08P i'&<  ' iWP''`'2 2 i'&P@@<@T 08P i'&<  ' iWP''`'2 2 i'&P@@<@TU i`'2y?A i i iQ$f i i iRA i i iXA i i iYA i i iZA i i i_A i i iA i i iA i i iA i i iA i i i i i i/altroot/standA i i iC i i iA i i iA i i imJ i i i`hpxm< i i i`hpx[\A i i i$ i i i$> i i i$ i i i$s i i i$ i i i$ i i iA i i iA i i iA i i iA i i iA i i i$Q i i i (08@$ i i i $ i i i$ i i i$ i i i$ i i i$ i i i$ i i iA i i iA i i iA i i iA i i iA i i iA i i iQuKWJ&:;7, 6/R4VvrN_1!<y7-5 d^۝P o)6_DK:%b4pI| dIqrEaж 2 . ...profilealtroot bin dev etckern libexec mnt mnt2 sbin  stand targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi  ... . .. catchgrpchiochmod cp dd df ed ln lsmkdir mt mv pax pwdrcmd rm shsttysync . ..MAKEDEVdd 2 reserved inodes (needed for both mfs and tmpfs), and round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. cgdgroup master.passwd netconfig protocols rcservicesELF@44 (@@99P:: ''T ,, ''NetBSDKwGPaXUYSRHffffffffffffUVS8"Ƭ'9s 9r[^]UWVSU8Z"]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*t]9nUWVS6"E@@9s{*s;9r[^_]UWVSR6W"E u @'M 3ME @E @'t/tuE3UEt E$lP$Ǭ'9s 9r$͟ED$E D$E @$$nj'9h9rX@'P4D$ D$ D$$1ɉL$ٚ$ B$SW٫"5u1ƃ5tЃtdB$k_[SWÉ"4uYƃ4t|$dB<$^kt?t<$AktЃ_[UWVShhh'  1t:PYxOvh'j XZ3h@M h'ɥ h'j ۋjDUEU MsMU HE]UVS1ۋ݀ tVP,ZYu ݄ C܍e[^]USDPhh'8h'h  CtsPhh'j莗UWVSE tuhPURhc@5'k¡' t Ph7juI~>]]ܻI}~>UI~>WVSuQRPhG跠E tI~>RPhn蒠 u5'h||1e[^_]U5' XUjhc 5' t5'hj 1USRj EPS xU:t Shj]UPEU Ph JtPhEEEPhc5' t5'hjo1UWVSSuE H1ۃv>PWZYtC` uދd EhDWZY1tFEEPhc5'k t5'hj1e[^_]USu Sh j]UVS1@ tSPZYtFSh#jVD e[^]UWVS ]u} Sh } ~Sh}}1{EFE} t!vM9Mt65EE1EEEK>tt,uh1}}}}}E뺉t9WuhjEU9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4@ 5'h }t*}uuuuM9~VQuhja1ۉ]Ek]lST EYu h4j;1}E1҉Uuĉu܋uu}}UUMMPh c5' u EX@1}WuC 5'hRjEuPE4@ hbCE rhj^ElU9U|`'<Ea'rt9U}I}s}u,@)1ɉMMf>h`'h> iXZCtCPhS_Xj k^CtCPCPh0 CtC"PSh Cts؋C4@ h C$PhޗZYu XEw1e[^_]UE']UE']UhVj?Uhlj0Uhj!UhjUE E EE]UhjjjuhB''Uhjjjuh''Uhjjjuh ''Uhjjjuh0'4'Ujjjjuh虱 '$'Ujjjjuhq''''('u(Ujjjjuh5''('u(Ujjjjuh ''Ujjjjuhڰ0@'u jUWVSu'1''1'>WYXuWh'j=StY_u ShTjxxuShg]hjjh EPiuu뺋('#H t uh P('WPZ_('t(#=t ('t hzX('ƒtuh<t?%t4!t$t (' ('hj&8'e[^_]UVS'uX'''''';''rgj''''''X=5'u'E ')EU}t 13A}uke[^]Ë''ut ''Uh h> j UUh h> jUUSË@4URs(PZYts$h> jS4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@u8uK ]USQVy9s SC ZSPEP ƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y hEjC4WPs(Xe[^_]UWVS]uVh'jC4uu s(P(8jVĵ$8؍e[^_]UWVS'}t '' ''EUEUEU}uH*' t?11ҋ}9׋M} ytEU '$'E '$'ut(jRP5''P Bu@u 5'hNMuSh'Ɖ 19|8uu5'hr/8t5'h> j11 '$'utTU܉EE܋Ux'|'5'5'RPwp't'P'T'1ɉ ' $'5x'=|'9}u;9uu6E9'u E9'tX'\'|P'T'lX'\'9}u9utT't%='u'5'huXZ't5'hjR)u}''+EUEU''5' '9uEr uM}u}tUR')P5'} ''' ''ut jZ'uKu<)u5'hjt5'h> 3XZe[^_]UWVS'' 'u jg11;5''5'5'5''P$ ~fEEEPhm5''P @t;5''s>5'5'h' ;'C;'7벍e[^_]UVSˋ <'yQj hIRPVuVtVSh莈(e[^]UWVSljӃ=L't%tPhh Vh PV =p'wwVPhw$w wwwwhF0wxw('4@'h0'h('/,'Y[0'~4@'?4@'('94@'}4@'=T't.t h;j5,'hh?XZd=\'u[4@'hPhP5,'PhVVh (=h'thj hj hh譍XGWO_)Ӊ+G(W,ȉ=T'!=l'thh hC=0'hh hDhuDž t1jj@P[ w0'tM9މDžs,11RP\pL1󋍤tM9މDžs,11RPoL1󋍜t;9މDžs11RPwwro1ƋG_RPPhg(=t'=h't w h,?Vl V\X1e[^]U塨'tlP`Zy60a P5'hy h'g|h>>1''tP5' 1҉'YX1'''1U塨't*PӖ'ZtPC5'\ 1'ZYuknUjh('h'譧2 tj'''''@=uUSUE '''M'Ћ] Ӊ)~'@[]Ã06$ 1ølbXND: 0 &    t øUWVSӃu]1'2''@ujjh'h'HE thh> <Y^''''`')''1'2''@ujjh'h'D thh> 1<XZSjjh'Re[^_]UWVSƉ׀:0B ;XZCut C1|1\ ڈ@u'h> =;XZAu@)1׋1Ҋ1 AuB ucjWV蚊 e[^_]UWS1'''1joPؐZY1詐'Cue[_]UWVS]'9'1ɉ 'Sjjh't5'='jjh'h'B thh> :XZ1'2''@u5'='S`^u'vFhVSPj'Y[8~hzh> 9XZ'thߣ''P''e[^_]US]='uU S'1'='x'P''[]U='uU'1'='xU']UWVS h茜[1ۀ8t}uE }='u61 !ـBuڃʀtڈ@}9uV: Ythh> F8XZ؍e[^_]US'9''P5' ZYu[0f PhIh'ruhg 7'H'ua'tjtJj'' 'u 'ųu١'P''M 1]UWVSSU'='CE;U tM'119~149u1ɉs19~H '9E~@1Aˉt'X[^_]UVS5'''19 t'1H<u '[^]UWVSfEp E}u.h5'˲_Z]tjEP Y^u@1Fu~hR蔲^_LP'Zy }Fu PPC x Ed'| tf% 'كu-hRZYuu h5X덋'jEP6 [_kE '9''=}\SR ZYu[:0 PhIh'rhg "5'H''tjj'' 'u 'uΨuً'EH''8uAx2"x)tދ'PRR yahe[^_]U'1''''5'F 1҉''H'Yu'tjtjUWVSP' t u h3X 5ƅu '8u@'S5'Ë='X9='|^SYt='tj jsPEUjjjRV0 ;EtGSZth1e[^_]Ë `'Q`'y ;p'| tX'J X'UhX'PrXZUWVS u1ۉ߃= 'tVF NyV軌XHF `='9d ''؁}U|WQ, ZYU='' 'u'tj>tj'u 'C1 mCE '9'؁}ULQM5' ZYMUuX貼0, PhIh'8ohg 1'H't '/t1 '' 'u' u ' KF @t.0 PhIh'nh1tt' '}'8='t='te[^_]UWVSu Vǡ'E'E'E1ɉ ' '[= 't5'11҉UuhEYUU'5'ZUt"?tzD'PPj@ƒ u- 't 'tjtj 'u 'uݨuE\u}}!9u„tt h'h&#='t!9uu E 'uh'h8sXZ't='19u!Ӆu '9uu 'Mu5'} '= 't؍e[^_]UWVS];!uh<CPMXZSh<Plǃ u$蹹03 PShy h'>lhJJu WYXyh;!u7WQZy4m0 PShy h'khaT.W识ǃ='uVhh'k '+E e[^_]UWVSu] }9tSC= 't VPVPQZYyո0O PhIh'[khy-1e[^_]UWVSQu V[= 't1ۅtW;uRWZuZW95'u='t ='u BRUPu! uËUF?륃= 'tuX؍e[^_]UWVSPu]>!uhFPKY_Vu Pjƒ u$轷07 PVhy h'BjhRuSRUǃ Uyl>!u7ROZy4i0 PVhy h'ihP,R諄ǃ='uWhh'i tE)؍X؍e[^_]UWVSW11 'yh'^u'P's='9 ''؁}U|WQ] ZYUu[腶0 PhIh' ihg m+'H''tjJ j! ='' 'u 'uΨu١'u'1ۉ߉ u''0''u '@t?0: Phh'Fhh*f% '1'-f '9t{t '''މe[^_]UWVSW'C{ u)ÃE'<TRP Y^tE '9''ށ}VR _ZuZδ0H PhIh'Tghg )'H't1'tjtjk 5 '' 'u 'uҨu١'5'ljD s} us*Ext'M| th)[oE '9~V''߁}WR ZY= '' 'u'"%'25'NjM}t1s2PRd¡'_YtD } )s! '9|X ''؁}tVQ ZYK5 '' 'u'sv'Me[^_]UWVSQ]utuhaXZ} 9EueF95<@'}hX'hD 蚳^XP^w<\u7\>t.ˆUPhrvZYUtF- /B000CL 1e[^_]UEH!'EPhht@j x$Efv@@'Efv<@'U='uE'E '''~9 1;'~h]&XUWVS'}t~} t 9'~[C ~K'tIS P>ZYtF='tj jvPjjjWu # u19'uh%X؍e[^_]UWVSP]U u h%XU19'~BPSYX%KM'uSwPux?]9tWsZu̸1e[^_]UE P'DBuh%XP<'u 'E@'1UEP'DBt'Eh$XUWVS'P''EDJ@t t E@'޹'0U?& } $ }^@' P'8f|y@@t t'tQ18j h'5'Ǎ vЮ8"uhe ?-t^u1=UDQ@u-t ^u؅uh#^p1ۉj h'5'#Í vE8"upt@''.l'at$1Ƀ/QPZYt'M:-@'"FP'@PX3t(@'';u ' ''9Et9'}؍e[^_]U1''''' 'x$B' ''' ,t(;t#'у~ ' 'JuJ ':;u'9t 't1]UVS '11Å t]9@'u 1ۉ@'J@։t '[^]UVSuj Zu+Y0 PhIh'^hg A!FV CS FC؍e[^]UMU 19tz\u JRQZYUWVS='ujEH!''Pjhhykhթ^tZP[=wJ@ P/ Yt:WP@XZ|3/t 3/D3hSO[5'jhS=jUM='tI 'QU='ujEH!'jh@'$UWVSE'1='u-t '| t7f% '';u1SЉ'Bz u)؃u ;.u{ tՍ<'SZu# 'uo'tj>t[j't P&FXPPj/ƃ t9u' ''u 른e[^_]UWVSSu'X;'|1ۋ'z'9t9u SEWá'ZYUSWj / u 't$195'~FPVj. u)ϋ'tj,jSX95'M~WVVWYXMXABy '19~')@'='t R3@XZ' 'u'FM1e[^_]UWVS}5'Rơ'')C='Y99~ )C)E1ɉM1'VZu' ''tjtzjPE"YtEG'PPjY-ǃ t' 'u 'uu6l'@PvX]1҉UH1e[^_]UWVSQ] 'Suj, u3 ''tjj19'~CPNjEpVYZ='tW0EmXZE8G+]C)'5'' 'u't{1e[^_]UWVSu 195'~@PXEuM^_1ҋE9USYYUCЋ='9 |''=}UWQ誹 YZUu[ҥ0L PhIh'XXhg 'H'O'tj7jn='|' 'u 'uΨu١|'ЋKS 'B9|^5|''Ё}U\SVظ _ZU*'|' 'u'OV|'f u u|Y^uoEH''5|'5Zu ''PPj9* t'H''u't ؍e[^_]UWVS}5x''V5t'Է XZuS0w PhIh'Vhg 'H'uh'tjtTj5x't' 't Nt'1#'uĨtɊ<\uGGBDtG9D3؍e[^_]UWVS1u' 't hfjEP£'XYu -E '95''=}U\SV褶 ^_Uu[̢0F PhIh'RUhg 'H'z'tjbjh'' 'u 'uΨu١'!L<%s='9}p '''x='8\ux='@1s '< s ='u5!5' Z '뛃='u 5'5'WZYu5'릡'PP_Xu'Hnt*ptlt '8 tK '̃='uu 5'5'Y[9';'@'='t ='] ='~ h} BDA@u hI1'Hnt*ptlt '8 ts '̃5'j_ZsBaK*t'PRPY[1'Hnt*ptlt '8 t '̃='u''9 RP>_ZB'Z='1Hnt@pt)lt1 '8 YWiSP+ h '뻃'PP[^C' Znt1ptlt"': 'ă'PP6ZY'U='Uƅ='Uu h';''='9|9}hpu ''Hnult '8 tσʃ='uPS?'PP]^_' Znt-ptlt': t\'ȃ'PPY[' Znt>pt)lt/': ^P5'5'1 '뷃1='\Pnt,ptlt'8 t'σ1='u,2uD@''='H0V 'wr 8 t ك='='u qnBDA@='u ''1`'Hnt*ptlt '8 t  '̃='u5='u;!t1hSh'1 ;u=''''PS_Z9''y1ۊgtR< tF0 w}]10j h'5'' vD$ptruD C@'3 8"uhe 1ۉ'6%' tB'8 V='uhYu8 t 1҉'x uhҋ5''tt6]ƅu+ ''tjbrj9'9t'tP5'< _X5'' 'u 'uut'ƒ='u!h'h' ZYy؃1У't%'S<[t<\t.RfZÅu!h] { uhv*[1C뵉) '9=''Ё}UtVW裝 ZYUu[ˉ0E PhIh'Q<hg 'H't'tj\jg5'' 'u 'uΨu١'5'lj'='tj jRP9e[^_]US'< u h XH< u='u$hXJ 'R8tڀ u ӡ'PKXu1't='u P|X9j@ 'Yu(}0 PhIh';hg eK1҉'5'S5' ¡' t+h'h'PRj5') 1'R]UWVSV'P'M1ۀx%u8Huz'='h[s9}e'P''' \P''2< ''M8 u''ف}|WR ZY='' 'T'tj'H'j'U5'' 'u''''e[^_]UVSVu] 1' u 1ۉ'U' Uu 1q8u@'JπwEW1ɉj h'5'  v-8"uhe '1Zgu@'됸e[^]UWVS 5']'='}+';'_&M 9}y;M)9 ڋEE'}RUu> ZYUu]f0 PhIh'6hg N'H't %'tj%tj'' 'U'uΨDϋ 'M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEW'}RUu ZYU'' 'u't 'M9u}EMELE B19uu)d9|T'ځ}tVuu ZY65'' 'u'ad'Cw9|T'ځ}tVu ZY5'' 'u''؍e[^_]UWVS] SZ='tj jsPӸCjPju t 1E1 '}t9U3 9'ށ}V5'賔 Y_u[ހ0X PhIh'd3hg 'H'i'tjQjz5'' 'u 'uΨuك='tjj ] 'NjEpSP  9~U'΁}V5'芓 _Z5'' 'u'='tjj S舶 'Nj󤋅  ?u9Ћ)ȉË ؍x'9<t ttjPju o'=}tV5'd ZY5'' 'u'~2 u)u thHXDžS='tjj S, 'Nj󤋅 'f Qe[^_]UWVS''H'1ۉ]1'+'9U'@'P藯uu PuƃU'PP[Z'3E'1SȰYu' ''tjtsj't PFZPPjƃ t9]u 'u 'uuE'G'E  EuhXE tu RR x1e[^_]UWVS'E'E=L@'t =H@'uhFZo='t 'j&''E'EXUZk EtSu`PR@PNwFH uu^13^@p][sHZPJJ@BE48rE@E܋]Ek ƒ 9]}3:}z}z}׉u0}xupK Ń='t谻L@''EL@'H@''EH@' 'u'tjt j1e[^_]UWVS''Ht7k X< u'ʣ'B0Z9tS;S芑 ZY1''L@''H@'e[^_]US'9'}Pk' 'Eu-Ck' 'u C'P'k 'ZY]d'j Ph' tPH PhIh'T,hg 5'谐 1''1]UxPhh' ,j `'Q`'y ;p'| tX'J X'UhX'P.XZUWVS։˅t9u RPhVPh' tdt`{tZC<x1ҍ{t2Hs!t ,X< ϊG< ĸ>e[^_])e[^_]UPEEjEP5'  UvhPhh'*jxUWVSf@8uVu1Q x1҉hW3à w8#)tSWV e[^_]UWVS} 5'ifDž<Yw1҉uJhPj u_w8Qw8thI-ÍjjP @u"w8th)jjf8utSVW yv8#Qh{)AjWjfDž='t fDž9DžjRji fDž9fDž9'jSV @uEv8tfu ftR.@ufDž='uK"'@uσfDžftv@u KfDžMe[^_]UWVSQ}u VW[ZÅuzjj/ XZu hzj?i;s jEPWƃ ?tE8thhjh,u8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19}9xu90u,]9Xu]9XtyB݋EEEE19}9xu90uU9P uU9PtGA,Ck,QMuƆ ZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPY_}ËBt1UjL$qUWSQ- 'v='ڞv]=']5'5'h/j% 5'5'hEj 5$'5 'h]j 54'50'hujڐ 5'5'hj运 5 '5'hj觐 E$hj蒐 EPP$hj~ =8'tJ=u'1 ujVeY[_]aÃ=8'tUE Puj UWVS}u _Phj 3 `'B9tT`'e[^_]UWVS$ ]5H't(V_$V.0Y^ugh j0Pu   yW_p4$~ 0ZtWVPt u Wh(O5 jj0։( y0hN jju ։ƃ A Wh V ƒ jjW ‰ V h ~ _Xuhvj| [^jh h R( y R/ Y߉R Z=t*w=bt%1=bt" =tu h11 Њ Јt u hjYu VE3ƅ/ t jZV8 jZVP3 fjjP% d'2tS SQPR(c%,9kP| Ɖ4W| 8t t10hj݌ ^9s1BFu hj譌 1e[^_]UWVS\]ƍ}ZE5 (,%%02 4' 8 EPSUe[^_]UWVSĀ]p$tV9V/9Y^㋃p tVf9V9XZ㍅xP~D1RPuuFt5@'9ΉЋt}"Q75@'VPh1e[^_]UWVS] }AƉI1RPuut C|WjVȃRP<tCuPhj܊ 71RPuu ‹N tvkk ыEe[^_]UWVSTERELIu EEE EE؉1 t1҉Ƌ] ڋUӉe ƉߋEE$EȋEt\EU 1 t1҉E܉UEU}9}}}sE܋UẺU1}}t 9u9uEUẺUF uuuE,P# E =D'E ‹EJu EDEO1 t1M ϋEe ʋ}t}\SQE,#h_ 5D'yÃt#EhSjPV.Ht h;& ^S6Y '$'E0''E<1҉UEt E\]̋u)։]uEEIu E E1 t1WVuu/9E #E1҉ t1EUWVRP9E EEEEuűE,|"Eԃ Et8"EL0wEԋPatELhaRuuPhW3CPEԃP2‹EԋXX9t"ERQuuPhj视 E؉EEEE̋UЃE܉U1ɉMMMċEE}$tWW}9t }O]K}9:t ] [}19]9Muu܋E,!EujP1Eă1EEËEt@d9s+tNjuE‹Euu}OEJUEMQRPuEPE]tXpXjuL5XZ9u9]EE@]k,Puy ËEY^k,tԋUEVFF E܋UFVEEtP4@0P,@(FVEƒEt@P@ltȉF Ek,Dԋup(ut H}P$]GVEXE`1 t1u}tE]9tE}?Et\]̋u)։]uE‹EyJu EE1 t1WVuuPuuhjL EtP @@1ҍMQRPuEPE0ju231ۋE;pEE9shI9uEtpp Euu܋E,ujP-EċE1 t1u}C놨u  EE]k,Puv XZu E}ȉ81EEE9k,]Kt[ 1ۉX]]u LL\HX M܋]HX]]tK0[4K([,HX]KH B9EutC E@ b]k,D$uu܋E,{ujP`,EċEk,Z(EiB$ t1EUFЋ]EEt  E}U}ԄtOO9M}1ۄt_9]u 9MGEt\ű})׋E?E9Iu EvEEÉ1 t1RPWVPuuShj E]ȉKEԋP9Ut,E:uRuuPhj E}8E}ȉ8}u}u0'4'EE܋UẺUQEe[^_]UWVSuEPzF VM]_9EEr )ӉM؉]܋Fƒu]uFt 11ENjE9sPu hNj~ N͉1+MF@UtR UR)M]E9s )E]1]9؋]sU܋EЋEÍEeM1SQRPFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW#.}EEPhE ƒyERPhnj} xhj,3W-}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QYRPh1ɉM؉M܉<EPURvSOE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]P<E1Em}''''EЋU''ẺEMEPh ǃ yNTQWPh0FPh ǃ yN"QWPhj{ 1eY[^_]aÍL$qUWVSQ9qd'X',h'l'?1<'@'1D'H'1hQVW6 ta#DtNJC,2D'뷃b$ p'P'C8'Ct'u5,2.@'e5,2)9h'R5,2.d'@T'/5,2.<'L'5,2{.X'X,2H'h'h\YX')lj80h'h[XZ=@'x8thj5P't hjENtjj)h(?y h+jj[[_@u hjj h(y hjW00h?@P@ uhQt|j/S/ZYÅu@: '׉hjWhj Wj`$8`'Pnh \'1urhcjx j\'؉8hDj/l 803PtP3hjrx W5\'HOG9=`'=P'tf95`'~W\'4!F_烽(ta1ۉ(,,9`' <'d=T'tj@'xrP\'0jX'dh1҉ldPh \' à t$]X8: hj"L1 1ۃ=`'*;,\',@XRjPjj(($tLPhDXP 28rt)rz rz04z('JJ 04zh P&U''f8ZY9tFS‰Yt"Phjv UjPhA9 Phju ‰Ju tH‰R840Ph1 tH89s`u[1 t1+049Ɖы0|9Ɖ4}LV 9Ɖ4|9ء\'40\'<0X108014߭0ݝ0y11WVRP ߭ ܝ0W=t'pݝta\PnV, ݅y؉RPh M\`+EU5X'9Ɖ# >jV0ZY@݅u؉Ph&jh'ܝp H ܝ0 YLRjP011RPJ$01tZL9rKjQ#^X090Q_|OlaGl막9skQ k4 JHJZH XH J HPW4 |0u|0tGlDhjP8F"8xuxuDPh`Y[, 1҉D<5p'd'8Hȉ9r09rÉ014840Phy840Phyj'q 04 41119q09Ћ4N8JZ8<<u 8^9 +4i۷m۶R<8SPhDPhx'SW(~JFD\`HP\Phx'W\DH[, X049Ѹ4}u01480Ph1ۉ8Y98r;D\`j\Phx'W\D𙋍09ΉЋ4}88SKut+4i۷m۶QRSPh#kDPhx'SW$~FJ,TY8$D8tx'11҉VPh<B98~k,D$Aۉ<014߭0߭''''''1XT011198t)k,ȋ0I9Hu0;0Putvt_|TRXR81RP$؃RP10P @ 9|0,PQpQRPjW'k,Љ1;P}0PTQXQ8)Q t p룋Tșڋቅ}؋ቅ  =L't 1Px'k,80$98p09~Љt$DPShlpPh ÃKxKQSPhjj #tV:t&PhjRj ,.gPhj2j ,G$)08<11ۅt;k[ $DH$(4Ƌ $9 (V194{t+!\+ƒu 1Ҁt t1RPkDt1҉V ,$(y11jDP4PSnDH1$9ȋ(}W$() $(119} @H 9ȉ}u =8'h9jY Y_qw t1WVRP( *DH9}kk,4W$R H G(Z dP90W P4t0$h_jYX B=8'tRP hjX KIu 1t t1҉4k,kD,49tCC8RjPjj8P 2h Pv wjh P  뙉<NjDHk,49rRP@8tGpBu&K E'@'Xe[^_]ÍL$qUQ ''5'5@' EM MuQQ$RPh;MɍaUS]CtS P S tSPSCr s {J ZStJ 'X]USEPsH) '' 'H1҅u0'Z[9t 'u'u hj&X4CXtYZ@]UWVSu EEE#@''' 'M11ɅtJA9~ʳ9M}#t'hht hh,}9x4u }9x(u9p$t버t'e[^_]UWVS]uuu SO trNj@thhl h1GGWX9w(~6Gthhl hh+wVw `" G [^WY'@';'X='u ='uBGWu'GWtP'WGtG4WPZWX'j@jt! Vjj! G _4E UG$W(G,W0wE #@'G8'tz8GC GtWP { _ Ge[^_]USEM Puhhd h4hD*P ʉPHPPP s E]XPs2H '''1ɉH 'H'.1ۉXt 'H' 'H'P4JH8'9t!tXYX tAP]UWVSUu }uWVRcËECUt'R'EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY@'A,y0yq I4 s RPWVQ  RPWVQ e[^_]US]C%CSjSZ1]UE UMQ1]Uj UU P'PYtHJ '@ 'UWVS] 'C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdBD C4D ${s D ]e[^_]D UWVS uE EEEE%'1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP֦YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8j ËEEC1CC]C'^C :f1C C$hjq Ehjb M쉁jhjP MAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jREr7 Epdg7 u_7 SY7 IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u'EE %'S0tK0J4''C4(C(tS(P,(C,(މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyhh h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyhh h)hh@륋B 뵋EEP EԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuhL}t/EEtP1uuRPhY]9]tSuuuhquuk} WY[9t$PRuuh̨u0 1҉U u0 XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPVe؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVhEtC M苉9t.CM苉p9t$1SQ1RPWVh֥C(S,C S$]9UrSPWVhD訥nWVhc蔥 Z}t5EtC(S,C S$9Uu9EtPuhT EUjuuWVSucE؃uju[X}t$EtC(C PWVhEEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPҪEuuWV迪9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWVn9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhۢ.uH‰?9u*_YӉ9u9u :9r 9r}thhX'ZYtFpVtFHuRPuWEU}t hXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh象(/t `d)RPh@z tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8j E1ɉHEMAYA1ZA XZ1ۉY Y$XZ}th4jG ËE쉃\XZu u =@'ƉE} t hwX@'EPjh WVuh4j ËEp }쉻\P P jP^_=t w=bt=btP=EtS S@'}tURjh  t1RPuh4j EEp }}M쉏\P P jP4ZYutCHSLC419|} tMh)X@Et} t#h Xu uuS9u u$' X S' X]tS' _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhySXZ؍e[^_]UE Puj@' UWVS]FHE1RPuu t C|}WjuȃRPVetPu h\ u~ 1RPuu ^tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu询€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh1 LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt PhLTXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt PhLXZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt PhL Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt PhL@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuut C|}WjuȃRPV~tPuhu Ep 1RPuuwtփ~u$~t:!vkk փ~t*uuht tFVC(S,FC BHMQjPjjRt PhL_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSX(t C0S4C(jj\0uu Se[^_]UVSUE 9| 19[^]USPPhh'ѱh'h5@'CtsPhؔh'蝱j'USSE] t$uhJs1ZY¸tr1EEPhvd5( @u35(hjg]UWVSPu }t}~^hsSY_DžtFh<S_Zt)hSZYthS[_t뫿}}uhvZZYuUEPhud5(% @u65(hje[^_]US}tQ,Shzd@5( @u5(hjJuIRP5(h!