`! 0j1 W40 0 0 0 ` V  ,0 ` V,0Z 0 ``dqYh  0 [ kPiߍ, 0!`0 1S ,00 0 ఑1S D 0|0 0@p00w(,P࠳0A Q Q(`80 0@$4 [$  B `R6     @T  @T,0[  @,匠$ Z!@p,0P p W  `,0R4 @80\ 00 0 0R-@pP@ 1L0 0PPX1P PP00P0001T00P1 X000`P`(, A$48`@@D 0P0A 0HZMH0Uj0 @, P  X 0h1T1 P0 ` 0V0p00 ` V0X,00 P `ܰA[@` @PnP ` V @ T 0PZPD0U |Z 0$4,8`@@U 0 (P!  AA8@@$,4 Y-Tp0 p,`0 @@DH \V 0f1`Z1 @0 p P0U000 PU0V ,00 @ P尡XP 0@P P U `Z@@ DH @\p>\ ``,   , HH0X p0尡D0| 0 >p[`p 00  0 ^ p 0 p`  0V  0` P  0U ` 0 P   0Z0^ύ P   0[0Jύ P   0X0̍ P   0Y0q΍ Pp   0W0( 0 $ B4U,8`@@ p`0, `$@  ,P0UH@少FʗD|=pTpYP$, `48@UpD0 0 0Rz 0St 0 P,00 88UK e 0PSa 0L000 @T @VT0 ,000 @(0P$ ` pC,U48@0 @,0@10 ,P0U 0H !Aʓ D  |h=p0 0Q1B?pPp@`P P @T  `Pp0(0S](0 00C00,Pp` V% 000 B!0 SB  0 T00 @T P@T0 ,P000 @0,,0Q0@ 0@1.0`` PPp@-P @T  p` P`p0SK 00  P,01U e!0PS:  P0 0 0 @ T @T0 ,00 0 @T!0R1VP@P0Px @U  0P0 0$4,8`@@0`$@(0 SX(0 @00C00, [$ 0 0 B 0!0@SC  0 X 0 0< P U  P'U0,00 0 P0|,0Q0P Pa}@0P  T  0 @5 0 0R}080000Sx$ `,48@f@dO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 {0S  1s0S N 8@-M@ @ 04@P$( ,Ѝt,@-M@ @ 04@P$( ,eЍ,d0d 0 R/DHQ @Q$00?H/,x$X0P0/ D D  R #@ R 00?H/Px$0P09 A-D   R'P?HU0`@S@TV,p10 0D C   S(  @T #@ R 00/x$0 00,tP h H ?30 R - D#@ GR<0@ 0G//x$O-P⌲-0R< CKD[1C+D;1C Q11^0fKh[+v0x+z;0#0| 0:01_01o01 R 1 R 0S8Ѝ0Q x0 0 00E\l0A Q Ѝ0'###|<>*!frxr<q0l 0 S/qDG-MTटPpk @+(@j($p T0CS0S3pP\X$: 0Hk{+K[@+;, @`-@8.@0@ p <8%`($P4x,~@fhjlnkp{rKt[v+x;z |#!d""e"#-@#`"h# #:p R 0S (@0800S \ЍQ ,2 0 0ND'l J p@@\  0(PU(00Ѝ>A@J@ < ^v#x:'#0# 0H#|p-y-v`_s|pompjrgydza{^@|[h}Xu `afghijklmnopqrstuvwxyz{|}s ڰrxplp<n oA-'^X`` p@  @0\(`V(PmO-MP6 p6006006000Jҭ`∂0 0S00 U0SpJ0px @v   $ `00 4S 0 0 40 s0 0bR$ 4S4 0%00 Ѝ$0 s 00bR4S 0㋰ ?;21 R R2 $Ad r  `R$ $ Q 00%0  0U0pS0p @   $ `00 4S| 4 0 0  ;0f $Q B q/ 0 ; 0Wpl4 S S04X0Sb 4 000r0  cR$HU  p p P pop P 44 $0$ s 00bR4d3 0 0gS D3051E `b pS 3051E `S p2 0 C0  ; 0 p [K40q0cR 4S0\20$0$ 0Cr?o  aR2$L p 0GG p 0$  0 s0 0bR40 ;0⪿p P< pI 40 s0 0bR4 4$R{ 4 00 0q0cR 40 s0 0bR41E00#?c pF0E00#?c p:`000! 00 + 4 00 40 s0 0bR 440`008t \l(}}@|h0*- 0 00044 4zDO-@PSDM3P0 8 `$Qq  :Q#R3Z 300S 8`)P@P@P@p@-@pQP<4P 74P 2P10S. ,P:  p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S000@Sp0@S mS 0C ;S P  0@S;C oXO-P0MvSp`f` `JP 3@|2 PU 00@|2fЍ0 D $l h $ <% p 0$0(0EXg 2P Y 2P Z# 2Pp2?;~0p2y20P:0 0rr H"R`p2Z#@3@tx"|2vZW%ZTW/  ~2P*x28x2>3@|2\Y>0@p2yZ~8t2=3@x2>3@|2!PMX&W"  Z2Px2.#@|"8x2?>3@|2 P 4ZW8t2=3@x2>3@|2P&>3@|2$<0 00F 00- $ Tx Xl l  \pT 0t 0x|" Rk804  P X0 0// O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-儑\ Q |pPl0@`P QV00` JPC ,0 R0200pP00 $P '0P  H  ర帰 就帱00Q0T bc@0 <00&Y LRS$A-@P/Pp Pp@p `EPE`0 ~2U @0 q 2@ p@-\`P@T 0S1 RT0S@@;0S6p@覣G-l@`pS0 ST0S"Q0S 0ST0A-0M`@@ႸP- , 0 @Spj0 p 0p@R~"†  2 0QU +/ P*#  ]@TۍL⠺㡾g4fX - LM  R  ʂ0   ЍX0 Q0L 00S P:@- $l/X0 0p@-P0S$ :@#RA# #p `0:#P#c Br0:#!BA##pT0 P-0M 00S ʃ0  ? Ѝ 804  P T0 0//p@-PQ|``p@0@ 40SP0P0:3S 8 L40 00 :#ppO- Mtpp3 hS0dP`0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S t2051E `ypx  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y  ` 0  S (q 1lR Q   ЍHp   B/oq"`Rm0E00#?c Ѝ 0X0 T0R0C$4  c ccba`_G-@P(S(3P`X 80$ RE T ʌ3S23SplW " Rpx 58 @00! 0@ @00@ !TP0 { p @` 坬P @PE0S 0  ᯬ`PЍ` D P 00 C40Ѝ @0 P0  0 /%` (400 000S :P / L0 H0 0S :-P /400 000S :P /lL0 H0 0S :-P /(400 000S :P /H@- @@\ ʌP 0 @0 0@-0@T J 3$S B0pQ m7@.P N @4804 000S :P Z/X PT 00 R0S *P@04//X000 000S :P w/L0L 000S :P @-fp @B/0 0A-0`V* Z 3$SP! #Rp@4Sopp3@Tw AOB0tQ 6A$.X,0@- @  @^~x000 000S :P F/~@00O-` MX$ p P 0 Ep @>P  0 P9p@ 0 #@ Ც Ѝ@~P  P /p@-JP 3S P`4`0P⒪3V卪  0s3 S00 0帩P 2 $R 0X0S H03 20X #$04p03ppDp@-jP B3S @P4P0@N3Sp@軓A-`Pe JSU>sW; 3$@PS2 SW)N0, S0s0 `SWP3PSSpP4Sbpp3PUp,0\4000?0C00401C0010L10|1spp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `pP LTL VW PT VW  H000S8 0U0 0 yxO-($Z A`Pp'P@8P ( #T2!P* T P 0  @#00 #0\ xp @ RX #@(  !#0@xx0@-?0p   0 0X( `@B$ pP`@U  0000wx8A-@PQP% pW0!  0S0,000 R   R   R  P 4`T `TX *P Q Sp QW02˨vp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S 603@0SpX@ (@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S H000080S@08@0p=ps|D0D 0 0S P@ ?# Q@080//r,$0Q 00/q,$0Q 00y/q,L0L0p@-PR ` ?@gppqX,l0Qh 000SQX@ (@ 8Q@@//p,0 00p|,0 00/pX,p@-P`0`0@T X0:20T1S@0?;@0T8000080S@08@0pp0,P Q@0?30R@080//Rk/R/p@-@S `P?Ypp R P RX @0*8"@0 8 R #@( @ //P@/7p@-@Pt`P` X0:20T1S@0?;@0C4000080S@08@0pn|0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/m0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/m4p@-P@0@0p@ l,p@-P@ p@p0 Ql0p@-@ 0P00S ^ p@z p@k,L0L0p@- @ P%ppc p@kH,p@-P@$ppT p@p@-P | @ 00`$ppT0\ ^ @ p@,@j,p@-`@P$ppT\  R @ p@ @Rp@-P@00S ^ p@u p@nO-@P P@ H,0` 1 00 000U000pW$ 0 $ PE0 0 `00(p U 0 ΰP@p  @p Ѝ4 00 @-M@0@Ѝ_,- M0 ЍC-@P M(,` P00pS 2 H0R  0 Q@ 03@@``8  (0 pHo0rQ 0P0D@0 ^pWPH1#00CQ000 Ѝ `00SZ00)0   T 0S00% , X10X0PX` T0R`F VژPpPV 0 pp Ѝ80  080 000 S0C`Chp@-@`P`!pp 0p@- M Ѝ\p@-PT0 M@ 0 `A!p 0 Ѝp\<,l l0 00S X  8Q Q @ ,@ /&R//[,H H0 00S 4  !R@ ,@ //[X,`0P0 T 0008!R !R @0<@0/6S//Z<0P0 0 0001S@0<@0//Zl0l 000S X *" (Q Q @ ,@ /&R//Z@,$0$ 000S @ /Y,P X0:20(!R !R @0<@0/6S//0P @ /A-@Ppp" 80  P P`s  l D000T $000S0Y`H0 D0 ?o20QQP T//X`,00, 0 0SP  T00/X,A-@P``$ 80 ! QPp P eT  800PU  000S0W`0 00W ,?o2?PRPT //0PPT00/,0, 0000P/P/V,0, 0000P/P/VPO-@P3 M0] Q t# PU d#00SH0PS@PPQP0pKP0IIS``pIW ,0S 0   1  PpGJP@00Sk0pS0a]0Ⰱ SW, D | 0 P000p ЍP`ac0JS`JY`a,0S1   0  p` W ZK0pS a@0 S<, D | 0P0q00p  B PY 0  0CI!0 SP 0TYT00CS``TTZ0JS` ZPZ0 P0CZV x0 00Rl,@-@P`Pp0^0C (,, 00^00@UP 0S 0@//P 0S 0@//P/P/P/P /P/P/O-PP ! , 1D0, 0S 1H``?c`@ p0 @s'W#갑@W0 8| 0 0p@ P @0@00C V,Q0 00O,\000S  Q R P 0!00//p( \/Q,0,  R/1S \/S @\/1!1 O-M A0@0S4p, @p P `0S" S#A 00 `0C``P 00(00(00S00C0T0 03/p 0P@S(  ЍN(0A-S$'p4@`P(0P@SQ Q appQ p 0P@(0Spp(0S/p@-0P`@ (0@SpP0@-0^ 0 @ 0 Q@RO- M@`P VTppD0S  00C(000@0 T0@ 0 S `&,0 R@p Ⰱ@ R`pD夞 ` | |p Ѝ@0 S RQ Ѝ,ᑝP ,0劝0P `00V  ppG , B(p!B, A0 T`  `  0Dp4_P , 00@Hp`4 0Tp `0Du@U   PB  0SQ 0 0$ PC 00\R =@U 0 BQ 0C R G-@Ph 0pS: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R00 0S1Q0/P00` 0S 0 0V(W ѳ`F`V`0XPU0P`W`V``0 @p 0 $p0PEPUP I,0PD Q P/$ $\/ P/FpA-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U EQpL @10 0 QV$ F 0R U E?p: y0 0F  Q SC$ 0R U E)p$ 0*$` P0`00BTP @T 80@Tp` 0UF,A-PP0P`00@Q0 0S: $0P pT00pW  0TD8P, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 Q0@ B( `p0,0,0CA`1@ V0S( X8: 0@-BE? 080 P R00 8$P R  R0 00S00!R0$R0 R d1S0800800080$O-`QMRDp0[|͙PPw ሰ ƙP,t ~P@0c W4* H0X S 0` @``F @ 8  < @0H0|0$T`8  \0 @`08 d0h0l0p0ЍIP4, ㄙP& :"R- 0 RH0SI 0p V0 0 @@  ʧNЍ ߚݚ ۚٚPЍњA-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,?PP D0 D0RH0!b pH000$`P@0SЍPЍ=@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI 㠚L1D00S*Y p$`(D0@p`0S00,0U00 D0@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @;x$0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ0:,H@- @  0M0 KЍ9lP-00 Q08SM$ 03Ѝ8P8 /-M 0  0N NLN ЍO-QPDM0@hlp0PtPx` RK TNP@[ B^@D࠳UEPpApWAA^@PU0EP pCpW[[3AP!p lp0@,00@0@0*l@ 0 @V 0 000@ X@* p0 Y DЍ  P Qp X@* 0Q0 00C0C84O-P, 0(0\ ,0!0s0 S ^LPPP0 (00SBP0 R^ (0S(,0Ο 0L XΟP LT R8  , !D$  Q$  \(  r Q  , R(  0 ,!$ 4  R 80pX@D0|0H0000xp 0SL01H@804 0,0000r,04 0Y 0Y 00S0` S0F0R8040,000㓉(09!IAYڸ@LH\R\ 0YpH0@\0S0000P P 00 SPR P)!R00S 00P ɟ`V0 0CS SkpL 0 0S0 @S P0P ` P R  0R  `X:,00Sf@ Q0C0^ 0 S00( 0S(00000 0 S(00 R0 000:3s T  T R 0` (`  R q@ t@T,0Q0@t@T80\P000S^8, 0@000h0S(00S80s00S. 80m 4m8, 0`V 00PP0 0C<0S HDGD0L  LL l<0L\oɟ`V?A80\V 0TD@00 R 0 R PPZy !YR   pY $Re  0E0 }0p]   0E  @000$R , 7@  ^@000!R| 5x6 8000Vt00C000C0T6, 00S?0 5# X0:h2 , 46@Hf0` 08 0  4P, pu'00S0 @000p 1P11qW\5t0  @00 00S~ 0 5# X0:h280V @ 03@0S 0S4, 0pQ0A 00C0|0 SPP 11 1R@Yz RRQ] 0    U#, R R   p6#`FpPC30`P@ !?3 pGWaFP `p?0@000L0H0P 0P0P00` `0$xP0T0;^L P0 R3(080 y 800  P, 020 p`lЍaP008 0080@080' R d1SlЍ( 0 0; x \P1, p0, Q0A0`Ӈ8`! ,\PY @@PY 1P0@, QaJ   8@,@ APX@T `P `p"d͐̀xTV (xhPT` P0 @ ` p, P@APUEDP P " Y   @@T`Q 0B0CPcP P8p0 CQQ @0p  0@4$<0S  P 0,0[1,01`w @@`[o P  XPj0$00S 0$ p0@X4<PLPA\P0(0 0S(0,0 ` p, Jz @W0,  \B `{80,0 @00C(@ 0 080 0 { 0PXx  0Q04`000CP0 X0H080 0DP# @ \ 80@ 开J U0L J D |pPg d1Sd , 4@  TP:X X0P@ V@DT 0H H00HE@H00: 80 0R,`0A0X0000C 0@P `040 0E00] P0U U R R  X R RR)0SE 0 R@H$  $;, `@ d0  `@ 00pW0 `00P  G0@`P 0 B00 :0 v  Q@  0`000 @000P  T P$ , |<@ 0   @000P" , <0 0 0 A R! U =p, @@0 0p1S U d=, @`@0 0PL5S 0 0RU =p, @@0 0Lp0 0 0 3@000?, 0>@ 0  `C0` @000tW &  0 U@`; 0 0L}P2Pj @00p nU xʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0` 0HAUnH50S0X0S*  0 0 00, @p@0` 0H%U~0 0 0 @000jP$pPb6hp@-@PPMP/ 0`0 R    80x  t000 000P 0  Ѝp80 @000! B/ 0C?0Ѝpp0 00,C-@PM⤐0 48! \`` Pd0phlpPg80  D000 0 B0C 0/ ?0ЍЍ\@-@P @TO-PP ! 7 1D00S0H``?c`S., p !@G'T :#| 0cp @W0 S 8 0? P PP0 S  0 00L, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $0`U VP `奊Vp`0P 0@PUpT` @半T @pp  ! !@-@P@vT R/0A-p,SP` @T @`T0`PS RQ A0@ ", "Q//@-`Q'pP@0D "! "T "! "U ^ 0N "! "\^pPV@@-@@@0S (0P0C(0iLO-M|:|z|*0p(P܂ pP L*40\b S @ s!@nRXl HR@ @i`80IS0c0@T ^OoB@TP AA  RR0)\ 4  |  bR\ P)` R&@) R! CP'I@0 8R S[80S  ( 0P00B(0X @C0 8R CPf S ^\ `( 00Q @800 808,0RJ0H 0@0( (P)0S700S00l0S# 0 S 0 80R#0l 0 P0S  0P(0@P(H70 RЍ07 0, w(,04 SBG@ `T & ,04 S5(&0CP ,00xP0S x(0P0C(0Il&@ - \&0 0@,@ R 50$600 80RpfF`@000 (P0 80@P0,@Sf 40 CRbڨ%% pp|% p%@ 4p,`Y t| `nR`F`V,00P0S  ( 0P00B(0X``!R  @ Q[Q $ 0,@  B0 00C S[ p@40084 0,0104#0zd4`000P ^% (@(#P@ ,@i4 Rv 0[, q  P+ p# _ d# ,@(@?QW, 0 #\ (6 ,@  P Q0,@( R n$@ P  @ lP " $ 200  0 m80 S -] *(D2 0( ܀(B@0S  @( 0P00B(0܀( 00P0 ! 뼱 40,`V7ڨA@ 10,`4 V0`Fx!,`0 xP0S ( 0P00B(00@'A@0S  ( 0P00B(0 0@d`dpP|XP|\($$l8d$0<P(x\HO-hs Md3p`C@4 P 8040800c`,0P Zn38@3`0T'#0CS 802PL좟 a0@DS,00S0 0l0S R "0 04 208@0P0T0hP \RP4 @P 0, 0CS P 20 0 P1084 0, Ѝ04S00h0S40~1 0T4 O @ P0P~@1,`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, p0  8@0SRC0PE@DP8@K 00SL008P(Tdh\8(@- 8 40,0(@- 8 40,01!0O- @ M *BT8 h!O T!0 pR( X+ 0S#,PK U`0   R    PU0 PU0P0U0 S @T ЍpW,0P q`W0 P`00P0 [SV 0 0 00 08QD0S0l%R h%R /!R!RtP/P//\ 0 000 0P/O- M똅P2 5` 80s5 t SD Pr T@R!1S<50 (5p0 P\`崦 50 00P 40 0400:@ p0 @ l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SO\Q*SvVrE Q SVW~V= Q SV_V5 Q SV@, Q SV# Q SVWV Q SV Q@S  ![=0Y2 0 C S@p"0TP!pR t0S8"R ,ŸU0 8@=0A00+ 1OaLOp`PU 0S 100S H0Z 0H0 , 0Q  Z@PU ЍZ 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sr Sp Sn Sl Sj Sh SWeh,Ph1P0S\ PNPN D QG\E,@- 00ʃlœ\ 1:t“ '^ tƒ'΃r 'tƒr A\ B\ r^tƒ    //  1P0? 00` P9ʀ: l2'΀S00r200 /@ P 0000CS0 00000000000000000/0rp@-P@M@(\\" rf Ptf vf0 P P 00 000 0ЍphPd-X\\ rtv /40 0 t 00S `0008=0!@00 R/@-ް$$$1 @-00*l"R @!@ R  (1:'.r"tB00 R @R   AR   `4H*0 000:h/p@-`@M0@P0*l"R R &Ѝp   P 00 00@ 0 @ &Ѝp`   P H00 040@ 0 @ &Ѝp܌hT@2C-08R M0@PS "03@ @  "0S 1hp0&R  l"R R- ! f#@ @080@0 Ѝ1:'.QPr23Ml120l T10 0E0!Q:20h1:'.Q"r23020 00 0$0!Q:20t 00 00h0:0!Q 40-0!Q  hh0 000/|0| 0p@-00@00C0S S p0 S P00 pɉPp00p@-0CS@0 S p0 S P00p᫉Pp0000 0p@-00P܁@pp@-Pҁ@p0 0 0S JQ R@-\,AQ /ט,0P JP\@-\,AP /P/0S/p@-   A BJR@Q`,PTa@@@RA  Rp03O-0`Pp$MCP@ W sP 0l#0C S-0 00$ЍT0 S80  2 0@ဥ  B@DT p`$ЍIɟ,0P @I%!R1 Q0@Sf000(00^0Ŝ@$ @D DP[Z :0J@D U0 $0$0Z㰁? p@0`@`Pp ~P, P U   P`X0(P I0EXUP(E 0(0C\00C_$ЍY TPP  D0|0Bp H0@D002 T `V `V `` P|ռh0 00,p@-@Pppp@D0D0p@-@  @Pppp@,O-@PlMP6 0,0j Q 0pZ`Pa P~0P0[ W0  <0P 0R 080ȅP 0@SF0 0800`P0S 0P 0 0PEPUT 080 00PS0P<0=  $500`0Pp0 @R  <0T R8 0 0<00800C?800P`FPY`00 , l480 pP pK 0 `800`p8ppP P8 E0<,PpR%4\ Qձ(X  <R! p@p G"RX : HpG U  $ $ < S8 8 `<@(Pp4$0 ,0 1 D400pH0@0@0 0PU<$0 (Q0 0C0 Ss 0( 0C04 Q00SPy 80 0? S,0"8 P ~0PI08p0 00i8 0k80pG0C?80/0P0C00S`FQ%0pP0000C00P0 0PS8 0B! We 0 0pGH0㴢01 WD0|0pF~lЍ#p` 0<0T aR0<0 {Pq 09-~lЍ`}!~`.0 0 Z,p@-@`Ppp p@L J0 0 0Bʐ,p@-@Ppp p@5Hp@-P@0 @  0`pp p@!<,H0H0p@-@  @Ppp p@ ,00@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` ɔO-SMԑD@ HP 0U p` @ 0Z C 4/  Z: $Z <RH!  R! ".Q   R>, P   @0 0|00  GPr 00 R0S0 0?ܾP4/ZXЍ G\r 00 R0S@0p0࿾pP4/pWȄ`Q# @-@M R ! R "R pP^  0 0@`Ѝ/@-0QM   S S PpP$@8R @ 6Ѝ40@- M@ @#Ѝ|H0DD @-M@ @Ѝ|p@-0@R P\RP ^R3 @%` ,R'R{ LR @Qa0 L !a}0 p  % <{ R`VA 0 FR8h!@P`  Q ^0@! {cRE0'  p @m%X {m\R:R `ĠO-$M`E ?z@PP 0@%pp 0 ;S p< @`\p,S0 T 0@ @0 C00  S  Qu%S+0@GS0  iP%@0@@0 `fv` 00S1.Q0*Q  0S@0 SH^0 @0p0dP% @ 00@  d 0 S-`30 @0|0 0BB   0 0p<@0D0@00 S_{ 00P$Ѝ0 S0^0@p  0 @  c%  0 S^0p0p0 p0 0[0@c%@+%B0 0@`0 S00 @s0p 00pp  00 p   0000!010 @0r 0 p       Tp0 S\R W' I00 S{0<$ tl> 0 s0`f  Sv` 0S0\S 0 S]00 C00`  P p@-@PM0P`0S SP!  0 00Pl 0 Q00Q H  < x0 Ѝpp0 ssstls4O-M0@DS@!00@0p0S= Q^0 N[AK ` ? 8 g=M%㕞R ᫱nੑ)bP P  02#cQ0P pW$P@PW 0fSPЍЍ 0Ѝ( TG-M0@HSD!00@0p0SD CP0 ` k@ 3㞜>C l.b  ! ƒ120BQk0P pW$P@PT 0nSXPЍ0"ЍЍ O-M0PS!0 0  0000SW @har*sE 0 `Ə⊡ - ?D%ᜲ✳B.b CĠ C,ᜁa b ! 2ਁሂBPH @G$SX C(0  ((0-( ?,D*Ec,`% f`Co1c,A ,0$0b  0Ã#3#cQP $0tS 0cS0SPP^EPE P@`P0H EP[w00z P $A-pP`0\ %\0@pS sS lS P0\UUW ,000@1CP0PCV`1E !00O-PQsM<00 P` 00S040  t@    H Y 1   RSI X P  4  PX %X%X ,  R:@vP 400@, %0404@p;l[` @0P`@ p0 :XBX HQ  0H  P0 P`500>X A0Hs =R* =S00 C?Q^` V`1 PQ -^. 0XXC cHqQ  ^`z PA0H^l ` Y PA0Ha0Hs Rm11OSpC00sߍxI@[, uP 00040uP, 000 ^` P`1l X   QU PEQQ$Q V! 3`,  RP*P  0}p 40P040 P PP`1  ]1S@ 0C11$1S= X! H0 Cr 2 'X POQ0$S'St! 0S'S'SX AT 0D1S1$a @D`7&HAq0 $VX฀ `OTb 011$a t!AT @DAA$Aa0Hs RA0HS3HAڕ0     00C2"0OQ60}SS$! t! 0S}S}SP1SZ !0C1pqWu #P1`,Q*P  0e|pb 40040k10Hs Rf1tx1OS!P$!01tWAT @DA`1$P OT1a$010$1A0St00t00S|00|050S%   ?R ;R P0S %S0 01S. 0C11'AT+ #,Q,*P  4 @ , 40, P 0P`1GA0HS30H1OS!0$t100@1@`tPz 400`,Vp p2~tPo 400p,000S   ?R ;RO eRQg P0S %S0 0AT @DA1 $OTC0 $01@At!`V ᶙ```&``VP``P``ù`@oobP``V ```@Q AIQ AAT6 @D!XA1 $oV 2tP 400,PV0`00*`00& 1&H 0 GX @pq0000y!Ho0㨂0000)000uV@p``P`V@p`K@`fpG@opC`@p?oo@pb:D*d - - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/EA-PQMp@ 0S XD 3sP ]P`! ( v00+ V T 00 %PPT00k 00ЍT i 0 0 R T ZT\SP0S T`D B hD\p 0S R s0r (0 000ST00P Y  p0(0P wY  p00\TD,4 x \ C ` $  0R@-M  ?@P 1 Ѝ0A-pPP U) w@T`0DV 0PS |@PdV  P oA-pR `Q 00@ PPz % RP LP (&F0 GS  RrP   0?s s0 0/r R0 /r R0 /r R   qQ Aqpp0U ?Qs0 \PQ  0?s0S $  pP op   1@⡏pqP V0?s0 q%qP w0?s0S   pP  q0RQ?s0U@ pP0?spWB 0pⲀḏx$SBPB " X$5  Ž0?"ss0 nR 5 sRB fR- p00?oR20S   pP:!SqP$LqP&$ pP r$pr ;qP$V    p03?/o"/00   0 S/r RUp p0?s0C-@QM|!pP `0x P o00l0S9 @Ѝ PP p 0 x p R 0S 0P@ [P@ @ Ѝ 0 1% P LP+Pd P * PP004Q PpP sU\ fUH0D Y-R0 @ nP$ H0D@ /  H0@0H0H0nUp@0 H PO sU: fU% L00L0@ VP @P m 0S0000Y 00H0@ H00 (,00H@,0, (s0?0H0@0H0H0, 0H0 0@SH  $03?0H00H0$?P0s0?0H00H0 O- M@ Z pP pY ` `(080H0/mP3 0  0u0?0 PZ0w 0/    E0Yv / 0   :00P> ;08@50@ Ѝ 1!00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00tA-p0 @`P`VR mPA0 uW000 x /   0 0 0Pl8  O-@P0 $M 0HP `m`Z5 p p 7& Om0P   0 m `| PP   P6m0P m00$Ѝ 0_ mm,`0 pV(0 0$0,0& P 0q S00jPo `V X  P2/R`V  P/r R`V 00mLp0@WH0@0D0L0: `fS* `   P$ pW$ Ͽ|P|0nS sS`ov v`X P`5_`0 000 9m$Ѝ P`_uP,TR00HRP_`DA-`@0PppW S# lP uv0Ͽ   ?0 000  0 Pfk0A-pW@P`S Nl0S u0  00` 00 00S=k0O-LM<0< 0$+0, 0, 6pP ||@P00`P 00_PT P?PPkPP p pP V 0T 0,P`8 0 ` 10#s0$0:0400S) $ .S  ROSD =ApP" 00p`vC <0P;0P?s004 0?s0V,P `=lLЍ#@P? pp`v , R 0S00 R 0?s0V0TS 0 000 00 O0( P-Z80}j80 R(kPLЍ6@0@SE p@t`00 000 000f0`PYm (@[  [0pP ;  )\[  R-Y %\^[\= @[0P00GS0v  0P (X0 KrQ40E K/RN  [@ [p&,0  @ 00@0&,0  J p00 DhQD00S ,P Pj 0 f 0S\ v 0g 0  00 0000n0g p( j807` Q  Q 0?s0T00   p    T00  ?[/v 0 S00P0@ P  0BP,  0  80i Y80 [!0@B PT@@p* 0 0 000s02P (c@p@tip@t> , Rm 0S00 Rf 0?s0TF_PiT` PT0  x~800  F((9P00hPp@t0p <0 QO0Q?s00 H 0?s0T0  dS0 0JP4,0  M0 0 0S00P pb0  <  ` 0 000P pP+l 8 @ l  P/$P0 00 // A-M`0 KpH gMM%P 1N;A\㓌al1#b 0 0#@B4d!{PЍ  P0`0>// @-MP0 C`CNCk,'@`0|0~Pl n "020#AB@C1dDPЍ D1P00&>// A-M@0 sb*cEQ - ?D0垂|垃B p@LLD&$b@C >c 000@d$C4d1PЍP Dp@-0M`P02@P 0ЍpZ0 0  B0S Q20Ѝp1!0G-@Pq0P04 0 `4 `S002,0PP00|``Q  VPe`EȄQ  V|0`0ȇ`H00@v2l2\@-@P hhh h$h,hh,00!R  !10 001/0 001P/ P/0@--`@@C X0@00s@ H ,PJI HH @tLA- @-c`3(M[T0 pR  X a  !00 (ЍPd P \300X 0B00 0X!00 PI ~P 300X (0 "P 0S !00 cP00tʜ2000X 0> P 0S !00 cP00k82000[DX 0 V/2'D'L"P  cP00100X 00 "P 0Sb !00 ~cP00x100X 0 zPX  kcP000100X 0!0[D2/'D" yJ`PR  QcP00?000X 0 BcP00>ʔ000X 0.2/'L"=P /0S1 +!00 ' tTL X<$\ d  P 0 t $ TcP00 l000X 02/'L"P 0S !00 cP00,000X 02/'L"P 0S !00 cP00,<100X 00 "P 0S !00 cP00pʠ10I?0[D 00 /G/OX" P  cP00\10E?0X 0 P 0SO !00 cP00`20A?0X 0" {P m0S i!00 ecP00J200X 092/'L"`P R0Sz N!00 JcP00,30t0X 0 2/'D"EP2  6cP00x30l0X 02/'L"1P #0S !00 cP003000X 02/'D"P  cP00,4000X 0  P 0S !00 cP00fʌ400X 0  P 0S  !00 cP0040W?X 02/'L"P 0Sw !00 cP00P500xX 0Bj P]  cP000ʔ50S?X 02/'D"P 0S !00 cP0050\0X 02/'L"P {0S w!00 scP00d60P0X 0w2/'D"nPy  _cP00ʰ60@0X 02/'D"ZP[  KcP0060O?X 00" GP 90S 5"00 1cP00J`70M?X 00" -P 0S "00 cP0070I?0T 0a X  P   cP00*030l0X 02/'L"P 0Sq !00 cP00D20d0X 032/'L"P 0S` !00 cP00u`20\0X 0d2/'L"P 0S !00 cP0010S?X 02/'D"P  cP00ʬ10Q?X 00"6 P 0S "00 cP000H10d0X 00" P q0S m"00 icP00<00E?00[DX 0   dP V0S R!00 NcP00|00t0X 02/'D"IP ;0S 7!00 3 ( l  0 d D L  ` $ T   p ` $  P @  L <   l \cP00 00 00X 0V P 0S !00 cP00H10W?X 02/'L"P 0S@ !00 cP00ʰ10P0X 0T P  cP00|10\0X 00"7 P 0S "00 cP00}\20d0X 0l2/'L"P 0S |!00 xcP0020l0X 00" tP f0S b"00 ^gP Y0S U!00 QL300 /G/OX0"D"00 @30030K?30G?X0 /G"-"00 )30|0300 X0 /O""00  400X0 /G" "00 X40800X5!00 40Y?%400<X0 /G""00 40T0u40N?X0 /O"!00 50p0X0 /G"%"00 L50U?X50R?%X0 /O"5!00 50`0%50=dX0 /O"!00 50h050050C?X0 /O"c!00 $60p0S0600X0 /G"x!00 th60U?X0 /G"i"00 e60H060K?LX0 /O"V!00 R60`060h0X0 /O"vC"00 ?(70Y?fX0 /G"4!00 0`70|0l70`0x70G?70T0f70(0.X0 /O"!00 70h07000X!00 800X0 /O""00 @8000X[!00 t800L800b0[D0 /G "ZH H  0/O"Xp"00 800Z0X!00 9000X!00 P90p01"00 "00 900900A { PH T @ "00 "00 ~}!00 yx!00 tq!00 ml"00 hg"00 cb!00 ^]"00 YX"00 TS"00 ON!00 JG!00 CB"00 >GP  8[D0 /G"*{P !H H  0/O"0Sb !00 200"1005"00 "00 "00 "00 "00 "00 "00 "00 "00 "00 "00 H H 2/'L"|l1 00/zD1 0k0%G1 @@ 0)0 l0!0 0 @@8 0@ !TD- x h H | T  x @  X 0  X 0   h0 0u0J80 0z0(`0 0/00 020L!00 H0 $00}0 H0 0@1 l00<1 00Pd1 00{1 @@  0m1 @@ 0_1 @00U$2 d00KL2 00A&t2 @@ 03j2 0[0)2 0e02 (0k0$3 L0 0 (L3 p00t3 @@ 03 003 003 0u0$4 40 0L4 X00t4 x0%0R!00 N@- M{VPLOAQQ-@\Q\P 00 Q P 0;B 0` 0 Ѝ3Q Q) {F ЍALL1\1 ^ d0P  010b0(#6(7`0{F q p   ;B Ѝ 0 H / /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00( @(4/P8,0S0Q 400 @-P04 R 0    $ < @ S. p T P  +ˁ0P R $ R  R S /0?0>$0SW$ 0  0p6?@0U 0PEt@T$0Sp0  0@7?p0U 0PEt@T$0Sw  '$   0   0s 0 8$ @pRp=?0Uq 0PEt@T7p0pp@>?00S0 2??0000CSU0S: 0@7sN?0 QP?0F(0 S@p0(0v0 ?3p5?0U0 0PEt@Tw0pS T<000Q?0LQjD0*;J?0\0T  0T :80PEt@ 0S.U0P`0,P 0U 0@@00Q?0 Q 0SU 0PEt@T 0S 60> 00Q?0U 0PEt@T:D*0@D17q0D0 dh0l[X0 P #U 0PEt@ 0S\7s@D0l0[  Q?RY ?0Sy50>00Q?0MD[T U01[![d  PE 0 ` C 0 0 0D0 0CD00j`l PST %UE 0PEt@0Rl @Dq00; T 0 $ R4,0000 a??00U  PEt@T   !R~ $40d0U 0PEt@ T:H0* @D7|0H0; 0;  0$ R D :/ $ R D ;/ $ R$07s0D@C s P@l0~90r0\l^PEt@^U ,( 粰* @D7p/R (!B0$ Q 0l0S>/0p0P0X0Xt  0p0P 40>  @s 40>0Q?0 7?RW0@p0s0 70p,50800Q?0E?l 0Y^[PEt@TU*U 0@0SU 0 000QO?0 0S 0@p0,> \, PEt@ 0\@UԂc7s0D@Cq6I?L07O?00 s0P7s@De 0@D'q0@ph0dlF?0 0`P 000 00Q?0||x80>0 sSR:@ 3 @0|0K??@0dp \T d \ h P ,90>@p0SG?0fXp@-@WPP80S $ (2/$0(3/00pPA-@`?PP@p0 QR 408 B$4 08@V000PA-P@ Pp` 0R>/ S  (P00S  ! 0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /(#(3 C- M0P000@P`^0@\ S?R 0 <032   A0Q#4<0M0@0 Q Q0c  B\Q} S Qs 0 S?Rs @0 <0@\32<0p0l0^ppWn H Q0c  R#2Q S Q0 S R*0Q  R*0Q  R:0l00p0C0l0pSp0x 000 0@P,04p??0 0 0 0 30 Ѝ0SzpSpl0Spp l0@@@ z/ ,P 0S $0S 0S P?,A4 BR/A/Q /@o/A-Xy@ 0(+p3/PPv 8`VG (0 ( 03/`P0 0d @ 0T   +P 45R*p 0 B0p0(0 8#8`Po RS> B0V P T  B T p  B0p0`0 0@ 0T   +oP 45R:o Rp 0` B0p0$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|M  80⤰@ 0    0T0X0ps\pW0  p p0 |Ѝ0`^`V0P@0t;JUS1@Z0@P05ᲀ0 Ts00R 0x@S0BSC@ RUP!U0!01P 0020# P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00(0S2( 0 0@0$0 0( $0,0  00 B0 4 pP 0R@ RN 0ࠃࠑ`@@$0t@<: 80C1 ( R@P00F#3 0S# Br #RVE  ` R*  ^ F C 0 Z( V F( *FW BR  ( Q  Re, %Q  R_0!LAS4 @P  0010,0!(0 , 0 $0_ Ƭ O-04M0C000 C BP [P1: cp Wۄ2  B37Rp @grq`36 B p`Wn B37`@^`pNV*jkV`H$Vc `\``\pWL\`pNWNWN\ \  ?8QPK@ U2E@ AaPA0% 2@  `"<0@ 4Ѝ`p 0D  Q2W ۅ >`V7*pG(p\ p`$p`p`p($p$p@ V(`$p PI:`~@`L\p``^`@`^`@\) \!$\```_$(@$,$ V,(`@M Qk$(@$,$ V`G(0L`$`0``$0P\(0`@&6 € 0LD, -0qR0Cs\@0qR0CsPO-,P$Ml0AOEx@D8SAO<@0@D000@^0| 0S`"!!Pt0@p^4! 0TT* RR 0 P ^ ^ ^YY 0 PU<PU=PU>PU?PU@PUA0PUAPR@oPP 0C<` `FV*\,^X!X~\, 6 QƋ5* 0L1CS0!S 1 RL\  U  RЍ `PVpl , 8 RƋA, l&\XE\\pl<N ^Al &lR8 &&RH &,lA Q l S`1 `!U00  SR#00p08 0\00\09Ѝ<` `FVx:8 n, lB\ Plr8 LNl \&lR && R, Ƌ`X  SR#p Sp`1 `!P 0S $0S 0S P *R9R/qRZRE B0//0@0@[ B3 /R/O-MPpQt@`Vp V] t0Sj0,0SD0p0$t0S)` Pl8P pLpԥDP@4H0  R;. 0H0``0t0l t0S` Pl  l \ 60thx0`0p`ЍVL0D C0 `C,0l`\`fpG0*S tX 0 ! ,0W0:A-@P 0S $0S PmpP `l0t,@0S@1VTU@80C pp@-@P$ 0S! $0S H`PP0,0`0 S`0c`0S ` *00 00(0fp`p900(p@-P@P pPL ,0D0<00 B@C ;0 X ʅ l@\@t@0000000|0Fx`h@H@p@-@P 0S $0S P0 Rp@-@P 0S $0S PP Q000U0:60ppG-@P) 0S& $0S# PQ`P0&0R:kpƙ @lT@40C0X<0RPUPPp@-@P P 0S $0S `P0`P|0pp01A-!4TpS`BCEP0 R R R0 PR\ \:0S@U!1!f!gll R ^  RX  p\h$X  p\h, RO- M` 0P0Qp 0@S QW0 S  R| R7  R( (pQyW, R B‡RP&"SnQ t0S Rr 0SV S 0> 02#03/0@SPn Pf Wo0S S00\0 00#400 00 0  0#400 0 0S0c0?o20 Ѝ0Sy<00000! S *SL0Sq00Q R0@SP Wg WuM0S0(0 Ѝ0 0S&+Bql0S0 B8@ B0 #22c0# 0l0Sb q000 R09S ES IS [SD gS0, q 0S0+W  2R-C0Q` ! 0P B X:G PE [ P ! X8*H q0 ,0 SR B000SS@ ӇS  00 # #8 00#"0  90 ,  Q R I   R&   0P P0S00  P,0SQ:{ R,0, R  R [  $ R  $ 0P P0S00  P,0SQ:O R0 i0 0t0 0  R ,00SP0^01$ ^U0 R1 200 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  P20 u0 B00>0 B00cR5 0 00c,0S+  Qg0#0% *0 B000, g00R  0Q RC00 00#400q00y0S+Zt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SW :W㴖s 6S \0l S B8 0 l0\0100S\ R8 C0u l0\000S0Zt0(l 8`R B  ^E 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l SOt0 SW S Sl 8`0 ] W 0S0^0 B000R ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs0,!ƅ0 0!1001  &6`Rt0l 0C` t0l x\0S B80 l0\0V00S;#  #800#"0 \0 0 0 0 0 0 S0 S 00R01 q00  R000 000**W6: &R \ R80l0 C  B0 00BL0D!C0C  t0S*l0\06~\0l S B8 0 l0\000S20k\ R80l0 C   A-`pPSq@PB Q00V0SH0S: (0sU Q P10 00000 |0 `hp' 0S)t l00\ R#6S S L0D C0 C060P@0 05 1# 0Rpp$\p@-@8PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO- M`p80S04< 08Q1S00PP 0 0S| $0St wpVkV`F0HSt0FSRp WnZlFYo᫲[eV @(& `4/@Pj * *J@0`( `, P X  P "L  BT  A4 *   6/ `, 8(6/ `L @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0 ЍOv `fh00$0X(0 | Ѝ",0  000%l-M 0 DЍA-PKUn`0 0@ 0Q@   & 0(3/@PR &@zÿ 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 ᙿ, @@ ᔿL DD ᏿&!኿0 0C&006 0&;> 0$0;/ O-Q$M R0ß ! 0 R0#s0!1`lß0P @` $* ) ` #z0 `&qy0 v0 p0PAr01!:RuPPQp'9RuPQ(6RuPQ+P5R>"uPr !@$0# "@QP` .DR P \!R!!P! \ ++ +P ! @$ @$ $PD!0# 0##P4!3?R4`P `QPE@QU`&Qv`a#4&@$t@a @Q#d& 0Q p& 0#s0a 0Q d& Q@$t@A&D$ pa Q$d&0#s0A&D$ p1$4#B R   "^r !#4"$Ѝ0 L3#2`S#b(0@m X ( ` C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0   C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0   @-PP |p CMNp`P`  1!Ȓ"Q C 0  P` $@-PP |p CMNp`P`  1!Ȓ"Q C 0  P` 0@-1 S]N,^@C 0   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C=@L   0R `R 0PR`RP0`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0QP0 00@  0C 00 Q q00H 'ᑒi7n00R#@-qHp@#/Ǡⳮ 0 I 0I 00LR<G @ 0 q0CR Y> 0 B\0 00000C0/ LR 0^  P0 0Q000S@\ R 00 R00@\DЍW  =xQ / !02@[1Z Gೠ69#6pQ^p N00O-@Ⲁ MAX``PPR ಐs@D+~@ p+0  RlX+ Y|   ^  DT0V `P \( RP|\ P`PP8 TA ` 0P X 7  Rʰ ^ T0. `P\ T0$  ^ T0 `P ^T0 `P T 0 P XР Ѝ  O-$MⲰ[PPR|1Z@+8+00+0`0* X [Pv S ~:|:0nSWuPT0N`PppPP`pp.pn\Πv|P::0lSWuP0L`PppPP0`pp#40060c^~P H\xƂ0̅|PP0PP#4 0ƒ0lLXxP0QPƃ9 Q0T pQ `k^⧎P p@6a pA S#0r 0   0#406 c0TBt `V 6 pW @0S p`W0\  P`Q U0p XF+=00c^0~ P0CppP .pp 0n\Π| S6`FPQ3ps00p00Ppp#406c 0CVn`6D0Th pW `k007PlUs0PL 0pp00P #4pp0060c^~0 \ƂR `FPQ̃6p|pPpp,Ġƒl LVn`Ƃ 0T# pQ(0 S P `a\uP p 0\0 `W5 p 0 S$Ѝ0pvH Qx066㳀 H Qx6Ƃ峀v P `'0 S P `0 S  P`0@\ 0V p` 0 @`NʀO-M6S 3k^P003`0030 0300300A @b9 Ts0@ Bp000@p#406 0c^&6S6 ⼖@ `0$0 p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಀphY>s0H000#4060cWsw0 p0@sW hD B@gTr >s0=pG@000@#406p0cR#6 SveF&0PnR2s0 NP0``00 @#4PP0&0b Qq0&0Ѝ 0&;p0v7 ,    0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4&&&&0HA-@ s0`P Q!r  pp "$  a AS2s 6 x u0U0U$0Q  00  0 ƶ000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@R, R 0p&&]P +(+|x0O p ! R:AQ j  &!R*\ R3 "[&&0 Z'p:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r (ßk>0 NΌ⼦  Z*r   "$ 缦 j JPp \ ἦ A > K O  \ P+R +R ,RE R  Q ,P3 "[X6 S_p3 s0000 #406 c 0CPp H66 O.V G.0 0S0 0xS0  0LSX4&&&&  Ѝ &]R3 "[jP ЍOg Pj 0 r :s0q#0r  | z\ xx:Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  v0S A-@P p0 C `"VUV `$P G$/@- M`@p+(PP P  " `p 9 @P ЍA @@ Ѝ;@@7@9T  Ѝp@-P'@P @Ů000p" 00p@-@'0P 0崮000 00p@-MP`'@P P @埮 00_"p R9PЍpPJ9U PЍp0A-S ` @p0 CsP"Uִ 0 P$y1r1FPP#0A-S ` @p0 COP!U 0 ,$t3i4FPP#0S A- p@P0 C+`!V `却/0S A- `@p0 CP!U #y1r1FPPmL#/0S A- `@p0 CP!U #t3i4FPPK*#/0@- M@ !p  P Ѝ03 Ѝ0/0 Ѝ00@- M@ !p y!r!F P Ѝ0 Ѝ00 Ѝ00@- M@ n!p t#i$F P Ѝ0 Ѝ00 Ѝ0- M Ѝ- MtiF Ѝp@-@<Pc#t3i4FPPpp@-@0PW#l?o2FP p00pp@-P`@PP  oP"p@-@@p @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@$ @-@@= @-@@N @-@@[ @-@@h @-@@u @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ p@-P`M @PP  P"pp@-P`; @PP  P"pp@-P`) @PP  P!pp@-P` @PP  P!pp@-P`0P @PP  P!pp@-P` @PP  P!pp@-P` @PP  wP!pp@-P` @PP  eP!pp@-P` @PP  SP!pp@-P`0P @PP  ?Pn!pp@-P` @PP  -P\!pp@-P` @PP  PJ!pp@-P` @PP   P8!pp@-P`u @PP  P&!pp@-P`0Pa @PP  P!pp@-P`O @PP  P!pp@-P`= @PP  P pp@-P`+ @PP  P pp@-P` @PP  P pp@-P`0P @PP  P pp@-P&@M!g>t3GP p0P 0pp@-P`@PP  dP pp@-P`@PP  SP pp@-`P@!aaFP p?P U -pp@-P`@PP  )PX pp@-P`@PP  PF pA-P@ g>t3GP p%4`P  P `5p@-P@ g>t3GP pw0P 0pp@-P`@PP  P pp@-P`@PP  Ppp@-@RP Ppp@-@P l?o2FP p$00pp@-P`@PP  Ppp@-P@PP Pp@-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@z@) @-@t@? @-@n@X @-@h@i @-@b@v @-@\@ @-@V@ @-@P@ @-@J@ @-@D@ @-@>@ @-@8@ @-@2@ p@-P`h@PP  GP/pp@-PX@PP yP pp@-P`G@PP  &Ppp@-P7@PP XPpp@-P`&@PP  Ppp@-P@PP 7Ppp@-P`@PP  Ppp@-P@PP Ppp@-P`0P@PP  Ppp@-P0P@PP Ppp@-P`@PP  Ppp@-P@PP Pvpp@-P`@PP  |Pdpp@-P@PP PUpp@-P`|@PP  [PCpp@-Pl@PP P4pp@-P`[@PP  :P"pp@-PK@PP lPpp@-P`0P8@PP  Ppp@-P0P%@PP FPpp@-P`*@PP  Ppp@-P@PP %Ppp@-P` @PP  Ppp@-P@PP Ppp@-P`@PP  Ppp@-P@PP Ppp@-P`@PP  Pxpp@-P@PP Pipp@-P`0P@PP  mPUpp@-P0P@PP PCpp@-P`@PP  IP1pp@-Pp@PP {P"pp@-P`_@PP  (Ppp@-PO@PP ZPpp@-P`>@PP  Ppp@-P.@PP 9Ppp@-P`@PP  Ppp@-P @PP Ppp@-P`0P@PP  Ppp@-P0P@PP Ppp@-P@0g>t3GP p0P 0pp@-P`x@PP  Pvpp@-Ph@PP Pgpp@-P`^@PP  nPVpp@-PN@PP PGpp@-`P1@aaFP pP U pp@-P`@PP  5Ppp@-P`@PP  #P pp@-P o@PP SPpp@-P @PP BPpA-P@g>t3GP -p/`P  DP `B1p@-P@bg>t3GP p0P 0pp@-P`@PP  Ppp@-P@PP Ppp@-P`@PP  Ppp@-P@PP Pypp@-@QP Popp@-@RP }Pepp@-@0 P 00p@PP 0S  ps 0R@- @@ rR8P 0R @-P Q ho// [t [hP Tt@-0, H [8@-P Q @B0ft0 Hg0 Hݩ Z Z 0S p@- X@P`@@~PpP p@ lA-P`p ! .@P  P` pp HP`  U @0 005 P p@-P @`+PpnP p@c@- q.@P $ j0 0 0  A-pP ^.@P  W0 0 0 PM.`P  v` P(/0 H8J@ XD@-@P @ l}0E/H" W-A-M `V $P 0PM6@P.pP  0PA6 GЍAЍ/ЍAЍ/U>Q/H W4 00 W@-@P @ '}0E/Hݨ Vp@-@P x0 0 0R0 P-0P Q ! p@pp} VO-MM(@P p$`6<10000(0  00[ Q`$ 0 `;/0 `NP Mߍ P 03/P 00  $ 0:/P 000 &PMߍ >tHp@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM P30 0뀰@p@ @@@$@@@(@ 0 0Cs0S;0fSR >"SF [Sl2 0 @3/P 0`0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SS `,`0 S S0p p S ;S 0 S S0GU0 RP0/S8 0(00>S; SB 0S p@03  0Bs0SR  0 S S5 S3 .S 0 S S+/S >S S`FVw0St `Vo0(00>Spi0   $ 00 8 S =SB0"SP0SM   0"R "R R@C$ >R;0 6\C-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Pm \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R\ BR   ;R@<{  @d0 8X"R /R  0nP 0 +r  R:Y Yy)     SP R0i* \Rf  uRb A P\ +r PX*6I0 r 0 P P#*-"-  P P* --  &0     ) 3 3\O- M@ @ 0Ds0S<_QQQ  0>S 0 T  @P (0SP  R @$ ЍT" T& @v}P0 S00~P @P P rPY0S  0S 1( /GG-P-Mⷁ`1#@PL ,= pC  pF 0F fpppS>0 吆P P7 u&  Z0 p `Oh }$Ѝ000 jp``S h$`Ѝ ` ^$Ao/A-PP #P`p @"@PG$@@"@P p40,p0P4080<0Q x  @-@  L@-$@@ ؚ ,Qؚ՚@-@q@nO-4@T ,p šP @Dp@Ѥ@T `P煑Q800 0WPZ PZ P , @-R 0P< P 4Q ,  4)`0 0+0 0$O + +p@-M@4 00R1SP,0S@R 1`V, P` 0 0P 40, 0C40P" `ЍpS" R}#y#ЍpЍphZ<.0Pyj?.0ڜ8co?.0Ӝ iN?.0̜ * * *t *XA-P`,p"@P W 0 !,@0`@#,@0`C-`0M@SPpF  P&# 00Ѝ!0 .P ,0SV !0 v/P ,0S(0S0 0 0|P 0S?0S0"Sr0:S i0}S "S000"S voP  iP \ @@ 0?P "$w?{/0( )X ), (8  '0p@-S T  Q @P Pp`0!.0K\ 'H0S ,0 00{ @-?%.0J '40@-S , 0C40P @ 0'>/0o?/0ڛ & &80O-M@ Ѝ@p` MPP @ ` @Ѝ訒  %PP0 004QY  4 ,R\ 牱 0Qv   P 0YIV  B B! ,0 P 04 `<0 4 0<0 BP,UM<U7U+p Y& x t@ e EP  ᫘PP( \ 0,S<SS8 !|PU @<0 P`04 <0y<: ! ᶃ,0P ӘYP  |,& \0202.0HW?/00?/0 t H|t # #p #Tp@-@PP0S D  Q<0  0p@`0/0F "p@-@P 0`0V PP h d0 0 0@S<0  0pPp `0/0⽚Fh< "0O-S M@PT p}`40SP p `SP@ Ѝ6P P 00 0Sr  A> 008PW 0 S/ @0R+  P$ []  P 0 P 0S  P( HqpN4` ЍO| 4 P 0  03/P  40R1# P P6>/0+Q 00C 0 P h`@yP?/08+? 0 E !DE D< Ch x \@-X@=0,S<SS~ ?/0 PG-W pP0`WTW@7 404 S @  S4 F000!,0 000,00$ 00,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<!-B> 0ₙ 7-F> 0zA 4 G-PS @- Y`' T 0p 0R  w u 004 00R$ {P d 0S 0 GX1G>I.00<I0,S <2.0-@  G-`P& 0 0R! 4MP 4 R @,0Q p  ,04 P@Tp:80#  ?p0P 0  Q@-P80080/>p@-P@80080p@p@-@P 80 0R@ pP4@p>Dp@-@P \0 0R@ p`P00S@#:p@=p@-P@@pA-PP 0 0R4p`40S @40@S ,0Pw `p=PA-@P 0`0VpPa0S P @T <+? 0V@@G< A-`P /o0P0"Q@@T @0R p. @P @T #@+? 0; 0P T@- ^ 400\@4/ <2.0;L 80P @-op@ T\ @\400\@/ <2.0: @-PP M 81 0R Ѝ`@80  Ѝ@ LP 4 0R S *,\$1 B!p@5400C40<00<0`uK.'> 0⛗DvK.M> 0ⓗ(wN>K.0 0⊗:H  x X P/4?o 2 R0S/0@ S/80P D- ?o2 ^0S 0 S /8P/0 0@0R/8PP/0 0@0R/8$ P H0-0/o@0"^ R  RV /7 0S /A-`@PWpP (0Sp 0P  pAd$`7 `7O-0S@9 0@S7  ` P. X6qPp@ P  P  P HPX0UUUB#1 !0@<  ?,By PO 0s0L d⸖X% X@0Pp#r 1 dP  G-@` QP p 20 Q0 ᥈PY @P Y7V W'*000p@ Q<Q =Q R YD Y<RT O  <R R B^0 QY 0UpS 0Y V W*V0 X " pV0 X ! p<R@ O 0BSP=R   <R R 0 .dɔ/  P/0 00R/.` P H0-0/o0"^ R  R/.4P/@-H@T ?o 2^0Sso-0S A-@(`MVPP !0 f/P $0S7Ѝ/ 0P `hpP 0 0 0 P5 0S2  qxP* V6 N@P. F0p0 `@l ` Mp` 0$ 0R0"S x>k/d"ЍM0"S@@Pp < ,l /P/< ?o 2\0S /0SP/+p@-4P4@P@ 00p+D0S   0**@-@<<# T (@@@@ @lޜ8 @-@P (0 0R*dP/0 0R/*(P/0 0R/*0P D- ?o2 ^0S 0 S/)0S /(0p@-S@ `P0` P 0P dd`@ @ @g@p<<<@ @0p O lA-PP P`p @A@P@@9@P p<``0` 0,p0P4080<0(@-@ @  @-R 0P< P 4Q  ,  00Q0L tV0L t( PG-? pP0`W<W@ 404 S P S -000P,0 10,0$ 10P : 404 SSP P00 t⡒0 t⚒ ` Dp@-M@#S,RP, R4S 1CaV' P` 0 0P 400C40`ЍpR Sd ЍpЍpLkE?M/t^4|n?M/tWlR?M/tP T 8 A-P`,p @P W 0 !q,@0`,@0`00p@-P4Q8 @Q ,4 ,<040Q<0pPpoE?s/t  @- MpW3 0P`@S$  &P 00 Ѝ 0 / P ,0S p @0 @P  Ѝ0]SRw?}/t̑ 8  p@-@P 0`0VPP d `0 0 0@S<0  0pPp0w0/t⢑"t `0G-S@PK Up40SG |  9P@|P P 00 0S=P6 0 03/P/  40R 1#P& E`P 00C 0P  B@t =`G lL?).t9_(?).t/!!   40S 0C40/@- =/t H0p@-S P  Q @PPp0i0/.t  p@-@P |0`0VP0S R <0  0p@,00/tސ0w0/tؐ P 8SG- p)W@ `V 0P 0R 00 ` V 0S  G83>/t⠐0,S \KJA-PP 0 0R4=pP 40S @,0a, 40a@T:8 408 hp@-P80080p@-@P 80 0R@ pPM0@JpDp@-@P 80 0R@ pP94@6pp@-@P \0 0R@ p`P$00S@#:p@p@-P@N@ pp@-P@80080p@p@-P@8@@@pp@-@P x0 0R`P40S ,0AT p@p@an?/t؏ Q &Q ĐQ P ЍP Q Ѝ輐&Q P괐&Q xPPU a/U`U"0E'S0 rP\bP ]P PU /U\U fPnPtPbPUt 0  PO/QQ 8P(0F/D{ x 0S p@-P@ Pp 0@Sp/p@-@QP Q  PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@#0Q/D  0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@Q0Y/Dԋ 0p@-SG@`PU Q Q sP<nPp PU Q bP QPU Q UP QpPQ HP Q/@P >p@:c0-D​ A-PP` 0Q`pp XpWVu@PR  qPK V<`p p0 8/PP`<`nQ P P 0S 1P P PPT P /P P 0 P  Xp@-P@PP ۆ 8P8`4`p {z011/@-\M@p`P \1S 0 € ( P 1ЍP (00p` P10 m @,0A0 4ȊB`0 4 , @-@^ P ^%QRS  T000QNRS"  TŒ 00Z0 4⇊ ,G-@R(MP00Q P 0 ` p Pl `ኧ0T?o20S00(Ѝp`0 t-0 2/   \-0 2/    \0 0000000 0 00Q0/0 0000000 0 00P0/p@-@P(MP`/ 0S, R00ƅ$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  /U P0V00(Ѝp@ R 0S V00 hQ0000 00/@-@p00T08090:^@-@T @-@T000 000S/@-㕋p000 000S/@-ㅋp000 000S/@-up000 000S/@-eTp000 000S/@-Up000 000S/@-Ep000 000S/@-5p000 000S/@-%Tp000 000S/@-p000 000S/@-p @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#Ͱp0 02#/ 0 00#/0 02# /0S@-@1/00/T0T0p@-@ P`0S Ppp㏊$p/000 000S-/@-}-p@-000 000S/@-jhpAo//p0@-@ MP  vHP Ѝ00;0 r Hp@-@M  wDP pЍ0;0 Y $p0@-P M@ T T T J 0 Ѝ0 H@ Ѝ00:0 4 p@-@ ^B @080 " p@-@PP (P$Pp070  p@-@PP (Pp070  p@-@PP $Pp070  @-@P  <Y.+ < 00;0 ڇ @-@P (070 ͇( @-@P $070 ⿇$ R/-~x` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@  P//-~x` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@Pᔂ8U5U5E03#0@3#C#!@11@  /  fp@-PQ@p : Sf G Sd0 ] Sp0  S?0c0 !-0r-w0-0 R00G >Rx  -   r -  w -  Q  1 &Qx-2r-@w- TT Tt T-x:0p Ss0  Sw0 S?0l0Q s! R0s  SS   S?0b0A0a0-0090 _ O-P,A@:  ᫁pP? ɂP?  pP% 00筁` 0@T% SP0=S AP` AT BX ! ܆맂ቁ<0>0  00h `2PC-MT0 @@0DH LP@h X`P @刐@@@@Շpk pp ·p` Pm n   p[ X0p 0S4@8@<@@0R000000*00+3+0+)@1@ 0 00@0006*X  "꬇0S jp@ ㄇ 〇 a Ѝ `oЍ @ꉇ0 0 g a ]  \O-PMp 0GW"S00` 0w@P-TPh +T@`0? ǯ0 0l 0(l  P  Ϡ@00Ds Pa0DSW0DA0DS"70DWu Y :\ Q SP P"000T; W0 0p 0 U00S 0q S 0F0 Ѝ0S U @0` 0000S   Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR `@H0?0 ⺄SWppqW  |0M0 00Ѝ63O-PMp 0GW"S00` 0w@GP-TPh +T@`0? ǯ0 dk 0\k  P  Ϡ@00Ds Pa0DSW0DA0DS"70DWu Y :\ Q SP JP"000T; W0 0p 0 U00S 0q S 0F0 Ѝ0S U @0` 0000S   Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR `@H0?0 $SWppqW  ٨0M0 00Ѝ6p3O-M`P؃@D@ [Hp0V:V\ U0DPW pT"S 00 @00`Ѝ0岅00寅0 0L0u@᥅0S 00囅000S0S Q +:[ -:0SV00ЍW00 Q0:[00:S0S @ X0K0 kV<MX0 b"00@ "00 -M000 0 0 000 0 tЍHoO-pP$MS@PHL T P0S X0S h30 000@ 000@%0 0LP`0"SX T 0"bC P 4$;RPF` P 0*S xS S' "0 @ P`$ЍX0 00T0 0P000P00S5#0QPP`V 0aZ0iP 00$Ѝ5%&;RP"00弄z !0 p!0 d ?