蟨1;us:PCPSh2gF e[^_]UWV }tEPhd@5(x @u5(hYjEEPhd@5(E @u5(hj}XZEu}P1RPWV膓RPWV5(h|赧e^_]UWVS}tCE XhS^_tDžd1ɉhlpdPhwd5( @^tltDCSx|xP?Pss ss5(h N 븋lhprhS _Zu+hxd 5([^@5(hjWh SZYxP5(5^_@u h%= thh h'辩jMtDžd1ۉhlp`dPhwd5(" @u5(h9tXl%NjX󥋽`8X K`t!Tj % YTujj7hp`hj T_Zt̋`1X\11t(X\H X+HXߋWV\X5(h-Ӥhxd 5(¡( BuP$Ph^襤Y[``pp pp5(hwt`px`@`9q j RP5(ы(Au@uWVRhJWVRhhT5(臕=th (hD襫XhX'ZZT` e[^_]UWVS] }t9hs4P v jhj sEP vjhj910j Ps诈Ɖ׃ 8t sh8"u:9sh*ryhDg1ɉj Ps 荵 8t s h^=q8"u!Ѓu hvjuĉ}ȉM̉UЍ$Vhyd5(w @u35(hjVhXZe[^_]UWVSlj֋ 1҉@'tUPQM+ZYtUBMQh/j_jhh(@'s 5(t (@u5(h> jM((VWS5( e[^_]U05(hjUSS}tE Xh?SuZYth5SdZYuEEPhwd5(0 @uE ]UQ}tqEPhd@5( @uE O5(h萠XZUS 0(0(t 0(ȉ[]UWVSub.(uӍP.(u'B%zBB?R+B%zBB?zzJ}  ;u9tHk?9[^_]1^.(x@uUWVS։ˋ=p,( t,(11~B? ыE[^_]Up,(?t,(jh>RP=vux,(UWVSQ5H,(At t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$P'1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉Mp,(t,(ÉEE1RPWV谉E)Ɖ1UQh> ӝXZ}Utt,(H9up,(H99stBRWh~蟝 e[^_]U塨A'=D,(tvPhx5,(5,(5,(5,(5,(hP 5l,(5h,(5p,(5t,(5x,(h%50(h Phhͤ,(,(5A'5,(5,(QRP5,(hÜ,h苤t,(p,(5l,(5h,(QRP5x,(h臜 5`,(5d,(hn UWVSQƉV1ۉjEPV  >u#ËE8u*8"u w܉1e[^_]USP\$IPhIPhIPhIPSh'h'm,jUWVS ÉM衔A'uh5A' hj>׉ljEU}jؙ#E#URPQBuAtVA'A'=PuRь 3P5P (R迌 9A'uNE!5P (}e[^_]UWVSEUσ}u }tCEU@uShMXZff=Ut+=,(t fuuSh 苀ff=u%Sth?]fLJ_f=Ut1=$(u Shd0Y^$(tShXZj(VPb x0XŃ~X ,(t\fLJᵃVe[^_]UWVS90(u0(50(w 1Xƃb.(e[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEE$EtE 11}=A'Et,(p,(U1҉U܉E1ɉMĹEEUԉӋERPSQQPE؋UEUuuRP4RPuuЋE؋UEUuuRPRPE؋UEUuuRPRPuh&,"uuuuuuuh h'jdh@0(~ u h jhh@0(țY[@0(]슀@0(< <$u { Ћ P'DQu<-"j EPh@0(}Ɖ׋]h2 SE؃}Ph$S tuhvSo t I =A'Ήʋ d,(1WQRP裂Ɖuh'S u` d,(ω%d,(ƉuuEt5`,(1Et 5`,(Et +5`,(Et +5`,(EÉ]hS\YZ؉E8 t,h@0(Zƀ?0(uh@0(h+0 59uE|E9Ɖ]}.uuuuWVhIuЋ}u}e[^_]g_USE Puhm踕'H' yh'蘵Y'P'؃ t7@t( 'y h'fZ'P'h j1Y]UWVS M A'u hsjƉ׋A'ؙljEU}ؙ#E#UƉjRPQDBu @uA'A'uhuPB mR5P (P0 9A'uUjWV5A'Bu@tP (KE!ÍNju5A'R5A' 9A'ue[^_]UWVSRá0(u ƀA Mz΍0( S}8PRU 0( e[^_]UWVSEыEU u1#ˀ Ɖ+5`,(u}};=0(}=0(EUEUE90(0(}=@,(Euy0(KlE9t 50(tމnʅu+`,(9UE}M1E܋E9E܋U}t+}t}u w{Ɔoȃ[^_]UWVS EӋEEh0(@Ph0(3E 50(t hj E9E|E9u|0(] }) VRPt50(31fǂU }u@`,(50(֋M)}CsKSCPKSs FS0(Ee[^_]UWVSEU} u }7M] M]9 ,(,(,(19UtWtN}1E9ϋE}79}E }&M=@,(}u1BuEP,(]Ã}!؉˃u=0(u =0(t=@,(Y}t0( }mhj 0([^u hjfǀUE0(EU 0(0(EU0(0(0(t_}t E 0(Hu0(=@,(hY,(=0(;0(0(EEU EUEUMxa] 0(tEV1;uE |9EE}=@,(}tEt뚃}0(E 90(u;]t~0(H0(1+]9~ Fu%uF PPR| 0( *`,(1RPEU 0(+E0(XZEU 0(0(EU0(0(> . he[^_]UWVSË@SuHt+5,(=,(9u9t h}sY^sǹ󥉍1󫍍@u({u {t PhCXZߋe[^_]Ã=<,(u x t!1UWVS|Éס,(tP Yj/S̡^ZuS5A'h^h,(2 SP,(Y,(u hjEjPB~XZy5,(h> ^XxPSZY@tϋuи 9E} 5,(hdV 5,(h{Ah h` (S} 9t5,(h> jY^4f=^ (Ut5,(hqSe~ZSN~Xtj趁e[^_]UWVSáL (u1Ҹ֗L (f=\.(uf= (ut#H (,(` ( (f\.(f.(U^.(1t.([^_]UWVS á\.(fEt,(p,(x,(,(11t;f}t0(E 0(164.(t9r $uf:t@9Ezti 9tܻՋ 0,(tT,(u$f}u=1.(ׅu 1.(4=@,(t u)hoY L (uhhÉXZ=L (t]f= (u (Ѕ,(=@,(tPho_XPh"ZYt 1=L ( =L (uLt1gL (tp (҅tSP5,(hv!o=@,(t!1f=\.(u1  (1.("5,(hZYu ֗ve[^_]UWVS ˃uu Dž Dž @uhZYߍ1jhS F t 1/9Cu苅9Cus Pj؆ ;Cuă=H,(t.{ t(s$s sh 譇e[^_]UVSPEA';A'u*=,(u!URhmdP輷 y h|PX,(11@uhDB=H (u111HL (~ ف` (@uhf^E0(01C;0(}. 0(0(0(@uSh{SY[1҉UA';A'u*=,(u!URhmdPٶ y h|PXe[^]UWVS(ÉEU EUE؉u=H,(Ee[^_]э11ɉt<u ȉh%jhh@ P|O tPQRh_ fu1k t PhIh#WVhIhu =A'RPSQapPh 虄Y[=H,(u! `,(9u )ȃ11ɉ=j-|j)UXZt1H,(f}Ut2JPhISh2EPh#~uhISh  =H,(x@9uHhQ jjPR=Rh4 hISh= 衁(R Z)uhIShJ x 6)uhIShm \ ƒ< h=0([ (MhIh  @ tShIh 萀WVC$u (vj! XUhjCQhIShRh=H,(xx붍e[^_]UWVS=D,(ujjju u.B=,(t+50( X ֿIuVWh ] PVWh HVWh 6 EU RPVWh PVWh $%PVWh ~PVWh" ~ ?PVWh4 ~%PVWhE ~ PVWhV q~?PVWhh [~ e[^_]UWVShEUȉM]t'BuUE$1ɉMX 1uuuuE^.(E̋EȉEE I1҉UUE,(fE90(~5 0(EE̋E,EUE$1}X &E$1ɉMX 1uuuuE=@,(u(}t"uPhy \}uuUEtuS&}t.Efu ukE }PEPk E8,(}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u`,(E1E EU EU}}E̋@ E1E},(,(+EU EUE}50(=0(0(E`,(1҉EUġ0(19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡0(0()9E]| h u}ĉu} 1E} lj}`,(1҉EUE9EE |K} u}t?1@b.(t&f.(19M} |j.(9M} |1EEUEU Ub.(t4f.(1ۉΉj.(9u} }9M} |1}E}u,(9EE ,(|=P,(uh /^1>E@,(E }uEEjhjjjщ¸ E H,(EuE1ۉ]]]] }t#0(0(EU0(0(,(,(EU11ҹuuRPQUM խ FEU+EU ;E}EE}]u)։]u}tq=0(0(E9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령,(19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu h }u}tEEM9Ɖ}uM`,(d,(1RPuubҋMu 9tۃ}u E9uWVjjRUEUEPuh h wh'jdh@0(X^u h jEh@0(YvEHƀ@0(t'?0( t9EEHPh@0(h ]w uh@0(EP EUĉEU EE}tjuuu uUEKjuuu uUEP,(tuk=@,(t Ph> jSPouN}tjuuu uUEjuuu uUEYt Ph> j(}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE 0(0( `,(;] u1;MtuuEU G_Z 0(UׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }PҊ 2=@,(t h5  YuEft=H,(|=@,(hz Z\E̊@EȋE̊XEȍE@‰x,(p1WVjjj  E1ɡt,(p1WVjjj Ã(Uȃ?1ɋ5p,(1WVjjj }̊MO_U? ˆWGEȊ_EȍG‰x,(p1WVjjj xE(1ɡt,(p1WVjjj QËUȃ?1ɋ5p,(1WVjjj -}̊MO_U? ˆW(}t/=@,(0(t Kx 0(u}ˍe[^_]UVSáD,(u h zX1ۃ=D,(u Sh԰rY^jjڸ,(CXZu҃=D,(u=0(th qzX1L=0(th0 u ShJ xrY^ 0(RP1҉XZ=D,(tCD,(90(A=H,(~hP )r50(j50(50(RP믅<f=\.(t3h y^hW q[1.(t=hq2.(Y=uhe "k Phx }qXZ hoqXh-u9yX=D,(nPh FqY[=D,(X.(PPh &q j=,,(t>u Sh  qXZ90(} h xX;_ 0(RP1҉u Sh pY^jjڸ,(XZe[^]ËU;Ph!h'/tjfUWVSĀ|xt1(wSh!h'sj~fS EZuh!+xƉjRP|芠9u9th! j2fSu|a 9t"xth "h6" Xje1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4 hA"oj1(fEEE0(0(19E~[tP9}u1M;u&}_PaR1(4 hq"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaR1(4 h"n }9sf}wfE@fj1(u4 h"mY[|}tFaP4 h"m ttt111E}t1(}x1(|1(1(1(f1(E]9]E@ƒt<u.E}tхtu|EZE]9]uu XEe[^_] `'yUhX'j rXZáX'PX' UEU 19s f3P]UERPZYUSBHBy;B| X RQErXZ]UWVSQ]u uh$SoF fw4 hOPh$So FPjh$SoFPjh$So Sh XZFXt Sh$׽Y_FXt Sh$ĽXZFXt Sh$豽Y_Sj ZUv(h$S&ov,h %So v0h%Sov8h4%Snv4hJ%Sn$vS6EXZEE FEe[^_]UVSSPPVu ujVSh~t,@uL:tV't"$0 Zg't}'PSh'j袪j\UVS]u VS9YZu Sh(j衪;/t"Sh'(KXZu E@(e[^]Ke[^]U*PhT(h'ij[UVSPh<Pmi[^t,PjPuVLV訉t jP]WZYS襃Xe[^]UWVS EEu EE}]EEE1҉t2( 1ɉ x2(2(h(Vu莐 NtJb$ 1=2(2(2(|2(x2(뗡,2t2(jWh 5,2y u hK'j$P% YY2(J'4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjPXZt1h9}P襥ZY uċ2jWShK@uLtV't"0u ^g't}'PSh'jyt@tx2(Z=x2(HDž(=2(tDž(t2(t tP=2(t Հ =2(t (=|2(t 61ۉXPh(h jɦSh(h(Vyiu hzj蚦j/G PvZYt|# Sh(h(V"itj/C PvZYt|Z X1e[^_]UVS]u VS YZu Sh(j;/t"Sh'(GXZu E@(e[^]Ge[^]UzPh(h'ndj@VUWVS]E1҉ 11ɉtp1h*)u u@ athg$@ 5,2ECpXDžp5,2CtX5,2=CxXDžt뀃K|wK|njuh 5,2 u hK'j蹤P躕 _:'P;UtM |u4uWEp ЋttKxPWZY@u Wh1 jG<ptECpNtECttt E%Cxe[^_]UWVS SVpPtWu u1hWpSh,@uSVh5)jG誣r@t@1RPh| hS4 Sh>)^(jTUSP]jEPS5U :9uySu hb)j]US]S١ Zt@ huSZY]US]S諦 Zt@ hSsZY]USP]jEPSU 9t :uy Sht)jg]UVS]u VSYZu Sh(jh;/t"Sh'(CXZu E@(e[^]yCe[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RPV2Y^CSt RPA2Y^CS e[^]UWVSӋEU ΃tt RP2Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]UWVSEUˋuE $EE tH$HD11E ~E}ufCRVڋE E lWVڋE E }t}t#RP0_Y`}tDɉ1҃t0119s#h)(_RP=P-jjjj`PË\ M߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ɉǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY \ChVQY_thVh)& u5;Džs Dž u5;Džs Džu5;Džs Dž~Gt~(uK6h)%XZ"t9t h)$X9}+uh%*$^_ދ9|<t hL*$Yh52(hn*;9Džx ;rh*%$XZu8u t h*8X 11  ˆK1<1P1HL@DK@#_tM⋅9t Ph+#Y^Ht2{{ @D0{{@D}"Zt⋅9t Ph"+Z"_XzG1t{${Q!^t&XZ$t CpStCH\Ɖ)ULƒu 1Ҋ t1҉RP@ȋ+tC@SDC,M)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t PhL.^_@ tFC8S /XZhX'^N_u4t11ɉ`dSZ=7(uSe h-u%71eY[^_]aUE Puh' USUE ЋM9t 1ك[]Uju u UhuZYUM19sB]US] 52(hPh'?2Suh'Ih'j K j$W|$wUWVS,EӋWE؉U܋GW EЉUԋwF1҉j EPSEUU tOzt Suh/k8tGpBu0 E87(A'Xe[^_]ÍL$qUQ 07(,7(5(7(5A' EM MuQQ$RPh;'MɍaUS]CtS P S tSPSCr s 腏 ZS~ 47(X]USEPsH) 7($7( 7(H1҅u0<7(Z[9t T7(uT7(u hjkX4CXtYZ@]UWVSu EEE#A'87((7( 47(M11ɅtJA9~ʳ9M}#t(7(hh hh(q}9x4u }9x(u9p$t버t(7(e[^_]UWVS]uuu SO trNj@thh h1GGWX9w(~6Gthh hhpwVw jg G [^WY7(A';47(X=L7(u =D7(uBGWuP7(GWtPH7(WGtG4WPZWX47(j@j~f Vjtf G _4E UG$W(G,W0wE #A'G887(tz8GC GtWP { _ Ge[^_]USEM Puhhx h4hNoP ʉPHPPP s E]XPs2H 7($7(7(1ɉH @7(H@7(.1ۉXt P7(HP7( H7(HH7(P4JH887(9t!tXYX tAP]UWVSUu }uWVRcËECUt07(R,7(EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMYA'A,y0yq I4 s RPWVQ  RPWVQ e[^_]US]C%CSjSZ1]UE UMQ1]Ujb UU Pl7(PYtHJ l7(@ l7(UWVS] h7(C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdL C> ${s* ]e[^_] UWVS uE EEEE%7(1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRPYY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jV ËEEC1CC}CC 0!1C C$hj{V EhjlV M쉁jhjZV MAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE|| Epdq| ui| Sc| IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu uh7(EE %7(S0tK0J47(7(C4G(C(tS(P,G(C,G(މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyhh h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyhh h)hr\@륋B 뵋EEPR EԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh/}t/EEtP1uuRPhY]9]tSuuuhquu } WY[9t$PRuuhuu 1҉U uu XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRP` e؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVhEtC M苉9t.CM苉p9t$1SQ1RPWVhC(S,C S$]9UrSPWVhDnWVhcw Z}t5EtC(S,C S$9Uu9EtPuh7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhEEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRP EuuWV 9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWVx 9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPh.uH‰?9u*_YӉ9u9u :9r 9r}thhX' &ZYtFpVtFHuRPuWEU}t h"XtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPhG(/t `d)RPh@] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jG E1ɉHEMAA'A N1ۉY Y$XZ}th4jQG ËE쉃\XZu u =A'ƉE} t hw XA'EPjh WVuh4jF ËEp }쉻\P P jP^_=t w=bt=btP=EtS SA'}tURjh  t1RPuh4j F EEp }}M쉏\P P jP4ZYutCHSLC419|} tMh3 X@Et} t#h Xu uuS9u u.l X S%l X]tSl _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWh4SXZ؍e[^_]UE PujA' UWVS]FHE1RPuu  t C|}WjuȃRPVetPu h\ u~ 1RPuu h tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu €}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh1 LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt PhLTXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt PhLXZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt PhL Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt PhL@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuu t C|}WjuȃRPV~tPuhu Ep 1RPuu tփ~u$~t:!vkk փ~t*uuht tFVC(S,FC BHMQjPjjRt PhL_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXG(t C0S4C(jj\0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRPR  e[^]UWtBRBR t RPBY_}ÊtBRtUWRPY_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRP  e[^]UVSuE H$X(1y9)tNp1SQRP  e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDž Ep 19}5uWSh4 EzBD1H)CNjE_dE@ EDžpA'pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G``E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hD h4jX2EÃd$S\DpTtt RPY[B^UEMhSQEjXZSbdtuuJY[EUEUDpTtM]19 }9Erp@dxÉ1 t1RPuu 1E URjW1RPVEEtH`Xd EH@E_Ή)׋EzEtIu EEu1 t1RPWVn 1RPh.E‹EE@ EEEJEtp`xd @@ƉEӋE‹E"EE.E؋EE)߉ЊM1ҊM t1RPWV ]K!E؉wEtp`xd @@ƉEӋEB‹EE܋EcE)߉1ҊM t1RPWV; 1uk]ӃK 1;{E@ r EFE@4uPEBHEMQjPjjRqt PhLk[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋E1MIdQ}u}u E M̉H}tZCr{<u7(C 7($7(C@CC sh5hp hCh5jS1[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋENUr,z0 t1EtpHxLp4G(6AM̃HEEЋE1RPuu荸 Ɖ׋EƃEۋMtEPjuރWVQtPuh EEЃE̋]s E1RPuu׶ €}trzuЉ}#Evkk BEEԋEMq,y0 t1}trzrC4SPZ}u }u1dE ]Ћu)։]ЉuԋE‹EJu EjEu1 t1WVuu EЉUԋ}ЋEFHEËE1EURjS1SQV]tPE1RPh.PEf‹Mq EJu P! 1k}t)؉}u"}uA1 rEF1ۋA r EFA4QPX؍e[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVoFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh5h` hhMЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuh6hT hh51GuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQѲ ӋEE}tEEPjuȉERPu"tOPQh EE@ EEH1ۋEtGW SQRP *EEG1SQRP }vkk ]Gju蕦hDuVuhDuVuy(hmFuVuehFuVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jLW Ɖ<W; FYZuWh61=6(PE fF81FF 菤XZ1e[^_]UWVS(EN7URu.h<P&XZuWh7(_XDž7ShV蟤 uWh7SGPPPPPPh7V9 u 1th8菣SetF68Uct SY9PZvjWhc8ƅM oP XuS=YDž E o1ҊtBщA1Ɂ)рtjhh8zSOPHP PPxPhS$ Hu GSh)Z] ;ot$RPh8ߡ e[^_]UWVS ] 1h<u薿ZYuuh 9艡_X螥G^t uh#9\93WVPhxo P57t.WVh{o P7th9[CC1Ƅa2=uԤ YtO认]hh9PƃaGlao1ɋu1҉ijhCP cj2WV62 9uE1ɋtWuh9賟 PPh-:V5uPZ;v.Phh5:`aPWh|:M@Aƃaa9tRPPh:ƃa'Rj']US5Ph?h''ShQ?h'Sh?h'$Sh?h'Sh?h'Sh?h'Զ$Sh@h'Sh(@h'豶ShI@h'衶$Sh`@h'莶Sh@h'~Sh@h'n$Sh@h'[Sh@h'KShAh';$ShAh'(Sh1Ah'ShRAh'$ShsAh'ShAh'ShAh'յ$ShAh'µShAh'貵jAUSRhP u Sh> j]Uuu u! @uuhAjUWVS(`؟ԟhBRh*rPEܟП119П~7̟hW؟ ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟^ ̟u ПԟEܟF`벅u؟