/&1RP:*&6RP$0SPP ` 00 0 SP00  TFH0 wP0S?T0 m7t 0P T  `|nL 0P T  `qc ֘ ՘ p ԰ Ԉ d 8@-M@" | d@ 0S H @0 0 |0 30Ѝ  @- `-M( , Ѝ mD90 0#0/00/G-@SP+ pE`J8-Q" 3-Q JIXP0 S 0C0P Y 000 ˁ O-Q,MIp@ 0U Rg 0S 9 009 P0S009`0S p) `)` \  T)    @2|PU0+0CQ I @p  q 0|0  0C 0B00 S00QG 00X0-SQ\0{P0-S0   1 0,Ѝ8H0@q0p7 0  ,ЍG@q 0 ) 0 B0C0@匧:Q  3 0+ B RRs0 P& WY :R 0S0007@0| | -Q0006&0 00 00$0S `="sPr A 0Z @ @Pp` P@T }Pb|2 PM v `  Q Q  0@RTZAgv 0 Z Q! 500S 0:S h  B0SL5 00+ C :S:J ? ,Ѝ0JS0 SP0 S,ЍA |T_PX `0 `W 0S 0VlTPX` H0 L 0S @H0 B 400S 0:S   z3 0 ah0X 'k;R0S00'X0ʘt3 00S 0:S UH3W 0 0+ C~0| 0S /0:S  X010 2 0000S000200S 0:S h20MQ 0O000200S 0:S @VZ< 01 S0$0002100S 0:S 00C 00!S  00 00+ C H0  0Sh0 aT10 4h0 ay 0t!0 00S 0:S 000+ CR 10]h0 aP((h 0 4< X t| < D ̀ X  \  ʨ @ ɴ dO-pQ` V 20 R" P@T60㰢 0R1-[@P-T@PC T"dRPP 8qPA -@1q0P  :R9 2 0 0S" 000P@P:T0S! 000100S 0:S 1d 0 ?@0Sl1 00@PQ 0:S  XQ 1Q:R0P@P 0S y0 0 P0 0P00 R0 {~VVST0 r~Nl0l 0 P( 0p4  8 h ǜ <   @-@P  @0/0 D~ @-@P @D 0/0 5~@: @-@-\" \ \ R2s 1# 0 P010 RL^"0 s 1# 00  0^00<H0 }$00 }T00 G-P `@p0#03w00qW@D T@! ~ 0 0R ! P  @ Go~0 pQP@-p Mp! @`8P tPP& 0@p0` 00 p0@P  Ѝ00@ Ѝp@ypv@Pq@0 0 X (0@- @ @X tp@-@PP` /o0"p@ H040 ?} Ì@-@P 0 @qH0A0< .} Hp@-@PP /o;"p@ ]H060 } @@-@PM 0 0OPЍ000 } 0 [p@-@PP U r00QUPQrp r00QUPr00Q0/0 | ¬-1@R !0/A-pR P@a@T T0 1 !3/pWG /p@-@P T 0p@/p0@-Q-@M< 0  RPP{P 0080P@D0 Ѝ0RP ~ 00A-P`pN@PE 0U0" V W0 p`Pp`P{P/ 0 㼀0@ 00D $P,`(p0W pPpPV W |px`p`lPP```T`PP`P6~00\8`8|p@-@PMP% U 0`1S ,0S  }$0S  } pЍp4<80 {0;0 { d D@-@P 0S# q0 P @0P 90 000 01 1 00q,0<0 {} 0  p@-@PP$ U 0`1S ,0S  |$0S  |Gpqp4980 {080 { T 4p@-@P q00C0S0 Pqp8P070 m{ --M  {FЍ Ѝ/ -- M0 0E ЍЍ/0P0@-$M R P @0S'  S%v0 040   B! $Ѝ00vP0 @0 P00 0S$  | l P  {XP 8000S(/00//{$ { pŸG-PLR 8M`SQU4p1 Y\ U8   Q Q  2 @h qvVP  h .@dvPV$!1 0 40 30=8Ѝ@@(4P0 zY) @P@ PU wP 0  0 | 2  /v @Pd@P@XX0( 4zX0 |zn%  x H 8- MF ЍA-`p!PPl1!M @00<80J 4000p40 4pĀP !1 0 <8 309!ݍ0  @00 p BPP@T Cn`4 P8T嗀PEwP @T@ (00 z$Ո( \ !1 A-@P0!MP0<80c a 0 ` 4 4  _P@44p pSP40@ 0@0 pp ݊PP"@T Cn`4 P8T2PvP @T@0S  T塊x d0 0 <8 30!ݍP00吊@800D y$\ Ґ O-@$FM`4 M PQ0琤t0d40㘄 T V Z XX (d 0K00;P0S 0K PW  0 P(00_P C$  Py Pt$7Wk ,Pk(.,,_P $$W ,  =^ $#3 0 d4 30Fލ Ѝ|0P3Ԓ M(vP#vPj /O}P@@W  QR C0Sl SJ\"0 0 W?Y/@W64 ZD0 I;PB/y0 xTEz0 xV>{0 xZ7l_0 x/P!0 W/ 60/$0S㈀|! 0 -P5 0 0 W?.@5 J|M#dEd , | \ 8  H  @-P0Ѝ @8P`^?A. 5rD;A. -rV$]?A. $r X 8 @-@ M 00  @0 (0 0 0 30 Ѝh@-@| M 00  @10 (0 0 0 30 Ѝ|G-` @PP  Br0000 C Ra CREp0pY)00 C Ra CRA CRS:Y 00Cx QaCQWC@00Cq PTaCQWCPACQ7CLS  0GSRQY / S U*@G0 TT-@A CRS` p A BRGZ00V0SZ  Z?0V*Y 00As Pa0ASW0AA0AS70AQ @ 0 Eq0 0Cq P0@p W:aCQW0CACQ70CS }h0 #q000GACQ 7Cz`0C0 q FpbS~ @]$`@0 q ( O- l1@0`@? ` R<T !4*4.0q0 ,p( ??p?0 SP#20Q *00\*0V0 R* Q *0V000?0R*00t?RPp1?p# q R ? Q*:  T: vvDv<v4  uux@-PL@ MH0`@p400 0奈@ ЍDd@-@PM 0 00T0@ 0@ 8 Ѝ030 ]pt @-@P(M# $0 0 0 p 0 0 m;P \0,(0 $$  (Ѝ BX0d *p s p@-`P0M@P& T- U3 ,0 0(0 0 $000P3;P)0 <8(4, $0 00Ѝpx0 oTX00 oU<0 oq 0 $ "2 O-P0TM`0L00s Vj 80  00A 0@ 0 PPP @p 0 p@P< 0+S+0S((A P,0(0 $0 00T P0 $a,$,0S, 0 0 L0 30%TЍ0  FP ONP,cq00L0Y0 Wo4X0 OoAP 8  !1 O-IM0p010jWX mPPO l@` 0 `1@P; 0+S+0S(P  0   P   a0S\;, 0 0 1 30Iߍ P lP ,p00,00.n  0/n8 0 p@-@P0MP000' U  `0   ""88 0S0 0h \0 0 0 30Ѝp!qPP(040 n( X ! 1 @-@PFM0 Mp0d40. `P!_PPd@!_+N P jp@efp R@\ T0 0 d4 30 Fލ Ѝ(NL0\ Hn:$l @-P pP0dM `00\00 @ ^P H0 0 \0 30 dЍ(hh0t n  77@-M8@ 4@D[0 <Ѝk8 P1Spp// 0 0@-PP0M@000& T MP0 ^#2 @@0L00(0h \0 0 0 30Ѝ0)@P(0F0 m @ G-p!@1M ࠐ0 e040$UVPF0Q T0Cp +t@P1  ^PUo0 ;u0 U@ a@P  KU0PUo0so@noo@  t 0 0 4 30܍_oPZ[oTP  0 ePJpx`|P;4- M0 Ѝ@-P pP0dM `00\00    *P H0 0 \0 30 dЍ(T0`  mt X8 80 O-@Q0M000 0S P@@P  @0\9P:ETp  @Pb!  !-< (  " HP XPd8@@.D@\`-a@$ @ M @b!`,! .d͌ dAh"+ P% (  ll $ p' `&n*! ,   " p` )t@.-@ p'ap p(x@$ pp p @ p%PMPb!,P!PP%p͌|pdAP)(" + * (0 ]lᄀ $ eQPP+`&_p'`&*!毠) `'L``p` ` ,` $ ". ``@&`+-`&O `&)o韠(`(`&( `&, .o `*. ao )` `)((. *+꟠40)럠4 ( * +ꯠ (뿠00菠L + p',ꯠ p' p' `&pp ⍈pb!p' 4p͌`& `&``0P%pP%p!P%php'P" PP%`$P pm@$@$l@$0O$@ @(0@ %@$(@. ". @ fa "P/(  ,. $P " ;>F`@& ,-@$ (a ,,4@ 쏠@$ @)b!,`P! @$P%@$͌n䟠@@0@P&(` P `PM,"+ 0Pl]! `.!+ `&dA+ `, `&  `eQ &$`- +.,`뿠.`$`&`0 ` &`%,`&,b!Ϡ (@ `͌*`*@ `@$P`P@n]@$0`@$ *@$`" `&lO@@ꯠ@@@`M `  `.`&eQ `  ",` "`, "`&dA/    $ `-&`..`%`&`   `&` ,,`$`&b!Ϡ$$P (`͌P%0`P%`P%` `&n_ PPp'P @P`"p'@ `&]p'(@l@@@(`M &`  `.`&eQ$ ,` (`( `)(/(  ,, "dA` 0) % " 0 0P " "!( !$m` "!)⏠ $ "fa0,n=, /H @ +@韠+ @@c1@ % PaA P +0 뿠`%,P! !PPnP $P * *`Q *0 (0&`0#0͌ꯠ0#? 00a00@0=&`  O@lA  &`, ,Ϡc1  P&,` P,`,PPϠ`PP&P ! `! ] n0@$&` @ o `eaPP(0p'0p'@p'00 4p$P0np@ @@ M 0%`Q( 0#0#pp p, } dA ,` )4`)͌)`g`p?p`` (`p (m(,$p pplpP0pP%pP%fqP% _(P P ` P`PP@P`+@+`+0]n@o @$@ + M ( ( eP菠P  P 佋P, p*4 p' P%( p' P%  dA! b*L40,080`0``)080 0 `&͌k0_00 `=&`. `.o` `$ `&l` `&`&`&_`4P P+P%@@Pc1M`)$P `&`&p Po``, ` ,n` 'pmp0#0#dA..0,p=faP@$@$c1 @`&M`&n0#`0#m0dA(.=.,fa0p@$@$c1@ p`&M`&n`p0#m0#dAP.0.=fa @$,8@$c1 π@4`&M`&n0#`0#m0 dA= ..fa@$ @$@ <@-`Dc1HP0#0# t0͌p  0 0 30Ѝ@X0 Xha$00 QhTC | |@-@P 0+ EF/N Iv 2A!#L0 0d0t /h |LG-PPp`5 W+ 100.!؁0% "0 0%0?S@@h  i 0hS@H"p ` *0V@@p`F  Gh80 gd0 g {\ {p=Ffk TDp  , e[dK|l`  j, 4ˆn! ᘈP  !`k  < g{!4 l[L(  , 舊ilL8 ,` h a LlɆ`H`  !h` ` 0`adK`` ` PPlˠP%PT`p ` p`HY`&k`p ) a{fii\ )` die[ P @ @fk@$@\ (aˠ Ih`  (i D荎p`  *` \8pp .*X a{ndK   "ꭌ %hie+!4P, /HP P0P P,@nɄ@dP* Pa0 0) P%fkj錈T@l@ P eZ\0! M0,0p (6m:Glɇ % ! h e[PPPPPXHp$Pp!P`,l[ !0dKmn{ @ . aP ,  . l̈`4&fk   ,la芄 !  <@`lɇ @(\ @h  @$@p@. pp!l[p,ldIapp'n p `k g},d 0$  , dK ! a,<j D' !lɎ `L g{(`a* j荆 a[ !, 8 !l@ lˠ @@d`` @.`@`@$hpa@n`(pK p ` `& ``{)Thfl D !  )L` $ *i PHa &dK * 8]fk ͈ X `  *h@00 p)p` p'ip % e[ "gz `0b,@N=S9J.@n!l @ @a@$(l0 @䫆`"X@,b+g{ ͅP@@@!D` H` `` aD$ j! T ``PP,P%`& PL`4lˠ[dKj p  p'` a{ b* n%$!  P 8e[` @" @$ @ fkLdI$b8 !,a ,   "n H)lͅpPPP%h P` eZ`$ `&`d{@@@$b+ @$flM, .,lˠd 0d $,e[! <a\0 &<0fk 000#` 0 dKa{9 . "n -T, (!lɅP$\`k  c,:" b+ @  ` lˠ. np p p, " "ac;͈  00*P 0#0 zn c- p tЍG-Pp 1Б0@@i T0 Y?W@` @@@`"VT(@T(pG  Ga ` a`i V0@-@M P0 1 3/1 @ cR c B T 0E P,̠,ĠD 80 0 0 30` Ѝ0@a? n ^|mdQ- 00 R- Bx@-d @4  R  *4 8/N8 x0 S\ R `0S Р@- d@ 4 *8//aBxM Ѝ/;R! /Q/--M  Ѝ Ѝ/0  0cL <cGA-@PMb  `Pp0 pp pY Z ,0pp  pM P ,0pp  pA F ,0pp  p( P0@ 0 20p  B@RQ 1 ! \% +0̠ p`Ѝxa0 Ss<0<0 k_  Z@-P8!M41p M@p0080: HD`p  LP3 * 0 0 8 30)ލ Ѝ"|Up `Pp 8_LP* PE0*P>:a(0B0 _ idh Y Ytp@-+,@@PPp`0Pp/4C-@PlMR `QP0SI pP@8@@Pl[`f[$0 `(`_[0PPP$P@@R[`pL[$0`(`E[P PP @0@8[5[lЍlЍ'A0H0 ^22 W @- MPWpqp1@p`PP@@T 0Q }P Ѝ A @WP @ Ѝ` WP"0S, -S?@0 0000 `  V RP +R@@D!0DS  `WP0S +S!@?@!@ Wf4 WxX ?P L0P00 1 R/@P/!R/d @$0>R0 00//dD@-Mp @_``PW0D P>S 0!3100 0_Ѝ>SH 0!3100_00_00c/-p@-M_@P@U0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, (  c.$ T. T,-A-@PP`p< =U( X0ES  S0 +0E0VP00VP&2!0` `000+W -W =W00V-0`0=+00+000@00$0]0 J]00 S Sxp@-PP@D ,a `0RuSpWS4X0CS0 pP0R Q PSPQPQ  0   I0 0+S -Sp0b40D \ R R$O-TM0wSp _@@0`  TR 0(0^ @(^@T%T7(P00p00000G, @ 0 @8$a0GS00 ^00^@^@PTЍ+W = W0 -S0000 0` X B R  = GS/o"!"   ( P:0,Pz^ ,`s^ R, "( @0偑@P(  ( 0S# (p W:,PX^p ,=P^0S,0"@(p剑pGPp(pW X0[0p0 0I00(ppW ,Wp`uS(`! Y0`,P'^ ,  ^ Rn, "0@(`剑`FP`(`  v`(=W +0G?oR20S$ Y,P] `,]0SC,0""(` @႑`FP`(`V 0[` 0I00X00F0(` 0 V:,P] `,]0S,0""(` @႑`FP`(`0X 00&0($ KR; I?I00 KR<I ]$ 0@$00S`]0"SA  V*(@ T:,P] @,w]0S,@(00CP@(@Tx - ? 0+ 0 `0TЍ'p  001]0 ^[1]0 W[p1FsQ]00(0UpJ 0{+l-L +B XR R  0+B -R +R XR 0 -R  X@P`QpH0]0 Z00o0P Z_ P Q K K JH J,0@-@PMP  0 @ 7p`Ѝ00:0 Z JP 0 @-[/o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`L+PLU PU  0  PB@P PPr^P \000p@4000Q\PLJK\P H H\ H00p@-0P`@T :@T0rS 2Ppp@*(P0+Spp@(40@-$M0P0 200o 0St ~0P 0O 1 00S%hVp@3 P" }V0rSC A0 0Pt1 h!00 P @00S5$Ѝ00@P0T X\49[@IV0 00S  [@P0 0Pp 0P$Ѝ0T 0 Y8@0 YTHp&d F$ EX E80@-$MP !e 0Sj 0P0A 1 00S=Gp@' P 0rS; 0 0P[T1H!00 P @00S-$Ѝ0=B[0 00S@ 534[@Ptpt0 0Plc0P$Ѝ0P 0d Y4@0d YRp$t C4 C@-PPPA M@I D1p0S+41@T4 `0`S@' 0S 0V0, 0S%PZ0S  =p * Ѝ% 0@T0S hZ00PD  08l0x XOp""8! AG-`PHMP6 p00 0%p@  p@ HЍ P 0 p p@ HЍjZ0S @X@0>0 [X;0P R@ @O-P4MP@\p W{X0S< `00 S 6 040 0?!S5 0$0 0;!WoW0k Yi X00U7:GS> G1@000`"  0 P(0@`0r05`0D0$0XS 0S>0`iW A,`0 ZSVW ,P@(05#K 0T`X2@ 0 $ $Q T  S #.E!b)L@T(\/H0#"A $1?"!": # `V4Ѝ3 00 0;!l3 00 0?!dt30$0H\1Ld0L``00|20SpT,0 P@ `!`R Q0V0 P ,@Pt P[$:6S T00U$0%%>!E!2c(\/H)L0TP%"1 #1O"QX0 "0 0 0$00?S%D PP@=`|S8 5HT1>O00` 0 0T &.60S 0 0P@0(0P10X00`d(0@t0P`d(0 ]R  R0@< D > = = <` ; : : :O-PP M@`o Tu V| p0?T:R P- [ P2 * P*Pm@pQ @T*RP [ P * P R 0Q[ SQ Ѝ? P @ @0!0\; ] \ @ -p R@]p\ p W R:\#Yp 00 .VTp80 %VVPD0 Vzp]@ \ 9@ 9 8p@-@PP U p@6GHT0` UU(Eh0` Up@"G 8x 8TG-P@V T] Pp0ppS1q W00SaP: P] 0S\ 0 R0C`000PP 0 X= V  0s00S0 00Q 0 01 00S-*_oRe`VoP" U ! JVxt0 UTX0 U<G0 xUxW00P 6 6 6lC-P!M1@P M`0040$ Q? U5  0s00S 0@ $03/!1 0 4 30<ۍ ЍQpCp0 1UV U G0 &UE0 UlD0 U0 DU8E0 UAA, 5X 5$ 5 4 4O-MMMpT&P0H6 @0 TD040e^ XA 0SH VO 㰰VU[0*U@@ R R0 0C?o2 000$0RU0 S@0E0`0S0000SgV ,0+0FA 0@ 03/[o 0@ 0000,00G(00 3/ P    0S00 * y 0.S Z~0S0 Wx:0S 0S , P80: S $ P (0J Q 1/030J1000@P}000$0 000S 0 P)80: S%V 00S 0 0 0s00S P@T  0s00S"V4/P/ 0,0" $2 MލЍ  0.S0Sn 0. S}j0S  0@0L  2/0S0>  000.SQ ` 3P J0 @}P@ @g  2/0F(100+$0  0`0P0`/0C/Sr0U R0 =D00 S0S0 SV0 S0 S0$ /QRyU0/(0 0 @ 0 3/0| D C0uW?? 3 X8     P   t - M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF-pP @P Ѝp\G-Pp= A@0S%@@Q0)耟lPPR @@ P %p0  T*  p0 p0 $0<0 J p@-p`pP`PS@T T0T0 R@@Gp᥸P00<X0A-`pP@p@.0S x@@~E R"@\ J@yP00K@@-L 00 d@-`AMP@QDpP 0SA|0@@V ! @p UpЍ  0P  R 0QTG B&R  8A@˜4㿘P⺘RS' S@p S'@z@ @S@u@@S 4⛘@q0@@q@4@⏘64q㉘@0P@q@4 @; t H , | 8    O-BM0S;!  A1@0@ \ 0P 0S k\10\ 0P 0S ~k,10 1P0P!0 $ 0 =0xS}0S y00  00 0000@EP( l  |X  `d0   Pd   ߴߠT 8(p@-`@@0S P Dp

<@P RV@P 00 T+ 0-S T@ V R]R@0 @ T$ r R]R \R] SX00@00 P   R   U/R S /S T 0-S T  0R\S @0   @0kR@ @0]SN -R ]Jo0X@V ~R S0R H0^ pU[ZS 0^ p P0@  U |<0 8E;2{0 1E1Rr0 @  ~! @@f 0-S T @ 0A 05`! @OS 0p0C00@P0V0   峠zZ4 0 Pg/Z  &   r R SR0 l /7=0]Sh /Sl \S @0P@-@ P F 0 Q <Q ?o 2c p@-@l`P`AP AP T00pT 00pxF 0 p XO-M"0  "  pc P   1 0230Zߍ PT 0 p H  P7 R @;` 0  0P P& PP 0 pP 0 DzP0@T*p@ E 0 ŲpP E - R  HO-M"0  "  ᒲpc P   * (1 0230Zߍ PT 0 op H  P7 R @;` 0  0P jP& PP 0 WpP 0 <P0@T*p@ D 0 :pP sE - R  Z (O-M"0  "  pc P   1 0230Zߍ PT 0 p H  P7 R @;` 0  0P P& PP 0 ̱pP 0 ᱱP0@T*p@ C 0 寱pP D - R  `p@-`T@P@@ [PPpP,P p tp@-`T@P@@ PPpPP p p@-`T@P@@ 7PPpPP p 0 00 ~ -H- M0 S0 0 0 0 00 00\100M\   0S0%8 00 0 0 30KH Ѝ/@`-H- M0 S0 0 0 0 00 00\100M\  0S0 8 00 0 0 30KH Ѝ/x -- M0 0&--M  --M  A-PPp`p V Q @Q PD@h0 0000APe@00 A(80 A0 0P R   0//Ht't7 O-@P0LM0D00 P P47f/0WBA00 00 0S* R 0 :R|RV F P@ h l 0p 0P `t>PX00X0P: P 4& X00X0$$` F @ p$0<(0 p$000p 5$ 0,  p 5$ 04 E @@P.h $\50 vL p$0,% ,00 E @ U80P0p<@`(p8 408@$ 40<  40p".$ u40p" $ id4d0p" $ ]<4<0p" $ Q40p$  P  E30p$  T  930p$ *  -3@a@0p $ * l# `  400,40,̠00 Ġ 04!!8..<""@ ' R 9 @0Ps@qT@  A@=@9@5@1@p㔐 (   p$   p㜐 $ R , p ,<p p㠐  P , 10@Q0 P0` B\P"#$#< 00 1@@t@p$005T0hAW5V2H@00\H!0 0 D0 30LЍ 10p"  =PX00X0whH0X ?,L( P @  XȰ Ȁ @  ` @njt D   \ƴ ,Ƅ T T @Ä p@-@P? 0S0 @;0@0T;  T06 0R/Q T:\& 0 \/RT0C$/QT 0C: B0PU0P!Tx00ph@@@P\ l@0@@@@0/S (@@@@@H0  h L Ѝp :   r%p@`$ תレX$ ܴ00 R ׬J,@-=?00 0S@ثd51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BP`=8 @5P PXY  P (@-P  1M@`00\ |p\ 00S30#^0#02S000R@0 t d0 0 2 30ߍpP @@ @#(@0$02\O-P 00YP(<Ѝ0 0P( 00 0U 00S# SM 0 @$`Ph08P `Cp @g7 P4P p W R0 0 @$`P0 `Cp @K7 P4P pW R0 (000@ 000@(Y(P(PzW0 GS (  !+S -S0 P000P児ಐ5P:U X P( .! @S \0cP$00 0(0v,50 P(]U0W,00h0p0060 P]4P+ p6P S4PP 0(P 00 S7, Y2# 0@ /Y- 0X 0 0H; 00P(/,c0 ,>0dS,0v>C 0C,0P(  E Ϡl b0,0 Y0 00 000 7 ,l,,0 Yv>C 0C0P( 00 0,50 P(0P(PY%S 0,,  ,00C0P( 00 0Yp 0 0 S0P( 0 0 0Y 0d 0 0P9 00ZP(YzY9 0 0HP(=0 P( Y0 0P( n1,,  Y,00C0P(k 00 0w0 0P(] 00 0i,0 z,0$I"I/A!b!b0C 0P( D 0 Br0 Sj0(0N0Y067 00P(=c0 ,N0S,0P(I  E /"bd2#,0 0 0 0 000Y 6 00P(Y0 ;0kP 00 S 00Y((P/0 0P($(P000,c0 P( 00 000  R 0s @` 0 @00v 0PPII0K1c ` @aa B 0 0 B  005 %!E!/#bb K/) P L@!(,"@aR 3 : ' @aR4 # 3!0 P b4t$ 0  Q0 00 00 0)0 51E2?3c#cK?)P( L%@#"(<2@bS3: 7 0@bS#3  0#0 00 0#!00 0C0 0 0@HP' R0PS008P,0YP @$`p(P 00 00YP @$`p(P 00 0 %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 \"  !1 00 B00DSd0,0ջ4 00(00N~0 S&0̜ ̌ ̜@̌L@X_pO OO @D G@Tn 4 00N~ Q@(p0FP^ 0(P0 0(PP @ ACLCq| \^JS S  00S3P0 z G/o("PzWq (PUSG ZSP @  PD00(00 0$0$  ՘ Ӡ P  ά ̀p0PE ,S#P ( P( P%!E"ad2c;S,0<2#TQ(P 厀Ḁ@CP(wMP P(P @{ @C>0P( $(0  @Y 0 @SYP(  00 0ebYP(  00 00@P0SM 00@I0S 0@B 8,00 0 0P , P(01(000C.$0s,a20a\Mc^ P#   0P , P(00(000C.$00 0M,#   0P , P d# (0(00c$060M0 00Ѝ\1A-0Q M@PHP PQ Q'|10h01 Q%dG@@ Qp ʵ. R$!  v` P:U" Ѝ0 Q0  $ g&f&FP`B` b  U8T 0 Ѝ\ H 0 01800 Ơ X L @ @-0M@ P0P |00Ѝ@-0M@y0P o00Ѝ@-<P@c`p@-PH!pD10M `@00,00? U5    P00Q Q Q ,H 0 0 ,0 30"0Ѝp ,Hߥ ,H٥t8 0 D;@0 f6(0:0 _6Qƴ Ā `p@-@PP U 0DPp P @p8070 B6U880 96 8 G-pP`' X- Y @1VP0PES  R D PEr0V R  RS0@0D@ 80H0 6XI@0 5 À `R@- 0BAs @ Q0C@R 6@O-PP∡ Mp T WC (1@PH F2PH  x1p`J b1$101S Y<2 Ѝ0F10P@-1P* 0 0P 10 0  60=   6`D<0 50700(0C0 |51d @-RQM Z@PЍTT g7@Ѝ,Ѝ^7 00G-`-p!p1@ MP0M050F ?PO 6pG @\@^ X0p00th0 O⤫00 TV3qύ@0ˠЍ (, R@P ( P t0 0 5 30ݍЍP0D0 4600@600D,, 00- $  M  Ѝ--M  Ѝ Ѝ/ -- M0 0_ ЍЍ/O-@P|Mp ` X X00?*a(00P @ P 00 00P ! !  EX\3?OPC (VP WQ V[XpPVppPW` ? `f0`0 IpPP `B48  0 c4W`00 0 00\* Ѝ孺C0 P P00J* Ѝ 0 :4` pPP V pPP `,0?0 "4g  @-@ M*(0S2 '0 (0p p1/`vqP0)  0 0 PUoR <0PUo) ЍP`TP 0S  0CPo)500`P)@-P M)(0S: |'0 "(0p p1/`vq@0/  0 0 @ToR <0@To)1`V ЍP`T@ 0S  0C@o5T00)500)p@-PPD 0eBS5 @Tp E2 Rp00P0 ˹ P 0S PcP0忹 00(廹 00 巹0 S,P 4P 8P p@@M@0 @30Sp0K0 63 tp@-P$@@u Qp@n\ |@- @@gQ@a[Hp@-,PPZ ,R@Sp[@-pPQMPE 1 @ 0`00S P 0 XRp0pPPS6  5'  U80C0GS0S0\^(:ЍU  !P\^#Q.S(p 0A a 0C ƒ0F0 2! ^#QN^^ N0 Qs0@  ̤4  R  *4 8/ 0X\S 040:8 R РS /LcBx@-Pp`E4L@L0@H@ఀ U  z +{ @-P`@J40 :A-pP␆`@P( T.  r0 SSSDv S00 S 00600000050  2T40 2%00  00l50000  @ 70Ls0 20-V00 ^V00;\ 40000 0K/l R000C000LS0 100C0 0?V` 000 00000 \ \ 00y 840000  70Ls0 0 h", 3010CP;\ cP3`b0D001~dPk R SXd0\Q|3 01K00 M \; =\M \7 00C00L S e0 D100C07"000 0  T 00Ls0a" 0W0Cs0Z2 F0nR  U50#\V00S003%V00S00&0F?o24 00=`Foob%d 00!00   00Ls0! 0W0Cs0 0 #\ 00 0P0f00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP;cP"dP700Ls000Ls0 0<00pP 00k  x X `  TO-RM@p 8 0S? XPF D P 0 0`0 @F/P? T@D 00X `R%R%V @F 00Z200ЍU 00?7.G00S\?7.=0 R @T 0E00Ѝ2200 " h @0  00  ߝ A-@R`PPm /.#C=1"#BbQqU> 0S$ RT 10 R RO 2/!1U 0000' 1/0P p $@0001003/0P!p0  $@V00 00 R (㘴000P3/0P U  R  SV  0S=3P00U ` OtOLN |(NNTA-@R`P Pm / "H0#BbQqU> 0S$ RT 10 R RO 2/!1U 0 000' 1/0P p $@00010 03/0P!p0  $@ZV00 00 R ( 00 0P3/0P U   R  SV  0S㤴P 00U $M8ML @LLLA-@P{ P*`Pw rpPg  00Rc</.#C="#2caqV8 X p+PXU $00|1p00S X1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(jP` p  0000S=P0000@0003/P 0<JJHJ<I\A-@P{ P)`Pw rp Pg  00Rc</ "H#2caqV8 X ph+PXU $00|1p00S kX1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(ӲP` p  000$0S〳P 0$000@0003/P 0|H4GT<GGSR: G-P0p`00S 3/0Y @IOP  T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /FEpSR; G-P0p`00S 3/00 Y @IP ʳ T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /E|dDPO-PPM M Q \ /\I  P (P>/\0p Pp 2 `I `\q @` /RR.\*  B R` `F D/00.0 0Lpf 0: S%  S/ L/o" R/\ @ DQ8 .PQ [0   YI/R W00Z0`# uᥚP.T  _(   RV -0/\p0#0 @ /R0 [ 0/ލ Ѝ@  ލ Ѝ.<0. [? 0/    RP Bx.00t.>00o.00j.00e.?00`.00A-@P Q ?P`\Pp@P 0P`V C.0"S ᘲ;.00@p@- PHaM`=  '4QP00 P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P F<0 0  - 0 @~}}p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 + 00 + p 00/=p@-@PP" U( PE0R R:Q|Q00Q0SP0@|R  :RRp@00D c+U$P0D Z+p  O-M MP ($ 0 p800D40x 0S 0S 0S t4!S S8h`P PP8  pP 00S RD P0 PD"P ` P@U"0 S* Z :S `\S S S 0T:H@DP U@p+ ʘP `P0 SZl[0@0#QQ BP6@P00S0 6 p0,P0040(000= P 0:R p0Rt4@<0 0 G 0(O<4`PD pP? :00`00 [00S  ` P  ᠷ 0 ` PcPv0Sа00aY@D*0 S :S ``[ ` @d `` 0:R& P0R 0E`F00S:S:00`0H F[0 D0 @   ᖰ0Cx `! pP 0H@D IpGP @ p ,P pU  XD0A0$0p#3 0 D4 30ݍ ЍP ɯPpS+ 00%@ ƮpP @⤢$3@00S0,P`U9 8`P0U3S; +@++@0080` )0SBh0` )0Sx\ t0` )0Sq8 P0` )i 増 垗0@0S> 00 $" !0A`0`0S0 3P; 0P0C0S 0000`0S00P 0S0 00停0S0`000 0 0P P0C0 SP 0`^00S`0`0Sʶ00S0Sp!p3`0 S ` 0䪯P 0P `0 0000Z `pG00Ph0W0S`J0000P0`0S 00e{00S 0`0[RP0000*  0 P$P!+" $P00Sz0`050停0SU^PQ E!p,0^W000`p000`(0M"W, ,0&0P$0$ 0 ` @0-S ]S `' S! p`0!0S40Sp!p3P 0 090X00 XPpG0SW ` 8P `0C O" 0 p P p XPpG 8`Fp0V-` 0 m㼈.pC1W, p!pH 0+0AMS00 Ym0H000C0SY000pWH R0XS 00 0, 0        H 00 0,0 B0P006 0B SA*n ,`?X047,` 040 7 0800F<0@PDPBQ + E P]  AQP Q ` 00ERS P 0 000 0XR\ 000S P 00 040pW W!80P $QWWp5m00A)Up $ _U$ oQ <`F@P 0Sp1*V V0`  ,0pVc  0,H  @j 00 400S H0S} 0 0 0P(UpoNQpiAQpd+ E" NU[ V0Ul IU~ X@ @`h  ,000Rl300YYl  m( $$( P; < 0@P P& 0 0#S5 Px 0 0PRS 0Sl  hP H iU nU' D0U 0 SSP? X 00 0 0=>0>,00S-:P) V  0@00 BH DH s p , 0t 00 @}i 00 ;00C00S0 S0p0dX0  R{ `  R+ p V0 B0 # RP0 `pHp  R\ 0H  R  X B   H 00 0SP HW pA 0 `0 000HpQ1wwH  d  x ` }R | x LX u$ sXL`P 0 p(` 0<00X0$0 ĥP7 p0C $ 0 厥p# P p1 ብp ᄥ0S (0PS0`0C00S 0S p㌥P0 0@00BVP (pY X 00 0y0SFP W( V'0]Yy Qw P Pm0@(p04`0@p T t``P `P$00 @0P, @0P,`4` pP Pi P P P P 0 $*00C7 00|W( pw Wy1,0R?0BH0R9  `-p0S0`0 Y1 0 P 0` S0 B 00 RP  <YPL`p 0` 0d40X0  R?o20S,Y/ `pHp0 ~H0PX B   H  0SdP H0 ` H00CPN ဤP p0CA > ,0 0Hp0 P s pPY0`P pp0C00S$P WW ,0z/,0ZA-@P`pU0 PPV@-` MHP@pB<0P 0009P? ЍaA-@Q0R`Pv v 200S8  0P1S010p F00v`0P$ pW@0PD բPP\ 0 00P0 0 C `C0000 Q  Q*RQ/ #@0000 B`0P#00P0s0 㚡P +00 #B0L0`0  B0 `` php@-@P {Pp0@-P$L M`T 0S pW 0 7/@P Ѝ{@ Ѝ0804 Ho0p o0M 00 0Ѝ]0A-P$LM`pT 0S $X  0 8/@P ЍF@ Ѝ p0 H90$ n0M0 00Ѝ\0A-P$LM`pT 0S (X  0 8/@P Ѝ@ Ѝ y0 H0( m0M0 00Ѝ[0A-P$LM`pT 0S 4X  0 8/@P Ѝ@ Ѝ >R/H04 m0M0 00Ѝ[ O-MPpD@@`VZ T6 0US`$[C 0S@ `V= 0 6/0S) $l @V 0S HZ 0 :/@PЍ@Ѝ0$lV?%.Hq0Hh[y?/^g0HJ>s/H^0`$}>[/^T k k| kX k0(@- @MЍY40@-P$L M`T 0S 8pW 0 7/@P Ѝ*@ Ѝ ?/H08p jT0M 00 0ЍXX001/@-Pp`x@x0@t @  U  0 R ᬢ$   X l| l,0㣈O-$Mp03H0 0 0P0t 3ʿ0 00P`! B b06<  @BU^PE @ 0Q4BL3@0 MTT MT   ^DP!q!@2 Q   "  R  R  \00T3p00 01@000@0@PU*$Ѝ@2 0M  00P- S@0^^?0 0p0  P 0J ZS0 | 0J ZSx R @ \1 0000 $Ѝ0\  v  p0\  f  p0\  r  p0\  s  p0\ 00Cs0S00 p0 0p0\  a  p0\  b  p0\  t  px0\  n  pq0u0PT 0 Dr RP0\  @p_WT k QA-@Pp`" rP=0D! D?o2]R0S p0T"@=0 !14 40 0 V V 0 P0 A g gA-P@p` P.T T ! DI632 0 A_T @0T"@%0 !1x x0 (0D,TS fO-`(p8SM PP 0p0D1070$0t1 0x10 ?o2V0S 0S W w@0P0  ؞0P0 [00 #0@ S PT- U T 0  1 #ݟP00?z PPc@T`P @  TP 0@T0P00IC1S@1@! 0<0`⍞pP; 0  00S V <0 G0CPa  5* 0=  R  5' 0f?  R 00 00 00 "00@\0000M L JP@T`P$> x@VI? n /P( YzS? _ DTP[0 "x0 x 0S!TE? n8 T# `@T 0 p9/P^00᳞属寞孞#3 0 D1 30 Sߍ@@B 0S`(O 0S,0  VR U 0 0@04p 0`0 p0 $  A aɠq4ʌP   !PPPPU@ $P,P U\*   0@2!p*>) `. 00 0< ῞p a D (0~s(@  20,0T0 0S0"7000P.,*{00, 0 R00(00S(0 00 00P4p 0S 0SV WTy? {4p00J(1$ @``,P Y 0[P Y4*  (0@0S(0 EQ >P U @Iw 00P0p0]QQ d` d8h c cp c4 b b b$MO-PMp 0GW"S00` 0w@4 P-TPh +T@`0? ǯ0 Q 0I  P  Ϡ@00Ds Pa0DSW0DA0DS"70DWu Y :\ Q SP 7P"000T; W0 0p 0 U00S 0q S 0F0 Ѝ0S U @0` 0000S   Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR `@H0?0 $ SWppqW  <\0M0 00Ѝ6#$3@-LMpP`@$0  00P LЍ`0 LЍC-P!M1M `0p0猑0<0l @PW p1 0S _P(2 ἃ  |P* sFR P $PPP) 0 0 < 30*ލЍ o9n5G㨀R 0 P P0n STP0S  娓@㥓JPGPEP(凃(噓/<P""Xp!p@-``@@{p@  P@P p#`{`p@-@P @$F 0 ( @ 9@-M@ d|p 0: S  zp  KЍ00ЍO-P-$@3,M00@ P0pST1p{U00Sz00y Pe0P$0@P`0 U  0 * 0 @Px `FP@`0 m {p P@PE0S8 PUS0  Y*0Pp R 0 U T 0G U@PPP @Vh 0`0D00@ @$0,Ѝ0 ὒ00 0$00S$0p0'P O 000 Fz +zp @ p @ 00 0g01[ 0 p0 0 0 S 0S[ C P p 0 S [ iD00 $  @ؐPP p  5p@-P P @T @JT0 0pp@-@PP U  p@  80:0  U;<0   58 5/O-pP M@`0& X, @T fP @W P51 5*P @ 8/P  00 UWK:P PU@ Ѝ80r0  Xs@0   4x 4XO-PLMp@< [ TW< <000$0D IP [ <0Sw 0WPD0`p00< 0G 000p 0 `;/PppYb* 0 h @( `P  R P`p,004P`Z ;/P R ,0V\P5P1@1*`Ip ;/P R <0  W@I 0@@ 0Y:W0@  Y:p I 0;/0P  <0  0I00 p' R` P0S <p00PZ0 ` P@000SCv 0 0` F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ P W 0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p, 04P8`0S"*$Q R0B 0C0 0W00|@D 0pS+ 0Pi< 0 {`<0 <S  ᚐLЍ <` UE W 0L0 0 Y ( 0  S``V 0`S`jp @@pPꊠ@ W[` ;/ PP @ pT00 510 *pp `;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 0EU0C"030 00c   S &0 @PCUP00p 0;/0 P0UpJp a%;/ P`pZ P000 JU0 0EU0C"030 00c   R 0Q$ @0JS 0J 0Q $0S 0 Q 0A A $0` S 0JQ 0  A<0SD s `00 P`( <0  0Ip'0 0W  dPh `R^'t0l txL0\ [cTy@0\ [8&@0l c 00 ) ) ) )x- M009 Ѝp@-@ PU 00S  R Q Qp}0P 0  P  pD0D 000Sp@-@(~P(~plpp@-PPM`& @T @T T0 Q 0QP ``)0`P 0 RЍp0i0 $V (p@-MP@Q PUP`0S$00600 00  >wP' p# PQ" 0 00CR0 000S 0S$0Ѝp 00 `$0L0L 000Sp@-@(B~P(<~p pA-p`@ PP 0 00S (&~P   (~ 0S  sP    0S `(~ 0S  00 p0@-@PMP ! P  0Pp@ @Ѝ0 0 S P 0<0   $``1@- (M0R0$00< 0SQR@ 0RSA!0 0 $0 305(Ѝ@@    (00 $\0R0$0L0S 0S ( !0$ R0 @P <0 0 $0 30(Ѝ@  $ $40PX@- D  R4 J  h #Th0P@-X  S H@ D -0( @$ 0 "A-`PpP@p U T 0F0 P U 000Q A@0?0 U$@\0 h "0 "000S x0m.!D900 /P0  \0\ 0 /t 0 0A-p`W$_ QNHO@A0?H8c` P@RX0X 0 0`a` P@@U `! tTp@-PD@@ |0S,000P p@ |t1A-0@Qp`P`FP t l|0dS AA0U0FU0!0, p000 0 L|?UU @P P0p0p@ e  B0B10U  ?ࠃࠓPL0Y0 4` |4l0 1A-0@PppG: `< z@Ps0@h0Q!-!0!1100 000000 0#0, 0# 00!R0Q0  00R00p@-P@`%1S 0p 1" R  ! R    Rp@P@`%1S 1 S  \  1   p@Q Q      p00 0/A- Up `QU @ @E7/P@G-Tp `AT P PD7/PX PPHPG-Tp `AT P PD7/PX PPHPG-`P@UpV1S @P@E  8/P?@P@0@@@ģYC !Qp    / @  q000 00W000 @0@S00 pPT!R1S Do 000  q@@0@@@ @@p p  qQ0 @-@"P 0 PCQ0 0 R QP @/ p@-P`@T0P \ 6 R6  0 T00"P ^[0000000000000`001T\pp@pR* /o" T 000 2 01T  p`^`  T V00pp@HQ `T ` R0\00 G-@ +pP! PX0PD@T$l``PX IG0@XPZOsw(Ow(0yTV  0 ?0@ 0D.00@-p,@@0@P0S@A-`@P吀@_}-P(p0@aaZO.w0XPOiw(0TTaV0( $0 00ܠִH԰0p@-05S PwP0SZ sX@ 0CR\wp@T P YP@vw l/p@-@P $PP $P p@cp0M0 $ p@-PP@ T  $0 !0p@/800H $wT\0H $n $ p@-@PM# $`0.  P( fP  aP `lO00S 3/Ѝp0 03/0Z0l $= p@__4Xh0T $0W0T $ 0 p@-PP@" T( Pp ^P 0S S]P p@]p0p@/80w0t $Tx0t $ P 0p@-@PP U  p@^80g0 $Uh0 $ 0@-PP M@ T \P Ѝ0_^P 0S\0 0__<00 $XT 0 $O4  p@-PP@" T( 0R0 p\P '^P \P \P p@\800 $T0 $ , G-PP@D T  R! R `V" V  0` Hq%p$, 0 R R- 0 00 `V00!`V . 00 F0R!  ! I0,$K/ 0  ` 00 00 0000 0` @-A/ 0SAS/0-O$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 >0:0 7 C-@!P1pP M`0030L TB A< XVP8 `Y O0S \!T1 0 3 30Lߍ(#@+ R? R/ ! T p0Sp % 0 0 D0 00  T  RP0 \ Rꩥظ(  O-IM,M``$@PPJ T4 I 0$000 pW W0  $I4$ 0 0 30Iݍ,Ѝ0SJ=0 0SX 0l 0 J=000h0aJ=0h 0 I<0IX\0<0I I I I I I ISPJ J- 0SJ= 0 FKUV00Wj  Rn R  R RA R R< SJ=0  J=00fWV O<  RUPj 0SU Jw!I0 T  J- 0S? 5UV 00R R SJ=00l1嚏 0 0d000H0:0,0xQP$ @? Q ", R RJ͍0 )%# RLP P P J=00W0  TPJ͍_P ꄤ֔< 8 ` O-`$@4M QP@p0DH0000#0C S0 #3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWX D# 0 T a XW: {00 0OpPCTA0S0SQWX000S RS  RW R.ZP 0SL"0 T "T@@O 00QWX00VT iT 1i #-pVT00xZpp 0P 0ȐpZ@D 0   P030#? 0@Sp0 00q0> 0 0 0WP 0 0 1 30Fߍ Y:wp0SX 0S P 0 0͸̸A-@ 0P`p0  0P p@-MP`:P@@P@T 0S  R0S @ PPЍpPPЍpp@-@P ppPPp0@0  0S/ 0CAA. q.S .R Q P-S Q P_S /@-0 S?RN0\L 0RF @PTN 0S`U DDpWe U_ ^" DPD`VQ S`. @@@0T)\ R /  R 0 0 0R0C?o20SJR 0\ 0R 006 S0 S 0R U. ^2 D0D@T 0U& ^ D`DPVS` D@D0T^U ^ D`DPVS 0R`V^0Sp@- Md0@0(  P 0R0 0S  R la  haR 0Sd 0S 00 Ѝp 0S S R, 0S 0S0S 0S/@-/ 0 R /0S S/ 00S S/0S/ //0@-@P M 0S PPt 0PTD@l0S0S 0S  Ѝ00n0 X @-pQM @`PQ Q Ѝ0SSp P*V0S# S!  0`S Ѝ Ѝ00S SD<0 4P 00@Ʉ p@-@PP` U V 0p Pp`D0P U@`0P V l0P   O-M F 1 #A 01p $0p8 ` P0 0 000 0008L P Z 00140030,؍<Ѝ0 R ,00,000(0PU,(Q Z Z ZZ \x0 ,fZ00Z00Z000 D| @-`0!p,1AM @PMP00 402 U 0PP   P-@ " 0 0 4 30$AލЍ0SP @0.Sd P0@  D x0 cZ00꽟L ` @-`l$Mh!0 S  ? S1  0 V% p,0< S9*@ \ 0S PUS  \Rp`V0 Sp h0 0 0 30$Ѝ0 000 00101 XG-@P`p W"  yPP  @   @!F<D0 9W0 0 H $O-@-Q'g M`4M$07,0000&<,000 $0S  0S &<(0P0" !S0$ <0& ( ) &<(00S &<(00S @&6, 0 0 30(ݍ4ЍS60 000S_>pC80 @:0 0`XP00  03/P 0&,@&<(0( 0 SS0040R0SQ Q R@p$pV? ,PP:00(Yp0   C 0zX`Pf00  0 3/P] `Y@YYZ pM40S?&<(00S !T? pY YYzo4 0 0DFX@P200  @ P) .xpP% $0 D0R 4 4SnZ 4Si 000p0 T &<(00Sb 0D'TS@PU0(pX,PC [u 80H cZC囟J` h@X ty[. 0 0E   @P $Pr P0S S000 p0SEy[Wz 80LE0S6 tX00pX0020 0&<(00S4@ }@PW 0 8(5$%0 %?R (0S` #0S yAX00@ $0R T? TThT @ }@PW_(0S p<0X`C80D\K X<0 C,0PB 0P,0(00(0700S@@W@j@0zo4 0 08W@P$00  03/P X00pS  @|@ @ Ռ d < 80.$`RC`@G)&<(0DD0/0$0%z0, $0SC?,0SD0,80.`RC`@G@0/%y` V@0) MVPy0000S 0R $RZ $R 0p굜O-SMP$0@4 00D10v`P vpP  X8`0$ 00pS  0  PN 000 ^PJ @@PX 0  MPww@t#l3 0 D1 30SߍY 00eV00 Q. 0 .Q0Q RS# d!"Ss** 0 -Pww @S Rd!"Sf*.[ 0 PD < Pd!o 0 DDQ0000 0000 Pz0=S V0S# S S Q 0 Pe0s70SQ0S V000000  Q000S0000 P?hV00 0 P5^V.[00 0 0sy SV00ux0/K0 PAV000 DDQ6V00Xꑛv/V00U 4O-@M Y 80 SS `PA 0P    0 S   > S S+04PTP 0   0 pPp 0  d1 pЍ 4P papvWrU00UP P P4P pGP q|aPp@`୏T` @p0 0 0 0  " $ & (    0 R! 0 &P  0 P P0+0  400  ,0PFvW`d @ lpWT  0 0S ! X \O-p"`20020' 0 ؀x@☰06 ` &     " $ ( * , W 0S0S  ` 0 - "2 ?ߍ踠P P0 RS S 0 0 0A`P  = $@`00,0`(p@ p$Y i792 I52 0Y00 S   S  R  R Q\  ^ \Q/o" S R0S 0 PQ +0 0S Q0S %c0P$0 IP; $ 00 B  `J0PEY $00X $C  0`V 0 \ 9 00^ Q  P V \  R R  p Y P$@`@ 0S   0?S CC" 0c6#PY @帐$@ A ^c \S㜐Q^@$T(p0S 0`$@$p,p T 0 d342 D52H 0SE0 S > S PR  PE @0 X0 0`P`&0XX'X 0?fρ/Z @'],' 0@S0 `X@T (PP@P ZsXsT(PY@T@$pTq W 0-0`P0`pPVUR qr0P 0L PX0  `:`PP` 0T!tPXP; s0S4 Z s` 0@?3.QRSP㜐  P  P \?oR20S f R㜐I GP\BR PPV{ `(p,PX00 00SvX@T0 4(p0,PpP S 000 P@T 0S00S`B`@ 0 `zP Y 0k[P-1Z0 P R 00S R00W  P3 0 PY 00S$S㜐R0S f =6. 00tC$(00P0p$l ( $\T D V 0堰@UPn @xPg댠 `VK|p  tp 0 j$0( \`hp !9ZP XP30KL L,0ZPpK),8P|,'0[ SR S0 ^0Q0  p 2 P Q 0QV09 X @`4P 100$70F&0 0S  00qP@P P0U 0PpP0U p0(p`,PK n.A> ߽ I LYP1x00x0 prc@`p@$P P`0V00T0`pP`WO-PTMe Yl 0Q@P1=^p 0=> 0 y`PpPF 0p R R R0 T@0P p R 00 00 $P0 0 V  X [ 00  [XV,@TЍTDk?/Y$lD0/ x ` G-XM`@ႃP pP@0 0     \ 0{P 40S0. XЍ SP p@  0]P o8<8 1P 4PPO 0 8 O-"M2M `Q0<000 Z 0Sq pr@ lp =~<  A. *8PPh 0#S( P$ 0=0P P @ PR R R UPP (tP4 @ R0 @PtP $K$ (0K$ KP0(X PPU 00   P 0@P&wP0 t0< 0 0 30ݍЍTD0/i8x0/_꺓  A-(M @ Pp`   v /P @PP إ$0S0(Ѝ <@-@ #nP t0  @0O-p"|2M 0020) `@1Fp! P PX PPQ P Q$p!1 0 2 30`ߍ0@PSX 0@SZp00 0P* %0 0 0> P ZY0 Y  0 0P Y:[ 0 0 X  R  XR P 0 nג0A-pP`P@ 0 I 0P 00 $ 0A-L R@.Ġ@@@O-LM0 H`@00QpQQ840 <0V $x4 j7M 0 "0 ` .V7 8N,0 0,`0. Blʂ 00#`0 p" L7pp'po,|eOgu`` ! #`* ㇇D   "  '0Jb* ,0!$ FOǂ 00#( 0 p"ب 〩Fc5 pp', p,௧DH|  ! # 04a)J OJ  " 'ྦྷ \H'  ,8 0!"㐫Flł 00#< 0q "}O<p p*,@p厳yJj  ! # !㴹D  " D  b Ob% 0! 0 0# 0@ @L= " 4, Q^B˃  #0! ધ 㶩Na  ,  " ]/Mb& 0! 00# 0SD@= " D, 㡨M˃  #! ȫӧNa  , , " Bb& 0! 00# 0֧7L= " , դO˃  #(! ZDa  , < " Jb& 0! 00# 0 O= " ,*H ٢oF˃  #! 8a  , * BOj  " (6q7H0b. 0 !4,"1=F0ʂ0* !  8=O0a 0"0# 0D㾤J 4 ,*/ +D j ! ,0`+&O ʊ # " p Kb(0 *<!>8B0 0,*7:N0j 0" 0# 0M : ! ,-$@ lȃ *, !9 )M  #8 " ۦN b.0,D*<?A0ꪂ 0! ,e64L0lȊ 0" 0#0D)O4  " *Db- ( ৃ㔋Ja 9p ,|Opp0ȁi 0[eF0#08p5``  p " l oHb-`` 0p!}doOa` ` p,meHȁ``0 0(p0#0OnoF5``  Dp " f,nOb-``  p!ccJa` `S7Oe0 004p 0#0 c= 5":-K    "  Bb+ P!0  P@0,0## +N@  0LЍ@-@P 3 E7FN, 0(Iv420A 00  (G-PPp`3 W) 0!ӑ00@@i00"V>0: E0iS@I"p ` *<0V@@p`F G4\0P 00P  D $ ! 1 p@-`P0M@0 00' T. P  !7R8 bx b   x0 0 0 30X Ѝp@SLh0t T,00t }0 ~ 0 C-$ M 2"0 P00p  ` 0R @  0XS @@0 T $. 0N X!H1 0 0 30 ЍT  0 s0Aa0C80BS.R ^V* 00RP 0FS0 S S^*0Xs000@^0 8< 4^*0 8<}}} - MiP ЍDD!@- 0(M S $ A \/o"S R9 S Q R L 0 0 $0 30)(Ѝ@@    (  0$\ S $ L R \0  R ( $Q C ꉎ{{ 0A-P!|1`P rMp00109 U? @^X0pA00tAY0OY?2D 000TAV AhP2  0 cwpP# 0@$iP 0 0 1 30rߍt0<0 BUX=@0 9P i003P 00 z(yH 00- $  M  Ѝx -- M0 0 ЍЍ/-8 8- M0 0   nЍ Ѝ/x p@- MP|@`x0@t P`       @X@vPU  Ѝpw P L1! @-`0M000Qp P@ t  LRp P@ 0 0 0 30'ЍPPpW @@T PU 0SP@UTP00@ow4v 0p@-P0@ 0 p0h`(0P`h(P,Ph 00PP 0P 00 0ppP 00 0pp 0@-@ 0 0 0  0 0 n 0 0 00@-P M @0~h 00P 0 %@?o 0 2c Ѝ0 2 00 0p@-@P 0U0 0pp@-@PTh0PPPh(0PMh(P,PpO-p0Pi `,Pa @000 S S0 S S l0PO 00CP Up7 ,P,@P! 0P0,0S S S@ 0AS ApQ@P$  P0S0Q0000_gP  gPP@@PP 8 O- M`p@,0(St: j(TY0 T0U 00SQ 0 RK@D @TPF 00SB0@D S@D P+ T0V  0@D !0@T0PG 00S#0A S0偠0&  0S000  0S% p@^g0ppZg(0pWg(p,p@ ЍfP  (,@(0  Ѝ0 00@- M@P   p P  Ѝ00 0 $$ 0 P Ѝ0?p 0$ $6 Ѝ0O-PTMf E,Pp@0@@ ppgPc,me`P_ 0 ppgPT,PPU 0@Q QG QR QB pp0U00S =eP- p 00 0@ ` R  R2 R[ R 0 @U ` 0 f 0JX0M 0 TЍ   @ QA@0U  `     0 SPE g04 E0:0r ; 0Z= S81P3 P#S41PE2s2PEsSPE j 0h0 E080r 9 PEPE  0jVU0 8PPEPE 0gEU4 :P 080 4:0 @-pM-Lp( @Mp+ `0v00 @ P.Lu l0 0@P ЍL00@ЍXML / @-\(,@\ \  Q:^: A Ͽ|q<Ͽ10000$G-\MP @P 0( Y 40:p;`ȁ B$:9-)bH\91 垁a@8736`# \  0008` <9P00 @A4ƌ<ŠaЍ /r 0?s0q1 2/3?10 0 0@-S@ 3/@DMA-pd Q㹉7I@P-7I @P @D  T<Ͽ2/ p `6o`FLPV% L`B, `F Ef& BL&&"L`F, `F Bb& BLQ"L`F,`Fw&Tp}" @D  2/ 0t 2/P HPEV%ApG!pG Ev' BA'&"AG!@ B BA!" A@!@ 蹉 Q7IP' N ^<Ͽ2/  `@4O@DL@ F$L B, PB DF% BL$&"L@D, @D BB$ BLQ"L@D,@Dw$^p ^ ^ | x 1t 2/P^^1 ^- ^/  2/PTT @D 2/ P^ ^ ^ ^ T Pv` @D 2/  2/Pj    \ X | t @-@P  @H0/0 y 10 @-0@0 0 0L#d.\ 0@0\ SC@ P p0  0C00 00L  00t@] @O-pl PlL M' u l`Ea d(0Ve aQl \M@l7 Ѝ 2Ÿ0 A-P 0@ @ `0C0$@i 0@b `0C0 @E 0@> ` p0C0&.SI 000@000@ 0pp@xqE0Cp2Sp X 2S 000 @ @  @0 `00PU  0R40$8 0U0@T  0U Ѝ0O00@ 0t0PX Ѝ0 k6| k4Mp@-@MLP 0 Q@0P0<00 0 `. 0+>8T @D GM000X L0 0 <0 30 @Ѝp@Ѝ/ `T.0 )0@t j@O-MP`@PP ~ p0 Q ЍSp SRPP 0-S  0  +S 0XP 00C<,0d .S 0 @QT.‖ 㘐@@✒)  S #3Q#@ " 0!   R#S # 2R 0T#+<'(0+8 +)(0'<0'4 0)< p 0)4 000Rp 0T Q#@ "  S #3Q#@ " 0!   R#S # 2R 0T 0T  P#@ "  S #3P#@ " 0    R#S # 2R 0T0 0T 0N 00 000J00 0A?tO-@Q dM0 R & @\~2)g/O 0?\0^mnb`AS0N0P0_>88H<Q¯a&sf~e~rHpl0W0E0T0=b0AE1D88H'ᓾ  La@L<@<d+b@ "gࣲ2X0+k[~ W~S~ZX0 K Y N XQ , @ 0 0( L P08$ \ 40 T D0p < ` H /@Z YY YX YdЍ0& @0 B?\0@R@0@g ό 0 0dЍL Y  -8X $ e d c= cd c c b@-@P 0D .R S0@*ST .P@Q QA.@P@@? - b<@-$Mp`a_@[d  /0v> 00  _Pc$Ѝ aC-p@ MP`@PO  08/0`(PEHk= 0p`P=00PP]0d P00k0 p 0 %p =000SC=000S* -T=0 0  BR   =@ 00 p $ R 0S .S 0S 0S00S.S\P=P<0=<00S|ppLd @P?p(@0 p 0D 0 Sg.440000PJ0 0 0C$0S0 @C(040#( #,  @:[@D0 pc $0Sp(0 Z0zpV 0 0ppN @;@0 2 B #Ġ#Ƞ#<00,00.0 .00R0 C0 ALp( 0 D 0Z:08H+@B0?R0Sp E?/\ @` 0ZDQ: TP0 TP@ *9 0 0 30 ݍ Ѝ= 00H0<0@00 0 p@ 0 00phypp-\ =H 0< @ 0 p0000<0 C$0vP0H+8@B0?Q0S%?/=<00S 2@0d D;|80R? Pp0 p <0 CP$0p@PH+<0P`@C$4 0p 0P`.Pm0 pd 0 P`PZGd 0@R_00p0 kpG 0d 00D 0 Zp6 %20d 0 pJp& pD{ XP zOP0d 00 0 4p 0D[ S=0003SQ Pv0p "p DD PU 0Y@I 1!0ES 00 =<00Sr ĵ1P @10@DKf?d  PD0 p P*=<00C4UPP=<00S u1pd 0Y00Y00D^?0 p =Ԁ<0  0C:  @PC TTp P 0UH 0 0p} 00e0PE0T` 0 pn p 0 Pe 0 PC @D[0|pX =-00< 0 SZ 0 PH=P<00 C+@0Y 10"34# 01;@0001;@020!201;@000301;@0S101;@010 1;@=0;@0 0p 0D 0 SPh20k@pTPt0e Upa  R @ T) 0d \0 p Y 0+@0Y 10"3! 01;@0001;@020!201;@000 1= +@=-;@>@ C+A0Y 10"3! 01;A0001;A020 1;A====C;+A0Y 1 00=-1;A>A C0==C;r&&t _p ^ ^ [ ]d ]8 ] [ [! Z@ Y Y YP X XP X V Vd V$ U Ul T( S R Q QT P O N N M M L L L4 J I I H G G F< E\ E D D D C B Bp A8 @ @=000+S =<00S@d 0@R_00 p0 Rp.  0 d 0 Dp 0PD[ 0Ud* pzOUD[[ 0d 00 0 'p=<00S4 =Q<0PPL@ ^0  p3=<00S "0 S00 =<00S @2d 0RO000C pP0 p 0d 00D0 0 p  0 d " 0 p 3 0DR  P/* *J@1#00DK0[Gp0 op}=<00S =S<0PP<0 C$0'PfS 0 Pp] jDKpJ/D{ d 0 0 lpH p8/D{ 0d  0 Zp6 %/p "/ /U?d p 0 Cp H+i@P<0 C@$0PP  0 p 0DZ3*(p,@] 0 PZD W[ 0 pq p 0d @ 0 pc pG@P 0Z 0 ZtpO=<00S? ,L8-0@d D; R? p0 Xp4 <0`$4PCpp 00 P$0 Ap 0 `pPH+^0  `P T=(]<0PPY=@ <0 =<00St 0d x}p0]?e 0  p XaPD3 0RX0`@  5 (07 =HK 0 0L"YP *, D>0 000;/(0IX = 00H+D 0 S&@P0 p @P(0d 0>0w? 0 p x,@u,@<( 4O@0Y00D> pP0 pl =<00CV5U5E !?C0 SHo0 }pX=<00S B,P?,@<,PP0@@2 D;?0U? `p0 Xp4 <0 C`$0pP+H+u=<00SN 0 Ct_ PPs=<00SB<0 C$0P 0D 0 SQ C* *J 1#00 S0 op?0 H{= 0P 0o!U@ *, >0 t>  08/0- pPEH{PD80 p0 H{= 0P 0@!U@ *, =0 =  08/0- pPEH{PD=]<0PP-00 R=<00S=<]<0PP(] 0P CP] 0P CPP $0 PD[ 0U:=<0-Ԁ<  b@PTBT l``pP 0UH0 0rpN 00e0PE0T10 dp?|d pP?0 Tp0 Z PzUDK  0d 000 <pԀ  pPPeWWU @`P 0UH0 0 p 00e0PE0Wj0 p0 H= 0@ 0h TP *:0,\* @  4/ 0 p0 H= 0@ 0C TP*:0 0 pY 0P CP* 0 pDp A?d p 0 pp  0 p B 0 py i*` 0 DPpl =H{ 0` PPbV *, l80 8  08/= 0`Fp` `H{ 0pC < 0 E^p: ** 0 D PRp. =H{ 0` PP$V *, t70 000:/= 0`Fp` `H{ 0Ip L 0 !p ) 0 D Pp =H{ 0` WPPV *, 60 000:/= 0`Fp` `H{ 0 p \V0 PpKp @)0 DK `p =H{ 0` @PV *, 50 0008/= 0p`FU``PH{Np0 p 0 `p O0 pz H+ u0p po  P 0DK dPQ0 p_ 0@TPDK_@`0 spO <0 C@$0`PF0DK 0SL @.)pj_DKd 00 Lp( @)DK0d 0 :p )0d D;R?0 )p <0 C$0P ԀD :B P@P18 c``P 0UH 0 0p 00e0PE0T¾p 0 p (0d Dd20R?90 pxT00 Np 2d 0b?0 p0 p p @0@D 0Z:Wڄ0N p0 py @lԀ  o@PMTrT a``P 0UH 0 0p] 00e0PE0TW@p 0 qpLPpTڀ ? ?, > > = =` = < < < <$ ; : 9 9x 9T 8 7 6 5 4 4 4 3 2` 1 1| 1T 0 0X / / . . . .` ., `0` 9p ` 0PCe0 ,p `TNڄx?mTHژr`0` p `=p<0pPpF+K Y0Y! ##10 !+K Y  !+K YY" !" !+K YY  # !+K YR! !+K YY! " !+K Y 0 1;K0p PUD @- MRA X  ,@0 4@(@@0 0404040040 Ѝ - M-(040 1Ѝ03/A-PS`)p@ W@0 V :00@PU &P@(00T0T@D0T0S$0l0 (P@ .pG-0`AV-:@p0T0'0 00 @T T P0S P UT0 $P" P @Y(00QA-Mvp$0P@S` 0(01$0,0v(`Ve0Sa(0S$P1,  0(0, V,400 &PR,0,0 RMU,,  4TP(0T0(0 SP$PQ0(00,0Ѝ0F <P%, (` , \:, 000\, :$( ,00(0 SP$PU 0"00(00QA-Mt`$0P@Sp 0(01$0,0w(pWc0S_(0S$P1,  0(0, W+<0<00(PN,0,0 RIU,, (0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P$, (p , \: ,010\, :!( ,00(0 SP$PU 0"W00R(00G-PP@`pg V] Tj́ H THH H0  ^P^0^P0"!, < @D#Ì?0  0PT T 0 00 "!#2<W 0:T  0H@H 0@ 0H =  =00P*PP000 h80 L00 ٿTW P@ )h (| ( ' 'O-PR@pP Tv 0S7 x" `lRPHP [B T Wa@ Z 0 00@=ZB ڱPM [ [T WE 0@0 0Z 0[9Y^ T W0 0@ 1 0Yp 7:P$T W 0@ 2 0Yp 7:P[0% [ S 0S 00@ 80 B00 ;wT W 0S S0S @=S0,Z0   'D % %d $P 00/`|X00P @/4/,/ // %d %L %< %0 % @-`MP plR@\ ( P0  < @,L,F $ $ $ $pA-`PlQ@pPP TF 00S?00XS; 0ST.C+SQ0,` 0000s0`  0C` ^7ࠃ0ࠓV0Cs 00000  0C Q700C20@?D0 n$0>0 g  #P #0A-Pp@FU`, Tx0 @W``W 0 PE.pVp P7000 2000 S70Q00 V00gD0T % ",/o////\@-DM` @p0 0 < 2 *0 RP600000C0< ,0 0 <0 30DЍh ! O-hhH Mz zJ0 - @P<%94BP B,@h3"f'*g* J 1`JH*ZOWVnX= 0@Y$* 0 Sp: [ @B0?R0SJ  Ѝ  0 H|p# V0X[0S   000 00000S 0WYp@ D 0 Mp WV  0 MAp X 8e0$ 4F Ѝ  A-`pPָ0S- @3T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 $0p@- M@P00 80p k$`p Go0 (0 0 8 30ލpg |0-@-@R M00  IPP * Ѝ@Ѝ/ w) Ѝ@Ѝ/gPRp@- `@PbP\P0 ?p@+JꜾ00pPRp@- `@P@P:P0 ?p@+(z00pp@-@Q `P PP0 ?p@+Z00pp@-P@w+P  p@ p@p@-@P 0PS <0S P 00p.00pQP@- 0R R  00p@-PP Q@ @Q Q Q AR00A32 00pP @pP Qp@-@P PrP  U  DXu p@  5\@\n,D0\S 0?G0jS# k`Q \0 Y6C#::X00\0q??GR 0?G06X00\0\\0   @ 0M 00 0Ѝ6 3A-@PU `ၱ0Sp @ P 0S U@Dp@-P@QPMP0 S :pSSp 0R:pp,0e0$ @zfh0$ @s  p@-@P#` V+P. P1 `PVp 0P P   $$P V0 P pTC0 @5<D0 @.$E0 @'p 0 0ɥ@-@PDQO-^ 4A`@Pp  0S 00CS 0 \V0 S  RYWppXpQpW\`\\U0 SP\p Q@-P-r-0w00-0x000ն 00ж000S wS -S rS 0S /xS /  @-P@20 0裶 0 P P//0S/ S S/0S/0S/@-@$0@0T S R RT//PP/PQ/?SQ 0p@-0 0,/ ?SS 0p@-0 0/ t?S S S`/Q/AQ/Q Q/?0 @0p@-0 0Q/?S0?/0?