hBjPe[^_]UWVSlj։1EEjhQ t(jhDBSv tjhJSb u EjhIBSE uEjh?S* t}~EhNBEPhrWhgBEPhrW =G(t=AB}t=BPVhzB良 }uE4 VhBk e[^_]UWVSÉ`dhPzlb1󫋅dhx|hBVhrS`hB|xhBˮ0tplhC謮=BuABRPhIC脮hcChDRPhCD0PhC/XZAB4t=BPhC84 hC j(P++y-@BB ڽڅٞzȉ+߭y ݝ݅߭y ݝ݅߭y ݝ݅ٽf f٭۝٭؃y <kċÿkσÃ=H(thX'hVXZCtSPNfc_X[u릾1;5G(G(WV ZYuыXtCtNPPio xu SbjSXjPPiPfc[룍e[^_]UWVS=H(thX'hVXZ1;5G(G(sJWVKYXt3fSЃfC{u ЃfCft hWSPXZ[Ƀ릍e[^_]UVS]S^uShWh'؋ 1Ouu Y[19Åt 9t@uu hEW$O ~u}t h1WV!PXZ؍e[^]UWVƉjhRP8m W(t9xu9pte^_]UPhZW1ZY8u"h~WhW5G(hWh'j}UVS@fC5dS(=~D`S()fS(5W(jhhS(EHt F'X1dS(1CPSS(P^u5`S(CdS( e[^]USjjj0 +CC]UWVSƉӉ9tR)yShWh' j%RP6Զ^thF P6w F e[^_]áW(t#UPju uXHt B'kUWVS =H(uu 9uEfftcB1=dm(tf҉jEPWZWYf E1;] }߃=dm(tȉGffG=hm(t?t=dm(uGGG%)ƋOu9rG9=H(thX'hXXZGt=H(thX'h'XYXGW9s=H(t+PRhAXhX'%=H(thX'j 3nXZ?te[^_]USjh F'v Y[th  Zu Sv Y11҉P]UWVSX=H(thX'hiX^_5G(5G(5G(hXhh F'jH(߃uFhPGZYt1;=G(G(r%=H(@ mVZX=H(E}tPuPuS#o uS7o EZY~/9jPuSjSh[h[h'@|EPSDDEPS:DE=G(tPuuuh?S#E PSn Y[ff~ uW Z5W(觖Xe[^_]UWVS}E U9ÅuWuu h[!?hhWi ƃ y@WhPh'o{h'`0= Phih'I{ 1S ѡW(W(0m Nj[Yځ~RQWh @u55L(5LL(5HL(h[h'z0 Ph\J=H(uURQVg @uG5L(5LL(5HL(h[h'tz0L Ph/ah'Xz$jl%W_i VYi XZe[^_]UEU ]U:= B'#tjjh B'l h B'9= F'#tjjh F'l h F'UWVSƉ׉˅ut;5G(G(rWVh\= Dm(RPWVR[ Hm(s{ S$=H(t [$t9{ u9suh)\S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh8\P=XZUWVu} u1tC;5G(G(s.Dm(RPWVZ Hm(t;x u;pt@$e^_]UWVu} ut;5G(G(rWVhY\; Dm(RPWV1Z Hm(t H$9x u9pu 1pp P$WVhv\; e^_]UWVSujj[_ÅtJNJ/t tF@PW3芶ZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P _Zu1,VeY/txtEVh\:XZEe^_]UVSu>k(F@g(9s%)P6S bjj&9tC/vKSh\:XZ؍e[^]UWVS}u h\j:[u蝳YƉ<@k(uE5G( Zu h\3:X)G( @k(9r @k(@k(@k(uS Y؍e[^_]UWVSu@m(uE5G(Z Xu h\9XG(Lء@m(19r _$(uËC$@m( 1ECIDžuQ}u} ujjY_t Vh]@9XZVVl_C[ٸ1Xj/V^Z@PP8C{G C_ Y^Et5uu YZYƅu h]8_E UCS FC^5}u} t)uu ZYt h9]8XًE U7؍e[^_]US]S蠱Z@k(@k(]UWVS]f{t hJ]SG9XZ{u&{t h]]S.9_X{ t hz]S9Y^CS utcRPl_Zuh]S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h]S8ZY3@m(C$@m(Xe[^_]UWVS]E 8ƅu h]Sa8_X9stsF C^ j/u ZYx3WƉWFC$19VP4fSЃ߅uЃ fCe[^_]UWVS`=H(thX'h]XZ=H((hu{s^_u,h0 PhZh'ruh]g6fc 195G(G(rIMWVZY‹Mt,AEJSBPj2U&UR̓1E1}E9G(G(EuuJZYDžttj$GPEP]uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EPo눃EUU1 Dm(9~(Hm(1tBESjjEP,G΋E E̡G(G(EUMԉuСG(G(E؉UܡG(G(EUG(ESjj(EPуC @t,舾0 Ph^h'quh^4SʋXe[^_]UWVS=H(thX'hI^>Y[}uXjj5G(5G(S Dm(jP Hm(_Zu hc^4^jjjh-ufHwjju^ ƃ y,贽0. PhZh':puh~^3xPV_Y[y,u0 Ph^h'ouh^t3EЍXjS XZu h^Q3YSWV] y.0 Ph\h'ouh^3j(PPV] xV^ H(ZPWhxeh'w^Ocs=G(u`he!ZSKt+@H(k = r(t81 r(jh r(~%t̃~Íe[^_]UWVSREhv( dv(`v(9| 5G(1H hv(h P9~ 1|@u5dv( 1ۡ`v(؃=r(t VP+YXVP58J'dK ǃ =z(u5G(9dv(}(~$=H(thX'he螫XZG(dv(z(tu؅y1މm~WG( 9t)P7t=H(tPWhehX'\ =dv(މh'he@L(ZYftCftfHth'h f h'h$f˪_X85L(h=fh'?\ 5LL(5HL(hKfh'\= H(uhS[ujNG( =`v(1=r(t1jS'+ZYy>/0 Phdfh'[jDNjؙRS58J'nBu@t…=H(thX'h}f[_=z(u G(@1҉G(dv(PYctG( PVhe +hh`r(5`v(VE hv(h5`v(uE\r(Xr(@ Xr(e[^_]UWVS8Ã=H(FC=TtP=ltIʁlt=Tt1#=dm(u$=H(thX'hfר_Xdm(t=dm(WȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRP,ZYChs,s(o,^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉCgRPhSgh'Sh'hug__X\r(Hpm(9tPRhgh'Rh'j 8Y^1t&t1Ƀu t@A9|pm(1\r(tm(C J'1҉$J'e[^_]USL(`f@L(1ۉDL(HL(LL(=XH(Tt4lm(@lm(@H(6tK( G(9 K(u;G(ʡ@H(Pp$ 1;H(}0H(t CK( G(9 K(tlm(@H(t;G(uQ`H(DL(H(PL(H(TL(H(XL(H(\L(H(H(`L(dL(tH(xL(H(H(hL(lL(|H(|L(H(H(pL(tL(H(L(H(L(hH(lH(L(L(TH(HL(1ɉ LL(lG(G(HL(LL(TL(gHL(g?e[^]UVSuH(u8jjhVŒy"j0 PVhkh'>%=H(uVhkhX'> ؍e[^]UWVQM1y;5G(G(s!WVZYt xt@uωeY^_]UWVQM1y9s!WVQZYt xt@uωeY^_]US]hShz( z(XZCthlhz(T; YXC thlhz(=; XZCth"lhz(&; YXCth+lhz(; XZCth0lhz(: YXC@th6lhz(: XZz(]UWVSQMSZt$1tH G(r11Sh?lh'$= eY[^_]USuhVlh'<h'WG(HQPy P;YY J tG(Hy PYZ J: tG(@ t1yt nw1y]UE Puh'~ = H(u(hD !pރV׃X9uEe[^_]Љ e[^_]UVS ] }t%3h4VcZYth*VcZYu E'j EPV/E U:uy 3hsTsh4VcZYth*VcZYu E-j EPVڐE U:uyshsjeEPhU5(+Q t hsjee[^]UVS ] }t23h4VbZYth*VbZYu E'j EPV<E U:uy 3hsTsh4VbZYth*VbZYu E-j EPVE U:uyshsjdEPhU5(8P t hsjde[^]UP}FE 0DEEPhQ5(Ot hsjfdU}tjhQ 5(O t hsj1dU}tjhU 5(O t hsjcUWVSEE܋] h~ E^u hsjcU 1E1E9}t3Vh t'aZYtNVhtaZYtAVh*aZYt4jEPVb U:u=v3htj#c1EGEEjh0uhuj EP5(C E=vhP5(h7tE1E܋}9}t}E܋E}܋}]܋TʉȉljщÉ1Љ1 Ӊf11 Ӊ1 SQ5(hUt{EEe[^_]w UWVS] }~j PW5( Rt$Nuj@EPjWU0Phctjaj$pPjj5( EЃf=t RhtXZ91׹󪉍,ƅ8fEf;}~lj 0P3Zƒ 08t3htjaD,ƅGʉLj Vj5(p ƅ9141}u"jhts] u ƅ5jhtj4Pj8P5( <hthX'S:[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5(K @u htj1`E<u 5(ht<u5(hth' ~<tP5(huh'_Pu󥀽_y-`9` CSh'uhX'R9 j 6RZ<h/uXe[^_]USUBBPJ R Ph>uX uEGu]"Sh^u5XZ]USUBBPJ R Ph>u uEGu]!Sh^uXZ]UWVS } 11;]}#j4hduC[ uCPQ1󪍕JƅPƅTJjh'jJRjS5(QjPj!gW,jPjAPjRjVR VRPW5Ђ(5̂(5Ȃ(5(hhu oQƅRjh'hVjS5(ffЃf=v1RLhW7 HLRhW7 LHtmQƅRjh'hVjS5(ffЃf=v1RWhWhuWhILgQƅRjh'hVjS5(fff=v1hu?X1G9 5Ct9C LHD04 h h  {y0L%`vRhu 4 h@M YXD4 hPXZ1ҀHu6C9s!DLPhCyLBYXj XCPShSS,e[^_]UWVSEӉʋ}EE] qtE8uE8At;ˀ}@utQhhwWR"QEPhwWR WVR)v e[^_]UWVS@EU u}JvXuW4 !Vu u.MP @ j@MQ4 !hwWV~xPw(t|f@Phxqf@у@t%wtRPShwWV{TwtPRhwWVZ3f@PhwWV?JuP @ W.X1e[^_]UWVS]hpVjSPhx8{vTh.x%Y {yj h>x XZ,C@tPhSxY_,C t PhcxXZCȅt Phx_X{w j VCȅtPPhx S C h@Vhx|C t PhxfY^hpPjSǃt Phx<XZj TX}it;} } <;u GVhxYXujhyXZjhy^X79tR;U }MuRlhyZY1ɋlhlPhyhAlBXXh2Xe[^_]UWVS] }uh&y;^X1C9~D3PhByFZYj 4X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`uA @u htj^VEtU(<uRh <uRhh' #<u jSRPRh2h'jZe[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt32uBIttyt ut< }]9t` y_v4m tN\ 0H2N0H2N0H\um tf\\M t@BX[^_]U_PhTh' jUhkUWVSÉ֡d(Pd(uhh`(Y_`(hhhW hW _Zuy^hPhj~ <(u tIh`(RPhڐ41X9ډ}Hh(轁 $h  Ԍ(Pjh(}$k;9}4u IP<ؙPh'뜅ut hK hm_Y[ph( Zu9h)j[XZj^Y 1ۉ$^14$j[_Xe[^_]Ujh(r U=(u hLXjUSh6h)jr[h)jf[h)jZ[h)jN[$hhh xVj"hP h("j PSs jh Sf (h(M$h(SK Se ]U/\Phh'#jUWVSыP':֍RD{@u1ҊBuIT8t9s P'DY@tJB[^_]Åt`UVSËHuJs8tCS8kC4`9s `Rt 1ɉK0K4K8CX^t tPs Z1CXe[^]UVSu] EPu36! хx9s)ʉe[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|Shj EP EEEEPhCyj EP UfT ȃP'DJu.D=uURP U_Ce} t EPYuh XZe[^_]UWVSS1}11#tAEtSWh,PShOP @u h!h36W[r }YCuEu#hIEZuh!h8jNe[^_]UYh=PhQPhZPhdPhnPhPhh'k 8jUUYPhP5K'H ( t5(Ph5K'% E Pu5K'( ( USÅtLYZtw8s.@( (ta.Z0x Ph(hS@@( (tZ0zx Ph(hy %u=(uj]UWVSEEEEujj}WjVPNu @u,e[^_]ËEƒUt PhjLMP h ZtjjWPVuu @u ]=0(u5K'uh+ msIM;Ms"VvvPh,E uj X]e[^_]o UWVSEE]EEjj}WjPSYt @u7uFg YtjjWPuS&t @t̓=0(uuhPcXZv<9t's sss sssh9* ՋE荞 kT؋U9u FE1}h(hO"ZYdTEM9Mt?Sjhv: :1;{s֋TM4PhbG ,j Xue[^_]n e[^_]UWVS΋]M M=,(ǃ=0(u=((q)}o=((tEhX'jSVUP}u5K'Rh }u RhPXZ (EH~}tj Yډe[^_]0ƒtot/U׉U}u' r2s4Rhײ 2U׉U}t RShg\ sRhRhFXZGU׉u}}tWVShn s WVhWVh }uEwe[^_]E e[^_]}e[^_]Ã=,(t (URh(4K'h|UWVS=$(uhjj=PzY^X d1Dž\ Dž`hj`Ph(\PdPS\@uډ7=(jDž`1DžNdX@DŽdj`R`PPVdPp @u!aT0r Ph(hȕBuh(hiXZ&,( 0(uPh(hy   e[^_]UWVSSE}u =,(3˃=0(u=(((=((tBhX'jWSu5K'Rh u RhPuXZ (~tj }X؍e[^_]u E rM19}V= (tUPhCyYXUt.= (uUPhXZUBSWhw: NuEwe[^_]E e[^_]Ne[^_]UVS]=(t EhSCY^uEEYNR1҉jEPS EUE 9u%Suh\ =(j<8uQ8u̸]1PSEPuVuum @u1_t =,(1((  (u}u}tPjUEPj UEmY^tF((  (u}u}tMjjUEjj UE#XZe[^]UWVS]=(t rEEP18jjEPEPuuel @uuh/kjTSZ WT u%SuhA =(xjjTuV |WT=P8u|1PSEPxPuuk @u1t =,(|t1p((  (txpjUE1Y^ExURVy EPVh^jduV*pPUEf$tk((  (t|jjUEXZEURt EPth^jd]SjPًUE$e[^_]UWVS(K'8(t f(/((SVZYuVh( e[^_]É)@E̍EӉljDPh(u hh(f uUWVS`Eh(=ZE@!1]M;>r2jPRU薉 Utj@uVRP}0 V3hh[GjEPjh(RU Uu}u7}u1}u+E9Eu#/tj@uVRP 0 V3hxjAAGM1EEe[^_]UWVSVUu=,(ˋ(( (u'@( (h(hhY[=0(u %tDhX'jSu0u5K'Ph u PhPXZ= (~tj XڋEe[^_]1vs9}E8PhCyxGYXt VhdXZE e[^_]pN@e[^_]UVS]EjjEPuVuug @u e}t ShƖj? ( ((tjYY2=0(u ShPXZuuuuuhe[^]UWVS]uEEU E$E@( (=4(J ( ((t}jjEPjuVf @tdMt]QMY XtMMMjjEPWuVf @tM;Mt Wa _j(`Y}e[^_]a }tuh(h = t)tu*Sho uShShCShXZe[^_]UVS]E jjEPuVuue @u} t ShƖj=EUEU ( ((tj sXP 0(u EPlP5K'Sh{ &IuRPh5  uRPhe[^]UVS ]EjjEPuVuue @u}t ShƖj< ( ((tjC=0(u5K'Sh  =0( h uu t PXuuh e[^]UWVS,EE̋}uu<=@(t3EjjEPEPh9E܍Pk((U܉UȉMQMW XۋMЋUuwM1Bt(jjURPVWc @uEԋU1Ƀt();EtuhƖj;uދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhK'uhjURUUС ( ((t6j(EYU܃(t Gt9|]e[^_]^ =0(uuhPXZv$v vvvvv vv6h ,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph{7|<Dž|tWT XuCxjjxPVpha @ult9xt ShƖjc9l%EpuEjj_X=@(t=19|WhK'ShjUR EjjUG ŋ= ( =((t jL=0(u4ShPY[%t huZt4WhIG9|j Xue[^_][ e[^_]ÍL$qUVSQ$EjjEPuVqq 3` @u}t ShƖj8 ( ((tjYd=0(u ShP0XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hSeY[^]aUWVS@]=(t /Dž SXuh!h> jX71h R Y^t{UC18jPSƃ t 9u 'C8"uShc8uv Shtj6 h jx 1PSPVuu_^ @u1;t =,(1ǡ((  (tW EZ)P1<$PUEIVQY tR((  (tj ‹EX+aPb1$PًUESX e[^_]UWVStx|h(1p($@(0Yl@(l)ȉp)ȉt lt|uH1ۋx9t担tIt-uRPhPPCC뿃} t~|PIxvK'RPhPP|PIxv-uRPhPP Dž|K'|K'Ã=4(=0(th@(hPGXZh@(h(h/ EP2w!Ph _X}uC|@0|9hsPhY^P|p4h |p@h|0`(XZpu hhIh`(OhhƘ0pt I6hhIh`(OhhϘh`(vO ƀt2hWh`(POhh٘h`( @u%Pu 1 3#8uS;: Xwjٺ(TjV(TS: =HLjV\`HkIe[^_]UE u@ t]US1]  t=U}tuZv!Zw t Yw 9u@뻃[]US]y(((mt =(t=(tb'ݛjt@j8(SUjh]jfUu uL4 ZYuUVSuV$@PVP裶؍e[^]U(E]UVSË0>-u F0j PV" x;3ue[^]UVS@Ë5H(=XL'tjtSvPZYuFl6j j5SHFS'$PFSh-PAH(5H(F Phtj@]S8Sgee[^]USQtP=(uS5 Z]UVSÉu=(u VS6 ZYe[^]UWVS׉΋]Uu E E!UuU& tI[^_]USt<0„!1=(uS3 Z]UWVSLEӋu>hV-ZY)ƒ?EljDUhTSP) EUDEj URPEU:*u%jjWSRPEP{'tEuj>u E9hTSVC) e[^_]9`L't3UVSRPjuV5`L'e[^]#(t ú(=Ԓ(u(UWVSƉӊ>uuVȒ(HtB1(hg5(V( =(1҉(hg5(Sn( 9=(~؍e[^_]UWVS,E9( (];S5(Y^y#(((=(u`( (Sv Z=X=&wAKw2if*H2[nRf*H2D=,w$==!f*H2=Xf*H2=KwJ=w$==` f*H2 =%f*H2 ===f*H2wf*H2lf*H2af*H2Vf*H2Kf*H2@f*H2 5f*H2 *f*H2 f*H2f*H2 f*H2Eۣ(Eݣ(Eܣ(eẼEfE1E`( 5(| Sj5(=E(e[^_]USEPhht@jT 1ۅu E]u+h_ZtP6(X# V~(h_YtPZy((1ɉ \L'=( (t(0hT_ZtP([T~(h$_YtPZy((=( (P]UPUE (1J$!(f ( UUg{U^ UUۍUэUǍU뽍Uu.f (Uuf ( (1UWVSVhܢ^PL^_ZXL'h]YuO 1҉(Ph (, Y[Ht (t (((ؒ(i Ԓ(` ̒((…y11((((((ܒ((t1(E (]ڸ$j t(H2ڸuI(ڸuI(ڸgĒ(ڸVu(ڸ- Pu}WDEВf(ڸDDuВ(ڸ #*ƅuIڸk…uI=ؒ(uIƉ5(>u  (e[^_]Ë((}((m=(tg=(t =`(uMU= (t=T(u(((=X(u((1҉(]1(á(t 1=(ú(((((US=(t =`(ul=X(u<((u(8t(8t=(u(=T(u((0= (t(=(t9(~j CX]6]Uuj5(* =(uğ(8t (Ã=(uUjXË(((qUWVSu }1+uG}- (ZYEU艁0@4@=(u2j2X=(t!=8(ujt(\=(O(93t;FB^p3VF B PE؋PVMىN r p,@;GiDe[^_]Ë (…t$@(@ ,@Ã=(tGUu3(,@w A,@$@(@1ɉ,@]ÃÃ=@L'xzU= (t,5@L'< @L'5l({ 1ɉ l(XZá(4@uƃ0@u (jhXZ7@t(tUWVSu} (y 9}!Ѓu EU@uG@@E9u9t0E%@؉EPE9t7E;BuE;BtREU$@(@,@1?9ΉMP(@9@}<@.(t [^_]UVSjjZYt<( 9t2ȋqY9t9pp}扲$@(@1,@1e[^]US(u1Q@t@Rg0@4@[ut RPUZYt@t(t]UWVSS(t @t e[^_]rE11E9t/EP@ MA9Ɖ}Ɖ׋EEWVZYe[^_]Ë(,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^]5[^]ÃUUx1ЅdL']US(@uǃ0@ǃ4@|9t@@@e0@4@(1ɉ@@$@(@,@jjj@Bu@ujhoXZ]Ujjju!ЃUVS(0@4@ut@@9} 0@4@[^]UVS]u 5(=p(Yh8@j2(@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@ XZtSYu (@5(5(oXZ(@u@e[^]UVS(@ t4t&9tPQ P X1ɉ @e@uB u @{ Z(t ǀ@P 1(j5(n e[^]Ë(1t@UWVSQ:t<ËBt<;r/HE19u|$E9Zsp;s HE1Z[^_]UWVSR1ɉM1(F*u:Vt3st!dt1k1uUE 0e[^]UVS hIj hChĠ(h(h(h(Ġ((Ƞ((((((((((((((heC1[<=:tjhjq FWZPÃ$!%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu= (tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU= (u~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US](1u7(u'Q'zu=(tL'[]_[]US](I1u7(5u'0Q'%u=(uL'[] []UE= (tE](]USS]uhh@(vzw2SYt'؃@PZu@ShS5Ԡ(S-YtS5Р(j h@(蕣"E@(ySEPEXZ@(]US](-uHM'[][]UU 1}DuЃ=%" ]UWVSSEIuRP^X[RVZY1uEVLXt SiY-h@(jEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhթ9h9ShP&NucjhVNǃ u.h̩P9ShPMu0ShVM ShPMEW@ Ete[^_]UVShک8P99ZYu3h ;VPZY1t=h~aV;Y[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPV_Y[{%=eh<V?VD GShVÈ #jhV  1҉p1ShW脈 t t u@hWYZhWYZh WYZt<"u5vptp~HpSPV O tu QMjZYMuGCQ W _Xu s <ZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á(t);4_'t!Ujh@(P(@ UWVS]= (u((uD((Àu(Шu[ШtSS(%uF (A((9~1Ph(ZYu'1(P1(:Y=(1(=(t 15(s-f](9L_'  PS.Y[@$!e21҉(51( 1((t (8 1((=@(vx ugx V(=@(w1((+5(X{1=((8eu15(Q1ۉ(e[^_]1ɉ (e[^_]a1҉(T1((=@(v6x u0(=@(x ߀x z(=@(w1(1((8 u(8 (s(]1( (h_'y(@(h_'Y[ t9ىM{ RUWh@(F UMuʉY15(zWh@(z(@(_X(8=(t  (tPK1ɉ ([V<EPZE(t(tp@(@(<9s; u Ce_'Ed_'E11E@(9stub}t6E9s-M܉UuuW6 UMuE|1}t8EE18Et < u_ 1EG눅((tP>Xj()@Pv(()RSPĨ(Me_'8uCS;XuS%A (_WA (WY[(M (txt/(Ph(-1҉_Z (((9(si(u,15((1ۉ(pu5(CYd(=@(v d_'8Huh'Zu1((e[^_]e[^_]UVSQM1uu@(EQЀ w[jjjj uuuVtjh#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1(9(|@(á(t @@@ Ã=|(uUj11ҸÞXUWVS|(t`_' 0_' (1bDž{P@$j辿WPvVDQ8QuZhV<XZ$fSftxRPZYx,E%=ufSfthP蜅 YXh6%Zud PX~P_'1Ƀx tA _'x t tlphhIS|1ɉx =|(u:pl)ыt)PxjjxPoh SSWV( VW XZe[^_]ú9(t9 (t 19(‰USR@(t>BE@(RXE=@u$(t t7tut g ]UVS=\L'u=(t =`(u$t/((u ujjj5(RP*V P(u =\L'u>5(((1҉(u 4YX5((e[^]UU]飪UWVSt eYƉׅt‰@(D((=(u0t;5@(D(}jjjG 1((ld2t8e[^_]UWVSVEj)ơ(u(ǁt#tj11u|%(Su5(á(ƒ(( t?x1 rjhCFY[t j0j1ZtՅtVk1V(Xe[^_]USTá($N   tw #5x(jCP7tW6%I/f5d(S5h(5l(ߟ1l(?E4x(؋]a((PSy<+u C< u(tPZ;u 1(Se(X5x(jPCP9=|(S0X]q;!t(tPXS5(Y=|(ui(uhUhIȀXZMhUP=|(u>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉@(YYu@( ыuUS]t CPX]UPGPEEUWVS@((@(e=(t1(/1x(|(l(=(t[=(tj3_@(t x@j荭X(\(苝Yu*P:t!u5(BZujǴ_=(t*p:t!ku5(AYuj蔴Z1(=(un1(=p(tjhƪ訣[1p(:at h0耣Xt?uhj:Ģ_X WrY.=(weu:{1d(1`(&\P菕Zze=(+ej(/t.7iCЃ .jSP_Zdteht(x(|(^=(t1ɉ (_=l(/uyd(u_uh`(ƒ@+t t;!tA-Ҹu u ‰d(@@d(3=`(l(  =trSZH?E|a<h(1EЍEPEPEPl( tD,EĉE-=h(u Pw P_ E@Ƀ}}uEЅEPhx 15`(Y=l(Sl(YuS艒EЍEPh6Ch(d(Ht!5d(hI5h(5l(s 5l(MZt5l(Tj1ɸ/&C$ !*t@tS; u݃=\L'u ̾J5h_'j+Y =(t)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=(i j1ɺ =(uEtEP1Z9tP(`(L((H((j(Y{j8(((1;x(|(|x(1|( ( (((1;x(|(|x(1|(sx(15(Ѓt+Ѓ$5( t (1;x(|(|x(1|(ex(1.5(C1FP踳X/b"'`(P(15`((L(1=((H(1(hޡ맃=|(qj 4_'& =|(M5(6h ;P衺 u jhF5(6YtjhaXZj _'@5d(ѣjPx(19|(|x(1ɉ |(PZ jh45(V1_PrYt VV1jPb1d(`(j1ɺ =|(u) _'= uj}=|(jh0 @j1ɺ;_ ƒ 1?PSmp?Zj1ɺ>^ ƒ Sp`?lj1ɺ 5LY ƒp glSp"j1ɺ%RZ/ t u.S}o_D(j _'% j1ɺ!^x( |(19}H((H( (‰x( |(`(EƉ9Љ}5x(=|(E)`x(|(19}H("H( (x(|(`((1ɉ `(``(XZ=(tp(_UE= (t@]US]SjšZY19} B]UWVSu}t UE  u 荲ZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:= (HE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt Q 蕌ZYUWVSSE utPeYtP}tVޘyhEP_Zthթ-PrZ[uCjFPQà u us=(tjÃut[UEPhLF=t3t. tSDEEPhr諈 ?Bu@uEEPh興XZ]UWVS] EPƥƉ$跓NjE8W该NjExZY11E@9scuSt) 39s"UVuS軦 Uu \3/t 18d_'18e_'t < u 1C듍e[^_]UVSu] u SZ؋V9s 8u@9r1e[^]UUM uB 19 s A8uH9s xt 9sH1]UVSuV"Yt迳ujV"XZe[^]US j]S،XZ}u}tS5(!a`Y[²5("Zt-5(u5(!PSj5(0"1(((((]Ã=(t%(tUP"Zt 5(Xá(tUjP!XZ(á(UEt jP^!XZU-t P脀XUS]yjST ZYxIPU Y=p(u9]EPhYZat5DOtAt Xdt{ouNhSK @L'XZFj S_T @L'jjjPޒBu'@u$5@L'U @L'Yjhy=@L'y]EPh?'XZ]UWVS}9=(tQhƃ=(t1nÃ=(ttV ZH V 5(XuV~[1WmP`W Éh t,DždW! YU`XJhޡ`讣YZ`Xt9hTQ董YZt(hPdP`qà tXh ;`SYZht!Dž\Dž\u(dDž\hTXYZuDždDž\nhޡXʢYZuDždDž\?XOpZt9pPh> $p-VWhڋ`jXQ dZYyJ` {ppPh> pVWhڋ`d=l(u WYt Dž\mdj Zt䋅`ppPhllZYYtdQ VWhڋ` X1ɉ\=l(uOdxEP腇Zt:`xxPhсVWhڋ`t 5(ViX=(SWh5(5(h(5(n(\dJ1ۉ($1HPTH;((xPlPTP0IPTTu PlLXb'?txLRDSr*ZYƅtVDR$ߋX9Lt~ ujhS u C: Xb't 1҉@H\l(t=(tPXh ;X^^_t@xPX6Y[u(EU((x|(((tPh@WXZy=(tu荄 L:1ۉ`(hޡ`Ȟ^_t:hT`貞ZYt$`$jP54_'S?