/ QP00 / /@- 0  A-8P 0`0@Hp P]0SPN:Pp@-@P M` P0E S a Ѝ ݵ p]ֵ0S 0Z0 ij p@-@PpP Q 0S PP:0S :p@z#A-@Pp X P@PE@X `P`008 ⌳` O- M` V" p@IV Pឰ @P0SV F!ྛ`F0 `1 Ѝ Ѝ 9` -\ /G 010C. *  /G   RA-P(M`p |@ 0 @0@0 PP00_ P@ 0 (Ѝ T 0?G0 5CS @/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0p80L0 òTMP0 ⺲ O-PM`p 0FV"S00 0^ P]@P-UP +UP0+  p"<,@P00Es Qa0ESW0EA0ES70EVt \SQ s@0U2 V+ y yA ` 0T00S0 Sl 0J0 ЍS T P0 0I00 0S  Ѝr `00XS 00AA0C PSVr `Pr `0?0 g 0M0 00ЍW PTO-PMp 0GW"S`@ ᶬP-TPr +T [ ?0 0 X  0 0R00D  @PpQ 8 PQ  S  R/ " Q 00Bs ^ a0Bs0SW0BA0Bs0S(70BS%| [X  PQ  S  R " ꛳"00ꔳ"0 00S \0F0 Ѝ[@`F ?0 0 0߬0c 000Dj000S  Ѝ[@`h0TG W< p̜ ̌  ̜@̌L00D l0T00XS8@00D A Bs QR ]`p0T3 W p p3403O3C 0`@p> PP41?0 00Dp > 100XS W#p0 0 0"00XS W ppp 00BA0C QSWpPppjp0 0> 0W 0@ p p0@ p $0M0 00Ѝ 4 r  Q0?0S @-[-- Mo ЍЍ/G-P`pP WV ៦00`F !R !V6  ᥤP 0PE (萱`V PUU@@2nPP X1 00z   @@PE Pm00j c000@00_H0B0 QW,C40 HJ \ U  RS A  (p@-@P00C0S S u P 0` Pp>`u@-@P  0`00@060  - M0 /| Ѝp@-PP@ T 0000 p80M0 ίTND0 ů A-pP@`' T. V5 0S 0SP0S0 000 R F``0Q00`6P0\ ⎯T@ap0\ ⅯV b|0\ | O-p#@3OM PPd0 h`0410`10 V Vy Z.` 喡P 30 00 [ Q!.PQP\.Q a :!q!PZ [ 00:[.[<##O[0Q.SI Yg0IS00`0 0IZ 00 0W  0 P00 `` ᚪ0 0C SB: 0  `  0 $+00/00H!81 0 41 30EOߍ:[ 0( @$000,i 0 0 `00P  P00 ZU00岰00B0 ⦮@4 <PPF U.R|  :ӠP pY  x X 4O-`PM@p  W0p0 W0_( 0K3P= $P  000 00@p-pP 00 0 "_P > Q Q0 `@V 0H`V:`F0V:\`FX @p1 p W`FG R{40 0 00@ߍ Q Q0 S S `  ћ pPx ` Q PG PC  T:  @D 3P  0@RP- #[z0dpp uY  `FҮ[ ~ Kqɮ `FW \ Z  Z Vv P `p 䠊 ` RU R R RM T* cPG p(^3@D Pk @P`V0 ᬪP& !T9: `P  囪P  T014@1:w^0 b0 03C0 @0 @`k32 0@0@0 P0 `@P D < $ll1@-pP0LM@0D00G DP`0S- @.0 PP( V( QPP0 0媨 0 FP  Y3 0 0 0 D0 30LЍFPlPPP Z@ ;3T8C?F/ ԬW   ( C-`PM@8 pPU* Y @@NO00T  0rFP 3 0 Ѝx@@JO @2T ЍDFP P$ C?R/ Ⅼ t O-UMMdjP, `T*0P: xU0爕0L50|5 0 ,0S 0 S00  :0$0(210P00 0 `@[S#`P 020)09 0 L5 30QUލЍ5  00pP0 $03/P p[: !2320<0g §P 0PP`P T0 00 0X 8H0R? @@0 0D T0L\ Wc*`P 0 C0@PX0 $03/PP @ ` V,yvsp( W4p0S8<0S X 0S0S S| 06P 0( 0S X H0S 0PUP( 0`X*\0L0Q*@䧬H0`0L@H0 00S 0 8H0S 00 d L0 W 0H0C?oQ20SN pZOp [XPH`BP0 0 00PT ! R soQ \ V\pp0PX 50$0W  H0SX0 B@Gq 0SPSPڰP^!P"@Tp `0S 0 00`@D @PC0@P0C`@S:Dp `@u1L0X` C0 0CS:0X40 @0 @Pd0 s (0S>@喦Z 00@SV@ 4p@(`@,PI0S 0H'XSB@KPHP 0Pa%20V?Z/ Ȫ,0S]]?Z/ ⾪U,0P08D000dR4 0 0pP0 8 (0ST00 D00R9*0P:P @`@30 CR00PU 08@ PPp0`P CR00@S᱗@P`@>$03/P ` 6T0(D 0T0@B+00Pw  D00 0D0D0U0 ,H5PI0 #pP0 F (0SH0S 0P T D001Q=*00P00ȥXL@p~ 0% 2z p Nύ 0 00O@!?RKiB 0Pp`P@0_0P %1WPW T00(D@C 0T0/0P D00 8  ( ټ ٔ pA-@PMPF 0 S`06 S10p 0.PP 0  1 ثP9 80 0P圹P! 0 &`0ϫV 00S S Ѝ0p/ừЍ0C?. ℩/ 0 Ԭ3O-PPBM0 M@0$40 0 00S01 S 0 "2 0 $4 30Bލ Ѝx ` p @vG 0 , ^6P@T*X$ G P 0!  /A6-@PG ;pPB 8 0 0@TPGp 000 00000 0`c/V> 0@ @IP 00S 0  0@T-   0  0  {7/ 0 tC?/ Ш_)/ 0 d 00S S[ YS | @ G-M`0pê@P0P0 V 0   0 pPªЍ 0 PP 0/ ₨ ФA-M`pPᒪ@P , 0P (   PᗪЍ, P00ЍA-@P MPp@`R UX'0S9 0S0S9 P8 ,1,0 0<00! P 0? p`JP 00 ЍU U+ */ 0 0 Ѝ0S  0 00S000/S S 0S @P,?/ 0 X π ΔO-DM@P L$0h @400<00 (p, P dP``7.0 PP ᜕P ,00 P0å RR RR00  S S$0 S S H t @P (` 0 00S S S@ 0Yi*@ Y@P 0S 00Q 0 0A@BA Y  9:I S4 $s 0 I0 Y$:  c TIr 0FD@@ P`   HP  Y>`PU P`--; 0  0`!L1 0 <0 30GDЍ(,I P ` !P:0 P0 0 0 09 0D` P`@ 000Z-X-  0 L- 000000 `Q`P  8  p@-M`@Pg 804 00  ɠcЍp<T@-M@Q (9$  Ѝ@-MP`> @pP0P0 D0) 8 00 @  PῨЍt0@- MPP@T p00P    T 9 ~@ Ѝ0u@T 00( A-@PaMP`O UU !0  p  ` 0S   0C \0".S>V 0@  Ѝ0 XR @  9S @ `F V0 QU4 8<00L0m0  U0n<0 S  T 4O-Pl#@Qh3,M `00$00 UJ Pd PR`00:V  h Vj #p @H P`@ P Z PUU @ pWpW P `$pVᰐEZ V 0F@ S0 sZb 0rJp<0t ᖥV VP / 0 !1 0 $0 30f,Ѝ!1 0 $0 30[,ЍO `:V@ ` ᧗P :W8U/ 0S 0$ SP`qIpt 0MU V V 0B[T 0:<0 3L0S@i$pu.W@`$pVPgPVr x ǐ , l @-`!@P1,M P00$00' U- 0p0H 00000002P* + 0 0 $0 30,Ѝ 0 L0h0 ֤U0i<0 ͤO , Ũ   O-tM`@%0Q85 @00l00 V P P* / 0 $4 0 l0 300tЍTIPp<0T ᘤTs T 0S` 0㌤x<0` Ⅴ  0 $   pP R@ LTT pRU P Q  R @R 0Px Ru00 Y0S @\Tj<00@:0T0p0 0B Zk 0Sk* 0CR00d:av"2 0 l0 30  tЍOP@PUJ*0: T00SH`"H0 l 1P00[0S3@Tp 0Z00S RZ  @pT0zu YPn R 0S0 P @j P]0SA:¥ 0 Y Y Y@0/Q 0 H P Ft8 @R0PHPpT 0ᗣV Tp T` 0㌣u@@0[' + P"p 0;/pq 00P @ P z)00  0 0 0Ѝp ph P0 Q+ L WY  0ppTP 00 0 SM  0 00;/pq 00PQQ <PU;ဖ0 z0p ;/yqP0 q 00 0PUßR <0PUß`X0p] Ri0]0dX0P\OS  00QZ <P800CPU0&Z "   RNLP0Pe/ P0;/pqA 0000 P @ P (00 0Z 00 `P*0 S': PE u ?J 0C0U<PTP 0S  0CPß(1G0 :APU0 Z 0CJP %JPP @0P z(0000 00|P0  000080 0 y   d O-P,M`p@PP T 000S000Z00ӗ$0` 0PPW 000@P $ 0R00SQR+XP `  ' 0P 0嵢0  UPP`嫗 [XhV,Ѝ C$ R_oR  B0 S $ PRPPU8 0B Q: `PP$ RPPURP%X00S PD00P \[ TP|[  0P \ `PdPU[ @Tp [H S$0 ` Pd z rP 0S   00S S0S S ^ S@@T0Q00S00嫜i0\#00& ^@ [ @@ S@ S80h0 0B'0D Lp@-@PP` U 00 FG p 00pt060 ɠUX7<0 0 @p蹢0TS00 -M0 3/Ѝ/0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04P0 v00 o 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04h0\ ?00\ 8 p@-@PP U 0S S S 0p@0/p0p@0/p40t 00t  h Hp@-@PP U 0S S S 0p@0/p0p@0/p40 00 ܟ 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ040 ⬟00 ⥟ 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04&0 u0%0 n 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04F0 >0E0 7  0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04e>,0Y0, @ 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04K?G/О0a0G/ɞ d D0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04iS?O/♞00O/⒞ h0@-PP M@ T 00P00 Ѝ0800.wTq[?.n 0@-PP M@ T 00P00 Ѝ0800^/ST[?^/J l L0@-@P MP, U" 0S S S Ѝ00 0S0003/ Ѝ0003/P 00S00 Ѝ04>a/00a/ | \0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04 j?g/ߝ00g/؝ A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 pA0/Co<0*0m/⒝$#[?m/⊝  h LA-PPMp@`2 W8 T&  P R P P P @ЍPX #00@R X ЍA}&w?q/L0^0q/EW_>q/< " P` Z0SP@#q{\ T 4  p@-PP@ T  ;p@800, T?, L ,A-PPp`@, X2 V9 T P  R 0 R 0\A/W 0A/| =/̜`00/ŜXD?/⼜V$?/Ⳝ T 4  A-@PM0P` 0J U@ 0pS S .P R`V V V ЍW ' 0SP"00Ѝ W` 0SPV"l>%.\P0/0%.U ! Pp%{ t /) 0@-@P MP. U4 0S S S Ѝ00 03/P 003/P  Ѝ0 00 3/P 003/ Ѝ080W0/U?/ 0@-@P MP. U4 0S S S Ѝ00 03/P 003/P  Ѝ0 00 3/P 003/ Ѝ080{0/⦛U?/❛ p@-@PP U p@iD00/⊛U(?/⁛p@V H (p@-@PP U p@D00/kU(?/bp@} p@-@PP U p@+D00/LU(?/Cp@ P 0p@-@PP U p@RD00/-U(?/$p@? @-M@P0.S00Ѝ"@-M@Sp  B0?R0S Ѝ 00 00CЍ 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S 0.0 R0/0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 / UH0 0 / U4// 40//0O-PMPw 쓟@% !E  0L \l 0S Xg@.  ^` @^e X[@\AP0SI <  cSB!  S   XGS`P @p@P pG W`W0P@W ` FR@y P0S R*S@BT00S8$0@ PϙS 1.34:ʛ(00@ЍAR R !!  X@\ P\dp `!S" Cr ;"*  X 0@Q 0;S@S \S ! C]R X @D#!2br   D"2c  Ds0#100DX0@FRP T R Sp ڄpg 0'`20epgL '0 " %`0WN00 X  O-@p$M|WP dd ``XY @ppW P\W, .W 0E0CI XG0 R S.R@ pW0 C B5 X3R XPń, PEU)0S0P'pW [W# .P @d0Q $P @ 0Qp' P @pW֚(00$Ѝ] PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00   0 ]R' @R " XWSQ   Y I b"r RyA  RC .R p@WLd@u@r00Q   Y  x " ^  @WX  P0R P@WX(@[p58:dX00P Å0\S X ńW PEUT0SPS0WX P  0G-PHAQ@I*p`0S% R@ @R0 0- 0U7 0  Ԡ 000s0 P00 p pS00@N0?V0Sp$0^/P՗AS 0S!0ɑ 00Uș@(00 LL O-`V MP3P#VP30 U0p\ @ U @RF R R2 (00 ЍW@ Ġ[? A @ GRP@R\ 40S4  0@0[A[V[ b?i/Pm Y*@T*0Pc0 A\ R!"ɑ 40S4 00 - M ЍO-pS$MP Y p 0 pS 0S0@^q @^` \kS0YH `  B@  p p@T @0S @SW pZ PT @`T00 S Sh*p 0A>S] B PY^p0K X Q= ۘ(00H0S 0Q* 0F S0S 0 `  0AS"`!0}@T`00\ڵ(00@$ЍAT}0S@"@A@pZZ ᢗ@0Ġ?  0^q0A>Sp0pS000^ 0AA^ AN[ ^& SQ0SP; Zp ?0.40@B0?Q0SJw?~/PMYp 00B00@G0?Q0Shjw?~/P.| V*p/Y P LP n?u/PB  Иp@-P0 M `00 1000Ip !@p < 40 0 1 30ލp@@ DL CA- `0M P@(q0 0 100p 0 p0 (0 0 1 30ލ@ C C@Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q @-A?S SAQ  0SLBq00l(00N/G-p@`0TS%V WTrP @0TS P?Y @00;(000QSp@-P@` CP`VP@  0R p/pA-APUQ?UU@A`pp W ڀ1AP(0000?00Q A@-?S SBR 0@S AԖ00ϖ(00/-- Me ЍЍ/@-M@ p TЍR/0-S0 \ S 0^C00O-P MPp 0EU"S~ `@;P-TR +T} Y ?pz\00D`" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+>90S \0J0 ЍY@0Tf UH4cp3cO P 00 AA0C RSlUPP\`J?pa00D00 0S   ЍY @~0T, U$l 00Dl@ Pp}0T00XS"@00D AAs PQ0Pp>ci p>cP0?0 ͓A00DPp>cY00XS UPpb 0M00XS UpbPPp>c 0>U0@PP/@ p>cP 0M0 00Ѝ :tA-`!1PP rMp0010+ V1 @^X0pA00tA 0O 0 ?2@ 0TA0V PPl'0t @ d00 1 30rߍH0F0 UV,G<0 L>> :< 9  00- $  M  Ѝ 9 -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/ 8O-@SM ^ YXb 0pS000!R !3  PP E``#Q9\*Q30A 0#1#2#4#8  P8   ۓ0U A 00 pQ~PP 0@pQ 0S  Ѝ躔T000@0000@0 ⫒꫔0000 A-@`Pp㖈0 }Pᗈ$0M 000Ѝ\ 60PT0 0p@-00Sl@@@p\P\\P @P=@P q   5p| p@-P@V p@G-Pp`*t@t0@p @  d U  ^50 㚄   GP 5  L "A-P p@` F  mz000 @P p@-@P*Ppp@O-M4b4B`0R@P: 1pt r$pQ00l 1PZ 0S` P U [0@Y P %0@[P  0` PV:Z 4aP`0pS PP @T P 0S 3/0S ȓ0P@U:W @0@00坫N Q|00p@@DЍTЍ0<0 0 \ 3 |P x X !@-BM1M @PDa0`040  D u<Pe ! R q`0 p  U PpA0@ P; P1 0威8!1 0 4 30>BލЍHP (G`P  6/P Q Q 0 00 00P +0 0 & `N P 0S 3/ D000P ; 1d 1P ~L  0 x0@-@P$MP U!  0P% 0 0   01P $Ѝ0X~<0H X⮐U8|0H X⥐B~\\ | {O-@PU  RM `100Xqp 0S@ @尀<P8 $)A0PS,0a0000S 000  000 000 000O @0004<0 X; { { {\ {X {P z z\ zHA-`P8  0S@P$ 0P @S0pP0S PU @P l@0Uf00 \xT@ 0@ P (<0B/X|{D yO-lMR0  4 吀0 R X #`000Sa# 0S00 #34  04 03P Yڀs@|Px3p 00V^ p p @QS  QN P0 Sh @p $ 3/0  0P@Yr@RPG00SS" 00C0T@lЍxB@@@0d20\ 0 00SN  R02( ,0 (@ ,0 @p T0TP 0S 0 @@00D0000P 0 S PW @@m(0XS, @ , 0c R1 1S@X 1( 0 (@ ,0M6&>I/X0S XbQ?I/X@lЍaE?I/X@^( ( ,0$ +pz ب|zPz ׄy0 8xx w| ը uL u t@ŸC-`82 M08@00051E@PrgQndea?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0(DHd,T$@VR gR 0` `\0@ S 0WS0 `0R CL S`H ~O 0@ `90 IISQ0C 0 B@24<000/0PA!b   _W0 `0R C W 0II Q B@ 0/C!b; 0000P=W0 `0R C WP0 @`(;Q 0@000P W0 `0R C W0 @`y:Q 0@000P W0 `0R C W[0* *BQ@#/ b 2b:000R0P   W0 `0R C W:9Q 0@000P Wv0 `0R Co W!P0 @ F`a0 l@`X9Q 0@00 0P WH0 `0R CA S: :B Q@0?0c cS00h800PD0hW'0 `0R C S 8Q 0@0P D0 OW0 `0R C W7Q 0@0P X0  5W0 `0R C WU PUP<7Q 0@0P D0 W0 `0R C S~6Q 0@000P W0 `0R C Se0h @PX00\00`0 0d00 x00 |0 00- & W0 `0R C S: 0@@0@ S0ŘWx0 `0R Cq W#W@kl0 `0R Ca W0051E@!2 Cd0bSӢ Rcӣ? ?"?C04P 00yW80 `0R C1 S 0@h   phh0 S0R05`0P @0400MW 0 `0R C S0 @`0P S@00300)W0 `0R C SW@@0 `0R C S0 @` 0@Sh @ Gpq  pq 0ASRT" R-Q RL(0c((HQW3( <100l0",= R$ ` QBP Wm0 `0R Cf St0 @=`X0@S !WPG0`0QCG P`CUyP 0@S;M  P   P W 0W `0QC8P# $ $| r # p\ o od o8 n n n m mL l lh l k k$ j j iP h g g g` g f e e e( b b b b a aL ` `0l @>`0@ S4 1hW0 `0R C S0@S 1W0 `0R C W 0@ k ! j $ 0LII< @P(D?HA1cd,0T$@:%!E_d2dN`Re0eϠl 0 bSӢd Rcӣ? 1PR0 b0  Ww0 `0R Cp W"0QT2 0000PW`0 `0R CY W ``+o " P% J4 {;A-MPp@`G40@0 p00@00p T p`40FЍ."00Ѝ(@- @MЍ O- M`p@P(댠 P0 X X0 0p00 @ Ѝ@ Ѝ DO- M`p@P눠 P0 T00 0p~@ ЍƊ@ Ѝ p@-0L| ^ࠓ P0L|@ T.^ڬT00p^p裊00pp@-@0M-S` +S`P0 P' 0.00:S V00c0Ѝp;0 P 0< 2#00:S0 P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <00 0 0P 0.S 0 |P 0.S 0 0m1o@0 e@- )P8 L5@0#(@c\3i*0Sn SW @: :B PT@ғ5?0c ScEPPgVfVF0rc?E1c_`GedP0pfV0@1 0II0CL``S0DB\BP< P`>#P@P Q\1 0\QTP@n 0@N@  ^0#@;\00L 0 @c\0#3S0@ 0 [ [<404 0@-M(@0@0dЍ XPY0 0A-00S`P`0S@P ,0E < Pp@ nP  pY\Y@l 190@-mL0l6\|@N<@h0P Q 0-S 0#-L ! b4 0-S0P0S00S0S0 `XTO-PSb`51E0_: T P O O c0 (: 6(QS X00[$ _0/+>P!0 Â!2c0Xÿ0+" ?00 #2>PV[ c0 ܁(: 6S X00[$0/!+>0 (a o!2c0Xÿ0+"  ?00 #2>[?PEG' `@Gpm1%0 P:#0  ό"!/ U n13:$  p C0!".#2R> ' @0 2 30 #1d0TX04? B4sppp0 0/S [jsc0 (Q _o(: 6S X00[$0 +>!P2cX0;#0(PV[Pp`vc0 & I&: 6S V00Z$0 *>Â!2c`V0:#i0&bnu8?O0P PcR` PU0$I"IVY Ba!kC(1 ? 0c00(: 6S X00Y$0! )>0%!EÂ!2c0) XLß8\?H)" ?00 #2>r?D$0CI"I 00/A!b,!b S`0 B@ 3 1I!` 50.c((H`" <2c4 0S/  0` p0a8\?H)LN*" Q @ \ uO (@ό"! W/ }:&*V &R Z$/!* %!E!`& V 0#0 0 C2 Ό 02!>`V0`000 `000T@DPP0S`@( 0 @ 0$ <Ѝ& v )1 ?0c0M0):6S Y00X$0%(>!E!2c(\/H) L0Y("0 #2>D<0@400P` # ≑0 ]P 0U000 S?S00SX 00PN<h0(0s ?S00`Y L0@- MH@P@00P UNLh@(@ Ѝ0 @@l@ KHO-P0M`@<SZ0PSЍ0S >S@0HSh0P0 T00g 0S0Ӄ!100 0[@zhphp@ 0 [ Kh :h0 0 0 01@T$ <T=0pS0S >S@p<S*S0S -S0 C R@0H9h @ bh&N lFhpFtF 0 0;@1@@0 @0*T@T -T00D S0@0ISi0S,S  ;S  RSh .Bl SJ ,S;SW00PP 0,SM@PG 0SDh lpbu( `,岷l6w60p&(,h"@t6<0 5Od)0 {,@P.OL P ' @$00 . /O4 Z pP [  R9 K    cR 5:0 cR$ 0#031d 40?0cX ؃@P$ p)<(,2L"@ ,!@0 ' @8 ! @< |$P  HPp@ @ P 4 L`PP0" 0bS005:80bS4 0#031< d0? 0 cR` c sP R 10L`1c00 P[ЄHP00x3 D p0X0=1@40)<2L80P8 5@<0(<2@@0<1@T0 7 0@\010@`00PPP0@ $@Hq @R + [ / c ^,  \!!` / $ cZ .$   ࠳^B Q ! !c 0 ?0 c@Rp@0PU<( , 040#5#@ cRT05:\ cRX 0#031` d0Y  HplP 0Y  Y. 0S ؄DPP0%d0g.f>0 0N 0h 0吂@ 0@≂ @L؃@P $ 0 ؄DPP0 B1R1ð1 G Fl Ed C!0 , Z0S , * *B%/ b Rl\ Q S k'.+N Q( %@ (,"@ \/%O .+N0 ' @4 *)|\H rL$   `R @ $"@m#W` ף pC  @)n$A[ O@:0@P % Ό"" \4. $ 3 #!do  0Q S@o!S \ )|rLR(\/H .+N Q( %@ (,"@ \/%O$ .+N4 ' @8 P) 0   PHP@m H b"`%@g׳ pC   P*$ n%Q R _P:4 ` & Ό"" \8. 0 3 #!dO So!@ 0S D@ 0 !Rc0@D Sj !*Q &@RQ P Ϡ! . ERP,b)L PQ\H/b"l .  n kN.B!PpPp ᇒ ढ़ p Qs  ` p}C&R ^.U W P@v `3`#p^ 0@D S  P^(/O 000cP<S:(;Q00 @d<@PqP`P0T WU XV V0QP0T `? 00?0S PpTPV PT0PT` 0 4/P x0Yt Qp Ql, Q|h@ Qxd( QtD0@S QD! @Q!SH R0S `Vj 0SgJ1$F|epHh@AKqY 0 S0PSJ#=p 0 A0 S6 00 0-S 0T \P?? 00cS !0 <ƴ spiPɬP0 0np@-@P<P80 0DV 0 p@" rh< 0@-DM@0D ` P0` 0 m 0$0 $ 400(0-` 0\ (0Sp`DЍ rLh<Ȝh@-@ S\ BZS00cSwT 0 ̌ <1 ! L3/L2S @00P2S T? #3T #QP0P0@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2SH@4$`0d A-\!`X1M @P00100P0Q0S0 V6 T<p `0xq80|qn8O8T@D1@V  @@TAPP@P"0@ 0 0 1 30ލ`0P0 ( sVDQL0 (suT 0  < h t T0- 0 M Ѝ  -<0< -0M$0 0 0ЍЍ/ 0--M0 sЍЍ/0 0p@-P@Xh`00C`0Sp S u P X0` X PXhpXJ`u \0 X0`00C`0SppSr P X0X /X+ l-404-0 M  X ЍЍ/ -4 4- M00 XЍ Ѝ/ G-@SpP] 0S:X( (S Y" WH Dh0` V V,* ?sp0J00/PM`1tT000@00 `pp`/P,0`VpC0 00 h s0 0SJ 0 00 hQ40 qp0=0 qIznPD@0 q0 0Cg Ihn  p @--M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-PPa$M@`< .pP* p@P' !0P/S0p@0 0 0 0 00   $Ѝs0000@$Ѝ0 h$Ѝ(0>0 zq 0 @-@P ig 0SCng0;0 `q RY@-Sp@-@QPI 00!R ! 00! \ uP 0A` / Q R'  R0  B  P R 0 U00SpDeP eP `eP0PW40 q00A(0<0 qs 00   RC-` 'P(@ R0 ,°00` 0  a0R00SL PAD\`6 pgfF0V `1!  x0S<0V `1!s  x0S  p x0SB0V `1!U x0S,0V `1!FPNx0S0V `1!5 ?   x0S pT 0V `1!@@@#!  00B S0 ## 0B \00C$R x0S p% V0`1 !0 *R# 0B@ Q 00B S i  x0S  up q  x0S dp  ;  x0SV0V `1!x0S Gp 0V `1!xX0S0V `1!x0S0V `1!xM0S0V `1!rx0S  px/0S0V `1!Yx0S0V `1!L pu pn pgs R  0 0pZ  V@ `1- pJ pC  x0S p6 0V `1!  x0S0V `1! I x0S p J x0S0V `1! rpD kpp T R _p$ Xp QpI Jp)_ x0S0V `1!] x0S0V `1! , xt0S p 0V `1!pE x0S  p$R_0@' p7 x10S py 0V `1!Ax0Sj0V `1!4x0S pXx[0S pL@ x>0S p? 0V `1!  x 0S p* 0V `1! p P y pC p xpD qp P X 0B Q^@   0B \0@$R8 x" R 0O0p V@ P 2 P - P ( P # P  P  P  P p0 S p  0V@`1!s P $R@00 P  P  P } Pz x Pu s Pp n Pk i Pf d Pa _ P\ Z PW U PR P PM K PH F PC A P> < P9 7 P4 2 P/ - h  P( & P# !x0S p 0V `1! P l  P g P b P ] P XO-oM M@PH /P0? T0060 H0S 0T00!R !0{0L0d00 O 0SL   RR l PiT 0pa @0< T08 }8]d 00R`pzP0P0 0Sx0%1:02@Z  0SP00y RQzbO0 0d0 @`80 ?0pP0X`D`P000P @PK0`0 <00@`0S 0 10S 0S 0P0P0 p@P@@@@J P*U 00E` S0 0 P1!00E S P@P@` l`00y00^p  0zS0 Pz0PS 0z0PJP@@ @TP00{0~{0P SR\  0SLs0{0\0o  `4$ 6 5t 3 3X 2 1$ 0X /h /( - ,8 * )Pp00E S   8(00B S$R0Y S0P0 10  ,00 , P0,0S50c,0P@/` l`- @00*ps ^ R 1P zxD`0 l`0p *? S !PD 0 S0z0<0V ] 00p0P0R00S 0 0pP  `S`-0z0m0 @\bOd` {]`F08VdVy @zV00 0XDS L0 0D0(10R0bB+ S- C S)!wھ/ BL ScS1e00P`EpBQ000@*Jo B0(h   BdP z\00%\ Q`000$WF,AZAZP  pJZ Rp Q tY PJZ( 0\ 00 S0(0DQQ<L`8@FT@T00QTBY\8ZP8P   d0 bO R @  0%8 `FV`V ژ 0 `R0  pVpGWWf@(P``pGW 0R`0 S X000P40TڴP(p @DT 0R0 S X000P @DT0 P\0@0]S0 p X0p 00P(0MX000P_ R 8`QbOd@LQ00`@0 S nX000P( 0 Lp@Wh\00JI ZP  0  P`@K[ RP ^  1X PyK[( 0@ ` \ 00zQ[%Q l` jV00p0S%(0Q8 d0zRo @VSY W@@P70 0(*P0 P0 S@0$0Uj@(p`PEU 0R`0 S W000P0S(0Q W000P( L0`0C0 10@8Q00'S W@@Ph J?000 0 (  00 RX,       d 00  R  @T^ L < `, @{0\D00 0 R RbOd  d0 ! ,   c d`80`F0p90P PbS 0Nd``F800p000B%-P0 p 0 Ss W000P OS0 p V0p 00PBz0S 0z00Qp V0P,%(p 0S p V0P(p 2<00NS! `Uz/>0(0800@00` 0X@D0SR 0``S@@W%do@(P``pGW 0P`0S V000PpGW0 \0p0  @  Sr 0 P1s 0P 0 0p  SP 0 01P Ϡ R0q-0z0 0SP @ X  ؟{@/ 8@ @X D`TPXQ X8 HJ@DQ0 0RD pBWpW ژ00QQW`A`VVڔp 0`P@pIY Rp Q U P2IY(@0P `X ^0`0^S0 U000P(0S+0(Yڬ@(pPIY 0RP0 S U000P0U0P(v 0D \b 380D \b<00080S50(2S 0 P5 SP0000!1 P0?0<080\0@X0D0) \0bO{8\ ̬ 8PL̬L@Xppt@P$A0S!"<  ?  #r"l@@E@@@(A@ @Sȏ @0@XC0E @@PP S PX DD@PDPD@L LLl lLqp(qA0S!" ?0 0? r&AS`.@"lC0q@@#Pq |\ 00aS0 D T0D 00P(0Q x0D \a00CL0S0j(0k  00,0 { D  DbOd`0\ 0pP`F8n`0 @0pj ^- 0 z0 Rp"P @(@0 w ;R ^7 00 z1QP£ Ϡ )SP0000 P0`0 @0pHjU ^ 0 z0 RpP @0@bOS0 P 10s0s0100P 00000`    S 0  C S 0 P1Ϡ 000S%QS01(0r0  ; ^ 00 z1QP£ Ϡ \0S  B0S0S S0\`X?0<0@D@80`Uʀ50$0800`@ 0zX`H50,080S0 (0LS  P0000 P00 0S 0sU L0 0S0(0%1S 0I00$S0000( D Jo00 ER 0 *! 00Bh00?R0SL 0h Sz`<0`@X@ 80?0 00i6S0P~(L0R``S 0@\L0 0Z(0S000P? dd`0p`F8 S000P V%P"l^d 0Pz P S0P00 0pP0p0S` 0P SP00 01P$^ 0Sz`p^W 0Pz aP SC 0 P1sOR^" 0Sz`pP @RD000P p R0p 00P> 00 0810 080 LbO c8L`%N0S  , 0160001?2(*p iRD0p 00P S  P0000 P00 0QR000P ( ( &̸ "tt8$  T TP0 zRpP0@ % 0zSP0P0@ 0%10h0pp0t@Xd`8P`F0p S 1,0P`p x0D R``S 00C? 0@1AS(0t@dADaPp`(`@DT5 0R`0 S Q000P0P000 P0N |?0<0@X 80PoS7 Q000P/ L"P0 @ 0 "@L|/> P`T 0p@ $0@00P0 0z0RP00 P0D \] BL 0?V0R  A@ SP000 P0$00 H00Vp 0SP0 , P0 @!P0 zRpP0P P0ϠP 0nP0 zRpP0 @P 0zS0ϠP <lP0PpP0P 0zS0ϠP m" 0zSP0P0O 0P'@( 0@00P`00E SAp 7'00A S$Q0 S< 1 0P`0S$ P0pX_ 0 $ 0 s SP000 P0$00PS0P0`1`0  00 P0j H00pJp0pPX H00p; 0SP0  P0 5@-` MHP@pR<0P 000PR Ѝ _DA-@P`pR0 PRO- M[T0p/ <30P $  ЍO 1[D a `Y: 3D-@"M @Ϡ#90c 0yЍ0@-@PMP  0  Pp`Ѝ0 0;0 nT   p@-0@Q r P p0 S!P00pp PP    !AU @0O-M`pD4@0DQ00P-5X# @0S Sl @   b 0P1# P  0 T@@  0  WS`v ЍW Qy @0Q AX00@P00  T 0`00QA@`VRTQap0 0 `b V 0 XT@P@0Q>W 000! @TQ2 0P@020k  000U"000@000 @T 0Sd0T 02aPP @ 0"0! #000 @lb`@Pr 0Q/ R  B /A-`0@bSP'`B0@AS* R@D@D p  pSV W@0@0  `f2& @0@AS: > PPO-` -p̟ M 0 s N,0 l0x00Pt0-Q 000Q| 00A S040 @ !0At@00A S TT!0 A0S`Ѝ 0S0 EQt 0l0S $@,(@Se ?o280$0Q0$0吊Tg `` T ء \;* +0g 1S B0Z5YTӨ(0S (0SQ( %0dS:l 1J 80(00dA1!  