=(tuQ`#Qe[^_]UEu1E5(PZYEU5(YZtjh®~jr h ;UWVSSÉ։M}uSSYNxuSLZu(uƸe[^_]UU(]UuQ1(jZUU(]aU1(jUVSu1SYtPZ9u]e[^]e[^]UWVS}WhWWWmtAuu$1҉u#1҉tEe[^_]e[^_]UWVSËu t׉SW W, ucSZY9uuj輈XV@e[^_]UWVS]vESEPG[^11VEPZYƅtcVEPEP 1WEPZYDžt.WEPyZY u5('XunXuc_닅uu_;5(SY^9(u uZ1u[X]e[^_]e[^_]USÃ=(tS$X]1Ҋt%uH%u@suB@á(u*Uh|Zt((UWVS jjd輇ZYEdNy VGxX P tStN)EH9|=MMMjuiWPEB>WURSU׋M Ce[^_]Uh)ZuUWVS]S$@P_Xe_'8u"CtZ d_'8uC8uICCBBP辗Z;t*tUQMWS MUuBBCe[^_]UWVSu9EPc[E11EtSC8e_'t18d_' MUURPkZYMt}tEEG맃}t1ۉ]utVYXjSԅE_Zǃ}tKd_'PVe_'Ph8SWU3SP\kY[tuWm<EXZFFGuEe[^_]UWVSRh4P'Y[unVXtaW6Ɖ$,T$RUSh?WhBURPVT S諽h<VE: EV藽E h<V): ZYe[^_]UWVSuu1k>tV誕_u 蟕|$WXZtu hVh{ WSS}tjSF Y^y SZPG X؍e[^_]UhթjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'(<%t(tRFPޔY^CGjCSȃXZutKH݀u=9us8Ft38Ft1 (<%t (tQPSd:S~ÃCFe[^_]UWVS]S臡^u1jjjSGBu@thVS\E ~ˍ19= (t)RPZYu FSWk_XSjWƒ =p(u9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=|(!8u ;P^hTPEZYUtKRUƉ$YPےkL$QMWd_'Pe_'PURh]MQVP$WIXUV肒ZUtRhtP%G Sh#BPVt'iW ; Y>u VܹZ SӹX؍e[^_]UWVS}1ۃ=|(u\WX$SWh|SP/PVuPǃ VP迓ZYu SgY1W^VXXZ؍e[^_]UVS]h ;S腓^Zt(hޡSoZYthTS^ZYƉe[^]UVS]SYuVS# YZu]e[^]'V!Ze[^]UWVS u=@(h|(Zj!hTY_?|uC؉E-uEh ;V蚒_ZEXHtjhs[^VubƉ<$XT$RUAWuURPNW VзYtsfGftjEPV3A Ht-W8 ZKtcu_E18E hT~XBEPE8E 0h ;~Y^Wd8 Z;u S5X1ۉ؍e[^_]UWVS}u =|(j蟒hZY~1E Ee[^_]qVWSE4$E<$UMT$RU}EWVSURPM$WlVfE@uT t]e[^_]a7 e[^_]U|EPu` XY1xE%=@UVS|u=l(u1V[t&V,$P}VP3hb'\|PV ZYy VhXG1ۃ=l(uu!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+=(u=(u D(u$Pkd(RPWVWVځƉ׃WVʼnZYuu؉}ܡ(Eut u EU<uu uuqE؋U܉EU9uE}}(!nEuuP)&ÃEU ~'=\(t(} t} uEU' t tؙ)]Ur'   E(Em tuTi'}Ɖׅ}t(`(EtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉU( t uΆƉ1ɉ (E\(Eu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI=\(t' t u}tƉECuЉ}E}t =L(tƅRPj # j}]!Su%uuwW=D(t&WVuuRPE؋U2=(tH}tBy u(t t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1=`(jjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%=(ukd(9EE}11S D(uEU)juuRPQEURP[^y=(tL,'83 t u, u(< u@)( u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@(Ey} u#"Å>H `(-CMڂRPu à Hu =`(~1(u}E=\(u~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ=\(t!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU=D(tWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5HL'=LL'4@w Hr5PL'=TL'e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S=L(Ee[^_] pWV9EZYt1E Ee[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuE()HP6WVƉXZutE21ɉ ( (E)SjjWV(HPx(H9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2=(uts1(WV]jjWV(HP e[^_]UWVEU EURP)ƉYXBut1WVYZu$=L(t WV XZ5d(WV hM9ȸ}|6Du-5d((~VRP[ 1ɉM Ee^_]"XEUEUEPh?XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjh]W^_~}Ɖס(HP[Y9u9u e^_]d0o\WV (IuuQjjf *QRPY(HPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃=L(t WVmXZ]u} e[^_]|USZtjhxVXZ%q|9} (IQRPa ]UWVSSEE] wBu@ujhV~ZYwƉ׃uu1E Ee[^_]VSuWVO9| 5d(RP e[^_]Ê t u@UWVSƉ58(5,(h˰hSM1=wWV)RP114(SXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPhٰjR,'"j PRM 9uIN; 0(<=t#; 0(|:j; 0(; 0(9 0( 9 0(҅5-,1 v#u t|\u@r;yj=SAZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=tIz;8F1< t#uً1V‰8u$I t tu䋅t3RPmYZűPPd(8u‰2ʀ‰w8t1lߋ1MWI4(Ze[^_]Ë(;(~~( ,( (‰(US(X(0(H([]É19f't @uUP?kYt(t(tܒ(t(UWVSd(UjS茍EjS聍}tUuuƑYXtP5 (} ljE5$(5$(苑5 (耑E (E$(d(XZ1e[^_]UWVSÉ։9d(~ ($(< +t[^_]UWVS׉ˋ5,(V,(Љ[^_]M=(tt*ttt t XÃ=p(u[USjm5(=ZY&t:t1ɺNC=Э(tt1ɺ*C]Uh(PUYZt (qh(P0YZt (jh9W (jh(W$(d(h(h(h(h( h(1ܭ(ZU1}]á(ĭ(U((1(1,(9((~" (,($(1ɉ ,(@1(((ȭ(((|((((ԭ(Э(̭((ĭ(h( h(h(~h(~h(~1҉ܭ(UWVS=|(uu uqƉ[X11D( (u=|(u u$ZYt ̭(@;PL' TL'9U] |%!ʃtM9 HL'LL'U | ̭(@=D(ṱ(u a(9(h1Ҹ WVY[u1ۅtj ]SRPlDSeÃ1()9~1Ҹ F19tD5ݺF1Ҹ ((e[^_]áD(t(=|(u (DUS((9,(~$$(<u (Ph(}XZCԡ((,(((]UWVS]u }Eu@0tj$zYEe[^_]d= (tWZ= (tw/Py_uS[ۃ,(~K1S ~YuSW_ZV$(t-fZYu,($(DVe_tW,(uVd^ƒt (V$(teZYt t(t(t(Ӊ؍e[^_]UWVSEUMЃt(} u}u=ԭ(tG}EPjEU RPu ueu=(tV̭(tM E@(D(U#U ;E} „t!؃tEU @(D((]=(tT1ۉ(1ܭ(1k (9{~%8u u1ɺZYGFu1ۃ}tO ( ,( E1~RjEP{ ,(1҅~ $(TRPuuCÃ=p(u}u9EEEE55(+5ȭ(E;5('EPw_`(9ȭ(uY=ĭ(u=(uEU (ĭ(1=(~+9=(~(81ɺ>Gh(yY19}E81ɋUG`(9ȭ(|1}uEPh(yXZ((9,(~Չ19((~= (   $(<<@B)5,(ȭ(ȭ(9`(}1ɋ(( Kݸe[^_]UWVSƉ׃=p(tCP`[(+ȭ(-;(~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ19x(~ (t x()C1[^_]UWVu} =p(uщu} 1^_]^_]n,(l((h(ál(,(h((UU1wR5(k4ZYUS]1w%SZ1uS5(64ZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;F!9tu&ـuH F!uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} (E=p(u#=ح(uSح(Zt ԭ(1(ح(_SPEZYtIWVM^_t Rح(xt Э(Sh(%vWVMZYu5ح(O1ح(Sh(uh(kܭ( (Pvh(Uuܭ(@}ܭ($ (`(9ȭ(}%h(PuX((=`(9=ȭ(| ,(,(؉ESjEPuU$ t9r)ډh(t5ح(脄1=ح([^(t (uuu} U,(~7;((  (|t $(D0te[^_]uuu} 1ɸJt1tq (ЉERj]Suƃ  (E9s=)У,(RjStNj$(,(?4WtV)(~뫣(z},( (= (u(P8rY,( $( M9u3_u(t M.(t EMMb_uM (UL_uGMAt?S~tZt (E*,( (PqSPuE u1ɉ ( (t =(uuu} U e[^_]g(+(4g' \(~9|0g')ș);`(}sd()WVuVf'SXZ1jjVsP u뾍e[^]UEo1҃t f']=(t&(tUSJZ P+JZ HX[]Ã=(y-U=|(u (1|(jhش3ZYá(xW@d(UWV1ɉ (5(=(+9Ɖ}jh=4(XZe^_]ø( @=(u1(((((((((1҉(((((1ɉ (UWVSEEE E}M((t"C 9{}E9Cu E9C֋s(t ( (1҉(pxH }xUPC=6/(ub(xHE0u(t,puX9} E}EE}ًEǀ}t E𣴮(‹ BA[^_]ÍL$qUWVSQ QEU=|(t E]!؃u 111}9Uй5(FV (t]9؉׋]}69Uu9Eu N^})((1=(~GW (tBN^ M]M])ӉM؉]܋M]+M]MЉ]ԋ]9]؋]܋MRPW[^$O_w E9ƉU}XM]jjWVƉ׃(M]t u M]M]WVSQM]]9uEM]uu#WZYlN^~ v9uE}RM]jjWVƉ׃(NM]u M]M]WVSQM]M]1(ȉڍeY[^_]aÍL$qUWVSQQEU}9}(,s{(tE9ƉU}9}u9uu CS K(tEU+AQ+u}9}cq qMU[^Mt qyAQ ]9މM}jjRP(uʼn!уts sqUZYus{CS 9u]}0jjRP\(r!уeRPEUWV#EUeY[^_]aUWVSQMSN2ƉOEUXu$ux9(~ CS!2Ɖ܋u}WVY[M9u M9ueY[^_]UWVSjj{T^_uxjh1.(ZY1111҉1ۅuuRPEUWV;EUjjRPp(u uu1(e[^_]UVSEU =(t5(9|)11[^]USZKJy ;J|< t Y RPZY]UWVSuE E>-uF"4Kh'V'hz' Ej5YFR&jh~:t>u R^8_UV輱Xt̋URU&IÉ<$IL$QM8*WPURhBMQSB Wp_usV7YS Sxpj uU u jTj;}t&uA&h 7&*j %% E(uGX1҉Ue[^_]SUWVS]EEEEuu QZYt jhhSa YXujh8*XZ8Ih%S%h~%oDh$j:jSjj U}u}uCPÃtNO@u,E UM;M MM|E UƉ!@tt t OÃuV jj UjSj:D(j`Re[^_]UWVSu6EU_}u }tcj-Ɖ[u u11j-Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k (GPw'k (1('t'(#tUEEPhK(YX1ÉUS.w$tX('^((1((( (tPgmX1 ((Pt jh]g(N ( ((((jh(-(( (Y[뉉txux ujhb'XZ1]UVS (1۰#4t'5t C'Ca1ɉNF FFFtPlZ1FC6ue[^]UE]UVS E%tYu EP,UEY^u uB2M5(sS CKCtPkZ1C(e[^]UEt*xu x u]zB@ @(]U Su]jEP>,UEYYut@ ( ($(((E,( (tPLkZ1 ((UWVSPEf=(uJ=((uA=$(u8((1$(((d(,( (tPj_15 ({u#j;PsiCsj1ɉKs {SC;(u RWV UPGZUte[^_]UQMt(9Ptjho.%XZP@ UVS]u (1k9$(u$90(u9,(uPa~#4t P'@5u1҉[^]UU19$(uǀ,(ǀ0(=u]UWVSu`[1((t:P葰PVC uE$(((ji1҉((YS[iXue[^_]Ã=(UWVSu hIu ( C Suu0(ue[^_]j }WRPsu s蔾Xh ;VCZYtVWsPhu7UWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=(E8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtPgY1Cu>/CZe[^_]USE] =|(t1E EtS.l(XNt1ۉ] Eu=@L'x1ɉM E͵^S-ál(ZtP:gXS!P]l(S g5l(]B=@L'y1ɉM E]!l(EEPh!XZ]p(s'x$Ujh@BRP(RP?d(USEtzE 8.MU u4@E Qh] R%s' }t jh}Qh] R }t jhkd(s'as'yd(EEPh,>PhNj ]S}S!>~P|0uD]EPhU XZ]ás'x$Ujh@BRP(RP"H(USEtzE 8.MU u4@E Qh= Rs' }t jh{}Qh= R }t jhkH(s'as'yH(EEPh>PhNj ]S`S=~P|0uD]EPhŶxXZ]US] }u!jS萏YZt]EPhBXZ]US] }u!jSXYZt]EPh XZ]UWVSUE t tP]+0(^w=|(t1ۉ] E*e[^_]P*PzPMRZYt]e[^_]ݠPƉ׃utS;5d(WVe[^_]USEU tXtugR*s'YYR)ás'Z=s't tP*cXSPMs'YX]]cs'EEPhHXZ]US] }uC=(tS3*(Y,@(hsSsXZE@]?s]UVSE]  XZe[^]UEut(E]bF]U}u]A]UEtHqjhW{hs'qh g P\h]RhtHhs'9 s'xu!h(h׷h h/hmhhָ1E'US] Ed @~@B<#w9$F!sknutwB<w ƒ&cUEPhK D=6/( ! =(ut1ɉM E"]CSPYZy]EPhIXZ]UWVS EM 1҉U9s; uC19sR0< wIMjjjj ERPEPPEjj0RPERPEPOU C8M명uE9\(}`(F; uC9rtC;,u[t54g'\(+X(0g'e[^_]UVSDu] t!S6YE ]e[^]hcSXZ=4g'~R954g'~3t h SX YXS6Z4`(hPUhF S6$nP`Y^Sx6Z50g'hyPhPh> e[^]U EU tSuxud_'e_'bJtzt1ɉM Ee_'d_'7e_' d_'*e_'Ed_'EEEEEPhWXZUS Et_Ejh;EPEPu F]h ;So7u ,(Du>,(E((*,( ;tRRJYEEPhXZ]UEtHw1E EϹ]x(]U}u= (u]i1]S1]UEu=( K(]UEu*=(~!EEPh(XZUEu*=(~!EEPh (XZUEu#=(t=(tL8Bu @u]]UUE t#u?s'^u2@t+s'!s'PHEEPh<N US E1ɉ ( (E 8,t)EPhE P }t jhV3(E 8,uf@E EPhE P }tjhnXZ7(05(5(hK j]SJ]܍EPh]UVSE] F1 RD+~vQQ r/Qd~ wG$8G!t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh1CSPi(Y(E sEEE sF@tK@sN@ sR@sW@sY @AuU9uE-EUEPhXZe[^]ø=`(u=( 1=(áh( (+(UWVS }8uMEPhӺY[1kÉUP1$@PƋUXZt@=0(t\u Ct C$t!tˆUPWtZYUtFVC؍e[^_]U@u0hj*h`(0Rhj*h`(`(ÅtÅt%UEtURPXZUu6EPhh(a(UU1t 1BS]UULDt B tB]U}ou>¸u1]1=(U(EEPhӺZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM(tFPtu)QjP_XA(ZjPEPH 15(1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr@(j+UjEEZY];+u$(tPU_CP(YSJfh@ fXZEn=(tz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPh3@EɅu&M}EuPh]}XZPh1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u(9{jQEP C]tSjZYPSSXDe[^_]UWVS ]u }翅u jhŻCu@t:EEPhԻlusEEPhJƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjh 5t)u9EPjEP }uSjh7 Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjh[X Y^jCtF XZtC t(te[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á(=(tUShvn~P~Y[u (@g';t CtS C t jjSXZ$ۋ]UM@g't9tBt 9t$1҉]UWVSEE1EE111E@g'>~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7'Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uh|YtP2 Z~s'øUS =(u[h( ZtL1(E܉EEEjEPje E9(u(ۃ`[((;EMMEEE=(t=(t=8(us'=(ttPjEP EufE=(u);P=s'9u (&Pi^Xʃ=(t ƒftըu1(uu u à 1ɉ (=(tx*It 1҉((@(~+jX!/68h!68#ZE9(tt (؋]Ujh(s UQEPOEUUWVS50;Tu%É4$%|$WVuhWP8؍e[^_]US]S TZuShh(pV (]ÍL$qUWVSQYq AQEU}WRPq1 ӉщE؉UM܋EuƉeWuuRP u؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEP XZUSs'@(t,s'@(Sh@(5s'l 9t (]UEs']Ã=((t 1((B$U=s'?(r|s'Ps'M1 (E]UVSP(t (E1$(EPSXZt'u $E$(XuJ$VoYC"e[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uMQWVRP EUKEЊEUu҅u΃}yC-YSusXZeY[^_]aPUVS]1)EM}IuyA-NQu XZe[^]ÍL$qUWVSQ ȋ1I@E1҉UUUEEPЀ wPPwP PwMP9UU~BMjjuuuu}W9jjEЙRPuuW8 ]F8M뎅t1ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPPwP PwLP9UU~AjjuuMSQuV-9jjERPERPV8 E8댃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPPwP PwJP9UU~?jjuuM1SQuV8jjERPE1RPVa7 E8뎃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%!hWVSjubu Z D((e[^_]U4tPw @rP:UXUWVSu} ,(cuWV3XZE e[^_];=4(uldh(WVhs'T(\S%g9( (e[^_]WUEU E IEI]UVS]u Tuu ]e[^]s'P1ZE E؍e[^]\USQtu u>31YZt[=( (j ZQujA X؋]UWVS]uE %=(u>t>S$PhPj jjjSPh$9t|V2CXsuojjk 1=(1҃=t( PSWjgt"WB_}u)jh[^tP[ 6BZY>1e[^_]US]tPr[ 3BZY1]U1}]UWVS|}ue( u ZE E(x9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWu躜ƒ1Eun؍[|yu19E E H]9}/3{yM j5(ãD((@(_XZutE<Éte[^_]UE(yЅ9~H]USXH:t t-.t?t\tBJu xtݍX؉É[]UWVSPZË=l(=(r()SVWW߉=l( e[^_]øLDUWSPYu"ux(H9~CSލe[_]e[_]USj ]SRP]]USj ]SP; ]UVSӊPtbwWDsMpPjt2Bt#bu6mttt"5d(YXe[^]Uh K!`(X I!=(uJ!Pd(h@J!h(hI!s'hI!s'h\I!s'UWVS,ul((>u$I[<:N<%<.uFu!1E1ۡ(H9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v -V-ZY1CCC ((((e[^_]Uh(XUS](-t-=(ujhXZ]1=((E]Uh('XUVSu] <t1ٸ(t;pX[^]UWVSEUE|E x(p+l(h5d( duu8EU =(t4 (ș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1t(ixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x=|(t )ؙ1)=~WVuuuu [Zt}뚃=(tEPEP5(轮t (t ] (t (u=(t =(tu=p(uSuNPEjEURNESEPuuuN((Eu0((9EM|!ЃtE;(E(|lUsjjEPEPR`us3^$`t2EUEUu}9uEbU(P[uC<ujj]SMQuu5(5($ EMt%tEUSQuuMM}=(u(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ `(M1ɉ `(M)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E`(`((}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xus&uk&[^}t}EUW1ɉMuF&u>&XZu(tWsS$Zjj1CCCj @u]e[^_]N$(C((e[^_]U €u1=(1]UWVS4u}((EU((EԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUC(Eȡ(E@u}t0E9ƉU} !u((]9؉ӋM},#u kd(׋E܋Uuu  9}%kd(]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}kd(9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU (>MjMQjujuWVY 7( (EUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEK((!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEU((EԋUأ((]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU1(=(u]]USj5L_'@'YZt4jٸ(Zt =(u=(uW1]U=(u ((((]|UWVSU EEt :DM@RtE3( s,jh=E"u jhHt=(=D(=(1ɉ (E]3Ɖ׃u}5d(P"ÉXZe _=(=D(jh\_XE+j,^@=(@1ۉ(.EPM(Z@t( D(j1(X=(t =D(U.}Ɖ(u1Ʌt1(H'uM@uu5d(cX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; (| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujjjK (XZ=(t UE]Uhwj  (jj=(tU}tOhwjYX=|(u>Pjhjjjhgj 2jjjjjjvjjm jjaXZUWVS(1҉(tkjj3j(jjjj wjP $h>jjx( tD=(5(X(9=(u9t@(贳̴(t=<(tjXe[^_]UWVS E։ϋ(SRUp$EuUR u.{tUM tuWVޢC SXZ1e[^_]UWVSSE։jju$@PCuPės {E C}u1C%u$@PCuP膗؍e[^_]USs's't%CBs)s!S 1(((]UWVS5s'Yh<PŴZ1ɉ ([ÍhV  R!tSV uNJ< t< uvZ8tPt t=_8dPjP u1wHx^u Hȋt.8t&\uG@P9tWPΉ1Ҁx$‰uH11WQщ‹ds's'Ps'(ZYeX=(ts'((1e[^_]UWVS ÉJtu i1ɉ (us's''&hnbDPD^ZuLK!S5WYuZlj4$$L9QfVh}P 9tVXh<W菒 W f;?SYSjjщ‰s's'Ps'( VhP th=(t'tVb XDPt_t u Ƅ@t Vp [ uP' u'DH@ZutfLH@tCu) ʍLHt@u C@tC fLHuDPttDP@yumDP@tG VDH@dBVS Zt1(((Ps's't((1e[^_]USs'hSZYuwhSZY¸t_hSZY¸tGhSZY¸t/h ;SZY¸tjS* ZYxP X1]UZu E6 ‹ENt HujhjhXZÍL$qUWVSQ ("p xutWV ƉY[jj講EUXZ(uFEPEPWVĕE؉U܃}u}tEU}u}ujhQY[=|(tuuuu =p(tEUju{7P7ESjQjEPuuS7(EuSXZEЅu u؋}eY[^_]aUWVS( (]11~1t2s't AFKމt ( ([^_]UWVS( (]11~1trs't IFK݉t ( ([^_]á(á(Ë(tUrLZøUjx Zujhaa蓚 ZYyjP~ ZYxU(]øUR~jEP5(U ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPZ1CC]UE1҉P]USUBt XZL[]UE]UWVS}wSKS Kr{3[^_][^_]UWVS]E EC9C|WƅujjWVRPCPt& HP5w'P^ZtbShV  Nh2 P#^Zu @׀8 uSYhP#ZYt @׀8 u SIX8t%8,t8 t@Ћ8tH5(R8(PY^4(t SZ@8(P b*ue[^]U(jjGXZUhUj4x(XZU!(jh`(l `'Q`'y ;p'| tX'J X'UhX'P耧XZUWVSREƈEj}W5( $ f=x'tk1x(5x'N jW5(Ւ j9 =x(t.VV"PhC Ktjh@(5(# 럍e[^_]USQhZ趨jj jju ӆÅt4EPl Z9u5 h`kjjjj]jjjjx'j/S;6څtPjRSXr h'hNHhej h'hN-hqj USQjh'5(虐 f=\x't# 褝XZDu&tO t E`e[^_]g_D1҃tsR4 t'PhPOuUWVS]S$S5( 1ۉ(jh-5(蔍 jh(5( ƅ jP5(^ jP5(J =p(t!Ѓ uh(jj h`(+g $rjXZjY1=(u=jP5(ƍ =p(t"=(u)uR~Y_uՊt< tJ< uf=|x'tFVh蝛XZ)9=w':WPu  9th;_(VPu ܋ 9t h^f=|x't$j+$Ph h`(jjj jh(5(y SjXZu 脍 Ye[^_]UVS hVh_ P [th脀Åyh;YhVh ‹ tP j S> }Pӌ hrj ?5|w'Vjj $ PQe Z9t<6j z j Vh=|jЏe[^]UWVS]ujh-5( 1(h;jEh(jj jh(5(ۊ t@t PFX(f=x'tjURP訊 PC jش _XjEU^111ɉMKy SҸZ PE=(@7uf= y'tq`ƃY y' u fuDE 6 u, fu'f=lx'tj ^EEu ft PY} tf= y';f=|x'tGWhXZf=x'1x(5x' XjEP5(n x( (tt hK臟Xj _.=p(t#E x'9uj Y< tf= y'uj Z} u*jƉS趵ujtf=|x'u>E tPE X+u}f= y't WVh_WVh jh(5(} h`(jjK e[^_]UWVSEhVh^ 'jh-5( jjjjh(jj (jh(5( T|à yhX11ft#jƉXPa Y9tGAj5( j jjjjV# Vhv͕jf=|x'tjy)RPh}jh(5(, h`(jj jj jjXZe[^_]UWVSEzhVh 4jh-5(跅 jjFjj=h(jjs (jh(5(肆 zà yh補X11st#jƉXP` Y9tTNj5( j5( j jjjj$VVhv[j脊f=|x'tj)RPh jh(5(躄 h`(jj jj; jj/XZe[^_]US,]S5(׼hu*UС`(uUУ`(Sj5( h`(jj ]US,]S5(ihuU؃%u ESj5( ]UShSh S:Ew'[tEw'jhֺ5(t Ux'tUx'5x't5x'5x't5x'f=\x'tzx't$x'f=x'thhqY%y't%y',y'D(5y't5y'jZEy't$Ey'f=Ly'thh|X]Ujh{t 5(0j軭 jhzt 5(US]e1uVjPƒ XZ]0US]CCtu P$ZYt1]UVSEhPZYtP ^yhȵ[PhhP豏 ƅulx'u蓃 $臃 X軆 Zo $c 1ɉ $Ph?SSb j1u*hX& X X1 $h`(Ё à XP[ Y9ut th'hXZ댅yhIuxuPhuPhh'B Cƃ`(_(8 u =`(vH@`(e[^]USEjPh(h uxh(hhP (yh(hZY?hSh t h(X5|w'5(S ]UVSjPh(hq h(h(Y[uE#e[^]NHu ((5(hhP- Ãy5(h8XZ+5(h<hVʌhHSVe[^]UE"jPh (h uXh (fh<P̑ uh (hJ賍XZ)j5w'P f=x'u(Eȋ UVSjPh(h\) h(h(Y[uEce[^](Hu(Rh<Pà uVhJXZ@(f=x'tPh{PhhV{Vhm S! e[^]Uh'hjǂUWVS}<1ۉ((x(%1u~11Ejh u'hdu uT =(uh'h%*jFt&`'FtrE96/ kU DЉEx(뉃a$dK!nEtPt=,2WYvhZ?95,2jhDBV jhIBV hsV^Zƅhj ,2h SZYkhESnZYLhsSYY[Åh뫡,2(,2(Em=(t hs,2j/RU轟YZUt (5Rh h( EPjhjjjj5,2x(U P5,2hRqU D(tehEtMl(p(@(=(1vldZR'E)t8HuR}t hKE h?RUYZUt("l(p(@(hFjkhFj_hFjShFjG 5x(hj h(談h(u h@u hjhX'* VXZtKth  hEhs& Xt 1N11҃=(1x'Ly'=w'1ۉ|x'=D(t ,y'=l(t5x(9 Yu.t hj=l(u"5x( Zt5x(hj e[^_]U(jh(R U4hpjEXZu5EZt1(=l(u!ujYX=(h(5R Zu+j t X=@(tPu,y ZY(jI Y(yuh> XZ(V=(IjP1 XY(tPy Y(URPԯXZ=@(uM@EPj5(- jh t 5( jjYX1}UWVS]=8(uh[ Yu h j h> Zt8/t P|^xv'|v'#Shtv'EPƃ 1҅=(t7((|(l(1ۉp(=x(u'x(%;/u%(jS ZYtt(t t u!h`Sh/k^_ h?xk[j{v'>uUVQP Uv'Euԃ=x(u hx(hחP @u x(%ht(hu @u t(=p(xj:hu׹ lj=p((uSh!t$=(u(=(u Shj2 j:hu| D(=l(u3(tp(tR5(ZYl(|(j:h u t x'j:h u t x'j:hu۸ t Lw'j:hEu軸 t1Lw'j:hf u螸 t \x'j:hu~ t lx'j:hf2u^ t |x'j:hu> t1|x'j:hXq u! t x'j:h=f u t1x'j:hu t  y'j:huķ t y'j:hu褷 t@(j:hWSu臷 t Ly'=X(u X(hv'=d(u d(`v'h(t Ph>B^_`(t Ph9|Y[T(t Ph fXZ\(t Ph~P_XhP(h u @u15P(hL(hnu @u1ۉL(hH(huf @u H( (4(8(4(tj,S苖ZYt@(4(؍e[^_]USPhh'τShh'迄jNwU=(th(htjM j 'y1Uh'ޠZuj=p(t!á'P'=p(t!Ujj|(hВLjh (gK Uh`(jj Uh (jj U E E1ɉ |(hͶjSEXZjjEEYXuh> XZh (J YtnE sujYXujXZ=|(uXE M9Hh'蚟ZtU < tU EE9sE @E 'xˡ'P'UE Mtt @8u1]UWVSu((FVtI)~@t8u\Q ^@P u f^?봈@([^_]UEP^v(^?<tP@(( (((]UVSEPh)v~XZ@t';t[Ct =(uGw'PPh.C~s Ct*PZVQPh2~ 렍e[^]UVS,u]S5(VS| VSR} EԀ€Uԃ=@(t̃Ef=Ly'tMẼeewfEf=x't %‰USj5( e[^]UVSuU ]=p(tSRVm y@19t ( @8u hAE{e[^]e[^]UVSPw'EÉ(@t't68u-Fu#EPPh> |SV1%tك 8]tjEP5( Íe[^]UVS!S 9X<uY8C L{ t VWȹZYtAEPuWjYV;C Zu h+Xc9s ts tC Ke[^_]UWVSƋT(C!wKT(XT("8`'H`'y;p'|X'PX' hX'j |Y[뵋>WZÉT(F<w <tj<t<f~ u=CT(`'H`'y;p'|X'PX'!hX'j!+|Y[6h> 1vXZ|Wh%"vT(F ^_tbP<T(v Wh8u>Wh%uT(F Y[t'PP#T($h> u =T("~1T(hВl}Ze[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@@t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]h*S ^_ug@w'; CtcE.ƅUB@tUQMY9MU~ wQRhh',pÃuh'j 7VXZe[^_]UPPPhh'ow(t@th(XjWbUWVSSt ÉֺM!"hh\L!hh讶u :u!USP9ZYUu=(e[^_]VShQjaUEuhhPL!hhA@0hQ1UEuhh@L!hh @0h-UQ1UEuhh4L!hhյ@0hTQ1UMuhhM!jTh袵11f3A@=uUVSEu ]uhhM!j`uhhM!jahTt0ffPhjfPhljfe[^]Åt$1ɀ8u"UJRPRP8( 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4N!۫ZYtdG (uhrOh$j h= h'l4N!hbh'lC uh'j R_XFN!EsR@8t54VXf@W>$WVfVEPhMU1e#sj@HEP susuh?qhuhUdhuhbWhuhmJhuhx=hU$19N!t@ uRh 4N!h hXZ}tEPhg[^h0)uuhMY,01e[^_]UWVS]uhhM!h{uh9hM!hh#11{ u.hLhM!hۋ=߶xtgtEWVhPs;^ u s hgn=ts htMZY1uhLX䍕uu-WVhPs] us h4럸"=thPs hLxe[^_]UWVSSljUQ^t#u uSuW] Ãu V<ZHW\X u uSVW.] 9uSuV# u VXV벉؍e[^_]UWVS@]uhhM!h8C@uh9hM!h9hA{ uhLhM!h:߃uhhM!h;ŋuhhM!h<몋1 9Ɖ} PQh9|(Ɓ tPQhXK 1jjh V[ = tS h fUtts hd_X1jjP[ 9u 9t-uRhgyPRhu to@u hqmu hS󥍵Ѷx Զx9t PRh@\)  W_Xth^CH$PN!fthhV^j[UYFt Vh0 ]VXZuh:<fvCfHfw N!PPPRh Vj UXy'f\{R1fDžfsh> U^_CH$lN!4fufvfthh4UYXKFV P'19}k<Dyt+@h:<T_09uj S^h*TY1F9}Ë8PhCyTGXZދQhTXZ뛍e[^_]UWVSf'fu(. h ;Rt萖[_~tu'fp=(tTjjRE à xTxPS|ZY@u SF X9E%=tISF 6h9 !jjRE à y6h> -^X(u(y h. =f'f=(u8=(t(=(u(((5(5(SD ƒ 1Rpȉt(PWtC yuh)j蜗 xPW{ZYjE_=T(JRt3(YtYRhr8XZ*tp)R,t5(h> ɼ(ZY'ft9tSD X>e[^_]Ë `'Q`'y ;p'|< tX'J X'UhX'PWZYUBPPhh'5UjG(W|$wUWSˉ1҉(M]m h}fU fUm]mURp pSQh}'0hh'T$e[_]g_UWVS]E }܍p(}p4EPS Y^tShiXZe[^_]UWVSP]} CM% CSCt RPW'F RPh}'YE 1t)g18th}'h^XcCt2PWE ZYh}'h蹺Y^}uzPh}'D YZu΁}ti=(u\SlUܠ1҉UtRWE ZY@u\8-tRh}'-F ZY@u"{lth}'h$/Y^uSh}'l XZ }ye[^_]UWVS(Xt.h}')h}'EpC ƃ \h}'!jjEp@ \ @Euph> 船[^xP=(t( (t1=(ƃ}  =(h}'h0h'%R'H' yh'knY'P'؃ t+@t( 'y h'9nZ'P'Ѓ߃Yt\@ ^jxt6Ph}' Y[@u8h}'h{1 肸\@ E *Ph}' [Z@uȋE%=t[jhu GPhh}'e? à uT 5(u"h}'h> \@ ih}'7GPhh}'? ÃtOGXW\`dt;`dE@hDžl}'`dpt`d T`9иdT`Pjj\jjPj=:TjwXP` `1ɉ`dvRLP)TPS< L9th}'h> nXZDžX7)`d=(th`d rPTY^1`dhh (\< ƃ ~aVh (S; 9th}'h> 賵XZDžX;`d=(th`dOtEp뭃=(t#S\芌 Y^th}'h?@XZ\U= ^Xu SE= Y5(t SWXZ=(uh} tbG tY(9GuOxPSsZYth}'h> ĴY^$E9Gu(#G%PS? YZuS< Zth}'h> }Y[=(tWh}' XZe[^_]UVS]hVs; u she'Ƅ} t'h}'ZZth}'hr[^.h}'V< ZYtVh}١(t jsPeZYe[^]US]} th}'Zt h}'hrsh}'c= ZYth}'hlZY(t1E ]]]US]} th}'Zt h}'hr$s$s sh}'軟 th}'hZY(t1E ]]v]U迗PPhh'KjA>U蟗PPh$h'Kj!>UWVS|Ӊ΃=,)u\=0)t0R|Y_u%=@u"萘|h> XZOt#h|V跧 =vQZVSY_u%=@t=8)u^VSf_ZuQ%=@u?V6 ^u?XPSh^hSE=΃=,)=$)|8/uVPZYti|hUhSWȦ W t=|Ph^hWDVWt|h辰_XVSpY^ ,)uS|W_ZuS|h+ j/| Y^|tpj/S _Zxt@xxVZY|)x)؉t=9|u fDž.Nj|ƄPRl^_x9Íu fDž.׉ދt󤋅tƄxPR ZYu<|9u(;xu 9 u ;p=@)t=4)hX'bSh*h'G'H'yh'(dX'P'0t- t( 'y h'c_'P'΃߃Yth'h7ؕI=<)t%=@uS葚 S^u@=,)tS|7 ZY#1=0) PSj|j7 tS=()u1#| )PShE,C޸e[^_]UE TET]eUE MQTU TE]JUWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]ڄ[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]U[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]Ӄ[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]N[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]̂[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]G[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]铁Z[^_]USU EAHtRSHtG t uF u:] M[]9t=)uyDutJt] M[]%)1 []UWVS(U) ) d)01d@DHLP4TX\x|hlEE8j_t;EPhht@jEg uEft')) h)苋 u )1۹Mhu WMb M1G$O!h)1\))1\)h)))땃=)t ))1\)h)1)1)Y)15\)5h)5)5))&\)1҉h)1))1\)h))`)1))1`)X)t)) )}1)|)K15)5|)x)J)1҉t)3)$)1) )1)11)))JH))L)T))ap)u)fd)Wl)H)9P)*1)1|)15x)@BPhah'67j)5')}䡰) ) \)t!hi ZMtPW'XM=)u1=))X)U) d)} =T) =) u} )u=P)tɀt*uMh)j\a XZM)))=p)tftt&)[)=)t ){=`)t )f)ZttuL)J@)4=)t )}=`)t ) )v =h)u/ =)u!/ =)u =\)u* )}t E E ')e[^_]UVSƋL)tp h XZTV ؍e[^]UVSƋL)tp h XZTV ؍e[^]UVSxDPTuRh> hV/R@ph^hV/hSV6" u"誁0$PVhh'/4GƄhw~0^|) x)tS =)t S< Y Sh> K0XZe[^]U=L)PTtRph^%0 Rh> 0ZYËzD) d)UWVSHX=)t>jj hI SQj]S @u hjt Sh/XZ=5)FډWVRP =)tRPQc/ e[^_]Ë `'Q`'y ;p'| tX'J X'UhX'P5XZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpP)tvv Rh t.Ã=d)=)tBjj hIv\vXjUR; @Uu hjs RWh[ .à L )AF`VdEUQRuu  =)tRPWQ-Ã|) x)Et*=)tU]Ã=X)u=T)tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP脠 EZuEEC u=l)tECu}EUE؉U܋=)} )ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut({u{ tNV [[^]UWVS(]j))X=H)uEԃ}Eԃxu x EԋpP=)tvv s h +=d)F`VdẺUЃ=)tBjj hI RPj}W| @u hjEp Wsh[ `+ K )AEUЉMMuuRP { =)tRPWQ+EPv, Eԋxvs$EPh**=)u7s,h3* wsh3* =)twshl* F%= u9N % 1RPs4%1RPs0h:Z*dVXN\=)t3jj hIQRj}W, @Ws(h[ * "{( =)tQRWP)=)tF(V,=`)tF@VDF4V8\|) x)Et#=)tNVF=X)u=T)t@u[F%=uEA Eԋ@>e[^_]UWVS]C=)tS D=d)t=)tS(SDX) T)lj?;'(C ;'~:P5)脍^ZujJY]e[^_]1S '))1txux tF@'E'}E}E1҉U}9}~j}1EM9M},=)tK(KS )k‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=)tS D=d)t=)tS(SDX) T)Ɖa '69~] [^_]șEș}E31tZ~u~ tIE9| 1=)tK(KS c9U~U UBGv뢸 [^_]{UWVSP})tG X=d)t=)tG(G\=X)71Etn~u~ t]}~9,EEF,;'| 1ɉM =)tO(OW Ev뎸 Z[^_]UVS RPuV虏 u1 -%S7e[^_]UWVS ]SdeYD1 󫍕t 19)ڍPRSP*ǃutAu$t?pC 1뉃u;'sLt??CQ=Zu?t 0%e[^_]UsPhWh'x'j)U^sPPhh'Q'jU EUK} uK=)tjuuhX Phhy hh> YXjrjURP( @uhhɍXZEthotRh|| u+juhX h/hh3 h3njURP:( @u h3|Eƒth3hhtQh3h JW|$wUWVSDӃ=)tSD[ ^_gjRt{ ZYu׃=)t;jDX{ ^_tDh;Sh0h'% =)tjS{ ZYxtPS^_ajDz ZYuMP|s# ju ju-  mV =)t18<Eܣ)PG)_uj1ۉ)V3 @띉8<=)tt1ɉ )߭8 mٽJfJ fH٭H۝4٭J4Puu<8SDhh'"$5)5)Vm ǃ ~ W5)@R 9 0Y_SzZt ShqXZV2 @' @V)` Y_@u Sh?XZV \u󥍽hu󥍅\P@l t Sh|蘈_Xuu@ t!n8t ShiY^||@n _Zt Sh;Y^u@m _Ztn8-tuSh  @! ^tSh> ZYD/Xt DhqՃ=)t%SDh ڋDSƉe[^_]g_UWVSÉ։ύEPgv Zyh 'y hja t)tSuSuu XZuR uJ Y[etjuu jSu ?julu jSdu u u jSVVj_ y hie[^_]UWVS ~1ɉ=('u,h~P50' ~fDžDžVhm50'K ylh>0jR 7fDžDžVhm50'K y Rlhfh~W50' à  &lhh~W50' tlh`fDžDžVhm50'!K '('tithjgXZ fDžVhm50'J y"bkSh0j؍e[^_]HyUPj XZËJ UWVSL]0'tP _0'15 )5)5)5)5)5#*' yB9)4'u1ɉ 0')<'0hjSU 0' yejSh0j0')1Ʌuwu0')D'?hhS 0' yiSh00j询 )0't`)tVJu0')D'0hjSs 0' yiShK0j9=0'*uUh@)50'*A_ZyN):iShk0j50' 0'1ۉ)yP:^@ujH)@u75)h}j蝠50' 0'1ɉ ) u)EPhm8@50'Gƒ tA:`t-jjj50'GBu@uOh¸:t1) 'uD=)=) ~'a1҉)u )*)*T'('17u)*~~u )*u)S}wt )*Huz))EUu3)*t)MؙRSuu* ҋMu u)*z)*~~11ۅtFMEUWVuu ҋMuu t 5)*u}붅u)*()*T'e[^_]Ã=)u =('U~h~P50' ('1$'=)uNUjjj50'Eyfh0jȞ RP50'1 x11U=)uhj蔝XZ$ )t5*5)*hjoUWVS] }1WSu" ~ )ƅte[^_]UWVS] }1WSu ~ )ƅte[^_]UVSUM ('0'=)u;QRP à ~G)9)*tn)*tb )VQRPb à ~ )9('5,'tdVh>0jOVh_jD ؍e[^]UVS] 5('Su50'ƃ 9u$')~1(')tH~Wjjj50'HC)RP50'. 1('1tc8u 1('1 c8tyc8EuLmc8 uhj(1ɉ ('[^1Fc8t y)u^Vh0j託('('1eY^_]aUWVSX'='t'PVx+5)= )Xu u1=x*='OhRWV5)*5)* RPVhhW 5)*5)*h hV 0WVhhV }}t^=)tU5\#*5X#*h hVH Vh)h8hV, (VL$Vj ='ubh8* #*1WVRP RPVhhV V5#*hNhP 0hR)*)*)*)*WVRP RPVhhR] 5)*5)*h htW; 05)*5)*h hV RWV5#*,'HPx*0h_hP 8}uV5*hS%VaK$Vj }*e[^_]Ã=0'y1#*))UPT* <*t@=)u7=,*t *R5*h5*5* )=)tLh@)50'53ZYu6H)%=u%=)u=)u5)1)X='w=`*t '~ jP YX50' 'Z~jURPL T* <*t.=)u%5*h7u[1,*5*1( 0') )u 1#*1))=x*t,'T* <*t̃=,*t*1,*=x*ti5*hwKZYuS)*)*utjhRP jh5)*5)* RPh5*_ j5*E'1#*ZYUVS Sh*jc yxYh0j/ jSj7 yLYh0j 5)=$'B 5)6=*u5*h R[X)hD'SOJZYjh<'S:JZYU)C,'uPSh:h`PShhۏ'whh躏[5*h詏h蟏hC蕏hk苏h S褏xh-uSxIZYu5)('5*h>1,*[^|tFu=  =\*tJl01e[^_]Uhh#* YZuOh0jԇ h#*\>Z#*1Uu9 Z@tNh0j蓇 US]SV Z@uNSh0jf][UWVS|uu V_Z@uStNt< tNu3TN8xPV蔺ZY@tE%=@u1(N8؍e[^_]UWV@u x*PHxx*P xjgƉX)#*Pw8URPh)x*P@ uˋEU|#*#*RPKYXh)VZh)[Yh)UZjh)HWZYuE=)/u(7uh)x<$h)h) hX'WVh) 2d'@tLh0j虅 '|#*#*#*#*RPlZYHx*P(jh*jq T 1e^_]UWVS:@u x*PHxx*P xmhxjeƉX=*t-5' [tLh0jʄ =l*tbbyY|1ɉl#*PwMpRPh)x*P@ u!pt|#*#*RPMY[th)TZt|#*#*#*#*h)YZu؃=h*txPh)Y[tX* L*tkxPh)ַ[ZuTL*=X*t/t/4#*9EE8#*|/@#*9EED#*|Wu4#*9EE8#*h)RYjh)T[Zt0h)_|#*#*#*#*RP =)/u(5uh)9$h)h) 4* 0*tgxPh)ҶZYuP=4*t4=0*t4#*9EE8#*|+@#*9EED#*|S4#*9EE8#*T*t1*J~PWVh).Ph)G0,*[X"*t@t=*uPY=x't1#* wlPh)XZ h) Ylu_|#*#*#*#*RPXZy h);^X=T*"=,**1,*=*uSlh)Y[y;5*|#*#*#*#*RPh)]pPRhh)x*P@à =*hu Rh)ZXZ=T*t=,*t* 1,*u!pt|#*#*RPgZY"* x5'Xx*P(jh*jK cd]O 1e[^_]UWVSx*@t x*t!9t30hj~]PHxx*P x=X*ux*X t []y!^xT* <*tW5*hB5*N,* 2h)TZt.|#*#*#*#*RP0 ^_Ht#t=X*t4h)ad_y#x*P(Ɖf\WVZYyuth)]^yơT* <*t"=,*t5*h7u,1,*ZY-u jh*j e[^_]U=X*u y  \yx*PHx1]]UWVS Džlh 5 *WT = w u}/t 5 *hph4~/t/CFtP5 *NYZy" *DSh0j}C|%=@t5 *hj| yX i$`=l*u )؉h&'n[yDžlh)}RZth)%ZtX* L*u#h)$h)XZY )P1=)/)PV;S 9hsh)hj{tPW}ZYuL*=X*t:t:4#*98#*W@#*9D#*u4#*98#*jh)2MZYy'jh*j 7`J$ 1oth)mXYSPh)N xס4* 0*u+=T*5*h)r),*XZ}tPh)YYZu=4*t;=0*t4#*98#*|@#*9D#*4#*98#*]#*=d*t h)9 h)"Y+#* tEt@wpPh)ZYZ h)uZh)"WXjj5*q l y8*dtAdRh0j$zh)V jh)oXYy#lPh)[h)V Rdlh)a dy Rh) Rh)@XZlPh)YX=T*x=,*k*1ɉ ,*Te[^_]US)*+*)*u x*@)*=~~ h~PhÁthPh)jwK)*T'5)Zx&1)*)*)*)*‰)*)* Dy밉؋]U)*+*='u>)*t5=~~ h~PhZthPhjYw@5)XZx%)*)*)*)*1)*)*1 y)*+*T'~)*~UWVS*t hjp)*=)*T'u)*yS)*+)*EU EUT'EEuuuu u})׋E9ƉM}u}WV!ZY+u})*T' M19}k)*U)*;)*s#5)*PY_)*)*+)*RP_Zxk )*1)*T'щ )*}=)*)*)*EU))*)*1ɉ )* )*o'hj\uXZ؍e[^_]Ã=P'US='uhj%uXZyx1ۉ)*)*15T'5)*ZY~%)*)*‰)*)*)*1+P'~C9}PhNjt Iu뙋]ÃUWVuM )*)ȣ)*^_]UWVS$]CDž$$ x$|$x $=@*u15xPu ^_y狳<Vhk0jtPuZYud%;ht0jvtۉ15T'5)*u # ƒ )*9|Ru -WQQRuk9uUy%:Vh0js79|$u9x$t hj\rZPu XZYyh:Vh0jsNjE49}u;0th뗋9}3t)1;x$|$}Ru ye[^_]Ã=)*t1US5T'5)*ZY~')*)*‰)*)*)*=u.=x*u)*1$x1)*)**]ÍL$qUWVSQ Q1ɉMMu u15)*=)*)9}Ή5)*)څutċ)*]؉}܍MQWSRPh Ɖ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u})*)*197)*+)*щ9|`tt%u؉}9}M؉]܋E)*+u}럸eY[^_]aUWVS] ~E)*+)* U )څ~'#9~؋5)*}5)*)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu 'Y[uEl*Džl$7hht0jo֋ltE1҉Pd19} )*+ )* } yjș9Ή}hlpPtPQ5)*u ƒ2E0x} yE} Gpu5X)*=* td@9u )*Й).1];x$|$}Rhu  19x=*t, u&Ed9$thh! jm 1e[^_]UWVSV )*)*19|1`; )*)*}hK jAmZY1ۉ)*)*T')*‰)*;E~ 1}}])1u5T'5)*ZY9T'uG)*)*E)*~$5)*lj=)*T'9)*~?E)*)*)*E)։׉=)*x*Jt[tTA1)*)*x,T')*‰)*;E"])*EEe[^_]Ë)*9)*s.UWS)*)1)*5T'EXe[_]UWVSu] ~;)*+)*5T'Zx 9~‹=)*=)*)1e[^_]UWVS1;EE }P)*+)*5T'Zx5É9EE }]u 1=)*=)*)]u 1e[^_]UWVS]x$|$ $=@*Pu _Zyz2Vhk0jok[)*+)*~b9}P5)*u ))*19|5T'|^yt7h 0}94tVh ji 1YuxPu ZYy1Shk0jij;Eut1Sh} ֋U Ze[^_]UVS]E xz$usP Zy;1Vh 0ji$tAPeYy$ 1Vh 0ji$G1$*Ze[^]UVS|]s|PV苝XYxS=h*t1F $M9$$u0;|u(,$U90$u;EuVh j2h 뻸e[^]US|]EPSZYy1=h*uOE%=@uEh-uSp!ZYu\S5 Yy} t/Sh> 0jh/ScZy5*Y/Sh 0jrh̋]UVS]EUdh1ɉlE Upt1x}='t ='|PS^ZuZ='u#EUdhEl='u$u! PVXZ=$*u ($j$* ' 't[j $P3V%A='u ='t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSu$u h E18}t}t:**E*6SVu{ 9#u h i**E*ҍCtPRm7XY PK2Yuh jP[XZ>CPVЉUP2 EU 0j\̍<+E e[^_]UVSu] }u1NjjjVy #Sh jh*V y"Sh 0j[e[^]UVS]u x@Pu X=\*t*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu ~ pt1@9uNjt9|$up9x$th jY xPu ZYy!ShkOT$9X$u;t h jjju y$V!Sh 0j Zp1$1e[^_]US*tP6 1ۉ**X*um1 'yh'Yu9'P'9Є'uu%1S * t뭅u oډӡ*<*u* B*tϋxyRZV붉*j5*h* * ,1]U=D*u*=H*t*=8*t *@=*u'h .*Yuh( jWXZ1Bt\*t9UVSut>uhW j :.Xuhr j?WY[FVZH~ 8/u3E ؉C1C=*u**X*1e[^]á*t@=`*t *=@*u4=p*t+UE$u*tjP5* US=\*t8*1t6{u+uh jVVXZ3hIh' [Ƌ]UWVS]=*u =*<15* @u=\*u95* *Yu @uЋHHQf $ Vj WZYV$Xe[^_]UWVST]}T$X$uV($A SWVhPe[^_]UWVS]u fVfuPZt%t0SRjP}W VWCۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=P*!u%UP*hjLXZ1ø1UWVSSu] E}MM1҉,2=*u)S*:-u* '=*uA *Q*u **UWPZYtAU:uC7tMM}E] ue[^_]M E] ue[^_] W3h(x:u9'9},2@'W3hh'?e[^_]1UE E EE]W|$wUWVSjEPSƉ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uhP_DžuBhjPJY[8zx1҉P=̪*uf̪*Ȫ*tc߀?t\j,W`[ZÅtj=WMZYuh=Ej YUuhjIV) Ȫ*B1e[^_]UWVSQÍEPS ^_uC Ī*%Ƌ]| tC]SR ZuĪ*1 KDe[^_]Uh'hTuj葶'9t BtU'Uh'hAh'h2h'h_#h'hY j-UWVSPuhS ZYhS _ZÊEhV(YXuVh 0jeI }t/1e[^_]UWVSlj/E 0NU _Z*t@E *hP[^b***1҉U11ɉM11Ejh`'hiu uKzX$Q!,2!)*5,2h=f )*렸1P'덡,28-uxu1)Ej)[D*Q)SBh*38*$1'='uY`@}1 *Ъ*=Ъ*u  *$*'c`*T5,2;_1T*pl*a 'H)9 *,2*$H*Ex9~/pPu!EZYuhjEj EMȋ,2*P})1*P*<*5,2,D)g)ԅ'X)ȅ'I)':)'+)')' ',2)*1=x'1ɉ *5,25CZ4p**'E 4'umu}t *'*X'Hw49Uu }uj5 CL'x**t Hu*1E`hjC$hPB[_hS+ZYF* *}tE8MMYEh ;WZYE't&h<WjEZYuWhjC1E1EEYE}tES!"[huZZYu *u!XEjhum u@ *t EtS![EP~u!XZ1ɉMEHjSu E&EE]}t EtSP![h ;WZYt u[=Ī*lW5E.j5*Ss ^E6~t*C}1*ExM}hSZYLFLjP[_}u'hP[_u^ h ;SZYE'ur1҉UE5DžUuzuh ;SVZYt uX_=Ī*tSh {E@u}jPZYy!h<S詻EY_vS6tj.hWYZt2jhW  ujjW_Z*jS1ɉ P'}C)t 81hS! )Zt 8)*11jh`'hu u z$lS!1Є'ă뿃,2)*5,2h=t*p*x,2)fl* T)SEh*@3d*΀`* ,2@,2tjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 5*h%5[_VhX5h5h5h W5hWoZYuhW\[= u h:5Y덊uh#5ZX<.uuh5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDhpj2|tHL@t<uDhh'Z WDhh'?t@th WD 0 1e[^_]UWVS]t K΄u hR<\u FFu8uShj1 Dž~jXuhj1[^GjQPQ5 t5hVP* SVhji1 WYpV֊t\uF8tFK) WrShyRlZV1u,) WBhj0GBGtVuhijXuh~j0[^C31CVZC 1ɉKECE C=*u*ܪ*Xܪ*1e[^]US*1t6Cu+uhj/XZ3hIh'd [Ƌ]UWVSu*t$tS=`*u S1u=p*uSu $uoFPjYuhj /C_Zt/1s\Ct/1ɉK;WvZC Hǀ?