0 ` ` ء` ;P|000000XS+ PtP0Q Qvx Qt000Sl00l0R  x lЍ ,t`0t00+S -S$1 0C ^0Stot00S 1C\@dZD R3iSt zISq NS,Dt@ ~ P$ t 0000(S0l0t 0x 00Q Q \ , EQ00}0x t`l0|000(0`D`V0`S< X(1J V 1 ` ء10p Px |0p0|0 `LV |0 p0|0  A< RH Q0 `CV `x Vp`v0p000400 S|  <00S-00<0000 $˷`00 (0, S@?@080 B $0S, Tp0L0HH@ 0P0_    !yRx0 PT x0   !mRp@| PD0P 0D X$ 0 @,0@0@ppC0D,@Q@D0C@p@T00S0S@DpGH,0SDQ(0SWX I 0P 0  @P 0S0S   w L0PppW 800 S `#h Z<00 S0l0 $px W@0 pGW;Q U Zvp0P0L0p$ 0#Y00S|0D0dI hd PP dQWx{  ! xD Px 0S pJ H VD0Zp |000C?o20S Kx i`+Z0S + ) ' % %&2S X# `HoC Z*0C/BS B 1J`1ZZ* 0oB`F`  0 a 0Tt0s0Sxt00S n1CQ 0ESM k t`@+ `f ` 21J V01  ءp &2S`! HC Z*0C/BS B 1J`1Z0ZjoF `F`N A 0 a E 2 P L000t0QA P!000$00t00@@t00C QQt,t00C QQ0  ,S0,0  T@TPP@WT 0ӓ" <V 8,@$0Ct0(0C ^Y(0 >.t00C0N Q0(L\@G$Q@a@znS x Px p00p0s 1J0@08 ,  B 1 l000  ء` LP $Zj& @!oF`F@)P~  PZ& 0`P0IkUPx?  B\ 0S6 p $0 p 0R00{ 0P 0)  P% O 0P0@ 0P0xA Px <0| 0C<0 B| x.00`hZ   Z80{S相I8 80S0P00P0P0吪00cP0相`a PP B\T<00 Sp  Bp 0* q %$Tpl0P0l00S |0 0HF DHB@ |0R! 00S S SD x2 0x000 0l  "!@Q*\O00  0c2300x S6 40S(0Sl0000l0) @0l0P"00" PBx Pxa |0p0C|0F I500x0  0l0nP "000000S0  EQ [3 !0l0p 0P0I\0$0C0080 qpZXWX Rn0t 000x0Pl0x St`0`0$@a,08(0@0sA|dzx<0| 0<0 | V $TppPIU6 xg Px |00C|0,Z{80S相I8 80pS 0P0  0,0lS@$@ @A($00c80%00880J  0l000PV e$pW pG hP$Tpx <0p0C|0 nPxQt@PP t00Ct0 Pt00t00000x l05 !\ \  XXQʸtP@00C00,0 0( 0ES0,0(x000 0 00P0(\@ 0H `pP0f0H`P0`Q @Gt 0 , @ I `>3[( 0|100|000=&| 0 `0 #1J5S 080(!  l  ` ء` P 0@,0A[$Tp. 08pP00P005 `Z$Tpt 0S p x0  ~\ 0   B!0p| l0Z$TpjU!0l000 P<0SPU@P PP0000 0P0l0S$Tp!00l00S/0S+ Ao  000x l-$Zj& T&oF`FZ$0Tpx 00000|0P0l0U!07 l000#Y00S`x 00 Z^  0l00" Rz   l Px1  pP1PeP[Pp00p0!0l0k$Tp<00 lPS |0x 0Cp|0yx0! l  RW0S40040Q-|0 x 0Cp|00l0Px_0,053@- 00vHG-` 0Q`'@PJ PpPa0Vs #8z *8 A"80A# F0V B E 3  ^ pG0 ^s#8ᲐB)80B#Y 0U 1 PP `P    !L/@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X  \50QR i T0#03\0SWe* G0V*0F@S F3 BS   3K0WQ 06S OW*@DPD@ Q0A Q0Q l l> U00XS Q0X j00Q )Q 0Ѝ<^0 n 2>000 )ARoᩒY 0v Q>0?0l 1 c0R:j O-MpD0 J:@`00S 000S 0P 0S EA R[* @E  \  P 0PS9 Y@@@Ѝ@0 R[Y Q 0APS10Z ^@0D0CSڣ0S~P [ ET p 0 pTD [@J S0T0 @  Tp BB! B<P DR0 SO@T]@DTDZ ` `Q ߰ AP[@100+S -SU  PV PT0 0@B\ @~s#,000 0L@BT @R0lYE^bP 0S 0 S S@0S 000 b@0 0K"00Ff0 PV 0SP00S PE 9000PY@ ^@ %@B,`P D` 212 Qa`^000 0S@0T@DUQVD`` 2  PE1: B @0T0- T@ T@00'@0PS YPEP RH 0 R Q 00PS00; 0@0@ENP 0 C0 Rb@Rp@DU 0S S SUU~ EPyKP@"00Ѝ^0E0 00`Sp Sj S6 `Pb@0@00 0 0V@ !I`T0 Pe 0S500@ 0faF PeP\ 0  SSIJ@"00ЍP20PS0 @_@0 Ѝ@0S@V 0S S S@@0S000L#@0S@0S a@00c@0@0S `T0J  RP!@K0@0A0 R@S 0 R S@߰ P[ B@10Q@0S80@0H R( Y0`'^ E  000@05@0S 0  BR "@q5P `@0S Y ^ 0`q0PS @ "P1 5@  P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPV 0 BP @` pTp  0 BP0U`@-M`p @0  B00C2S J@    B Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ %H0"S1 1  !2R / 3RS/00 0 c Rda ` 0 ` R<A 80 ` R/cpcDTc$A-R\0000 A1 !0T pa2!"`'  T2!L0R L,! T TL L\LR 0@-@MS: P @  0Q P@ЍA-P$aM 1`p0S3 U10AT !0S 000 @T  0S00 0Ѝ 0 @0D1S@000ټ0S 000м <p\D p@-@P00p R pPQ`00App@<D `ᱼ80 0QApp@襼 pD0  +0#10/sQ#8sQ#4  00/sQ #2#01  //1A-`P@100("@Up0p 0S1pP@P$pP    !Fl`hP081#3S412ss /"r3J / R//@-@P0@0O-0 MZ  @SpP; PaU* F B  ZF ^!*0I X0C0 0ZP`V 0600Y0ZP`T@T 06S @ ЍG-0PpR%Q@X A@iV&10SP`P\ 1q0i000S l1⎻ @P4 P1 p@T `P@T10SgP@$ 000S 0d0_@T 0C  pP@d0LiV0S 80A (0R0i pDZG-P`塢0`@Tڃ0TP$ Zp  p E0  i )  S2!:R0L0C`\0030 `0pG \ `&-0P1 0^$23\ *G-`@P0@DT1  0\E*32Q G*@@P`Pp @!Pq@0 0S 0S W 0G`WL3 PP`R@H0 0S03# R B B  02NS dP 0!0P` A-`@ApDP; P 0`0V @ *\ l0D1V %& 501 P%&0;BV `C5,5#11C,C-` MXP@P XzX0W6Y0 W 0 C~GpGp50cp0 Ѝ {0P c2# RW C>C0C01` Ѝ0S0/0 R /@-p`aM@P`D ?P7PP5 ᓱpP/0 S Q6 p! 0: S/BP 0uPP@0 000  0 0 m ЍnE00Ѝ\PH0E0 ]C]E00YEO00 0Tㆲp@-@P B900C0S0 P@9pP0=0 .CT`@-@P 00C0S0 @0I04 CTp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SD 0 p`0>0 BSSp@-@P8 0S< 8P00 P! !' 0S 3/PP೼000P @ P 00 00`00aa8?`` 0p<6P(080 BDP 00R<@-@P 00!R !#P 0C 0;0 aBQ@-@P 0 0 S @60;0 MBQp@-@PQPU 100SD 0  XV ;000S% 0'$0 3/0:s00P7p00P @ P s00< R 8000S60 0PʸBHŸ@5P00s0`0J08 A 0@0 00 pC 000@00  pPP-Ѝ/A Q@-@S S S 6@@0 @Z 6@@0 @9cC 0  6@@0 @j000 0 0000/4P@- 0At @C41S~ C-P ! Mae `@`2/A/0@0 혷pd APMOĀmpX@Q 0pGiPS`Q 0p Q 0p(iP4Q 0piP*Q 0piP Q 0p iP@Q 0phP  T ЍCOppC, Ѝ/NQ@-P @41S ` P hP0BA-4!@M `PP/1S 0L14P@-BPPPU!RMPP !PRp V B`_oRB`B``p@-@P PpPA-@`*P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V 5BPD1BPSSO-P M1 S|$aVp$q q(SSp A`TT X`F (0Pʀ 0S `(q\ 0VP@ A Ѝ C$oB/갰[$ (xp 0\ Q x@^`PP ^@ pF p(VJ ( A$!T0$1$( [ 0 `( A^% \ :0  @PA, 0 S$1J(!r5 V(* T$H0 ?( [$5((~ 0Q0 0 $s?$!@` A(a$Tt 0 $c?(P` 0 `nP]$XG FF|O-,M  R0 1 p3/,0 (Q0 Px @P``^$`P 0BZB @P UpWW 0 g`PP @R㲀) PUJ[Jp p,Ѝ 0 'mPPu3  $`em$`P  0 =`P& @R㲀/P  P^ ^2 ^"  }eP 0 ~hP 0`00,Ѝ0  mh0 P0ᰰ[P U pLp  LeP(A DR 1V(Q`0  @@"mP 0@-@ 0! \ @"n@,h@00,1S@-@0 @ Y@00,1R@-@1  0@F@,@@ ,!G-0⌕SM 9 Ppw`@PK WQ    #@P 0 p@p0 RP  0p '0 X% PU" A/ Qܫp APae`@Y @Zh4  !2/@P Op@ !>X Pn0^4P P3S@ S S0@a4`9P3[0U D H $`ePN 9JZ5P7Xce0` 008`XD4P ! =@ =CPP >```Z >00>@p>p^>p60&>P>P @T@LO-@(P0P!0`5R5s`(P5QؑJP- (q ,0[ D D S 1"1 Opgꁡ kP ر $ JD= ؑ@-@ 13/, (Q0@-@Q v.00 2g> 0 O-SMf` $ ZpW 00PЍ6 p% 0P 0@P 0$Q1012PP. 0X%0 20@S p5 00d50 0\50 0T500L500D5000 S S =00P Gp A 20 2 H0 p +0fWp W|3Wx# 2Z 00 20120GqS  000 1S 0@8 G<8 @Rr*Xw? Á Ñ 0 ,P0 "  -P 1S0S1S -1 29 21 29 21S 28 2EP0U2S #P-E0 MPyP00b @S ; < St480$ pSxS<0^40^80\4!0\8"0R4%0R8R,&0' D0@ ^ \p#R+; 0RR, S$ S(S< 0 +;+; ;2 SO40SL8p`0p! Q0A R  ' 'PL 10CSp'*w0 p0C 0P$0 0Rᴀ  '`崀X 00p10CS`5*v0W 0b0 $d50 R `崀 `_'V W'`崀 0R &P 00,0b0 $55 9'0O-pP,M`Q *'00 VV 06J  (0x7`F0V` 0FS700@,Ѝ(0VO ,0`1vY+ 0-` 10`1 I0ⴐC 1& _&@P a`FV`:b $ 0 4a 0`F `Vv6:v` 0b ` 4밑1I0Yِ`1: 0 b41,0@1s0S 0 @0& &@P 10CS0:\5b0 $4 @ ⴒ@P ֺ0 00(0 @ 0⸑0`(0r?H=Z 2  @^  h&Z 0 p@N 0S>  00Q& %@P= VS V1 VO (0{aV@ :&T@  %@P$ 10CS`*0Fs @崒0S 0S 0 U@T  @崒(0KaVO, @b 1& |%@P 0VSa V0F %@(0+1ḑ0CS㣠y7*z0YV9 ` %V R%@P  % % @I y洒=긑0 @(0崒6`FvVv @: 0 b3 @1b0 $3, @崒{0Y1a V0F 1% %@P 1ᴐV0CS㣰y:P1b0 $~31崐ቐ  1! 0@x% $@Pd ` ` A0Cs 0 ; 0Fs6 10  崐C @1T% $@P@ 10CS`:D0b0 $:3,0b0 $33 hTD(p@-@`PP 0 00(0`0Q0(0pO-p@`&P6LM 0Q0D00 %00 2[V  400%5 0 D0 30\LЍw0 R*R* p 0 0S0800$00 P<080 0Vk 1S6  F$P䑄/  {00! 0Ⱐ0 B0Rἠ:1S 0ZS000 P 0 ἐ00000S !$  P 0崐V` S0!1  BR,*0  P 20 2r(k iw0 Qx #`P_ 0 p W$R0CS㣰*{0Y* C 0@1! 0C s0! 11 00}(0  0RK 1S RQ  RYF  $ 20 2AQ00i*10CZh `PbJV0`尐0 2 i Sf # p 0 0S0000,00(p4000(01 S0"1!{/010CSP*u00C S {?尐!0b0 $1c0`y0弐ᰐ300D0b0 $1,0b0 $1 D \O-(0Mp I @aP0`f0yPP P FPJ1ZpuP01a@0  Q1R@@10CS㣰N* 0Ks0S0Cs00  VrS10C1(0  0R/ Ѝ @Q! R b0(0 `p) 0     PQ Hp 0 0 >p1 S0C1ȁ3b0 $1T> Y3 0I 1pWP(00(0U QPEUP*0EY* 0p1CPs YQEQPEUP|*uP0EY Vp崑 (00(0D10CS0I*S @```0 `p崑P Q +"PP  @PAPV(00 (0"0!0!0 "PPo PJZ㪠7* JⴡP(00  "0b0 $r0 0p1P(00(00b0 $_0u00C StQPEUP:P0b0 $P0{80b0 $I0 M"s  h , p@-@PQQp !P 0 02"Q !P 0 0%"ppO-,Pa V0Fg 1!@P! `Vp0ഀ0 0 .pp 10CS0*s0S0SQ PP 1b0 $/0p 0 Hx-1FV㴠0pp1  0 S001Rpp10CS㣰5*0Ks0S  Cr 0 Sq060W10C1 ! R bP 1 ! 1 |P ! !0b0 $/ hO-pP$M@Q {!00 2tT T j100$Ѝ(  @d P00 $00  `PM  R Kt@ Y*P0 PcA 2@D @bT㴐:b 0 ,/Aᴐ@DT@* 0t@S @D0COo0B 0 p= 0S0C@0  nP 10CS0N*s0SQP@ v pP 10CS0*s0SC 1 Y10CS0@*s0S!P  o  jTq*t@TtP` 20 2$Ѝ4b0 $.T  4b0 $. T`  00  P3  RB @4 @`0 0R8 `V  q, W@ t@ @DXE ~ q Wm 0G 1P AᴀW@DT@: 0b $^.d3b0 $W. \ W  pP\+Pz 2b0 $;.02b0 $3.F@W1 @0t@@C 1p 1 0@10@pC1%  @P Iy0   P u@T 6 T0/00`  R P ,` 0R pW 뼁V@B뼁0V# @0H 1IP_ X R  B1T@Dr 0ⴠC 1 #!@D0Its0ⴠ1 加  10  P6 10CS㣐:\0b0 $-    P@ H4@-@PM 0  0 P Ѝ050 i-O-p"P2JM @P M`0040h VW00?$G?7O0S 0SNIPIT/ P @/00H"@2 0 4 30Jލ Ѝ >X@00 0UXS 0 I0;s0, T:)[' PK0/S  0G00P0: S .000S0I S.?00 1X0 ,QP@PV$ 4- Śp".0SY 0C \0 RK Y P.00W p yP .@on  R Q0P:Q0Q:-@-@-@@ע $ @ Mp@-@P# )P$  p@踛ย Ld @- M@0 @ 岳P 0S  Ѝ LO-\MkeG@3PapdFxF`0P  $,4@< @PHy    (0@08`-CDLp PTp `` ` @$ . `&(dHnfhlȠ  "Pb* P0#p' `&PflP c:eZ @$``gz,dL`l̠ . "` n0#P%,\ p'< P| P, @$` ,.dH```eXlȠn `0#  p'`c: gz P% " ,e\`   "l̠fjb*   @$. 0#dLn p'\`& "<̠|,s$PP Tp(pP0, `0P4P8PP<` PP` P @P@DPHPPP 00p  $( y",`-"C0 4@8F00k0e4G0 0\Ѝ@- Rp 0 \MP@0`0T00  "P  00   (,@ < P H0 0 T0 30 \Ѝ(7 0, <+  x4h1O-`0X!`0M@ p 8`P  ] 000 0 4p. R+M X G L h   0 0 < 40 0 0 30Ѝ\ @-`pQMlPDǡf0S6 岡@P P&UЍ Ѝf0S!  p # 'p 0 00 p@  ᷙp vTt@@ePU  @⥠ Pgᙙ`@    ED DH0A0O-PEdM@ZD"0!82 `D ?&cp0$V0\00  W Te:Z0F0#Z(VG @`p @ p@p@P V@P0[ Z]!|1 0 \0 30VdЍ\0 <)@  *V; @ @A S 0 p *@ [ @0ph0 <) T:Z0F0Z l0 <)Z0F0ZV[p0@ $2PO-M0H`(p000       :p2K[0 0+;R bdbjcHd(b@ ` ` Q ;>"<  0 \ P Z̑@'GP N \葐     @P(F 3*Z D Z00300F P  P0 0e @@ P0f000d | H0 0 0 30Ѝ@?>= |T > > > 00@- 4MP00,00+ @T d 0T T H0 0 ,0 304Ѝ0$  t = (! Q$1 A-HM0@P0D00 p `RV( 0Vݞ p `AV 0V  ; h X0 0 D0 30 HЍ$ $ ꯞY = < 0 C-P04M`0,00%`@ pW:T p 0T k%T H0 0 ,0 304Ѝ$ Hr x ; 0 0@-,M0 P0$00o @ T ` 0T P D0 0 $0 30,Ѝ0$ D : , 0 @-pQ0,MP0$00 `> @T 0T p d0 0 $0 30,ЍHV?Z/<'$  :8 h$A-@p0P A`q800P0P0 00S   L| P00 0 00 0S$1   @p P@  0  P 0 0 0qXO-ء@pJZn*z0 ( P  aPz`F`0 VF*vP P Cx  P岁ᶁPa`F` V>*vPP0 0 000 0O5Vv`4*V 0  rPP:Vv` *V  00sPP:1bL0d p'|bL0d p&1\bL0d p&@bL0d p&$00 $&O-14MP0C0SX0ᰐ*1 0CS  0 0*0S $4  0@p`  (P,$0Y P P0ES 00 01  PPPYg00CV 0 @P`pUv`b*P0u@S0SZ 000pVwp:@(P,@T*t@1@A(0  0R 1 S0"s0&1!V0C 01ő 0YX0 pX p0Ӂ0C00V*R p@PpP V@ Bt@Q 0Y100!00Sa*00CV] YPU:$0 $ 0#&01  P0P P Pt01  P PP j\P    r` @v`@pOVt@@pTA*t0 Y!0s00s014Ѝ   r    rpG(P,wp@@TQ:0 $%I0|0 $%`bL0d p%D0 $%`@p,VtC-Mp`@P& PP! 0!0 0r 0000 00!! 0 04000000@PЍЍO-$M@HpUPPP 0؁00岁S000 00 001 1ᰀ0CS`I*v0X< ؁Ԫ`PH  0岁0Q !  F P 0 0+L0 009!&Vm@P$Ѝf$Ѝ000100@P,bL0d p$ O-\M`>0pᄀ@ P30$ SD0 (0 r@T X'*#1 0Cs011 " r S 0  0 0@SD@ a,00Sp  (8 008,000F 1PR `V 0` 00Cv`cS00 p㰑1 0CS*0pS 00"@ `V@ 00 0 00CS00 !1  S0 pp  "VQ  IY㩐*y H≐ Pⲑ T PLH3/ 00W p0 01 , p pp 0#S10C s011   00000 o 0@00DpS, 0S 2 0   a0S @ P 3@,0p0@ 0 S@Dp    \Ѝ3@S00 01040封HX㨀*00x4 1pC0wp0qqpఁHX㨀*0x03@S00 01040封HX؀*X 0 0 sP:400岁 H0x 岁ᴁqpGWp*W 0 0 sP:0 0_ @ IY㩐a*y0V* C`` F 1`0100pN  W S@ M Ig`V@Dp00 0 000  0 P} 0 0 0& 각HX㨀b*x戀1040G각HX㨀O*x戀1040abL0d p" 2 0+ @Y@ \0 0,bL0d p"0bL0d p"=bL0d p"RbL0d p" p~bL0d p" 0 1kbL0d p"hbL0d p"Lq0 $"DpPS@P|\<ؠ؀O-Mصp@ ,0 弁 PPG aP`FV`;*V3 P P@`F` `tPV @ t@@ PP 0)00 10@@\P [ @Kt@ 0r0@0b $="PЍ 00Ѝ 2 P [0Q[P0A@DT@*t@U0Q 00PЍ P @  ᴡh `P~ 뼡0 X0 mt0 0C[q`뼡 X 0J 1d0P0 0崰ZA@DT@:2b0 $! 2P  P IP A@DT@d*@DA@   PP" a0 X0 "@VT{ a0XJ P0F 10P0W g1b0 $!g`  d0Z!0 s00B!@`Fv0A 1 010@C1l 0PA1b0 $U!` 1PE@Du t@@! @ 10H `P 10CS@:h0b0 $.!01U @D0`t@PE @C1 ӄR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P H  0( @ 0! pO-p 4M(@(2P$0 ``0p  pP`@0 0  0 R%f#"," 0#0 %0  d! "d! 0 X!p p\  P`@ 0 `.@X!.b!!     !  " !)! $   c! c!,    $(`,!A+ ;K[k{(b a`+; A4Ѝ($0G-~q@P` @g(XR @&!$0刁@`F0$0 0(`0 0Op& ?V9@F(?@@ 0@ 0T  4$0<$0 00T 0?`@pV? @?V@F?@"@@<$00T 0?@@@?`V(  "a0$00 0A-PP@ $p~)7 `v 0(0 0`0$0d0W0D Qh A^  08R(@R )@ bQ (`8 I )8 bC (`R @-Q/ @-@-@P L Ό 0( @ 0  R @-+/ @-p@-PP X0@0m@`\  0P P pD 6O-M(P 0 PH,P$@P 0PaP0<@(P8@4P8 ,P]< 40< ``$pp@ 0( @@``0pp, $ǠɌP0  0 $)',.'.97) ";4 0#0 ", '  "(0/&!   " 0 0&Ϡ' ( +̠ Ì !   ,,  , $  04 $Q(< 3408~?80 0b@D 0     $ $0 0   @  1a1Q 1.0p@00?0#<&!0#@!i0f`& qyv0"#.-%. " W i g YP%aPPHp 6D0G-q@P` gPX; q$0 $# L00L0H00H0`FPP`1VFppp$P;D0  S0@ *$0L00H0UPP`VP 6$a0 $#$0L00H0VFPp  P$;D0  S0@ *$0L00H0U`‐V PR @-}/p@-@PP > E80R pp@-PP X0@0k@`\  0P P pxR @-D/p@-@PP  E(0R bp0@-<PM00 P;@6@0;P6 zP DP6E@05P) 7P (7P 7P@ 000< P0H 弣p H ߍ0a00 ߍ03P 3P  @ˠ  @0H 吣p H\ ߍ0     t@ 0      4\ 0H  V30pH         0 @ 0H@ 000Pl  s  p  {  x@ 0L>@ 0<@ 0.~  O}  L|  I{  Fz  Cy  @x  Kw  HH݊P)L(o  0HӊP @ 0,@ 0|@ 0dN  M  L  K   EDCB <,+*)(&%RGF  Ű Ĵa`|  e  d  c   _  dΠ@W 0H Ϡ 1p{ lzI 0H  !pk D/0ci@`^\Z̠X=@00S,PL  Tt@ 0(X@ 0     ۉG-8M_(P` p ༐@W@V@U@T4 0S  P4 0S3 Q!-VL W0`b U pp P\K 0 020  @{ c8Ѝ0SZ Qp 0 00 od" P0w ! r R  #m:VW$ Upm P`10   0 0UU0  P R & U Pt\ P0 0VwW0 Up8 $1 P0`   } z00 R y0 P0SQ q0Sy Yb @aU^ PTh0P0 TP0P0  M Z| d , YhY4 8    L    hp@-๏0@T 03/@TҟhPP ͟00@T 03/@T\p辟H00@T 03/@T$|p  <@-M@@P Ѝ 0   ~p P(0A0  V<H-M 0ЍO-@R MpУ ഁP  `A80 S 0SJ: L 0 Z 0!80S7  Q@0 8 0 0 Ѝ 2 Z   00  0 0 0P 00   |P00 2   vP   oP  000 0@-RP M@PQ    s/r?  DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U 1!^ 0F BS @\ `fpUpG-`P @P0pS:ؑI Y `1`! p| ) PU  @PݝpP pPO-Mq  PpG 0 PU @P U `1`!  <[  0PU0  ЍЍA-0P @H P 0 a`F > P @DpT  P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp * *J1 '0` !  4^ <0PT@  RWY 00S <  Q(( Q BPS !SR0@T N000S  00@<Q 4Z ` [ TI 0S6 0 3 P0倰SmT0 c/`A SE !SR@T 000S $0S !,j0` 0S 0@T 70倰S \c/ a R  P!SRPU 000S  :?00!SR@T 00 R 00'"00#3 0 2 30ߍ\c/ ", p <Qg!SR@T 000S  00@O\c/@0r@ %uX *` h(g"0`0S$X U`3(0*PWY``2{ 0<` $H:p0 S (W(` `0ࠓࠃ\^\S440000<0QS<0  TQ`0@ gP!SR@TJ `%00E@ @` 7`I 0PP ` o<@T@ @ b W @ !SR @T 000S  #@ 3` B `  < tA-M`@P`@p`@p00 0,00(000oPbЍ -0  “ ƒp@-P@Q 0P !  2!0 2pp@Yp@-@P` VP"p0-P@  P 0S RP0/OP *0?c0 ?oPP0/0/R00[ B-~x` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@t0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@) ܼ 4 4 3/O-p?o,M2PP00# R00SGW=  0$00 R00    0SU 0SS0哨(g 0 00(S@C0 $P#  7/ P7/Pa 0S 0 00`PcPU0= E B R Q@F 呢"`B`FV `!VY*0SG* SG:P 0C 0 0000S0  RR㢀@($ 0 P   P7/ 0P 0?  ` @U) 7/PX X0  0R0X 00  0 @# 0P0 0 XP  S0PqX 0 00Pe" Q0P0 S*S: r "X  QX E ^@F 呢"`B`FV `!VD  B.7/P  7/P} 0 S 0SR0#! 0 R 0S0S㣀0哨( 0 0S@㔣$ X B`S 0  1 ` 007/ P 7/P0H 0`7/ Px7/Pڅ0 `DP7/ P^7/P 7/P^P$0@ " Q0 @  7/P @0@0St,Ѝ P 0  BP 0 C06-! ^@F 呢"`B`FV `!V  B&a`V|7/PJ 7/PPB7/P 7/P~7/Pl  7/P d 7/Pk  7/PT 0 0 0哢$ T P`c⃰@ @Z* @  Tz@ 7/PrU U   0 Y00 #0Q0 4mL0 (0l0 (l- M00 ЍXR Q0P:Q0Q:@-b 4A-SMP@  $3/d p0 PQ0 0o4P4S  $3/000Ѝ<00A-pd 4V:@T@T 0P0 S  00 S  0⧔@P0`0dp@A A-M`p X~@P0: S(ゔPP ˅P@ P 0 N tdЍ00PЍ $$4/p@-P$0r0" @`Pp$U04  0B0 0 1R  0 p %  00? ' 0 @-SAN 00S 0ܔ4O-S Mz@ApP`ᇁ0S*0S'  TP Y !P0 00 Q   0     Ѝ P>   0  PQ1 0V$R P0(@p 00q000S0 0p  4 S  $3/ Ѝ 00 Ѝ00O000Q 000A/0@-S@  R   0 >0S9p@-P@T @T 0 cpp@T{P`p  0S S/P/O$(0c03?c00 R  0 !!!0 ?oP//@-@ MRpP:Q !SV@ЍA0 0`y P F @vЍnT000@00O-PPp W 0SL K 0SH a@-[0T B,B R`  0S7*V5* >000P<0@D0C0S T0@@T  T,0 1 !3/P0@D0C0S(PQQ  .  DR !,0 3/`Pʼ@00 "R( T `10`!P0VQlRO,0 3/`PX R 0@D0C0S T@ 0T   P @V `! 0 0C0   B R @ZT `@ 0`V:f0P 00``F0``G  0X0C00 00dP  { 0 0C0  `q 000NP nX0G0 _ W<H<0 V V00]R 00YX8p@-PP& 0 `V @`0@D0T0@T` ,0 3/Pʼ0@00pD0Spp@/0Z0  p@-PP00 @t@ p@ 00, P‚ :@ἂp XpR0 q R/ S/p@-@PQP7 100S- 0 3   0 P @P #0 0$0 s0 00R 0   p0  0c0p ]$0<0  p | @-PPqM`@p) V/ T6 p p zP0 :CRo  S L 0( 0R  ; 0 Ѝ;0d00 ` VH<0 W T(L0 N HL,"2 A-@PRhM0P0d00< 0 C 00  P"D2 0 d0 30hЍ 0`0S# p0PO !W P00\0pS pp4PP0001|0`  0Sl$p@l PA D10F L410/R  0 p 00 0   0SQ ` 000p p00` ppd0`  xEPꕵ    pp@-@0MPԀ00TaցV( 0T1S O%0T1Sف0`00U TX!\!R Ѝp@诀\!Ɓ00Ѝp@覀00U\!X \!X0 000S/ Lp0 0p@-0PUp@0℀00TQ冁0`U TQUP xpX1P0X1u0T0`X1  ph0h 000S/@-@0]0 X10CX1S @TOT1局0 @M |p0 000S/g p0 0 0S/p@-@0P4U00 \A\Q X! BX!R p@$`=00OT!}00p@ p\ \0 -4M0 0,008 00 0 ,0 304Ѝ䪴 4 p@-@QP  ,Dp@y090  }O-M`P؃@D@ [Hp0VV\ U0DPW pT"S 00 @00`Ѝ0 00| 0 0L0y@r 0S m 00h 000S0S Q +[ -0SV00ЍW00 Q0[00S0S @ X0K0 8 V<MX0 / "00@ "00||d-M000 0 0 000 0 tЍ |op@-@PP` 0S$U  ppvP%0T0?P0p0:0p\CP0 @0A0 0S B80 {{{p@-@PMP`% 0S+U2 0  0 0p0ppq 0: p0pЍp@yv 0S0 PP41?0 $M00Dp > 100XS W#p0 0 0"00XS W ppp 00BA0C QSWpPppjp0 0> 0W 0@ p p0@ pu0M0 00Ѝ @-M0 @| x   tP 8 ,0 0 0 30Ѝű+8 u l0D S8 0 / 0@-0  $u@0 S 0,/0@-0(t0D S8 0 / 0@-04 t0 S 0,/0@-0<tL0D S8 0  / 0@-0Ho s0 S 0, /0@-0P[s0D S8 0 / 0@-0\F 8sT0 S 0,/0@-0d2s0D S8 0 / 0@-0p r0 S 0,/0@-0x r`0D S8 0 / 0@-0 r 0 S 0,/0@-0q0D S8 0 / 0@-0 Lqh0 S 0,/0@-0q0D S8 0  / 0@-0 p0 S 0, /0@-0pt0D S8 0 / 0@-0y p 0 S 0, /0@-0eo0D S8 0 @/ 0@-0P `o|0 S 0,@/0@-0<o,0D S8 0 / 0@-0' n0 S 0,/0@-0n0D S8 0  / 0@-0 n40 S 0, /0@-0Bm0@ S4 0 / 0@-0E t m0 S 0,/0@-0GmH0@ S4 0 / 0@-0J  l0 S 0,/0@-0l @/ /H-M 0ЍA-`@Pp8#ApW 0P@-Ϡ0#M0S " ! Q@, Q! QЍ  0S RP/O0?c0 ?oP/ 0p@- M0P@000@`!!0@PP  EP< (0 0 0 30 Ѝp (z A-Pp`@PR#W 5`SRQ Q` 0Bk ?o/o0CS 0c11@<)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO 0@-@P  000w / RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO" 0 ///Q R Q/U/Q0 R Q/00/Q@- S@ 0S@ \ 0 000S0Q0@- @P' TS0 C0 ^@DP \T0L^ Q^P 00PPQPS @R S Q0 S00  / 00/U/S 00RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P ST Q@DP  ST PUPQ P00S@Q R U// Q#/   //s R PS  00/ 00/U/ 00/SR Q 0 / 0U0/ 00/0/R - /p@-@R`P R U  V  R 0 p00 (oQRp@-`P@ 0S0 000 0R 0 0pP0l (oR0  S 0Q 00S00/ 00// Q#/Q- S$ PQ PP0C S00UPPQ- S0S P 0000S0| 0 @-M0@00000oo00o o4 ,0 0 0 30Ѝ% L -BMRM d @T   P  Pmi1    mLm0m0 @-@-`x@t"Mlr MP p $( rM TE <" `0b0R @$@`P  0u!1 0 $8 30kލ ЍB~p\ @0p ] }m0 xaB^P.