/uC C$l*9tP@uhj.Y[CS 1$Z-e[^_]UVSu1ۉ$*u,=`*u1=t*wC |/t[t0CuPFP3 KVPYuɡt*u #$tV^Zt 1$e[^]UWVS]=x'tes{.u{.u Ct:u hj/VR3 [_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVhj% RE@jXuh;j%Y[.t;u GM1GtAt+@uVh%O}tgE8t_W@uuhj$W:bGƒWt+G 9OG}Vuhj$W1G=*u=**x=*1 he[^_]UWVSM=*tPÉֹ=1:t9pt@9u9U}tjZUuhj$[^1p1ɉH xe[^_]Ã=*u1Ujh *YZt1h6j#XZ1UWVS}*$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujYtGGP^Zt0 $$$CSEC ECECEC1~SYhaj"XZdUh 3 P:  $Uu-$CHCwC3S[^̍e[^_]UWVSM*4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3X]e[^_]e[^_]UWVSS=*t51ۋ4t#1ɉ v0EEPXZuC u͍e[^_]Ã=*UWVjhG *_Zuhj!Y^C=*5*A'5*Z@uVh0j! VX1e^_]1Ã=*u1Ujh*YZt1hj XZ1Ã=*u1Ujh=U*YZt1hjP XZ1UE$$ $]UWVS(}u=*0 $$$EUE 1҉ẺUЋ,$0$1!!ډEԉU؋E9uE9t1!!ډEU 1EE11ɋEUƅt6@ ]9Xu]9t@P @ $$$NEU#E#UЉE܉UEu1Uu1  O $$$ƅE] tYE]1؋U]1 uEjX1ۉY $$$AQ F AN tX1-t"****uϡ**M̋]!!9ur9unt`**utLUj Zt=UMHUPX N HF $$$EԋU؉,$0$Wh@jh{j1e[^_]Ã=*u1Ujh=*YZt1hjXZ1Ã=*tDUVS1*0tjjs sss3[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ *=1Et#؋M9Hu9p u M9Hu9xt@$uj(X҉UtMuFXUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RXE Ee[^_]Ie[^_]UWVSEEE EM}*tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3SXZ1e[^_]1UWVS]}E= *t,;/t'PS< ^ZuShjT |j$.Yu#Sh2j2 tXue[^_]cSVZtGFG4W8F VG(W,FVGlFF *F5*e[^_]US*tvC*=$*u{ t s3賴XZ' 'tjjssss 3=|'t s3YX3S*XZ놋]UWVSE @~}DE@Eu119}1Ҋ LBuEC}t#]1ۉ]Mэu9s F^BE1uZY[^_]UWVS u=*FhGSPG <9tjww 5';Wu;G t thc*SR5'{ 9؍tHh{0j SR yT$X$G9__W1jXjjj5'<G WxNS5'J{ 9u)T$X$GW*W8yh mh0j$ WiXhjZYe[^_]UWVSQ*uhjXZohu u Eޅt6uCY_tcvj ^t;u+SƉYt#uSGZt _E81QVXW_h< jN[^0^SuZYtSvuRF_Zuh! e[^_]UWVSu} *t=h7V t&3VmZYuusV[  [֍e[^_]UWVS1ۉ]U]u tu} 1҉EU]t} t} u^ <^4^F (Ku0CEUEU}t9s}u9rKC0E}1 ۉZY[^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=P'ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vhc h SߊSyEVhk h S迊Sy=Vhv h S蜊SzyVh h S|SZe[^_]USSˋ t%RQP E31U1ɉ EeveRu P ]URPh j Ujh豨ø1҃=ī*t1UMU1ī*1<u @=u3} u( A=*tī*AH]UVS]} ~;uqjhP; u%='u 'h j@ZY1'jjPƺ 9؍e[^]UVSZÅ3h VuZY[uhcSaZYt)SVh jhch h(!j 'vSVhV!jԫ*o1e[^]UWVS]u hV_Z@ub- 1{ǃ4$K<vCVh** | Rh** Y jjFdP(%($jjFlP8$jjFtP<$$jj F|PdEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1҉$$$$ 2t8,1ǃ$ǃ4$($Qv`ǃ$($ Kt $x$|$ށ1$$$$w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%1҉$$$$1|/uDe[^_]UWVS u$Hwv$U!=ԫ*t_h|!j h!h!h!Ń d~ Ph"뮋XcV~Rh$"땹1jdRP 1$$$ u#EƄ/ojj 11#Y[1u9E2jd PEPK ojj 11wE1Ex$|$ƅz ӍynHʃ0Pu uo9uhg"9rH@0%1҉$$=P*u =L*t t*x* T$X$W($1jj_Z_8$1jjZYg<$1jjY_{jj _Zud2M1jjhZYuDhSV[_y>jh虡ZYx鋖$  ЃhB"'e[^_]11UWVS}} ?jhVU Åulh"VY^¡* Ы* uЫ*h"jE XZjjP虻ƺ- 9tPVh"j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPW. z/@E K<vM E)Vh**Mȉ Rh**  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)PF' yjjFtP<$ Ɔ(8$P P% ZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2h<VD|_Xu$10PVh$j['1EPS(r ZYt/G}vEVWh$jEUt'u1 S.Xe[^_]áܫ*t UU RuPM5ܫ*%UVS]u F5ث*tRPS ^ tD3j SiZYu1e[^]US]}t *<* T*t=,*th'j `1,*ZY5*hPh'zzSu h'h'j ` ]USjhaah Y[xEhP)ܫ*YZt&h<Sث*YZt135ܫ*הZS i X=l*thaah$j ]UVS] u}t *<* T*t=,*thX'j _1ɉ ,*XZ5*hPh'|yVuh'~SEPhh'Qyh'j h_XZe[^]U-Ph$h'!yjk*UPh$h'xjkUWVSƋ=*tPh%h'x =*u ЉˋQtjPI YZt8tɍEPsv XZ=*tVh'%Z^Xjs[ jsj  NZYuSa Xe[^_]UE @E E@E]ɰUVSutYS} u C tC*@*RDs<S6*H* u*te[^]UVSu*@* *؃8t VPjZY*u *u*t e[^]e[^]UVS *1؋tJ9tFjPZY*uԉe[^]UWVS*@*ƍPYY11ɋ *tx?tBA'u9t h%~ *u*th jVSy19}Vph%p'HQP yP'H Z J GSKXe[^_]UMtA'1 *]UWVSu^Nj7t#vu臮Y[Åu jWXZ ׻؍e[^_]USh +ZtaujY1"4*tP{ Ã*X؋]UWVSP}U UWRW"ơ*@*$5WiC1҉S URXC*H*u*t e[^_]Ae[^_]UVSuV[t#sVmZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY1*8u&S;u0h%5'MXZ*P*uj=CPY_uyjS5_ZDžuSh%5' Sh%w'xWP yPH'H YlJ ]@PS3XZKe[^_]UWVS5̬*ʍAЃ wVjEPVڡĬ*Ȭ*] b!2KȉMAb!uV)PRh&b!tK**Cb!u)BUPMĬ*NjUĬ*X/<1t &wlҍ~$@V!"v?F:w;$V!&R|t[~-^tC *QQhT&!ÊV=>u,Ƹ^ À~|tH;= ÊV(,)%%#$Ƹ Ƹ^̬*e[^_]U5Ԭ*Ph&UWVSQ5***P0É5*^=F't &uKt;u 1҉jEPSƉʷ 8uE8t+起8t&`b! tBUUue[^_]W|$wUWVS ÉUM7Hw$V!& uu &!uME5 &tރ uWVuu P WVuuQ  MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=Ь*%1  UU6EU=Ь*&t '2EĬ*Ȭ*MQ  xWUEaYutu]ƉӉڍe[^_]g_UWVS(ƉӡĬ*Ȭ*EЉU"tUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh@j]S*bjSu( e[^_]US7=Ь*)u n[]W|$wUWVS4É։MЋ?E1EăH3Ĭ*Ȭ*V]ЉE뭃$" "tCك<E4EȉU̸'=Ь*# wEУЬ*tV!EȉŰEЃ'wFiЬ*ƒ}'u1EURPh@j}W`jW6 EУЬ* Ĭ*Ȭ*V]U]Ĭ*Ȭ*VWEnY1 M1ۉ]Ĭ*Ȭ*VWE7҉EȉUX}t ' yЬ*t VEȉUUĬ*Ɖ׃ƒ'u1EȉURPh@juV_jV5Ĭ* :'닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sáĬ*Ȭ*EUUV0Ь*Kw\,W!8,W!}GVQЬ*YYuRPUMY_Kw#,W!9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ Ь*AZwSjƉYX=Ь*uREĬ*Ȭ*MQ  SUEZ  !1e[^_]UWVS}USFƉX=Ь*uQMEĬ*Ȭ*MQ  &SUE щX 1e[^_]ÍL$qUWVSQ q}W觟5*XjLPsZYt5xIu,xNu&1҉Uj PsZYUtB@)։5*@뽉Ԭ*̬*v1=Ь*t L'EЉUWEЋUԍeY[^_]aUWVSRE} I_''**HO;t(*sx&觠P ωʋ7*tx BM{P M҅xJ _H+ 'QtX5*SƉRPh5  e[^_]Ëج*Ѕt /tt@1ج* @ج*US]u1Z;/uPh-uZY@tEPS ZY@tҋM9u;Eu3E3U ]UWVS}V膜VP tSG*Y]e[^_] S3Z8"u뺅u 0Phh' e[^_]UVSu=*uE='t.1҉'h' PYZtS躛*Xue[^]3e[^]UVSu3t =*ܬ*tPY*@**ܬ*1*jR*H*Zu*tG =*t,j5ܬ*h|' j5*h' jh'T[^1VI@$ج*VPA''* >/t[5*>t'*H*FxFC苝XVԀ~/u#*KhVМZYu$'9r :ƅuh*K;/u>th-uV薜ZYt *x/4X/ XV>t*H*FxފFC9'u *x/C ȜX/=*u贜**@*ܬ*tPX*ܬ*5't*j5ܬ*h|'' j5*h' *H*u *u@e[^]UWVS} u*@*u: Yy *u*ttj;á*H*Zu*ttt h' Y0t$='u =V't5*hINXZ1ue[^_]UWVSΆ'hƅdh'}Yt  hЇ'J'HyP'H X J EЇ'e[^_]De[^_]U*u蔆U*jPI UU 1**@*tuRj u*t *U1*EEEEjEPjA =x*t='tjQjj˞j U=H*u H*E Puj:UEPu u(UEH*jUS]3Su 0uUuu 0uUEPu juUuu j}uUS] ƠSu0^ ]U諠u u0A UE Puj+ Uu uj UMW!ft9uPU t@Qh j h**á *UWVSP裨 YuOƋjjPXA ǃ t 3A ;ZC jjP2A ǃ t sA {Xe[^_]UShIݦY*8tN''K*thB sRXZ*XjjSP5*"j1]W|$wUWVS ƉӋ 4*uj'd$k< 4*X1ƉU1}m M1EmPP$h)jSL;6u{0ujhS F S ZÀ{0u K{.te[^_]g_1,**(*$*US]tvUUt[F~Xj Rs WE@C ?Ct8j RPVjEpSus 5XCX C @C[놋]á8*USQjj]Sjjh$'i@tBEPe8*Zt,jjSPjh$'8@t8*PATH@=58*8*'X']US ]t6;u1Ct*p蕨Zt*PjEPCp`']UWVS }W1t@*B*PWqE_XZsnEX;t-E@u"xVa> X蜜0Ph)1PsuQ uK *u*te~ jVYX}xu= ju js_XZxV= ^uu= Y1u u{Z upX1* *u*te[^_]UWVS}] 'tuu15*EnރUR脋ЃEYE$X!VwXZ='=,*%jwmYX='* ,*jw=XZ='=,*=*=@*tSWSWY_e=@*ttSW=@*tZjwXZ='>=,*1=*u 1*=@*tVW=@*tVW_X=@*tVW8=@*twww*1ɉ *zjwXZ1=**fjw_X=*tQ*E=@*tNWfY(jSW Rh)!h'= EވE1URpZEPXD*tr=ކ't*t }tPtje[^_]UWVS} E E܍uVÈ5*ju^1jY='tKt>='u5tUXUt E PuRXZ=,*u V莈X^VZu1*tje[^_]UWVSWE} _''**HO;t(*sx&‰P ωʋ7*tx BM薉P M҅xJ zH+ 'Q菆^ *PS|ZY1**e[^_]UVS](*1jshXZ=',*tKu0*H0*t1,*u0*H0*W1ۉ,*MwE5*=*; ut-t)E Ps5*,*ZY[x (*5*e[^]UWVSu=*='u1EPUE؉E܋^Yt$hPSO =,*b[E؋E1҉(*]؅6F*='P̹*PϤPBh[8v 0'xWPyP'H =_ J=s'xWPYyP'H X J 5'>_jsv E Pvk=*='uJ,*t:u0*H0*-1ɉ ,*Hu 0*H0*1҉,* (*=*EP\Xe[^_]UWVS]uV袄E؉E܋S *jPs^M[tt=,*uk{t_G*EpWRZYt@1=,*uA='u81; u{C*u s ]*ZYt‹띋[1*V虄Xe[^_]UWVS]} 3EsdX='{5*̹*P萢Ph *Stj RU5'zUR h *Xu h/*X'HyPz'H X J 5'Y*@*u"jShEPSRU|tUtubguu *u*tjs2Ws$UuRHg1҉* Rxr*X *u*tjtJ='tA{t;5*̹*PPh3*'Ee[^_]e[^_]USD*EE1EEppX='tlExtc5*̹*P衠ZYEP$ *[EXtj S5' [hD*[5'[XjEP. ZYtlE**jXEuKt&:EP$K*X5'XԋEt*j5* *@*Eģ*j EpWXZ1ɉM *t5u EpY[*@*E*jnX *t*t뻡*txEt"EP$U*X5'3Z]UWVS}] 1CCC ='EP*@*E^@u h]*VjWdjWPyu31ɉ **tue1 jujWuH1 E؉s *H*Zu*tpEPXe[^_]UWVSE ,1@*X*(|*$1`*EP~X1 *E@*ptEXt7u!C*hpPSG 1 s._tҋ[ŋt1ۉEp ^x|EXtC*sYu|1҉4pjxPSG [븅t4B4닅4P}_0pt0J0H 䋅010T='t"=$*u4~0@T40)Љ0='u 4}fEE9 5*̹*P-ZYP[x1ۅt-'HyPK_'H J ~j=WQY[Åt?vbZ'HyPX'H = J={=W(X6 ept@t-'HyPX'H J vX6 뼋Ep 'tRVP2 t vHyPOX'H J 5'_uxsjh Y!Vo| u Xԁ}9 ``041 Huw)4)400toX4t-X`0QRUR0of}Zf}tJXZ:-{z-uzu apu CSu>E `tfE=@*u Ext,AEftfwE=i t=9 tNˋE@ft5*@*ju[_[^{8t4{8t*{8 uxPWZY@t v{W  XZt h+vXVh> Y^tq*@*sP$Pb*H* u*th&+,Ph,+ PVh0+{ t-'HyP'H *Z J*'HyP'H X J e[^_]UVSu@h!t"8u%uCVPtjZYt؍e[^]UVSug!t8uVPBjZYuCݍe[^]US,'1ҋ`*tHft fux@ |u[]UWVS}*@*`*t,Pfu9x fu9=,'| P^X҉΍^ح*t *u*t e[^_]%e[^_]UWVSu*XE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVhO+sZYUtU~:uBC렡,'U҅y E,' !WE,'Xe[^_]UWVS*@*`*t!f{usS4XZٍ݉wح*t *u*t e[^_]e[^_]UWVSutA%<`*`*tCVPgZYtdߋ} tX*@*Ve$)eÉ1fCC VCP *H* u*tB=@*؍e[^_]USg!tjP)f@SPXZߋ]U*@*@* P*H*Zu*tUWVS] j/u9^_t[EtFxPuZYy vu8tlu8tbuffCf1CrƋM*9tMEthN+Q Y_tM ju_Zt@HftftfuEu6Eu E u=,'yƀx u1E\tE Dž\u =,'yuGYDž5DžXt,'f~tFXDžTDž`juEP` WcD*Zu?/ugX9`Y@PhO+7pZYtuYDžt5D*hW+ pYZuzX9`hxPWYZy.s8Bs84ssT"E%==D*tlEWbLȉ`+'$=bWAaju+ƃt fx`tWuh\+dQW.eXZ*@*d\ujuY_f~udfF`FDžT BtEt$jTPuhy 5' f`z*@*d\uju=XZf~udfF~ *u*tF FfF CfF fCFCe[^_]UWVS(EE1E11E111Ehq+xEZtPE܃bw$(Y!1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEE*: E؈E1`*tIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5'Z^'@h{+[EjWVZYtY@ft8*fuu<*P*8ufHu("fu}}t̓=,'x t*fMfMPu̍EPW EfEփ}t f@ E܃}xf}tjWY_t jPlXZOE܍e[^_]UVSu *@*jucË@ZYft&fHu sXfCFC fFC FC *u*t e[^]e[^]US ]*@*fEEE'fEu EEPSL*H* u*t ]]UjuZYtfxupkX1UWVS$1E11h+xu_t'ptvtV EѾʋE ct ]tPh+nt h+^1ɉMԋ *9u/Icu+QPh+3;u(u/h,Y*P*uwuS_ ]!t' 8u SP^ZYth,jSXZu8h/,{j wD1 th=,`[ hM,NY1whIXZA*83'HyP'H J }ujSY_tHfM@E:*f}f}M؉MPjEPSEfEEE؃f}f}t f}f}j/S,0_ZuK*}tEU؉UjSEPP[UJyu h4  [WmjSt ZYuuZh4 _Muvk0Ph.L u&hS,uhi,u h~,ShIZYu h,|XE|E~pEԍe[^_]UWVSEPZ*+'PZ '^_}GE܊_tqtg}tb} C<v8u1:t* t/t<EP-[[=V't"E u *xA `\H}낃=*uH\*'8u(hթMYum PKbZ1t p PaEPZXuEE %E1F^t\}tÊd! <vC< w **y[H * **y[H *5**H*^u̡*t9*~ 1ɉ ****}**1Ҹ*t 9X}t2 ***@*2R*0*H*Zt *u*tx9X~Xe[^]UVSQu] UWuF'ZYt1UtWh2 .'ZYu^^뱉EމE}u;tjQXuVFXe[^_]á*u1*US*B*Py**H*Yu*tp*u1҉*]UVSuVQ@$SQVPl jCQX**e[^]UWVSSu E~oщ1ۃr?1ɉ RUPËU)VWƃ}svSZYy7t؉։݉ ߋu3Ee[^_]UM1t@PQ]UWVS@] }E1ɉMЉM̋ExMր*$}|}ۀtVp}t e}[}\tX}?ttJ}t;u{t}LC;uV}t;uCEH88}t;uCE@8uCEx\}t;uCC;t>AE@uF9utmb!t_U9UčvsՉ‹EĈ@ȉƃEM9MMP]xYPEPxx EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQ ZYx>EE1EE׉E1҉UURMQ YZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=ܭ*Uqxvtu@r t@;}u5ܭ*[xP5ܭ*ZYy9tt1t9s'@ZxvttE]S@ϡܭ*;EtP9Uu8/t]C -uP?O X E9ܭ*t@/Džp>t F1ptJxw@tu@o*tSB YpF/S~e Zt؀x .u o.ux jWtJ tptWu 5ܭ*@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu*sk^<*HP* **y HP*ƘEd! <w **yGP* *xUBE*GUJMH * *x"BE*H *U:ufGUJMك; **y@GP*QE'E=*1ҹGE8u5  **yFP*%EE*Htd}t) w!*x*FP* *xUBE*VFUJMH *덣*x*P*1 F1*})'9t   *H*'@*uD*=*u!MGE}Ed! <w **yWEP* *xUBE*.EUJMH *뒃}u6 *xUUBE*H *Eu΃?u<< w **yDP*DUJM멄}t+d! <w **yvDP* **yXDP*U 0 ^>R1ɉj EPWp'R 86EU t<="*t9**DEEd! <w **yCP* *xUBE*jCUJMH *뒅u. *xMUBE*H *EuE< w **yCP*BUJMSP*XZe[^_]UWVS(Eu uԍX0uMu1ut@b!Ej=SZYE@EEHEE̋E Et*u\E)؉EO}t(EPS_X1u4;@u+*S8Y1tEt 8u11*+'EuE=F'/<@%<*}tE< SE)HPh,}E%}}tuUJ~@*H*Gx*H *O։UDAH *OU뻋EP1}~ })1Ƀ}~ˉEu uPS1} F*+ 'ȋ}))**} u W>Z }tsŠd! <w2 *x*H *Uc@H *U *x*H *U4@H *UЈG1ƒ v! *xM*H *GuJ *x*H *ĈU?H *U뫈U?H *U1Ut;@u =*u M @1!} @u1E !1}pM$Y!U5*P`*[XUЉU E PuZYE܀xUB **y>P**+'uuuuSu u%*+'ʉ*)@*uX uuuSueuE)؋* Rh,訪u܊N#uNQSHPRh,#u E܃EEPSE)HPRh-eA0W*+'Pu4 }tzM]u EMEtZ|wt**׃uY]Qt@뿃uHus독tEe[^_]UWVS]E %E1ɉME tE'@*u D*E*+'E;~uE t u SXZE 1Es}B~< V$Y!:B=9QF{<s4{u{y{@u{=uz1=*}} t **y<P*e s **y;P** **y;P* s=*t(*+'M9~xu*H*tE 10E t **yY;P*̃}u C< w **y);P*S *x*H *U:H *U߈ ts*1=*~6*;'t 1z {uS*t@u {tU#U PVu R*p>**&V[ *x*H *U,:H *U߈EE t3ˆUPu0 ZYUt*+'jPHP\ UE {~=u}1Eu V[Xh u* *x*H *U~9H *U߈EE "Ru ZYE *+'jPHP މe[^_]UWVSWE} ]=&'t15*P *'*'*1҉**P*Sp*Y^u#u8***H**y{8P*5*+5'V5**Yt?h*NVP*1҉*** Àt SPN,P;^%PEj%5UP**Y[=*1҉*tOGe[^_]Ujju5't@E4UWVS$EPEߋ5*+5'hR%~W,[tW,XYA/*Ft~uH<-tB<%t<+u:'"/'i*1/**E1MxdtS~J~?Hu(UFPQMϪ YZMUt UQW"+YZUu뗅uV+ZtjV+**XJxRt~i90tM΅x29*~*i*t"A/ 1/Q/1ۃ} uVP褌؍e[^_]UVShIK5X=*tYh_/r'HP!'H YrSs*Z8P*xj*0Y^u ho/BP+*i5rO@Ph/$ 9DiPhNFXZՋJ ;1e[^]UWVSQ111Uh/-4ZUt%jtptg Ժ;ƍ7H~h/ *tyt h/UjPYXUt 1t+*i5rO@Ph/t"PhmXZ1tnHi0i0hЀ'HQPFY_y/PX 9~ 'x99z 9~ z8 ܉e[^_]Ã=*u!UjuZYu11á*u!* *Jxu 1øUE='t@=x*t7uR+*i5rO@Ph/5'UWVS=*t.5**NxtSX1***J*B*uh<ViP)Ë**i߉_19~i9uFP=A^**iƄDŽIu* *u$*tt *@*=N'1ɉfǃ*4؃} ~iE PZ *u*tN؍e[^_]UWVSu]=x*u1ɉ x**@*SSmwXZu1*}='tpt u ؜8Wj- ^X}u-W5'] ZY@u(0GhPhj.SjpSjp*}u$SjYwSjQwtAt8t$='tSjpSjpSjpuI*=^uj jh~a th~ah-S}uke[^_]US]U M='ut u1uEM E[] UWVS}tE1ɉEPu EPE t!*@**E1f)'8D*tt;E܋EEEEi}9r(}i*M9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉tcu tQ=x*t1='P;u uEt tEu򡴇' *u2*t)|"}upuEe[^_]UWVSjjjà ~ jjj='tQCtN5') ^9t7P5' ZY@u$0PChjPhj.71*95*|btPu=*u>SKX5E t t&tt M ڋEsF떍e[^_]US1h/h+Zt$ltptZu⻀ۻԻ͡*u t8t Ph> ( ^j YV='u =V'u@t/jP‰١'*P*@YZuS5'DXZ1]UWVS411ɉMh0*EZt+}nt}put h/跁=*E1Eă}u*8Eąt2jjW{ uWh0jWHY^t Wh.0T*Eȅt}E*5* *Nx.}t 9u1҉1ủu؋1MjVE^ZMu u؉}tKE؀u?MjPZYEԅtjM1W€ ='uXE؊uẼu؈R*M ƒ}EЃE…tEEËEȉEԡ**U1Mx3t#t uE܉kuñȄ]܅u@1E܍EPjj @uq耉E]܅i\9]t}tLjSPY^Eԋu5}t/1҅tHi4hjuV(uS#Z}u}Mt7}t1jVW~ #}SXEԍe[^_]UVSu3 á*@*ujVjQ 耾t-S5'v ZY@u0*>hPhj.~u%+*i5rO;'t ,jVY[=‰tut čt ujZuVX *u*t}؍e[^]UVS=*th_/jPXZu ho//}Ph> msY^9~iPhNDsFXZ١'HyPq'H Y J u5' ^Z@u(0<hPhj.|*@*SSË*J*XYu*t{؍e[^]UhI$X*US] hI$X]* *uPUS**9|:t%uh:0q*X A1Ë]UWVS fE *E졄*E11}uEE@<}%<a~<w=$Z!) F<=Pހ<'<\"FEF1FEv t![0< tR0E0 wEi0< ue0փ8t "BQ u11}~ uxFEp"ntj@'t ɉ1:QS@'<}t!~u9SCE\U'$o0"u0 $l01E]CMt]BBuPt}t E"M@EE裄*E죈* [^_]UWVS]} =*3v$8Z!w jsZYu hEXht h0X6jsjs u7{t1h0*Xh jsh 1~[(h0js u hE_hrjs { t&u hEf^h0[js T u hE@[h0hfh0$XjsZYu hE Xh0js u hEXh0h[s hjswh0js h0Cphzs t=jvih<\jv U; uh0h09_vh0s!h0s010%11010 }0S9tRhj}WlWVC [w*yh ;:Phj]SlSvjPiZYh0h2NXe[^_]UVS]u t3u hWuZYtWh2 ZYuuƃ}tjuhfi j5'E0Qi EE؋jh\[!P݅tT}q *)Otދ*E؃xu*EJ*xF6p'ljUhE0cZYUu.J*xV P+'RE^,u*j5'E0bh E5''*1ۉ]*EP EЍe[^_]UWVS1h'E[t*@*j~ Pv *H*ZYu*tg*1rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPh1]Vh1]Y[ ȃ0 wF1҉U1ҍpЉvSh1&T1 EGuԃ}t{Sh 2Xf*@*S蕏 XtҁRW W *u*teu0&PSh-2eҁR Y5'NZZ'@thG2[XEEe[^_]UWVS$f11hY2QEYt(}St}at}Hu׃Ҿˋ]EZ!E؃8t@9tE Shi2*Mԅuxt heuhu^Z|u1ۉ]܉]k] EډӉM܉]FFHЃ w!̋U9и Esuh}2dt uh2EX 1RShj蜛 u9UrMˋEÉuZ!11EPC P{sCP3h2bZtWEUE܉U}uM}uGh-ZY t PhMZXZu ;u EUE܉U1C 1RPuu賚 RPh2Y 띃URE@ P赡ZY@Uu0S#Ph2G}t]u]u ]uuRE@ P [^y0 #Ph2bE؀x u_j轉$**tEUEUuu h2YY$}O 1SQRPș RPh5 X 5'VZ'@th2VXXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSM 9t#t9uƉׁvShb3ShM3ae[^_]UE0 w @8u1]UVS]1tSYZ1tpVhz3S% ¸tVVh?S  ¸t<uhSY^¸t0 vS Ze[^]Åt2USņ't1:ņ'uƆ'AuƆ'[]ÈƆ'U'PKR'PXZ= *tM=6'uD P  PԤ  * XYY u= jPh34a UWVS}] Fh3U_d1ۃ<'u,Ć'RƆ'3RPh33VuCuġ'HyP~T'H ^ J 1ۋ't#<Ɔ'tRPh3U Cuh35U[1Ɔ':dž't2'3t RPh3Ć'RPh3pU Cu'HyPS'H YJ vu&h3W^Zudž'@uK1'tPWZYuډe[^_]FuW3Ph3m^e[^_]USMU 1Ć'9u ]R@uQ3Ph3+^UVS]Ct&st PXCEe[^]e[^]UWVSP]1ƍ@uPXtUP0UBX1h*r*5*=*1҉*Ye[^_]UWVS }t15*EE5*9N *BE-uB<-uzu+t 5*1ۉ؃EEE@tcu}t*ĵ*ӃouUE8t E!Pu"Ft5*U!RPuSjGY[+3Ph3k\ru"}th3_Ph 4Rjz\SPXZDu)''u~uMe[^_]e[^_]UVS] C}أ*V'1Ɔ'@uV'jMX*8u=*un'='u*=n'u:j^tjYt ' ='u=n'u'='u ''*='ut :-u'1 Ɔ'u dž' Ɔ' dž'@uـ=n'uC=*t *u<@**P**jPV**XZ=*t6뻋u h4ZH **Pt******1ۉB9tt 5* *e[^]~U}ujjjjVE*@*jL*Z8tPX *u *u1iYUU0 wj jR Hu1**UWVS}uEt ]uQ t9-u Ayu+UB1ۉ1ۿE?5Y]-uyt͉:UtKu5?:u$EEEjEPh)4Yà EPh04cQy:u벉뮍Py:xuWڅuU?<:u!EEEjEPh)4Yà tEPhD4hЇ'Njh)4U^1H9ujRh)4GYà 1UjhIh)4*Yà U+E@1?1ɉE11ҋMPhj URbNhURh[4X ÊEEEjURu X( t1E1҉PjVe[^_]UME  hb4WP u*=*u*1ɉ **h*h*RppUVSM*tuA*u1:-uztC*B<-uztBu *˅tǍr8tuPh49Yy:u܀y:u.zu *J *2u Ph4V5*15*e[^]UWVSj**^Qzth4:8-0E *1*j*Yt8zt h4 V8-u @P5*P)Xu n*9\x9}h4벍EPYá*@** *)<}_߉ƋM9sω9s x19r )ЍpkME)9s 15* *u*tTSo[PY*9} h4*B*)أ**ljNx=*tE7X ZEy1ۍ*)‰ Lu1* *u*t T1e[^_]Ë'z8U *x@ @'J8'z8]ÃxuUSt P XK]HÃ8uU1҉P8u]UVSƋXCF~h 1A1Z1f@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P'JHR P UPUSUJtXxv-u~u C $t h5'B0+B8PCXe[^_]UWVS4'EX=uE8t h\!35''*} t u Eu P9!E@EŠt 9u u4''PP GӁt uu ljE)WPk *H}t *R\uG*x\F p\Sà u! *x F dp 4'> *xF Dp u"4'@4'==O A94''PP *xV P')Rx'X4'M)ȍe[^_]UWVS@} 'B ]urVY wVh5Vh5 4`]!h6j"S:FSZ؅tWh6}xM4`]!h'6jPFSUWVS]S5'M EZY9'ulP8_H= *9s<wDu 9rMW5*mZYt%*= *M܋=*5* 76E6S e[^_]øI'ztLUS *ttY6u*I#**54'P *ZY]UE *jZEJDU謳\uH袳 u"4''@8xtjjXEjjhD _UVS'Xt 1ۉXX8x tjb'1҉P Y1p84'P0 *xx*Px*0ƃ)c t,~tŁF $[! 4''PP @\ |td;Z=t g u,?&u'@1'@d|u'@Ǯ'@)&t;u,'@ '@ q'@'@r'@_a=t0 u74'@4''B0ztjj`Y'1҉Pjh"g!Vtà ؍e[^]UWVSSá'@tuy =',uyGEt7 ]!t,O8uQP,ZYu ]!^_8Et2jwu0Y_t XS4$PS- Rt '1҉P؍e[^_]UVS'p$ t jj'ubX(x,u{ upVDZuhq6P: uBPV軑'BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um'B]US]V9tjS]UWVS3t u%j _8XpZʡ'@؍e[^_]UWVSS'@}%11EuCPw C u j X1҉PYt8uj 1~^Xj 1҉VPXFYƉ}t'}ugEwRu ?}twu}um'@'@}t_]!t<}t jjG'@#61ۀ]! r؍e[^_]UWVShEӉM'@E1E*E誰E+']jEP@b ZYtxcTd*"t~L tgF=.H#"$[! Džd't+pЃPЃv;4''Yt藧PЃw tPd@d_ƍ@;w`u h6<\u<\uh6ރ?PDžd Džd11\PЃ \w t0)Pw t0Pw t0脣 Ad9ud(=w h70=* á*HCw6 *?ʀJ R *CC@wj * ?ʀJ w *CC *?ʀJ vH *H@ *Ywj * ?ʀJ w *CC *?ʀJ vH *H@ *;wj *?ʀJ w *CC * ?ɀQ vP *P@ * ?{ *?ʀJ w *CC *?ʀJ vH *H@ * ?ȀP vQ *QA *?ȀH vJ *JB *?ʀB< vA *AA *Xh07}€ u * e a]tW t)蔣'y \u聣=uh6%4''xtjjX븲Šd! <w *C *fxt @ *C=u *s\谟k u%4''@8xtjj^GJtujaY>uVZ0VXs;5$*};5(*~5(*}>uIy>u |u &u y1tm&ups1ɉK'djdB('@(X4'Pj¡'@(Y-u @ 1҉P  躚s'X$'@ 荚'`H,hP S'p9'@ Y (\u: *5*VXO"D3 )lhjډU*H\^{t b!*\+'X *d\@{1#Tþ}Tttb!u!KЃ vtQ}Tu ھ @T $*%*jjh$* T1 T٘銂b!tJ *xd@d\Xd\b!uJЃ wK *xd@d\Hd\ƒt:@Ѓ v0t' *\d\P *xdX=d;X=d%:t #u+¾Rdh\!YZ\!d*H*tx:C X:xCdXdt\dd9‹\uADdd1 u#}t *x#C )X#轖1Gfxufxt΀Aw@ ȋ'X2d[Nj@f@f@dw@"g!1҉Pf'uAW|"g!u1*\Nj@@d!f@*\$ܕ*HNj@@c!@f@e[^_]UWVSS'1ۅtXC1'0x tj'1҉P YF8Pv vS‹FP U8tSj'p蝚'Yx ubx,u\hp^ZuIu¡' up02pY1҉US@PvjjfHu? 8j!@'1҉P P'J0HCBHYvB'@ttjjjyCV'@^Xj蘾 'B0+B8C j 'p0JC 5' ~ uhvZYt hCEF'xjƋE0FEY'xu'x  jj p0‰EEU表'@cZu UBE밡'xt jj@0Fj?F '@Yt-Pv jj u '@FEM1҉@{j jC1҉SY^tNjjX=V'tt3j''@X&}t'@uWf^_VjjO¡' u@$x@1ɉutt;tj fXZÉs؍e[^_]UWVSP} uE E1E1}𡨇'X' u+p0ƉxXtӡ'pc[뼋H up$E0FEJ럋]K9u}} uwj' 4'H4^SZYuh7S&rj/vx t h7  '4'+A8FF'1x4M@u} u jja1E1҉j1ɉHEFE F '@0F[e[^_]UWVSS'@1yu=V'tt h7QGܡ'@nFuWj 芺1BUjsËUBpXYUjZ$C^Ut1ɉ ֡'@tj')pZƉe[^_]UU'1ɉHHPtjjX'1҉P t/Ht3'@j~'Ytrrh7('1U11ҋE]DUU Et 9Pt]UM4*tPt9JuB]US]jӸSCU PUPUP X]UWVSEPx [y h]*R(u;5'~5'ExWZ=w PWVI `jjjw uNuKk jjjjjjjj$jj SEpujuj Ee[^_]1=0*UWVS}u ~}th@VW à VW ZY}t9u9t:Wj X19t-y0GPVWh8Suj SVWh8!'9'}'؍e[^_]UWVS]{tN7Gu 0*} t} t&Wxjw PR+GxPi YWKZ1Ce[^_]US4**@*uSw4*S*H* u*t ]%]UVS4*t/}u jS$ZYstFxP\i X6͍e[^]UWVSu] '9}5'9~'9t7Si jjSV+9tE8Vh WPSh9%؍e[^_]US ' A ' ~.CPjjQh x9'}'Ph X͹ؙ } ,*]UVSu,* ~;$*|p5,*j Vg à x9'}'9t:2tE M܍E1OE9=(*|jM1҉@GX5'gX'@L1U~tF>0tV譫YwN9$*~>}u}1ɺ<ƒu,EEptVq_9(*}VhL:0sssru>轻1UPjS] @Uu虻0PShp:> !9t'VjS\ @uY0PSh:}!ju܋MZh:rXe[^_]UVS]u M1P1<@^!t#KyS PMX P]!<uFtPhS+ S4]!VZYt vVuQShMSh:EF y)KyS] P-Y P-PhS Sv XZۍe[^]UVS]ڹ0@*u!u ȶ*u*tX=*uOTuZ*tO*8tCt>*D*@D*='tu*uh *J0[^]US]SYt ]]鐵h5SYZtSN: Zu]US]:t%S>< ZuShj h*f*]UVS]} tKyS P ^(P ?u3Shq ZY?tH!VmPh> S  uKvyS~ P XɋP 뽍e[^]US*@**t8t P1҉Y*u1@* *u*t ]]Ë@*u*t9u=*u 1UWVS]u =@*u*t8t=x*…teu`tM t$tAW؃u>='3='u,=*u#=n't='u`*uYEPjSǵ @}tz tD1:='tt!Sv='<uu9ujPS蚳ZY@t^u`*u jS9 ZY1E܉EEEK>v ( DjEPjU e[^_]UWVS] }uhX s8^_t}shVZYuh: j5' xh ;V^_Eur*tF*@**Pj1ɉ *[t jVXZ *u*t6F@u1@*1Eq}sh}tVYY_theVH_Zt CE1#~puM} CEhX E0ZYƅFMEu}}(th1ۍF~u*u6u h;XV?Ph@M  C ~ hoX1ۉ@ut hWX11*tB*8u6u h;-_VPh@M C ~ h[1F@ut hY1ۋ*t7*8t+h;*PE SlPh-C@u91tLu==@*tE0Zu)E0>-u~u1}tE1 111ECh";RXECu\*t*PhIY[E PaÃEX?vEph;5'6 h;*Zu h ; *P XSCPh zCuui*@*t VX*t*P Y4*t jSJXZ **EO111Ee[^_]UWVSuu @*1ǻĶ*tB8t;*@*W-*P*H*ZYu*t5*uu e[^_]e[^_]UVS]u `*u VSQYX`*<vjS XZuƃ`*e[^]á*=@*u t8u1UWVS*1ɉ D**u@@u *e[^_]1҉*=@*u‹*t*}W/5*S&jPDS5}/t }wW/5*Xe?*uHuUS]9*t$jj1jj(jj*]US\1ɉM=*u'=*t*t EE****D*tjEP( [Zu Eģ*jEP( ZYt*@*jEP' Y[uO8Eģ*=@*uы*tǀ;ta1*jSXZ몍Eģ*bjhwX] Cvv1ɉMMMMEPjs XZjS豫YX1EEEEK>v ] DjEPjN ?"SPHO XZ5*ˬU*E*YUWVSh _!P` ZYj'Vr_Zu <)ș19e[^_]á*@*'t,UP1''Z *u *t *u*tp UWVS]~;1Wu uL ~ )Dž~E u F ~) "8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu*CfKS u>*@*sCC CC*H*^uV*tMo Ffu9s*@*6CPRC S)S*H*ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9'u]e[^]e[^]U5'uXZU5'u~XZUPuu EPa E u h; uPJue UEPu u UE Pu5' UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'Vn_Ztt~tnh;V觸 ZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h _!V] ZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9'u]e[^_]se[^_]U5'uXZUh'IhЇ'?XZU8ruPh;Ph<UWVSSEPE X85''*j=RUlZYj=SlZYU))9~߉Ӊ *I *<=t$t xFU蝙p UCɅxUU] Ue[^_]˒ UE1@u,*+*Rpp h=<jhT*TT*UWVSu} ]t t9u t1141b!Ft9tb!!@t)[^_]UWVSS11ɋ*tZuA=u܍P譕EY1*t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE;e[^]hE<S$ ZYSZZ9u;Sh> j'SjY^ƅu+Sh?XZ/<'uh]<sXuS)Ph`<o e[^]UWVS]} sSt"CtS҉XuEs1Et WhʷY_}t5uhʷXZ$'Jy R[ 'z9 _F>=u y:Cu}the FPZY'HyP'H X J e[^_]UWVS=l*uh* h@l*Y11*tJG} tE t8tEt.h*9P5l*l*%h*XZl* 9uJjj\ Y_UPxPUR3 Hx N9 uW谬XF!؍e[^_]UŠH8-u>1tfzuhT jjh`!1zuHhi jj ha!BR;.uhT jjha!h=P脆ZY¸a!t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&PFl_7;";f xuWSX[^1WSZYuNf$ `!)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!] ] 9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$t`!SV^Y[SVN_ZYSVA[^SV0ZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PV^^_xPSGZY04]E9uc9u_E98PV^_uWxPSZYuD04MU9u9uE98f9]PV^_t1oxPSZYu鋅|9u;xu͋3E 3U $^u~t05'mjaUWVS j EPVv M9u$ӁM]]19Ms Vh>j]e[^_]UWVS} hIjjXZ}7EHEwW:-jBjyPhI; j5'j ztz EEuh>`wh WZYÅtbWV XuU9u ztN"zUW+ Yu URP'DPtÅt S Z@tM}thX 6ZYtƒ ˆU1E}tMڋE8%u!PaX6h>_X~G1ɉj EPuctljыE 9Et>8u9ut1u uI 9uM8Mt#y޸uuPh?8 ECSW- YZ@u'(}>RPh8  E}t jW- XZMuUVS@<\*@*X*@*W53t j=SSPYZt hSXZ+ Phj@]S9jShw?j h'h(j h h[4 ƒ Y u= j Ph3mj,h|?h3\j h h^0K$e[^]U=*t 1*|*R'*1***=4*t jY'''Ї'ȇ'tP#1ȇ'ZUj1ɉ *CR'1*'Zxt@胈j*@*jXZ1`*uƀ`*@@u *u*t UEt]UVS]u tVs XZe[^]UVS]u @j!$`i!Vs [u CEe[^]s ?yVDF4$VsJVs Vs[Vs GsxVDF[ ]VsVs C[XZD[SV [ tLu к*ۡ')ƍN;EȍCẸغ*Ժ*EȉEEpJ<\uBU1ɉaE衸'HyP'H U[븋JE<%u}%u?'Jy$ER 'ZEYui YheAVO2 _Zƀ>*uFEEhzV+2 Y[EEE8.u(px*u EhzV1 _ZEEu uhlAEffEƋE@xWBtG,%A[A< $j!CCA<2hIEܡĺ*tPf^um$ǣĺ*YE܋E܊@<<~8Hw0$pk!b~<'tz<\tv<"trflnhrdt`v\ru P'DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС̺*tP3Z1̺*Ⱥ*tPX1Ⱥ**1ɺ> E5*FP蒋£Ⱥ*XLx׉2Es}t"tRSuuh̺*@3 0RutRSuh̺*!3 Ruh̺*3 @̺**b Ek5*h> `غ*1tغ*1҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPub_XMƉUйjEV}t uWVuP(hWVStWVSWVNغ*th؉EM܀"t'uEЉUmЊM  Sh@M o*ZY*e[^]UWVS}]W Wy YZ9tPVhNE)ƃ Vh_EXZvLE @PE PhnEƃ }tuhEYX}tuhEXZtj Xw E*wtƀt)CuCwܸCw0 sƀtC߸C{w0t sC߸DUw2ut߸Dݸ D-w2uu߸ DݸDw2uu߸DݸDw2uu߸Dݸ Dw2@uu߸Dݸ(Dw0 u@u߸'Dݸ1Dew, r u0D߸:D?w1y%  r9DED%@w*r x޸DDܸMDw*r uLDUDw,rrTD]Dw,rr\DeDw r$rdDqD  rpDY7E w us#0zDu yDzDw׸D w0@usḂD߸Dw0ƀu@u߸DݸDw. sƀuḏD߸Dw, r s㸗DḝDtw, s r㸜DḣDPw. s s㸤DḪD,w0u sḫD߸Dw2tu߸DݸDw2ut߸DݸDw/uu߸DݸDwu%uDD uD]wEwtt)DuD%wܸDw6ut߸DݸDwu@1Du۸DكtDwt8 Dt DDwu uDuwEwt EuEB%=t"w uC=uC CC E sE w us#0Eu EEw׸Ew,rsE%Ew, rr$E-Edw,r r,E5E@w,rr4E>Ewr|r=EFE rEEuSE& l!;t3C7P3hEjd,V) 111ɾ l!$tVF8 ($hEj ,(PFPhEj E(P A u,P EP YX1Ƀ Qt,Pd EP[ XZe[^_]U ePhEh'j U*DF=*uuPRPh]Fh'jY UWVSQÉf10;#uCj EPS e 8t Sh> jY E8tWShFj}Y e[^_]USÊt%<#uuSHXZt@*]UE E EE]VUWVSÉU}utj VS  @t 9E s  z XZ]UVS ,* haIjT ƉӉ1 RPQh@*V ,*9t"uRShIjT PRShIjT e[^]ÅtEUVSÀ8u1.hPn ^ZÀ;tshV ZY8t΍e[^]1UVS._ƻ s!ICtsPVRhIh'jUWVSÉ֋t8u VhGjURM/_ZuuE8/uc*UUU@j}WM/|ZYuC*EEE܋E@jWM1WY_uEuƋuEEEEVhI H*XZ1e[^_]UWVS ÃPjhJhX'Cfw4x!h_PhJhX' s(hCJhX's,hJJhX's0hQJhX'$s8hXJhX's4h_JhX'}KhX'hJ^ Ea6WhJhX':vWhJhX''F (twu1hO SFY_ujhO Vd x!t"VPp_Zux!f*x!uhP11҉zY[thG vVh!N f*hSE_Z1ɉ>Éh$Vo_Zu h$VoZYu6h$VoY_u VhIN e*h_NS2E_ZDžum>jP11҉(Y[thiN XZ *G}Ɖ듍WhNS~ HuEt9$*s(hN6 $*f**Y[f**uƅhRS>D^Zujh*h} SDZYujh*f hNSCY^uAjW11҉_Z*PhNSCY^u.jW11҉_Z*hNSbCY^u.jW11҉t_ZL*hNS#CY^u.jW11҉5_Z *hSBY^u.jW11҉_Z*ThNSBZYth OSBY^u.jW11҉_Z~*hOSUBY^u2hW11҉d_Z<f*h2SBY^u2hW11҉!_Zf*~hOSAY^u2hW11҉_Zf*;h&OSAY^u.hW11҉_Zuwf*h3OSMAY^u*jW11҉__Zu;*h>OSAZYu9jW11҉$Y_tVShNu*wPw{tShRO F;$*rShmOC ~!jShO ‰$*H*f‹8*H*hV _ZƉ>uhG Y[w!;twW=Zt ucPVW= uT-w!Ë@*Wu=Yƀ>thV _ZƉ>1hx!tP'DPt7hP11҉,ZYt$hG [_ Dž"!y v5VhOd hOZ 1ɉƇ**$q!0*<*<*H*WH*16C-fC0*<*<*H*te@H*t>16C‹<*H*h*Ze[^_]UWVSP1۾w!PhUP: Hu9Y[u uVh|[YI][<1M9Y<}Ph[A Y[1jP t5(*uhX'=4*~E1]9^~ t)t;FtF5(*WuhX'+FGVh[ XZe[^_]USBHBy;B| X RQG XZ]UWVSQ]u uh$S F fw4 {!hOPh$S FPjh$S FPjh$S Sh 9 XZFXt Sh$9 Y_FXt Sh$9 XZFXt Sh$9 Y_Sj \ v(h$S( v,h %S v0h%S v8h4%S v4hJ%S $vu-8t/jO,} tu ShR])G Sh G _X뿃} tu /PhR]F 벍/Ph F [^띋$t $PADYP4DZ}t E1_jPSz y hF X7ƒu*t=tRhK$u h e[^_]UE*E *]á*á*UE Puh'*Wh'j , j UWVS]T,8ށu=*t5*hP2 YX=@*t"=*u5*h^ 1@*XZuu ZYyWlJPh t7=*t.j X=*tS*P5*h^ j e[^_]UE Puj' UE Puj UE Puh UE Pujjp UWVSt1ۉ*Phg^_y h^YKhVup }t Ƅ1ۍPWYZyWh^NXZ]%=`uz 9u;u*Whh*8/à uWh^뜍xPS蟖^_yS끋%= Sh^e= u0t,WhV}/à t ߻Wh_+Wg Y#0hVà uh*h> BXZ멉؍e[^_]UEPK ZtPRPh8_ u uhG_hh`* `*UD*tjXj 'US=)j0h}!jH*jjQ&)]US)j jj'&jj&(]UWVSÉ֋x CPww wwփt=*~j X*e[^_]UWVS1=***1***1 Dž u/hM_hX_D [^Dž SUYu@ Åu@3hVǃ uVh> xA XZPXEtVhv_ Eu {u{wu"Wh_h' DžQCC jhPjV(Ãt'$Phzd@Sl @uS[WaYD P'9rDYt)PH*t4KRWQ[ u <tPȉjWC1ɉK C C1{;*C**XZ{ t%VwYZuVh_D XZ?jVzGlG ^GG1CG8{Dž*Ed@DžT*Eu*} u:E 5j Ytsh_j s _Xtvh@M T 6M 9~=* 1ۋ9}IU: tE 9}?C9Ft16uPh_ XZP: Zy5*ы1Ҩuԉ ^ EtPs ssh_ ȃƒt.t&Ps ssh_h' Dž StPVS t"1*C* s:s:S: 1ɉN*H*~ X *9;**?uǃ tuU E 9|q*I:t'h `Ph%`h' *t`;tuPs sshM`h'm ͅjsVsUE u \  )9 _ TU e[^_]UWVS]fU ffCffBCffBfCffBs s3Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss`Y^} GWssJY^GWs$s 7Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHsuu褞Y^S~fCe[^_]US*tcQRP$*]Ƀ=d*tf‰Ã=d*tUWVS$ƉӉMС8*EF,E؋BEfE졠*KMK d*Et EEM MEE1;=@*D*>f}3EE܋Eؙ}E)9EE у}uUuG=*=x* }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AE8*1}fG18f@@XZtA 15*8*C,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=8*9E9UʋMou{58*C,)֋C,C,)s$S(;h`SNjCSMEAE@ufFZ[tA 1*Ee[^_]UWVSu^8C@Pvu uu uhPu u* )P@1ɉ5*NP t1҉ 91CtCS OtNCSWVk+QCSLCS >WV+CS yP @1t|u!<|uxuxx u xv8|^u |tx*=*XT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp 8**H0|Ãx} 8*x58*f's*B0C9sjh'V蕥58* C =*t@Y @[ JPdh t19}#8@#BLlp>Ãxjh'pPh`j=*t h`% Yh`OZtWC jj*@0 RPJ P^_D*@0Ɖ =*tL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|21* ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jj*@4 RPjjWVv f'8*Hɉf' f'f'f'f'E'=*tE']E]C WV XZ=*t CpSt C(T1ҋ *I4 xtWV`([^11tjupE贡 8*f'UJ *@4B9s$Ujh'QMuM 8* UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_Wf@tPh`$\=*t+=*tC CC C u#ha谸 YhaڰZu1*1nu t3f@^_ *$*jj ¡,'ƅDž Dž1 *X[tBBp tBBtPR^_t *$*h aӃ[=*t/5('jjjj *$*uh8a蘯Yu5,'RPjjt*=*toh?a& b5 *=$*ut(jjX@[ZHfAWV$1 *$*XZ=*tj  _ *$*ut!jjRP! *$*uu hJaRPof%[^f=@hvasha臮ZY5 *=$*5('jjjj *$*utRP5,'jjEhjj5$*5 *YƅDže WV}@@PP WVaf@5$*5 *5$*5 *6^_8thax1ɉ *[@*D*tCjj RPu{C9s#Qjj RPN0ӍS19r)#u 5$*5 *iu"ha蠀h} 1*XZ$fH^_f@t !5$*5 *hfu8!t%h5$*5 *5$*5 *#@Z[@fAs5$*5 *gf@5$*5 *ha$u thaj =*j t XeY[^_]aUWVS}u w wN@fEEZY9ucp*t=*t =*tj jjjw wup*jhbW[ w wNYXG $*9O u,'; *tOf%f=@uWRhbd~w wE)Puh&bB =*us=*tRyNj C h=b~XZ=*t2hSbر _=*tfE)fCe[^_]q h_bݩZHt1ɉ *x밍e[^_]UWSá*p8ѻSYu1ۅt$ *q0RPká*H01{ ؍e[_]Ƀ=d*tf‰Ã=d*tÃ=d*tUWRP]Y_}UWVS,u} }P*T*9]KM])9ȉЋU*H8UUE9|"A!!EUM]9]}=*tuI!QWVhqbj *MȉẺMuuWVEMEЉUԉE؉U܁\TtCЋU!CEUԉE؉U܋CEU܉EUEUEUE9ƉUCEU܋]9؉Ћ]ظ=*tduuWVhb蔧 *EƉ׃\TtAЋ]!A׋ARPuuhbE ZEȋUEUԋ]9؉Ћ]ظ};=*tuuWVhb *uuhb $럍e[^_]ÍL$qUWVSQ8QEU}9Es9=@*D*Esuuhcyh*l**sx1u؉}܉Ɖ׃uЉ}ԋ}9}Ћ}}sEU9E}(\1ҍMQRPuu؉EЉUԋEUEUċ}ϋUEȉUḾTt E"CC C*HT t1CS  ChX(*,*=*tE }̈GE؋U܍eY[^_]aUWVSX *E*1RPu udqEEƉׁ\TtCЋU!CQC RPh`*5|**}d*=h*ttt5*u5|* ExU t U tuhd^_X1EU1Ee EU EURPË*Y^t@@psEtCCt_EtCXCdK EEPS9XZ=*t *@ * u u^_}tjjjjuuuun (*,*}ExU uEX\á*1RPu uKn E@ *EL@h R5*w5*5*ѕ=d*t*PP虹Y[5* `*h`*芐*XZe[^_]ÍL$qUWVSQ0AQEȉŰA Eċ5*FPE*Ef%ǃ}tCSCS V0UE}tEU1ɉ ft1 uމ#u#}̉u؉}܉9E؋E}ԋuȋ}̊M t 9|P}tFTFD1҅u{uRP}ĉ*@0 E1uE1Ẽ9Ή|[+u}̉EUE9ƉU|R+u}EEEUEEE9ƉU|.uuheYEȋỦEUEEEE؃}t DT1҅uuRP à uuuuqEU䡐*EԋKMЍEPuuWVmu}}MtT j1҅uc *q0RP肌à MoEĉ*@0eY[^_]aÍL$qUWVSQH9*EątGWGW EU5*F0E}tE1ɉMԋGWEUEE1EԋGhE1҉UNPEU t1҉E؉Uܸ u9]|bEƅu1**X0EU=*t@M؃ωT ‹E؃T ؙ]UE؋U܃EȉŰE9EȋE̋u|uMЋ])M]̋EE؉U܋E9EȋE̋]|c]؋u)]űMЋEȋEԋueЉE؉UM܋E9EȋE̋]|.uuh6eVEЋUԉE؉UEEEEHËE}t1 DTtVEEą*p0EU=*t! uUADX}t DX1uRPÉEă uuuu|nE؉U܋ *MEċpEPuuuu8jËEUEȉŰMtT- 1҅uiueEƅ*@0 EUEU=*tMċIىTUċRE@ `uuăf *q0RPˈEă 1Mu hVeT*@0EUj=*tGWEUPGWGW E.Gh eY[^_]aUPheh' jyw UWVSSƉ׉uEPQ U 9t:tWVhfj e[^_]UWVS É5*PSXZ=*t=*t hfTXVSa^_t u=*u1h&fT[p*=*u6*Ph?fToSZYt hVfjTXhkf_TXr=*t8=*t hf'TX=*t hfTXhfT_=*u hfT^'=*u hgS[/=*u h4gSYr6=*u hYgSZ8=*t=*u hxgSXP* $( @8 $(RP54*50*5,*5(*hgS*@Di($ʉ1WVRPqjjj RPhRPk(dd$WVRP?jRP ($hg^~ @=*(*,*+@*D* *(*,*5*NF)ڋ~,f,0*4*Ӌ~4DӋF8׉֋ $(+ P*T* 0*4*u't2!RPhgZ} =*FSQhg9} =*t4hh#} *Xtssh;h}  j | X=*t4hBh| *Xtsshoh|  j { X1=*=*=*=*tm*jQ 04h 5*5*j5*5*赉=d*t*PP}[^5*S*Y=t*t1҉*jBX1ۡ**;Z,sDtPXCP1*X=p*t =t*thvhO*X=*=*u hhO_=t*t hhO^zN0PhPT Y[u70t-1҉,j,R Phh"^ t=*u hhOXnke[^_]UWVS]s{{@u(EUE9E1s WVE܃ WVhrs sGX*\*EUX*\* E9U}Xs shiTN =*thj ^Ehj/z[u1ɉ *j<j8p C EE}d}uJЃ1H*r80*4*jWVp tEWVhps sP*T*EUP*T* E9M}s sh(jj Zu#1ɉ *hBjLhj y[^px *u**1҉*9t9zu9rt9zu9rt*C0S4MEEe[^_]Ƀ=d*tf‰Ã=d*tÃ=d*tUWRP{NY_}UWVS0RPM詀*xf%ftGWGW sft3j`h*GpP5 umjhp*P5 uS3j0h*G(Pp5 u:j h*GXPY5 u#C uu utkhVj KhdwHu=#ZY=*t *@ * h1=* H*L* *t04A09rAA09rf@u79s#=* hwj=*ufuthju^Hufǡ*@4EY[=*tGWGW f5*N0ASQRP[y%=* RPhj f`t f ufp=*:9=*h*G(RNd1RPS5|*Awt hjDG=*t1Shjt !PG(P^b=*t 1GG1GhX5*(*xgș9rT=X*t;9ظs1ttht)t 9sw Dž1H~A^tڋNtftH붋 5* 9ظC tIDp Dtt=*u0D(PShjq d|(븋DpTtuRPShkq / *119ЋAt\C띋RPhMkq t uC~3|X=*JuDXVPh6kp [^+W-pY(*,*G fFf[j 'Zu01ɉ *hfkMDhjap[^u-ju~jqf Xp**f@u;u tW$*  F=*=*tzGf@t`@ GpfGGGtfGXZ Gf@u1P*T*X*\*FV *tGGp}FDtGGtcFHtGXGdI F@VWR[^=*=*t =*G\u&G`WduuGhWlutlhkBhk1nu 1ɉ *&'1G\G`GdGhGlaf!qXZ=*u]*P4 @0ȋ^4É΋X0p4=*GW *W\t@@I0D115*uFu=G\#8t-@DNL!!