`d0a/ᕇH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A @0@->R0M@ 0 000P0 01200 :P0ЍN000@ @->S0M@   "00!,3,0 P0Ѝ*00@-@m@m0 00/ t,0,0-M 0 000 0mЍ T -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ p@-@p@-0@ ,ppPmc0Pp////// //1O-0,MPp`W }0200(000"00 00  05/,Ѝ͎@PK 0S HHH S0 S0S1*! 00S S& 'S000S  0S S * RpC 0QW 00(0 0 0000dT0 0R0D00 0Jx@`4Lcc/Z/[/O-M-0= 00000P0Q0S* Y1 ZO00\= X-0040< d0 0<  0 [04  (0D T,000CS0C  Z˄0S* 0S0 Z 0S 000S S0S 0  0R000`Q0 R000  P@`  00CS0C ŷ 0S ~0  0000q00CS0C3  `@P  [00K0 #2 0 0 30Ѝ      ~+  0000D0@L 0 Z000 00 S*rp0``@ P 0\Ÿ 0 90<@: s0  0,@* s0y0lA@00@s000@s00 00O (0D TY|0D T  @    0 /0T0  0C_껤 ccc\H XWW\W8A-Px@@ p0`pP@PU J0S 8/`PEX@upW0:0  tV 0SS S  0R @-no/ 0R0@o/O-p$! 1CM M@`0Q0440iP c 0 0 44 30+Cލ Ѝ0`@ 4 @P t0 0@\_L+ uq 0pq/ ј |UpUPG-`0S+ S'QU$ pW!@0 S00#40S 0S0S0S& P# PY@ Q@0 0R!R  "$ R R Q O-0pBMMWH1 P`0 pW' 0 ]P@P UP^M^0[P;PD <0 0 4 30BލЍꁣ 4 pO-4!01 @ AMT M0040. 0Y+:0`Px0(S2 0pW!W@T ^ ^ 0 P pW $ 0  /]PH @0 0 4 30Aލ Ѝ0x0(S-  $O-mMMx /`0? |80060W [ !R & R/ ` 0  8 ?x@ X@0nx 0|  0 P   R: R20uo@P တ pR NP p Ḑ ggP R!Rs 9P P@Z 0Sk 00 0[u `@PPP0S@ 0Sʰ00 9 S 0S)  4 < @l [g` 0d<0v?L00H0< 0h S1S H 300S S00\01H 021QU[0P0S|000x0D0<00SyATv H0CPu L0PPPxs 0;dD@0 ᡢP L @I0PDP H0 <0H 0<0L00L0 0S d0S P0S@0S %<00x  R  P RY ꔋxp|`@00*0 0 0 @5/P @+,; 0 6 30RmލЍ 00S 0 Q <@PL0Px !fL0P0 |  8 : X0| 0L0q<000SB0\0CH0`Sd0c  `@pPV000`G0`/10$0(`  '9 D0,>X090Z?T000 04000F00ZdPP- U;00 0R0J `1  8 \9T0 X0@0Z@0   0@05($0 0 0SJ0@ , ᐀#/E)b,"%dP >0S : @70P } -0T 4 @0@0PH   R!  0 0D 0P^P`1  8 7X0 X0@000 0  1 01 0@0D`00@ cP$ 0 I Pb `1 r 8 60^ X0@0_O00 0 0\041PJ80&4H X0 ԃ>1Q0 U 0pK10} O `Wv@PQ@   W 0 0000QP O { vp01 000P v 8 <5@M X00PP@0 ScP0|L O @L0P }tR/00  (0l00@0|,K/0\8d@L`Wʧ 0+S .0CS P0@t@ @0PdP41" Pg `1SC 0    P 0P0@0m  P@ P9`!!! Q5   38 @ X0  X d0P R) ' oqW tR@*`Px 0|@7/P   0 @0j Rg`V q8 ,2@~ X00`!8 1@XUⰂOS0 d01SH 3h0h00S S`` ` `P16 h0 cPf0 h0[bP101Dp@PDwYpP 0 Dpp00 0aDp0Pr00 P 㸠D* ̸ ̬PL KJJI4GGGHFEE<CpBB??0>>>$=<<<4;;`;0:::x TP Br DR aP0l0P0@@ l06SGVE `v YXpj0P0x D0 P TP Br DR aP0l0@0P {p 0P0S_00 0RV 0`1 z 8 10 XP0 X0   7g \{ 08d@ⵁ8 $2 X@X0rZ0    PD P0Scs=00c.{8 d0⇁g0p} G0r 0R D0 P T Br DR  R,#*aPʇFd0 A P @ 00bPhP 1011S1 008 30 X0u)<0l0 l00<48 X@" cX@0cZ0   8 4 X0Q00`j0+S .0CSP@0P zX 080' s(0l00l0@0Px |zx 0 `0l0`h0x / Odꗝ8 5@X⿀Yz%08 dⲀ} P0@t CzH&H08X d✀g/ /M-   0 C R1#0e(6, Ѝ /M- 0S  R BC0S N  Ѝ /M 00S 0 0 0CSЍ/RЍ/0@-$MP@=aP$Ѝ0 HaP0/0$Ѝ000 $Ѝ00@-$MP@aP$Ѝ0 %aP0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-$# 3CM MS4p0@`d04401P$D 0 D2$0(0,P0000 (0  0p e P<QP0$d400I PJ00=  !8 S    ,0<pd4 0;0 P 00 00; PP4 P0. V L<104430FCލ ЍS! V 0S0Q+ Q% Q V    ` p00|000 ~VVV 9L9, 666\C-PT AM@M`p0 4$ R6 Q~!0@ ` } P-8ĝ0  0 0 4 30"AލЍRR PP 0@ .R` @@ }@ ~6Vꊛ 55 5 5O-!1AM 堑M0  0 40P_pPLpA@PF ~PPB @ t+0?P7 0S4 `  0S+ 00@ pR3P00@S 0S0S 00@ K@ @wh @n j@ ,0 0 4 30AލЍ $ 4h O-p#3CM M`P0@X0,40\ @U0S`  .S@0SVI:TW d1#T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @( 4 PPd!"" T00 0 00P00S !  @D DR0$0 0s<  U80 vP0 1 00S|z0000   Rl@00S}0000 { 0s0S0S TvT L O-p0\MP2@0`KT V 0&S:Š/OČUŒ0@0 p= 0 `& 0FS X0 F0 0SP0wpsTT0崠SUPP@`HVT@@TV \Ѝ|!07 0  P=|0 `F 0S0  s`Tw]T ^T0sVT0SP` 0  P0`CVT@@  B RX00 B 0}SP 2T/T0T (T뺠V ,$0@ Ps\Ѝ |D.-\C-@0 Mp`(P)@D T@;)T?XpS뵐0 ! S  @S`D0000?U0S  ЍXx: H$0 P, Ѝ$* `,X,@,G-@P p`㶒Ẃ- F0S@`=0WV!9 S@S, @`DV00W0S ?V0*v`DGS0?U0S X HA$0 P(=0 P`+ **0O- M䑐P 0S2 s @䃟p$` S S0  P$ < P, X PB t P,0U 0  SR 0  SRS Ѝ d1P2d1 ,z0P Hz P  P060 0P dz kP  eP090 | z000zu0:0 KP  EP090090x  5P010|  ,P020s B #0P0Yj @~?P1?# :e0 2[E  0P0YR @f?P1?# "e0 (3C P= @K P0103 M P010*+d+`)`(@-@HM[x"\\0 | % 00xZxHЍ'H@-MAT  [0000 00[Ѝ@@ 00@- AtM0T0l00  [P 00#0E [@ 80 0 l0 30tЍ0@@M A-@POZ1 !01n0SuOPpp ?Zp0PSp@-@QU x3s|p r01P r01000pZc[VxZP //$P /W/$G-P@`>V$0QV@0\\"  p偣 ppQV@tp O-aM M;+@040; P0060]Q0|U =0H `pp01$,_ d!0q"d!. 0`151110(qPP 0ʏ ʟ8  ~Wό", d1 0d1th YPH `P c`0H SDP_x p\ S S00 PPp0S SR#3:0 0CQS0 0CQS0000 09syP reGo 0a]e-oTFa.F 0 t",0o#G(p i$Pp/F$ v"e#G0 / X  +0O:P 2#S;S 0 S# 0 S 0 S@ 0 S 0$ S0 n?R00sS2 S ST( 0 n/ n9R2 S S 0S00 S S SS@@ `0 c_A_0(0P@00 0S? r5R2, S S800R00S 0@0 S S00 4P eP R R p}_g?5     `X-0G PfTP RbP ,0zTP ,0R@qe,@N,0 @S(p 0d10d1 QQX|ᔧ1|Yp 0ό`0S W`0`HPDSHp .Sp0SWP`.pGlWV0 8UPP /P0%004 0 6 30(aލ Ѝ t3i@D0D 0@-@P @7$0$0HNu 9(0( 0@-@PA00 ,00/ 9@-@P @600H'u 9\X@-@P00p@-@PP  P 0  p|L0X $p@-@PMP. 0 ` 00H0tPP P >P 0  Ѝp٣Ѝp 0  Ѝp L0h $ 8|@-`P|A M@J p!p1pQ P0p0 SpG0SD `Up< Ѝ$A@D@cqP 0]qP 0S@ @R NqP0`L *n Ѝ0L `n Ѝ`00 1H0`L  n @dpD0A-0PU" 7U"P7UP!q|@@``FkP $kP 0!E`$1(`P 02~PO-0FMĦ@  ,0R004 v0唖pf$ `}P (S8 d&Q  GTL d(!< 8&0C S00 6 0< ( Ad  PH8@L@P( 4<0P(0P{ P40AP@S"0S t% 40Sn@7S T% 4 0S@ 00S S(504 RU 4 40SP4040"S , 4 00  ( ^A.*02P10SL TA0p1 S\ X40( L40 0Sp 040$0@ T(816P(P\ 30(P PЍ 0p1Q 0 Q*# 0T!6# 8(P04Q(A0%1pRt4!8# <)0ȓ\ \300X 0T:p @( 20<1P6(P`4)20( 2 0< ( t2 0< ( `2 0< ( L2 0< ( 82 00 ( $2 0  8 ( 0 0(0( 1 0 ( б (0( 10( 0Q0001匱0 00 0t1000/Tp ( 4PЍ=p  K7p  q p1STknP , 0 R0C. L `l, d\@ tX |l @ \<  xt\D,`H@d@L1O-0$M pW H*(1$Q0AP01o@0^O, 0 ^/@5> 00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X $00 $ЍLD4000 ,0(@-  qn zp@-@@`V 0 CQpPaViP  `FP    piP 0`0p A48@-@00 R \\  $0!0D0 0@  ( $ T|(@-@PL  0S  T0S@Ri@RP/0d 00 0Q,0/01P/0(00$ 0/`p@-@P`H P (0S  1T  0"00`pp@-`0Pg@P  PgP 00p  * Ԡ A- @0S  P p00   ($ 8PP(p`P0 ~~+O- 4M,0Su 0 j*`_ p  5. *`* ^ ^  @ 0 ~ς Y  ` @[ @:T8 Y :RVZ 9 0  Ii@9`P00<0 00 A4 S  !p$R> p`SE0 0,0Q0,90( RB 900 RA ) 0S  Q (0 (0$iHj@(pP 080 004 R Btȟ  B QPD8 pP0 0L,( ( ( X 0 8P`0 p 0 0Ji4Ѝ70PP SP 7@p0 00  t' 00D@0DS:P7B0P@7000GP p@0040 @ 0 0DQ0C$010,6P0$$ @(,TJ* QA([ A([ P` pP@O@ A(@T0@ @  T 0Q,P @P&E ``@P, p  fP ` BR \pA@OcPp `,  P01#S0  E0@P@( 孝 py Pg 1(0@ 0SA1 @P1$  @T(00^00<40$@ ^P` p5 $0P0000/3000C?00ꬰ( 0 yf 0( 0P~ K ,P$gxC @(P0$0 1Q@30@P$ 1Q( @o!PL$00PQ0\@[ 20P$1Q,( a0B@0 (nP W R'SP( 01 (0 mPP$ P( 1QYP( $Q$JR{ wK rP` p$ @@p1p!0< ^ς~0S0 0@0P /000P ! 5.1:[0 [00  0 PZW6~l v  ~  |}  } |`|L|8| {{ %P{T{|z \z8zyyy8xwwvvDu|uLtPss@-@P00 R ^  !$0000 0@  ( $ rr$p@-l@@`VpPPp80U1pPEP1Sp  (0$ 0pqQA-pAP@T`QV00d@P 0 pPP``p`0 @ ZA-p`@dPP T  8000P   ]{_ v@-@@0/ 00(/p$000/p004/o00/o00/ 00(/o000/o008/o008/oA-``PU 0AP ppP0AP-e<0< 0 ,(0olo NNN/D - M8080a.0c f Ѝn d0@-@P 0`00@050 @-@Q 00 2  0 G-PXsM@p 02p T 0S0-00 00 0 0$00PP 0` 2# "Z &= " 27 D0 00 00pq{ X X 4001@ *Li < 2R"$00!@Y 2: 2( wMP)0] 2< 21 0010010 010 0100100x100uP 0 R00   0T 0 2 13/p ЍTi0-00lPP ` 02 2z00@Z@P0SX 2: 2d Pz 2 @0 28001,00 e48,C-`@ MpPQ 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH `P (0 $ (p 2 P7 ЍP ЍH00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR @-`@ MpPQ 00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00PO-1PMS0:00 X'*q`I`[ cp@ p W  ` 0 PtZ 2< 2ЍЍ\bPЍO-MrX>*`00Q̱P@)p@ W0 [KPE 3bP$ 0̡1PE PU0 Y 2< 2Ѝ1PE P0 0V Pt YЍЍC-1` MS.:rBW R* U"R  R00U00SR 0  PpXB Ѝ 2< 2 ЍaP ЍG-pMZ Rb* U 0S @ R0  D P X‡Ѝ@ 2< 2ЍЍG-`pᴑ 0F PP IPuP ?0@ @S1Z01a>:z0S0Cs0  0S001R@10CS㣐0*y0/ 0 @00CSÐy0S Cr   0Vq00R!2 B!0C2pP00 (m800 (f bP0h t^p@- @VP ` PP Rp MPp@-`P@Q A00T T 300p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-`P4M@Q 00 Vv 2+ RJ 13/p* 0 00" "0$ 0 004 p`0 9/P 9/P H0  ^ 4Ѝp$ 0 u rq0 aP 2: 24Ѝp`?(0 0,009/P I/q0@}>I/g$uI/D0_ ݰݐ 0A-%> S0!`$P@  @00CQA$0@D3@N0qW T00@2!$!ApPWQ?U/*ܼO-? ptM@PWp0 x0P(0^ 0 p P0 V (wp0 000 00`0S5H@0@ p0 P H  yyF0 0I0 0Აᴀ @ Rڴ R  H@D R0I Pq  0pH 0CwpL08봀(00@` @r PX 0,00 $408hNRI0F PK0Fbh*F,FJK9hOF&"#`;h+>H (`h=M;hOF#`O "Fkh;k`+(FAF *o(43 .0ѺyO 4+a4 .%  #HJFd0[QիZ !h$H#`#`d0[?EE{(FO 4 JHDd0^ 4#$ 0 &0F,!T '0 " x  . .,4+^ 0I ~02Fk4+. M q0- l0 s20^ ^0?{.F@? +hY)`xO竉#`)8F(-O$FhFF(FI F%FU/D#J1FK8F C[R(4G((;в9f" 7h(_H8 (S OOO+OOOOO %x(e(X( d(#jKhO hI hB:V" -ђEђx ; `^Kh/,йи XI 2O %FO 5%ENOMO% |V#  PF>FGIRF % F0AI"F&)F"XF8F(^IEHmhpCOc")Fl\9IZ `^FhpCOTpCO*j)I1H! pCO1 س_𶀳_(F!O🀳 Ol+Ё(F_#j*?+ J)jH bhjPC'Ѻ)jH^")FOCF ")~ Fhkތ޲t%ѢkBHSco@"?KOq<9;HLq$(!TpCO#` ѣi{k-J;c+R# ,K@? !u(*?}m"Hh v)j!Hch+?S,gch+?J^@@Fj Cch+?2C?U&IF0߭U& I "  6H -GF- FhrI T|J!F(F0ЩI KMh@8LP90NH3h+0_ԝI"PF(  F`k#cKdccH"mK@+iUj^00F! #m@aOrdO@#Fj(c"m@`l@!OOrF[h`kG#kC#c(cbkqInH a<#PC`aв#Cв#mCO !cl lZC"l1ik DG]M#m@\IL@'60BA88F8DF(j8D a(ы)FOHOI VMI RLHOSU`#`n@M3hZ2`+51DJB@#m BA`i!v ###C k-@l(FiG0@h+ ,I9'm #BBBAҺ  !:0 [jGFPF,ф4AF ! !ɰ0!07!ɐAO)B{ XHF00"j6#GCKH#m6 24 B2##3B##mZ-2# #2c62ÊEE4A 2!mDFJF4N 2#3B# "3A:"F0 D01G!JBѲJB讲eU?j! i` #!iDf#Caae?lkhG0I* (0\-OFt]hF&jI T/ XgLhOhJAFHF\E !kh#j)CaI^G8-(+.?GMS #&047h*OckDkE@؀e#k+`#kcccl*AF t]O F "lU,ԢlU,ե h"m@C bF@Fb   ENEі@B*TAF(Fja `Z"(*@BF~ @AS\8`~I.  @J#ccV(?kIF5h( (F3Fcm+1hqH0pCO(FF5hak(F;h 1(4l:h  (F2:28cm+ZH)FnlaX cm+TJ1h ^ XFPcm+LKZF1h*NccqЖ8+m0EF_аh#3C2#3C2#3C2 #3 C 2 # [B ##[B##[B##[B#F`8hAF Z  ckKEةNknꆙF@Esh^(,hDD#nm(p(O иLDM(hDF *h AI@F0FSZРF:I@F>8I8F 5IF@F2O F 0)F (h F p( `!F#HV#pBO#/# 0)F F p0VO,)F F F(1h0h)F T0 '0-OFMhFXI SWM&WJAF F.CTK , OI(a i , qhX*6i( f(h(зv(#k`a"###cE  =YFV% F(pCO V%@BPFoF  )I YJh  + " ( + " ( + " ( + " (AO;h@H! (x`=J;h+ѻh*08H.Fȱx6K*F0F"Fk\/* RFb@-I B*NF*F1F&H3b/#0H#I ;h;+ (?e#cbaKhI ;h3#;`C"} xP"~1 !! /pFh FI S&L(P(&J)F FCKhBF!F8F D~(иN H Kd@I!! !-OFh FI SL&'J)F@FC їKhE4ܓKi 'f( W(&P(R(Od(tv(i( r(Ox('bga#ac`#g`a`agb|I O FF0U$0pL+LXF"`.]OW[-?iF(F Pcj(U+7NpCO@Tbi*@P_H)F()XF8XDEx/+%/!XF< 0.+ћ0#.+ћ0  LHEK"aKFZhC+*F  FibhCF!cj A#j A@8F"~FO8FFxFh+À1I^F!/I 0P0; +j1iiiYiiihj (-jS)FF#H##a@SI"FF i3kj+?++.JSIFFi+Ѫm(")F8F(#"#!"~" "i")"`"I"Y#;Ci ic)jdH:iӱP0i+#+hi 2i"hC?d(j]m0(U h+Li!(Ei+h+?=h?+?7h+8Fp ii3:H)F##anh+?hh?+?bh+ѝ+? S)FF*HipC`O"(F hF8i{ H)Fi+?y.v(FK0+c?Kh+_ ;Kh7K(`5K0S6Kh;=Kh;K``+ ?,K60+6H1H-4K#L ` B#1O LSKF0+$H#~U#x+ x+#nM$U 4!,єI ="0@ t"",""@""4  0" 0"0n0-CFh`rI RjqNrK$`3h BX#mIHFFHF"BiJAF(FB2hj(,aI a+R# 9 [ = W$TO!8h (:h PI$$NI h(KHKI ^(HHHI T(EH,У+h3=M#3hq+F(@6I#ع8*hh#x320[ F6FF!F8#3I" Fj aH!FKI (H l[ [[['0[@ tB[@th[@t[ \[[tg\hN b <-OFhF@I RJM$FF&FFDx(`oSBSAk`K9FJ@F*CєK иѤ+6TлMЊI R(%G((0vH8 (S   m m m  m m m  m O &h(d(f(#v(#nKh#O &O O #&FO33,FkhW)+=:!PFK^W)@#x;#+'UI F*MK`"1F@F\F(@NI .!PF(HIPF0FCI F0PF& F 0.?e0FFI2FHOrK  %")FFnHt({n ""ndmk:n"((sJh(KZ`#N$MV{H9FiF +n;+f+ I 4, mZe "p18"|  #-OFFFFF' AFJ F"AѓJ ,9l-ѥrQBQAIH" 2?F.чJ  Rt(c(S(P(,dE B n( t(#Fa(xJF&-d-!d-A R-S--Q-mI*F p-wr-Bl-",;X*HF2F # X*"~^IHF 0[I X*"lWIHF 0UIX*" ^RI HF 0OIF("! FX* "H"YF@,<QkFAI"F`&WE&6BE:I HF t08IF5JF(F@X* 2IXF1IZF(FrIF/J(FF(FN*JIF \(I  J$I"F"I V,@𓀊F&X*HTH!FP FQ A '0ڀD~DŀD{(D|&D}7ERe|(I 2F(F%KB.=s@3B0QF(FFQEW(O 0J IMFZFF*1F(FV"PFFF(FIRFH RFFOaray x-OF-FL#M222 23322O3 3 J9F0FJC!ѨK"h 2vc2CCCC2M+:*@Hz(R(3(`/(WuS8'(S %']IQ18( "$A8((S u#kaQ###\ 4 "#IF20x ( II CKXa/#d2+# 2'#2##2#2#2;M$jh4U9H, c#2232#2.K/!@FF# ;0;<@Fl02< ?߮/!HFF#;0;I F0;I @O =@HFy(m(P(f(n +R#,,,,!,,,,,,,, #`#!3`1#"2p hT w"9F HT2T F FPF EF" '0KJ-OF F ` :8# # L&7F #$f00`J)F@FC;F00#H&7FKh 0ch#0! |(КI v#hI pI lO EKh+ PF z(O(B(eF(P8*(S 0 .O.O.O.O0!.O.O0Q.O.O.O.O.O.O.O.O/ /?/a/.O/.O.O.O.O.O.O//.O00.O.O.O.O.O.O0-030E#0PXIXF A0DTIXF(@CQI# b 0 #[FKH*#II0XF#0DIXF#0AI #ZFc 7(!H"!X(F < 8 # #! D O0,h=%K0h]`G kk)k.ik@jkkQkh D]i#D-OOKLFFFFFO5 J9FXFCѡKh  .ʀM+h ,h&4khBZ?+ 5u(f(F(+R(g8(S ??7?7?7?7???7?7?7?7@M?7?7?& h "hwI r  hx#+ hM\ h "2 xF+"hkI 0 "& xF+yhw hxF(q"haI P hx#+ h R(?a h " x+?V"hTI 0 " x+G#D#!Fv!FIHTOGHTHDH 6 4=+?Q0FW"pF CtQx9xc*p*b* 2IDT F?.#DD*I DT# NEE..O@,F!F@F0F +!F8F(h+ I:FK '0l #LllllmmmmLm,#F `hL C& x3 QIhrh+63.0IKh GK#B 22 32pA_FZ  8Ix h310[5I 0F GFF*?b.IF]2FKF!F8Fdi+?o8F 8;2BJE#pO*?7B!F8F(M 3?(*F8F0!H9FV8F \#!F8F&2FKF!F8Fm#L momm-O$M $ FFFD@J1FXFTGEѐKh#0B0@)0+;"0 --@V' qOaX<F(🀸@ā{IV'(@AF(FBBF@ph+qI*FA(?a8((; -04#`DbKh x+PFD[I "XO8hFzDwkh3k`sDp#l#7iNI8FhXLI8Fb0KI8F^(@𛁰hAF(@EIh(@7hBI8FHXphK rh=I gOaq:FXF 7Iq #3h0#F (EW !0FF'I 0hAF8D0T0h8De5B%@@Ig QV'F` XV'(`PV' I#Xry rs'0rToUo rrrrqoro_(`(i0FHh|I8F#`BF.h6OaqJFXF(?d#3:F00F#FF`V'nFV'FPdF(XFF(]I@Fjh[I@Fd@ZI@F`V' WIQIHFTx (V'R(?eiv XFC()F PObZ P/!hF0F00DB(r# P3p!CF.6J0F6I0F0А#3)F3HF0#FRho V<9 %I0F:Fh00F(F(D[y4Os4NV#CV@F60OF0O6%4KV2*s@+O @YF@FbCFтIBF`VL0IBFX4+4FC4[VK[z1 3#bQ iK4< JeK)p CdI氨BFOaWF(`IBF :FOa `Y61FOc(HFYTJTIV0VhpCONI$B!HI !BFDI"CH . 4 JF(F .K$Rh$|0H1F0',J1I".H iIF( IOr4 IF(  J "I C04$;#X4 3BH2h*$I' *C*#C%JIq#x#%8nN#Ug (ywIHFp#T4[qIHF0pKpJ tT4+kIHF(iK"_*"bKS#Bp  ]I۱a`[#JC" F1 Dt0@ځ[# OI#BF +CbA li FIF"0GHAFjOYIFOpN&F(AIJF JF!T8JR#JC"D$*5HJF[FAFOuyMw-M0$$4Tʱ+@)t%ERFy FZF0C!IiyF+F+O0$ܙ+Ob0$@ǀ0ò$_BHOR <2;#cg##xhHP Or 򇀰r 򄀰_rOR0$B+0} 4S$O0J( 44#0444 0+@4+ wJ#E#@4,4K$4 *Կ,4"F1F@F wNЦBI Fkh+?  ,aXhF`=,@[J#Fd! la ,`(cTI ,bX OrObOb}!OS$4304$4{HHObBT4+*p0FfЯ@HM x:Jd!F F  5H,\480Hg*KS @"3FTH0(RJWI"SH jQF( JOr4QF( 0CJ HI C;`4+h4 BIIZK=Il ;K0J .N?*#I`0*0 $Bp .IXh}0 $0(F0@# !I#2FH+ai_t(F9Fh01FHOQ FM_F`IRFph*|i# # -4# 0$p 4y4+OHJF;F1FOs/y3XFM t $/W*7F $$J4+NPFAF*F0FkB(F WERFYFy(F:F2B(I ?iyIFOEzOc 4 ttIFOPEzOS*ЩF;F ZOFIFEztIFOPxEz +qc-O|MFFh"! FJAF(FC ѮKh=-@@85(S _^5_5_=^5^5_M^5^5_Y^5^5_y^5_-_^5^5^5_`^5^5^5^5^5^5^5^5^5^5^5^5___^5__^5_` ^5`!^5`7`S`g^5^5``^5apKqIh!s#$0ojKh`khKjIhcdKh v]aHO2cK!h`0C@a`0MYKh#bIWKhbEUHOrXK!h|;PHO2TK!hr c1KHO2PK!hh`c'FH"LK!h_8AHOrHK!hT`FJIFPFCHh @  +H +z(uIC84(jP;&5:T[H_cShCC`"fx ( XI hCc8;C8;whCNKh>oHJK x#  DI8 RR; ?IP"x ( 7I< 7hCshCSh0I .C@`-Kh@; hZChC{hCw8;C"xF ( IrOsBIhCUhCQ?zG{A@bMR`$"G $1Jgƅ'0ƣƿhCC$ "xF( yI#"zxC+ qIKoIhoJCcoH`# hiIhkJC jH`# heK x+ ?m _IOe DXI-<;+:UI$GP6QKFY` +F[ @08`( {:(; EIhHCBH2k<+D 02FH4DDE0KBFU6?+223LB@ph_p'_rAـK)!rH`aQUR !" "(I0K0k K& "!(Ih@# "!K(5I P$ȁȍȬ$$P Ë$ȹ$$t H3 "N(Iܻd &khIFHAKOq4(򵀻KAOq&&I Kk"k2F(1 k#kKf4aM'#f"%f)F <;B󊀤I K0@LVz @:!:۔I @TꈰH zF0F/' Bh  /K 鸹 / $Ha"K 0BEoꈰH zF0FJ!hBDzHD 'hchB'9H7 H '$(L'$ $tʁʷʺ;+Va  #2F9F(F4(?ix)7  "$&(*,.024H HHH鈯H1F(F#0'ZHHHHHHHHHHHH#2F9F(F(?ЭH#2F9F(F(?ŭix) H\(FHHHHHN#2F9F(F(?ꈩH>#2F9F(F(?H2#2F9F(F(?􆭉H#2F9F(F(?{ix)ЂHwHjHh#2F9F(F(?h)y}Hg#2F9F(Fz(?\yH#2F9F(Fo(?QtH#2F9F(Fd(?FpH#2F9F(FY(?;kH#2F9F(FN(?0gH#2F9F(FC(?%bH#2F9F(F8(?)x]Hh1F(F0+++w'ꈰH zF0FrIH7+њ  ./ :* D =HrD )ܩ o O   3 FF 4ʿ6[oˇˠ˺!;Mr̟̀̑-E͒^tͮ':rL  BF F/>+E(IJF@F@%H :U!HJFAF 'HD yܪo SC  PH /F HAF?O0$LTbgm-OFFFIxF-+4 F(:ѩK$"`O FFJ1F(FC7ѤKhBu'>3FS}[(FKFV)X/DDd&(Y KIF 0$I F(щK"@Z`d+ '*!$DtDOyKh BDdDD4D$D$O O XF:G(FlI(F%)F F0fI .їF(JphXKhb "!THKs[I2F KYN[h "!+RHKdUI2FQHK^-;RI+F2F K~PJKMJ##K!F! ! ! ! ! ! \07I7I2F!O0P0th+1H,Ll!0hFV?D;+Ѥ NF@NhJhi t+#kbI t(F nI j(F dH (c~H~|K>$3`+~r+YR+i+H rt+x+ O V)Ob6FQFЋS#+d0BF;F  Ef ki+ W!j)ILr:HIHHHHB jAICHCH#"iwk#$3+=Dch_Ox*:B2F(F"k)$)Dchx*:B2F(FHIk($)D{hx*:B2F(F9Ik($)׀DkPK$33{h T@F{l+@AF8l*FCF@h7+hF!HO5h3+@#h+xg+BУl+?IJ. FhFO0+ KYFp-@Kh+ %[`%\(%[%[XhXKFe $ JdJaJ^J[JXJUJR( FO3Fr#p F @p%=I8FZ2a  h0%1-?s F,FHmk(F#1FC(3CkC v"1F(FOP%\( -GFh FNpL')FJ0FA ѵKhBv JYIF D(DРb++R#בKh 6#$6#(6#,6#064v#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rHr4&r<&ZnJ06C+F`U#PeI(FJ(ZcK #D#xh_Ipx(-\MOjO W(@A #+p#kpUHHQMP&khCH`FMHHH(8h1!oF(f.@4CF@&=HJ& *+x++ .F0F35HF(F !8B~]g*Jhkxh320Z<#XCKX`P&BD#m 620 Ѹ:(3x '0 1 %h ty% tC.9-GFh#FLMJ9F0F&C,цKL1 1Ch$C!+@߀@# C@O,p%%aTIF(rI Jx(`(A(;M(Uda+R#h3`434434yHKIJZ`u+h#`131m@33@3g131a131[131U131OД *F)F#s(F h@+I0F "h (I#&JF(FF8(Fh8 3x+AF0FIM.?K.W AF>>"h"$+?K J`.%h$'0  1%h( -CFFIFFPLJ9F0FCbeiݱK R.@3B-@M#j+@Ia((t(<єKi JhaJ9F0FBяKMh6.,iTI Fb(I F\( ]O 玱+i{ BF|I}H6|IBFzH2t(o@(A83(S OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO!'OO-1=AGM]Okwz(Fci+BOsci+;#caci+4#ci+.#ci+(#ci+"#ci+ ##c`#a#a#ci+ @####`#`##bKh`ci+Osci+##i+ KIh a^(#cbi%l '0pet x:chh+&i--iI0F*XgI0F$0fI0F ( -c.--Ѯ=-?ͮS%c-W)P h)F(MI*F B@-Ѐ-i#"jih*(cAF=Hti##"jih(zshW)MW)cj+?S eW)`" @0&HP??!HJDOBFH. F><JHٲ2 C #B"F-`j(? iI Ff(I Fb(AF HeA-GMQLF F'PJ)F0FCNKhB$=O U/HF MR(f(O#4' *OaSr @E ? IC12FF ML +0 24LMNpF`PqI((@zK"T(XRuM1F(@ӀqK"XT(oHmK xjKkJ,hLh8C<x%gHhX`L0(1d ^KAVJZK8(BHOM&`h$"dh IK  #FFHJCF@>L#F"AJ0!\h00 0#</[(8F#C   (E (@hIe&IF:F!Rq FIdKT=O1 FIZ K"h(4Uq FIO0K"T(X('Y0!FD!aq F(+K"h(%$L@y%DBjD EC Ej4D+R#'IM?oyÚK"(HK"X(T(K",K"!FhK` #hx+?KIh K,B,,2,K",|K"H(zKLzKhF FtK"L(sLObuH!h"ow? $hI#pI"FFhK"P(igKeLhjIp(]gK8X_Kh\K<(RZK"T("X(JXK "!Fh.RK( #hx+?:OKVIhKK"t(0KK "!FhEK( #hx+? BKJIhn@KhGL "  TA(F:KO h!?IXFdxx31KW@h  E"PF0-H` 5H K",K"L(Kh#FK"`(d(K"L h{K( "hI Kh?)H) tMHKHhI*F%D\'0 9D%)DD xDD@yDD', EEE*L#H<<(x l(@^GF(@𹀵K(*@߀)@HgK L8 "$QF.Q "(F`*FF:!hȱh(h6H!5I ~4I z/H!F(,I l+I h@!h0FF F5FKF ObF F FLRh " Px%#n(b( 9(*0(35J5H4I*F$c +R#GGGGGGGGV(JH J08`J!F0FCKhBKhh Kh K"` K"Z`jF!  h T?+dG&[dNdSdY xdr ?Hd FV;ELH`#`#`}Ir##a zO|`aV >  ^hmIR#;`kJ;hP+Fu>- 3hx-*+*[xK0p lV{=[I8F((8FWHNaxCTHGadRKaRH>a[OKa!j!!NHvF-ci l( ]V =_ F?Kh;?Kh#iC=H=M  +h+8K9Ih6(5H! 3(h(?? *Kh#c*Kh+!