ڋNT tF8F D`Tdu#u@DžVCSSS[tGh19u9VSRPhk:@=*t hks YhQrlZ Ë@0V4^_=*t sCSZChVx@jjp4p0pHpDӁ hl_?hdjkH6aZY=*t *@ * #he[^_]UWVSĀ *E1E *E;A,}EEU}\TtAЋ}!AEUAEUEU11}tAu}׋E9ƉU}4Ѓ1H*E>HLY4DEUE9ƉU}4Ѓ1H*뾍U1E_ 10*4*(*,*E*];X,W}}1Euu *U׉e^_\Ttq֋}!qSI SQh`*To5|**}d*=h*ttt5*u5|*脜 =*tE@x *E1E= *t7*p,kEd1E;SVuPh lh'k 1= *=*=*ExU t1U u E#uhHl;[^ExU uۋ}G\M]ȃ}tgu EUHu}u}11ۉΉ!!u6u2EU}9}u܋}9}uԋEUEU}uE|*ËE}uu 1ɉK<}%?}u}9t uuuEZuuhwl:j] 1}MECEUEUtxu}9r WV[X M89xu9tuËEUtx5H*=L* H*L**1҉EUtxEUtxt1x1 E9EEEEe9׾r 1)ӉΉߋ|*E]3u us*|1҉TYm9}u9utc%?u9tWVhal;9jv[ SuYXu Suhl9uEsE)Éٍ1EPE 1`*e[^_]UWVSEP@EUE@ E}juu艻 t`*t`}9xuPu9puHEuuhpEp p `*qyEpxu}qy `*9*u *u덋=`*98tEUMK؍e[^_]UWVSTU1EEv *`*111E*H,9M= *t5kEd1M6SMQuPhlh'"g 1ۉ *1ɉM*U;9soWVtXZt`u} *tCCpd*tEtCCttEWVkZY8tEPSZYuE_Ee[^_]UEU @,+B,]Ƀ=d*tf‰Ã=d*tÃ=d*tUWRP8Y_}UWVS Ep8=*t 1Q=*tt1;@*D*slj}1RPj@F[_DžEx48x0.Fh-uP-ZY"}O_ u9ttFPhms4Y_lPn`ZFfSPVN whl>`_tr<Fo)efFYPVW|NGfSPV`NE@0P4p pihfH DžU;B0B4wr r@Y[=*ƅhhP譿 * d*ufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFhP躠ZYucA1A =* ~hmEp pFho^H1*EHX P@uuȉhmSQRPVFD9m>tFPhmy1_XmP][tguE@0P4=*t hm'e YP1҉P FfPhm#]_u@@ uE@0P4=*t hmd [H1ɉH F>ufWVK C+fFPVSJfWVJuDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uh n ~ .u)hnEp p֝1>ho[EH0P4 19@*D*s h.n=*tuHu<~t6hDn1RPEp p蔜=d*uHt%~u븉Fho&[[H1f1RPcXY,t#B<v^uM;A0A4o hn1RPEp pЛh=nZW1ɉ *?M;A0A4t!=*=*9m1mR1RPEp pPh=nZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0PhWnPhn-=*t hn` Xh=nXYU;B0B4}R AAQ=*tTVC9tHhn1RPEp p™CFho~XHt 1҉* DžfKPRhn>+u Dž 1 e[^_]UWVS\jj`_ZP$~!hn+haW[^u 1ɉ *}hjjjj8hn+haW_Zt5jjhjjjjآu hnX*1ۉ*hjSW^urjhejdM ho+ha,WZYuhoW_>jj%[^@%@3fs Ph!o)=*tjjY_fXZh j5*5*c1ƅDž 5**9T= *tD+*=*k#)WSPh=oh'Y 1 *C$w0h`oss 8*A 1C$ho 8*QC SRPRPhW^ 8*C$1҃=*tQRPWh{htoa)QRPWh{htob)=*t hSb] _ 8*C$D1C$=*t/ss CNjC$1~YY=*u$GW 萷h_bTZHt1*GWڍ@1=*@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=\*u*_5*1ɉ \*9s؋{$@1=*@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =*thoSQRPOhvvvv 蜓fOWhoSQRPhoPu 1*,v vOYf@fOFVFV RPhvv 訒**49s$;ww Y1҉WWY_8u؋=*9s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=d*tUWVSX**D*9= *tA=*))Kkd"VWSPhoh'S 1ۉ *ss WZY{u { <{u{t t&5*tC=p*t8=*t/u*CS 9RPWf@1C SCSut+RPWW¡$*Y_:u9|Css菰FXZ95$*|)js s賜Y=hoE"haYN /ss^1ƅs{Dž  *^_tBBptBBtVRPZYu hpx!_Pss觛tQDža ssvVPtUf@Y[5$*5 *UfHXZ4e[^_]UWVS EP@EU *E*RVuu}8EEƉׁ\TtCЋU!CQC RPh`*R5|**}d*=h*ttt5*u5|* ExU t U tuh?p [^1}E@ EE}juu跢 pEUЃ1EUH*0M;*Ӆt3}9{u}9{trzs{*RoY!}tdExU uEp`ơ*RPuu5E؉U܉Ѓ1EU܉M؃30*4*Ex@t+jj*@4 ؙRPEpHpDp p` *Ez89x t2}t,E@$ EL@ EEUMW}tu}to*E{89x u^E@EL@jRPEpp3K` tPuSzch 5*5*885*5*W=d*t*PPzXZ5*A!*h`*Q*Ee[^_]Ã=d*tUWVS\U1Ee 1u*X,9]$= *t/kEd1VSuPhbph'L 1ۉ **u1EE1ɉM*MU;9WVġWV/QEu}*tCCpEtCCtEtCXCd EEH$~!EXftbWVgYZt=*WVhp!WV]YZt!=*WVhpG SEPwXZ*Ѕ9xu39pu.JZHX*R莯jhbEPTjhb,t {u{ { u{u jhpjhpEP迵XWVPhpE;Ee[^_]UWVS* *|jjgO1󪋅h^_=*xX$=*uhqnF[uh+qRY=*t؋1҉$*h 5*5*45*5*`S=d*t*PP(w_X5**^HXI$~97`)q~$tl<hNjH`ltW,Ћ9G0sVhEq$Y[n=*tVh]qXZhqqD_C=*uՋB,t|Cl$1~H`C|@ltË#XLS5 *Ϩ|Y^u hq| **h 5*5*725*5*Q=d*t*PPtXZ5*@*X*ttDžPLDžHLPƉPX1󪋅lT0TGLÉX$~@=X*u\\`H`GÉXDžU )\tu{xlLtuQ+HhVL\DžU 1DžTDžhDž`TPhq1hDž`L1 *׍G@tu tL9u⍕1󫋅8<@8ؙ!!Ӊtxt9Ɖx}4Ѓ1H*1tX,9tQ= *t5ktd1VStPhqh'CD 15 *tl1ۉpttڋ\Tt$dӋt!_؃QO SQh`*}F5|*|d*=h*ttt5*|5|*s =*u-|xU tU tthqrXZ=h*th`*G*X=*t =*uh* * *d *AhdlߋplƉ߁\TtAЋt!AƃdAId t1RP5*5x*B *lߋplځ\TtYӋt!Y؃qhISQh*D=*tth r ^_]*ph5*5*{, =d*t5*5*oY[*\8 uǀ\TDžd5*5*KXZ=*th5rPDE^_u/5*5*Y[u͋d9*u *AhdlߋplƉ߁\TtAЋt!AƃdAId t1RP5*5x*Aj5*GXZΉlߋpËlቅlpplp8X<HX9ƉH} XH5*uy|||@tXl)É@,dPfdt9u6xfdșD1ddff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU uH1׋h󪍕U u P1׋\u"xLu DžU t11ۋ;WVpBZY< <<tt<<tM U u Pdك⋍d9s WVPhYrO CVtuPU u PU u P1dX9lpHH*Dlp1ۉP1Y8P9ك1DrNU u T dPщ@ы@ @P\9(hIdd1HU u HPU t  L1~\Hdd11ы1Ƌ1f$H`d`ktgU u Tjj(Rdd)ٺ!P~MH8șlpd]$\`pd11;dsTd!Ӊlt @lt$9~ҨudFAl뤅t$9~șdl tLjS P =*dt'W3VslsQs thvr4 (hrPo<ZYtej PS #h 5*5* #5*5*A =d*t*PPe_X5* *^1ۉ*=*tP|p`|P  uT|PTxU u |PTHU u HhRP hr\PW;ZYtw`S|! HU uHڋ|xU tT |GThRP!h`*z;*1*=*u)|xU |P\1ۋ9TU u P|~U t |V\ !8uC<1sY|yU u |Q\r0t‰lRhr-YXl@u1ۋ|@L9=U t | |G`U u T !8uC<1sY|yU u |Q\r0t‰lRh sUXZl@u닍U u P\RP txh,sP8Y[taU u P|xU t |G\\RP&h`*8*tj SVr  =*ts hGs/ DhrP7_Zts󥋅ƀƀh 5*5*!5*5*<=d*t*PP`Y[5***Z1*e[^_]UVS1;] s8ShX ?/ ^X1E0Phs'/ FZYuj 6. XÍe[^]á*!UVS1ۡ*srؔu <=*t40'hs. YX"susP.Zty=*uɡ*t4肣*1ɉ Lh P5*5*5*;=d*t*PPh_XZ5**X15*C *=*t hs5 [hs-Yti=*uۡ* h P5*5*5*:=d*t*PP^XZ5*"*X1*j-Wj$WYXuj\Zuj\Xe[^]UE(*E *]á(*á$*UE Puh'蟨 h'j  j # UWVS]}8ށu= *t5(*hP, YX=*t"= *u5(*h^, 1*XZuu [ZYyWPhX, t7= *t.j b+ X= *t{P5(*h^!, jJ" e[^_]UE Puj' UE Puj UE Puh UE Pujj! UWVSt1ۉ$*Ph^_y h^YKhVu }t Ƅ1ۍPWYZyWh^NXZ]%=`uz 9u;u$*Whh *譀à uWh^뜍xPS^_yS끋%= Sh^e= u0t,WhVà t ߻Wh_+W` Y#0hV BXZ멉؍e[^_]UEPM ZtPRPh8_ u uhG_hh*( *U塄*tjXj jyUSzj0h~!jA*jjwz]USwzjOE jjwjjwWz]Åt3USӃ=*t+PhP-) YXSh#tXZ]Áu=T=Tu =Tt=Tt=8 u[^5***Y *8<qH։9u9RPh{*BHЉ8< =*uho ZHuqh(z X=*th 5*5*/5*5*=d*t*PP=_X5*8**^ *@DqL։9u9RPh5{>*BLЉ@D =*uho [Huqh(z Y=*th 5*5*V5*5*$=d*t*PPhSP5<*5|*ƃ (*,*0*<*=LBALt[=X*h|`hotY_jjjjjSW;=<*fGWW:fG@*CJtejPh| =*uhQr Zu9hk X=*tC=<*fGW9fG@*_fCff=v]h}Y=*uh/}Zu8h8}W X=*tfC=<*fGW{9fG@*_fCffuihE}AY=*uho5ZuDh(z _=*tjjjjjS:=<*fGW9fG@*f{f9}zD3<:u XZ=*thc YhoZu 1]UWVE5 **x=d*t5*p5 *e+ e^_] *ÍL$qUWVSQQ9@* D*s RPh/5* *1ۍ}WSQRPU Ƹ8';sAeY[^_]aUWVS\]u EUEUEUEUEM1ȋUM1 uE u uE )uu*_Z=P*u <vuE LD]e[^_]V P*U1EEƃE9Eu E9EEUEUEUEUEUEUEUE ]uuOURP\S 6)lj$SW2wG/ 9rbEUEU}t@EUEUE E䬔RPNURP\H1҉P*#}u1ɉ P*1P*}u}tF?N)Eu ]e[^_]UWVS]\T?2} 4E uh`sT} Zu hh`SP =*t ha _=h*Lu=d*uE PP%Y^E \=d*uPPK%XZ1f Fff F@9u=d*tE PP%_XE \Ǎ=d*tE PP$Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\PT UWVS}u=*1*x*y |*h*P^_=*=*=*t hj[h5eY=*u׋* *=*ux șRQ**h S5*e*5*S2=d*t SS!XZ5*r**x*Xh *5x*5<*Xh`*5x*5|*zX$*1t- *t%FS5x*{sKXSEXϡ0*9t )PhP1=*=*=**=*t hg^h[u 1ɉ *=**ƀ1҉PTXh P5**5*S=d*t SS ^_5***x*[=*u h Y=*tsh *h 5*5*g*5*S4=d*t SS XZ5*t**x*_=*tqh؀d 15*h 5*5**5*S=d*t SSY[5***x*uZ=*t"D* @*kdPQSh .5|*Xx*Ee[^_]e[^_]ÍL$qUWVSQ0E11҃}5*F8E11ҋ]9]E䙋 P*T*)ӉMȉ]̡H*E1ɉM؋Eؙ]9]؉Ћ}E})E1EE]MEBE9t,EȉEл]]ЃrAEE䋎E؉U܁\TtFЋ}!FEU܋ *QF EURPh`*5|**d*=h*ttt5*S5|*- {U tU tuh?p XZ5*EU؋E} 8ȿH*{U u{`ߋE؋U Ⱦ Eu9uuE0*4*5*ML}9~8u+KIjN`EPSV}){$) )y h 5*5**5*Sk=d*t SS8^_5**h`*)*EY[GE9}}S11ҍeY[^_]aUWVSu *!Ut 9rt8R}t-j%JXu hb1rBЍe[^_]UM *#AU9uRЋR9uRP]USEM *1!t4^Fu(9u 9t331 É[]UWVSu} ]9WV*ZYWVqZY*tvL*t9XtjSRL* M]XM ]$HX H*t}9xtju5*mH* UMHU M$PH e[^_]ÅtUWVSE ]S8!4uEE@89~]ȋ}rA!4!ϋE9x8|E!9u%EUEUxUGXZ[^_]US] EUR`t(t7uS /u<<+  !8]RhX!h.UU ME@`t+tDuTɃu:< %ЃPhH!h.zUSE MUR`t't6u?Ƀu)3  Rh8!h. ]USE MUR`t't2uAɃ)u+5 Rh(!h.蓺]UWVSu E$ %EFlU7EFhU'EE}M}~ !ӈExE$E8NpU9r UùupE9}!Etрt EFBۉ)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tV?* _uVhp6j( `1ɉPhd@u  tGRhedAu / @u!48tuh6ZN XZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(h辉ƹ ߋSh6VCPh6V  C Ph6VCPh6VCPh6VCC,$C,Ph6VC0Ph6VtP茲X}!uhzd@u  @RhedAu  @uuh 7j.' 4}1󫍅Pu肟^_@4ȋ999t(Ћ}1ۉ1E1ɉ [Eƀ*P{&j PEPA 1e[^_]UVS4]jhPjS23uIjPjVSVu؋E ʉʋMQ؍e[^]UWVS]1PS蚞ZYx=1%= j/S~v ^_txrt11PRS)PhJh0W jP Ƌ 19}Y WP"ZY u$PSX^_yvA =@uG} tE 1҉ RPY[uk%=@u4hRh0W WqdÉF= j^_1!hh à 1}PSZYftSYylR9u 9tԍ0P蔷 ^ZT8P8RPS yt 1ۉ h`j$V jjVÃPhFSa y/8u|S Y랃}tVP UZt8PhF|@S yhF S_X1-tPE^}tIMQ3tPEYt TbZy SX؍e[^_]Ƀ=d*tf‰Ã=d*tÍL$qUWVSQ(E̋AEqy AEȡ*X0]؉E܍EPuuWVUMUЉMԉE9މEs *p1MЋ])jj`SQ/ǡT*U4ڃr hlc_W!ʈEȋxlEHX*!9tPRPhT*u< =*t h(z ^ho[u 1ɉ *1!EPT@P}̉WE1҉PPPTeY[^_]aÃ=d*tUWRPY_}UWVS$EԉUMQƉ׋EE*H0ș9Ή} EE9EPWVuS*J09u EÃxthXșRQWVCuWVPuU tUB EPE܉UM9ME9u9t)MЋE@ E܋UM9Mt7}t1a+E9Et }tE`M؃PESTCPƉE9Eu1E`e[^_]UWVS,E @XEȍ]ܹ1juȋEpG ޅtPEp[_E P@"EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0hn,=*t h(z) YhoSZu 1*1)V] CSFV rC8S<e[^_]UWVSPhjjIƉRP 2ÃfCd;EPjjSP*;B0u UztWVM_X5d*u  *QrRP E@ `*M ȐȔh P5*$5*5*[^=d*t*PP] ZY5*Я*Xe[^_]UWVSE XChSlDEU}}E=*tP@P @ Ɖu5REXuh耫1҉*YX5d**@0RPWVqSx E@ `ChSlEU}u}u h2*@09EUs } }AEPuuuN¡*@09u u~thJXRPuu3FEPT@PChSls}EbUBXEU}GWEU G8W<5*#uTGPWTEUTE@ U B 9t`1e[^_]UWVS<]uEEtEuEt5*f *EԋސޔuRPAE*ؔؐY^uNw9$$!1RPuhbjRPuhV1MQRPh%j` RPP.f%^Zf=t-*ڔڐuPhՂEPjjQL5*;F0u Ext%{rt4I5*1DXZ@F^=d*u^F9t'ޔސuhiE`'P9uъ*8PufHEf9ue=*t hud YhdZu 1*t*ؔؐH^_5*1ɉސޔ{rޔuL<uFuh豧XZ=*t h?am ^h8aYuS5*pXZ*t4,EEPjju!K*Z09u Extuh+jS @EE=*tP@P @}ԍu6G뭉EuV)Ee[^_]UWVS}]O,uhhP!h` ؙt,hՅhP!ha hM U Msu)u؍e[^_]UWVS}]O,uhh htQPWVhr$r tQhu*,hjRjWVr$r u FlWPl1S X1e[^_]UWVS É։jQRPLEuhS[^EfUt)tWVhCSu Y111҉UMU슌 tu@ tiE}u҅tou\uXHtjjh_S>~jjhjSjujjjjjS iytWVh}S~WVhSjujjjWVSE ,EEEEEPHME@ uWVhS`~0E1ɉM܉EuuuuRERhS EԋMQуt;t6juj1RPEURPS uiMPBtruiu`thC}u}uhhSY^,(S @u,(hS EjjEP11ɉ6 @SjjjS1;t-jSRYZtW@ P$@ utS9sKjRP jWVS@u/tPjZSX1 $ ؍e[^_]USQ]tdҀBuCu'EPhd@ @u%hSXZuShS E]׏]US]jSZYZuhjS? YZuh4SXZ1WY #UEF9ø| 5,2hύe[^_]UWVSxu >1;VF|~$u~,u;VV | F_8tZu[tuxY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ||t2@|jmURj$O8QpUR|PtijWR'V uYjuWUu@uuZYjuPUu@v0sh"u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h2S? 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uh<SZY<$E܉E1EuuWVutuWVhPSLEPuuuu[~Ɖ׋EUutuuuh뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^h 5,2_X1td1SщU!MYZMt/UBuShu h j覗XZ뫋!!  Vۉe[^_]US1!!uhِ軕 `u܋]UWVS ]} WhIS 1!!EԉU#E#Uut7I;tuWPS W!S EԋU!E!U`u}u}t;uuhjuV输 I;tuWPS. WVS& ؍e[^_]UWVS]u tEU E UuuhSY[ SZu E@P9sPVhSۍFEPS Y_EtVhSV 뭋EU҉EU#G0#W4 E UG0W4SZ@tuSZYEU#A0#Q4 E UA0Q4S_@NVh8S Ee[^_]UVSP]u >u>j EP5,2{q U ߃ Ku;=?v5,2hXS A BEziuUŠu 5,2h>뱍e[^]USQ] ;uX!1҉j EP5,2p  U:u1҅u.8u 5,2h>u Ћ]UEUitstau+u P uPeZYUD@RhkP2 UE t*u 5,2?ZYt5,2hu@ US] ;u#5,2V Y1҅uhuXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~hPdY[E1eRP $RPP[Z/@8Zu%S5,2>ZYQhӑP ֋]UWVSu }jj hIWVj]S }yEWVuh }t Shߐ ZYj Xe[^_]UWVSQ]M tu E EQhS'M $j+XZM uWhS 9jVQjjuuSU 1ɅuWh.SV5‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_ZthI6jSY^ujjjjSTEU}u&}u hySXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt hPP @9E}}EUuu h'EUjjjS@ $uGY_u h̒jPjuujjS8 uVjhSU p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PSg<_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS <ZY@UB߃}uujSr@jp juuuuS u hb @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9'tE !1҉Ue[^]Q,(h8&$hCH $1RP,(wRPhT hf jS\ uh{͓ XrX CRPhڋ s,s(hs4s0hĔ$C8PhhxV7Vhה蒋 sPh腋 1e[^]UU E$E8E U]UWVSQEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^hPWE UEԉU؋E9EE]}5Eu"WVuu uuuuhPz(1 AU1]1 u`U3U ]3] uPt3}ut(EuMWVuu hPMEAE A E$A$tMu}t=}w } !w!QRh/u<1ۉYMuWVE Uà  E C E$C$E;EMu7E;E u/ACKtX EYEUQ#E9Eu0E9Eu(ACKtXYE܋U)AQ qMԋE U+EURPEU?E t]s{ px EUMԉQE܋U)AQ A}G{YK_Gtx)E}䉸hKu"XZ؍e[^_]ÍL$qUWVSQ8EAQE؉U܋A QEUqy19WVuuput-E؋UWVRPqΉE؉UMWVuuout-EUWVRP^qΉEUMEEă}Eăx}PEЉU1M9ˉËMY}u}tE9E؋E܋]DE؋U^9E؋U܉EU}XWVuunEU}u}t6EЋUEȉUWVRPnMȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}u}tE9EȋE̋]9uȋE}uH}uB19}FEPWVuukыU}ut#ΉEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@^1EċEčeY[^_]aÍL$qUWVSQȋ]yIX P@E؉U܋w yh\uhwurXZ~thGW EUN^ }u}u O_ uuSQM؉]mM؋])9]u 9M@E9؋U}SQuuhuO_ ȉ+EUEUVFV +EUFV FGFtxM]M]SQM]uuYlҋM]ut&M]uuSQM]/lM])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U# M]uhKugt tN-}uA1h 1hٸ RXYS}uMQhԙS jHJ8QRUP0(Ur 1B$E1r(z,ꀃEE}S_@tPS^@tFUȁ¾1uuuRuSz@uhSZY1EEe[^_]UWVSSÉЋt  Ujq Pq qu uSU uWhS &PSZY@uWh:VWhVS|1e[^_]UWVSÉu uRP@ }}t}ME E UMEEE @ Ur $Ep PFVEPF V$EPFHVL1Fv VFE0S@uuhuS uuhSb1e[^_]UWVS]} tE H!1ue[^_],SEUjS thSjSrjSd jSVjSH u uhɚSY[z uh݅t)I }9y$uu9q t+Ph.S 븅t*t u5Xu}+rz WV tjj _Z@ultjSY^+uu tjjr_Z@u)jjjjSuu h^jjjS4ƃu hs1fdžUjuu썆PjVjjjjjSC0PSY^@uhShaS0XZ1e[^_]UWVS4u ] 1E%huVǠ tPSu @u95'th\!jZYjh Suee[^_]UWV !}^_]UWVSH]u }1ɉM܉MMMMMMEhܛWV)Eԃ @t=}buEPS^XZ׃}qtuԍEPEPEPSv@uE95'thp!jE1;EE}1SuMu_t xuPt9pu 9uU@uuuuuSsẺUЃ}u }E܋UEĉUȋE؉ES|ZEHEPSEjh !Pg1uuhS\ g$1RPuu^EUSXt E;AtIhS_Xqy 1U9ЋU}`9u\9uuW}u}t,1U9ЋU}=MuuWV\ҋMu#u}t 1uhSY[uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,S'Z@tJup(x,S:@t$uűMq1uh7S>Eԍe[^_]UWVSH]u }(,EUEhWV\ t(qtsu&jsEPjjS@uzE95'th!jG_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuhS Z$1RP,(\Ɖ׃uԉ}؋M9ȉЋU}WVuuhSjSEY^tPE܉U}u}t hEċ@ EjS_Zu hpjSY^u hRx G EG$EjSg jSY tu h!SXZE9Eu"E9Eu}u h8S_X1E̋p GPGTEE܉EME9s3Mjh !V}- MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuh]EԋU+EU9E| h.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u hSZY^ U܋MHE܋U+EUЉQ}u hםSXZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uhS @ r $󤋃p PF V$1~PF0V4j\V\FSv H PAQPA Q$PƉ׃q0y4AHQLS4@Eu}UԋEhS[^MffuSZY@h8Íe[^_]UWVS]1uuuuu11hVuu  btENtoat%itClh UY1EPS&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9'uEU t th!jHZYWVRPuSwe[^_]UWVSDE։ϋ$]$ẺUMЃ}u}tE ua]tWVPuu i ;E] er#E tWVRPj 1E%EtEE@u}wERj hIuuPu eVz*E }\8EEtEű}EEBE@EtjhWV~O %1ҋMIM˄t u tfRPuj MQh ƒEE 9shEčDU)ÍMQSO EʋUXY}u ED }tjhWVPƉ Euu EʈE}t"EˈE}t t ű}؍e[^_]UWVSXE׉M]u E]u t4jj hIEƉRPj]STy&E j@URPUME[ƒ u묉ډUuuuhh U:t Rhkh ZYj g Xe[^_]Ë `'Q`'y ;p'| tX'J X'UhX'Pn XZfx8tNUVStjmuVj$8PhĞjjVEP虂 $t SjXZEe[^]1UWVS΋UM x$!Eڞu 1ۃt h]g XhZPg Xuh 󫋆Rhf X&8VhhtV=Vhf ÃhEe[^_]f E~u1ۃ>t h{f Xh+nf ؉F VX1