(He R 9  eF(N3h+(5`Kh+c&[dd&$ddddddde&\l&e& feCeE&&Hei&&-GFuLFh'ZsI Hcg`qJ1F(FC*oKbih:CV# 5(h(=U(@bK!h`H@(^I u(`(G(DI(FE(;rWIFFWH a+R#===%=-==?=Y=====_hC`h#s8K/Jh+Fc`#`t##aqĠO 0RF)I@FXAFHFHV$K 'hAOhCsKJh+Fc`##H"F(?:H5#a2# H"F(?*H(@%Bid& & M x'0,-OFF I(ڡI K,FĕL&K 0*9 2(F"F1F.g"I,",& J! I:FH+H"!H"!~H"!y+`0+ ii*ݭ0\0 I0 K@th&& xtg\'x-O$FF&FUJ9F(FC-SKME..K0FF(8,D FFM  %GI F(6W) j0=W) @I g( u(G( U`3x+@#x0x0FR00I2F FFx+-)I f5K %H$0M(F0 I x4@F0I6PFl0I`> 0F HL3Fm(F%F)F(FLJ*F ܿ܆ܘw'0-O#mO%lLFOp;`FjK`jK`jK`jK`GiKOr)FhM`o rD&hֹeJ#eM$eH5dJ5dJ5#C>(r`I`H FJh0BhF(F! 4ah`m(T D(@f(BC(EPIRH p(Hr(NJIF@FvC(?*YJH HX pCO'+&s9BH~F(;O F8{+ѸO8K"`w4K5I`##`̠.LO FO (FH&I"O #L h_F h_#Fa|(:IHy'V'#X'$'h'#`'''%'#hV''8 xVVX=XHX^''#lV'Xq'X'0'ff(f$rHZqI 0oI ,nI ( h[~d@jH@ # GF@ GF-( 4##`(`V0F T ; TfWH # T / .I T .JO@FGsE~(FGn FGk F@F GDH"!F #;`@K`" ?K`f:Kh)[ 2p1*X5K" `13H  T !0FGF( #XH#A#3B #2FAF #O3V?F XF!F=XF.F|FF{U)GT)G  s &M'HXX'#d''&pX]-OFͰhLFn&O3FF `AFJ8FAFќKhB!ݹN"HFFHڕIJF p-a-b=-   " 4z--7]IoC"H## h"(3K~IO3oB~H## h"  uKh`6OF[ ( 6 8F1FXHpC_(##&jJ#aX)FaeI0 ZRF(F:00P##bGF(vZI.л5ѹ2VIJFPF:TIFRI F 2FOqF( " YF2 "IF,0F0(BIG 0 HF(=I0;I 9F !1F8F+J3FF(?g'I PF($I"IC)Fl!FX#\IX# '9 D'0". @thGRTs>I O06wIF8FL,O  BF(zh+ 6[-IBFph+ 6P)I #DBr#RFFU Fz"h+FOqB ##`{нB EF6h+B 6! LHFGPFXFpFF )-O(-OFF/}  0LhI FJHH /}I F<0I$H O$r!% FN K!(FQ01K!h1O31y3l3,130(F8!F0 8! 0s OE8w#FFKa 811F@FKTJZFCYH32(F80B<1C3<1:@:0 FQ\!`1=?#FF F<F(@81@02BlK+! FoB3x<1C3<10CE@؁'`MV('M( 6(?(x4(O YK'N8(S goooo5;Af('j8(?g(?dS _oo]oo oooooo7Kh01=@G3Kh$@2(L%E+-K''81%Cc81%e###81?H%O K'K'FCF! F<(-81?9H#X -Lj '0{ )@𐀟Hj02B)F F<%# FFV!<F(FCF! FPFM CF+4H99FF (,h+ H9)<p @nMl G  ( N21C813 C 0rIFV#7'0ёH9"K8g0фI5`9\!*<1Y\Cs<1`1 F9x(>vIE V`!R#9H0@`!wHR#903\!xB0h */81lIL  98F7<1fHXj*`!dHR#  #j)[hx1Mx8F2F91F8F9E<1Y8F7Sx1h.ANZԞG2 RP՞pLQCBI  98F7/)F8Fp x8_S0嫚 @G0ચJ000 P00 0 0 P x8`@##[* P0P l8 40GU P0P l840G= 8| 8<30ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/lT@-M   Ѝ-dh  \/X-M 0I p 0 S 0*0 Ѝ/|/H/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/~*/{*/x*/cu*/2r*/o*/l*/9i*/f*/c*/8`*/]*/Z*/W*/T*/ Q*/N*/K*/0H*/QE*/B*/)?*/{<*/|9*/#6*/)3*/=0*/-*/**/"'*/$*/!*/*/*/////^*/*/ */< */*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@}@*/*/xGxGxGuxGxGWuxGLxGJoxGYxG2xGxG FxGxGxGxG8xGV xGLxGtxG/xG}xG笂xG~xGC7xGPxG}xG ..., where is one of: !u$'Y*-06q9=AEUHNQUZ _ e k u {ڂڈ( ڍ,ژ-iڡ19ڥ5ڮ<ڳ>ڹC!ڿH H!H5HIHOHcH{HH"Vq/];b@uGuLxTx]~yclu|ۄۋ5ۏۓۖۛۡۨ5ۭ5۲۶ۻA| %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcdstdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreferenceHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s   @@  @@  I   Y@@ )  Y@@ %s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdinDΤ΀8,t h,ʹfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of input%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\invalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memoryusage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.%s: %s%u-%lld%llu%d%s: directory causes a cycle %s: %s: fts_readusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS/%s%s/%s ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdoutusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %s-n-ewrite error%s: : %s& & &&&&&' &&' ''#'7'KE'\Z'p'''#' '_'^'F'<'>'?'( error %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found HOME :]./%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier%lldnull or %s %.*s: parameter %snot set%d%zunot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes%ld [%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d %ld[%d] %ld /dev/nullCan't open %slpZ%smore than one -p unsupportednp:invalid name: -p '%s'%s readonly%dYou have stopped jobs. ${LINENO${#LINENO${#${"(()(...)$(...)">>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error 3=3Bt3J3Of3V3[d3b3[s3h3Oc3q3[m3x3[l33r 33p33n33[v 33b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpected:b:n:v:z:~::::::::::::::::::::::;; %s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \:%:(:-:2:7:::@:F:J:M:R:T:V:[:`Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Pipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)>+>2@>8>=>F>L>R>X>^>e>o@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error >>>>>>">%>(>(%d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATION"L0A"1A"1A"8A"80A?M"$0B "0B'"0B."0B7]PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad numberCtCC CC CCCCCCC CCC CC C CCCCCCCCC C!CCCCCC!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unsetJD8JJ8JS9JU'eJZ!cJ_JdJkJt:1J{5JJ:}JJ:yJcommandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexpK! K  K&zK)K,K2K7=K;=K?:uKEYKM KP)KRAKZD]K_m1Kbm=Kj{KpKuKz?KKKKKKK:yKGUKKK +KKli#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260402074430Z SMALL REJECT_NULSNETBSD_SHELLLINENOincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failedQ^Qf QlQpQtQyQQQQQ QQ QQ Q QQQNQRQXoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOPSSSSSaSTT TT}T#3T'=T*3T.T5]T<}TB TFTKaTPTUT[3illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedttyXXXXX#X3Y#Y 3Y2Y3Y3Y$#Y+Y2Y8Y? YF@YL@YPYWY_YfXvX~XXXXXX X@XXXXXXXX WC$WCWC$WCWWWWWWWWXX XXX"@X*@X2 X: XCXHXOXV@X]Xd XkWpWwWWWWWWW W@litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZowner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferenceDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %sppp@o@p@p@p@p@q@q@q @q@q@p @q@q%@q.@q6@ppq=qBqHqOqWq]pqcqjqpqwqqqqq q@q@qqqāqʁqՁq܁qpqqqqrr rrrr#r*r2r9r@oorH%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:orn5nFnVnnnnnnnoo8oKoVovoy%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=hsGsKsPsXs]sbshsnsts{rssrsrs rssss%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:rOrVr[rerorxrrrrhrrrrrrrrrrrrrrrrss s ss's3sCt%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFOooooooooooooooopp pppp&p0p6p?pFpOpXpapjpup~pppppppppp/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd%s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:|T}}} }}}}"}(}.}5|}<}@|}F|||}I}O}R}XDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>||| ||!|*|1|@|G|M|T|\|a|i|n|s|w|||||||||||||||||Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd# %s: #M1type: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u  #'17;CGMQ\kw%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. %s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootablej+Abu  < g  Rw !#$&12'345C68N9T9[:t;<=@AB#CODvEFGHJLMNOP QR3SMTVU^VvW\acdef0gChCiCpJqstu`vwfxz!3Tt5G^z4T\isz*AFYfx6C[p4Hh38K`z!4GSv%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablerorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype8=CGNUZdnw~ .:Jvfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUsage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entryffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblockhhhh        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:7u @index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:y No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]| AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]]~ @@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),y " , [ dUnrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to function u Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:  @label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored J Q U c v    bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrgpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: 068  '8(|()8+./06x0 Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*#+08=BFOZ_dhlv|Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %s @Afp:sNo MBR in disk to convert?Ry   D ` /Th} !#$&12345 68+9198:Q;k<=@ABC,DSEiF~G~H~JLMNOPQRS*T3U;VSWm\wacdef g h i p'qstu=vwCxWs1Qm  $ ; W o        !!1!9l!F!M!p!!!!!!!!""","9"K"e"u""""""# ##.#C#`#x####$$$;$V$q$$%% %%3%M%m%%%%&&&&&I&yMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s(h @Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremoved( @ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type])5 @a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]+m @s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q]+m  a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)en_GB.UTF-8 (active)UnusedExtended MBR%d - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s Could not find index %dDetails for index %d: StartSizeunknownType: %s (%s) Attributes: None()start %*ssize index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]/5 gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed /E  @ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l0A  a:b:i:lunset-a attribute -i index-a attribute -b startsec-lHFS0eC33UFS0eC33!haHdInotNeedEFI44 *s(ҺK>;44Qn|n֏- q+4%41Qn|n֏- q+4@4JQn|n֏- q+4W4`Qn|n֏- q+4q4|Qn|n֏- q+44=Gry=iG}44M;t?44WmCĄ 3KOO44yD¢<#*=(44޼YBbRuoqr44РD3h&55 \M}-5!52ޔM@jy֬5C5T-ıܹчH5e5i-ܹчH5~5IZܹчH55I􍂱ܹчH55I􍪱ܹчH55I2ܹчH55LǠ6 %?a55'S@ۿ )Ѹ66 1*@ە )Ѹ6&6+1ۏx )Ѹ676B.TSqHBo6֯i6R6]%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL6M $@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-8ȓ ,o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin;c 0@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeee>>>ifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s HHH linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroyJiz Jiyaliasdeletetrailers-linkstrdescription-descr-descriptionJJJ @ JJJ B# BD @ H`A (? XJ @  J) @ J J J broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6N2N=NHNTN` NlNxN@NNNN N0N@NNNarpdebugunnumberedlink0link1link2RRR RR R@HHgetifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %dY@GYKY@YVY]YdW|Yk, YKYd Y@Yd`YpYx@YpYxYKYdYVY]media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaoptWWUU hWWUU hUWUW UwWUwW 0WWUeU LU`WU` no carrierno networkbackupmasteractivedownno ringinserted0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %dQ+aktunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnel[y [ bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif\ x]\ \]>]y]FVLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA tPtX otdtwtttttt t@uuu u7@uX%s%s%sunknown flag%s %#x%smounted by %s%d%sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s])nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'uquvuzuuuuuuuvuuuuu/sbin/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddenlognoatimenocoredumpnodevnodevmtimenoexecnosuidread-onlyrelatimesoft dependenciessympermsynchronousexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsffsmsdoslfscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node x/x9xDxGxJxOxXx\xaxfxm xsxz xxxx@xxxxxxxx getmntoptsegG:jM:m:o:rU:stat %scd9660%s on %sbnorripbgensbextattbnojolietbnocasetransbrrcaseinsuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedupdategetargsextattgensmaplcasecasetransnrrrripjolietrrcaseinsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node {{{{{{{{{{{ {{ {{{@{{{{|@| @||getmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceext2fs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdatereloadforcegetargsdevmtimeatimerelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node ~~~~# )0 8=I R^@dipw}@@getmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: mount_kernfs [-o options] /kern mount_point Zdoruz  @getmntoptso:kernfskernfs on %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath   @@getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdup`jux{  @ @  $ O@TZ`*is} @getmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpsrealpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'# )0 8=I@QWgetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).OB_$KsFfusage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @BC$F0IILSN`OSabcefh0i?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s ?;73/+ '#Cannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood /Hu(Hh6`%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???FPFP*0 XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/{;< < < < < <  ==(>e@< OY< lq@=772 < < < < <  A(<  5< GO< gn< < < < < '< O< j< < BEBE< < =66 < +< 2< 7< regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s):  "CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c@@3@U421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)FHHHHHH ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forkaaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhfAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYsspclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGSVWY%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. XXXX'*XX'rXY'#pYY'Y Y'8Y'Y1'7YBYJ' 6YgYr'YY'qYY'!5YY'!SYY'"RYY'$YY'tY'YY'ZY'Z Z'$ZX'sZ$Z5'HZAZN'$tZSZN'pZdZm'Z|Z'ZZ'ZZ'ZY'ZY'ZY'ZZm'%[Z'&[Y''[ [.'[@Y'([LY'([XY')r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hfeb/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula]fU]f%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5dxfJfOftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalidnknnnnnnnnnnnnnooooo o%o)o-o7o=oAoIoMoSoWoboqo}oa%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF iiini/sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug}I}P}U}_}i}r}y}}}}}}}}}}}}}}}}}}}~~~ ~~~)~5~E  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s  8 < s e    , ,1L e u %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error%05:>BLRV^bhlw/dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijz PI XA X Zi W Zo T R Y} SS T R{ Ry c] W \ V TY O S Z _Q a) O O b S; S- R U Rdisklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS %s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s%*s %s%llupartman%s/%s'Bx'BX'B'Brrwlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s%draid/tmp/raid.%d.confwCould not open %s for writing cat <%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new  S 5  i  m u A s c] m K m 5 out of memoryaI<<DDHk MX^cj !-a t} ,gpt %s %s -b %llu %sBINQTY^aekouz%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredHFS0eCUFS0eC!haHdInotNeedEFI*s(ҺK>;Qn|n֏- q+Qn|n֏- q+Qn|n֏- q+)2Qn|n֏- q+CNQn|n֏- q+\`=Gry=iG}doM;t?zWmCĄ 3KOOyD¢<#*=(YBbRuoqrРD3h& \M}-ޔM@jy֬&-ıܹчH7;-ܹчHPTIZܹчHnrI􍂱ܹчHI􍪱ܹчHI2ܹчHLǠ6 %?aʝ'S@ۿ )Ѹު1*@ە )Ѹ1ۏx )Ѹ .TSqHBo6֯i$/%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/  !.9IANX`jz %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new A     u      c    G  c] 1    % I   q A  A A 9 & 'U%s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s V %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initsplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentbcdefgh+ij$k,l6m=noDpOqĦrUs\dtulqvww~xЃzГyКAРBЭCдDйEFGHŒIJKLMNO PQ"S)T.U8VBWLXVZe1m4v6щ|њ~Ѧ}ѯѶѿ $37=DMU]gt~ҍҒҙҟҧҴҺ *7EQoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL U U (null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deleted = =rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_delete sa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULL+5>EIS\got| - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s #protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @DCHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s(4CL %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %sXagow {BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- - - 9 9: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc % %UVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory . 0i 0 0 0 0 0 0 1 1) 1A 1Y 1qalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~0 4=FLRX^djpv |@}{ASCIIcs_path(X bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_max/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)vp|\H4|[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d X~  EGz 1,  \ januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8b2Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!JgPMcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown  '++ 9L.DDҵ;15MS7) t:h%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,2~nnw9kUnA n64UOKGC>:8.,11)15-1$1TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c|LLLLLLLLLLLLLLLLLLLLLLLLLLLLL|LLLLLsLsLLL,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%KHz<!u"=pX# >oW[kW_M-2Hz<!u"=pX# >oW[kW_M-2# acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error C0002G,.r{cq=qo 8unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger/852array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist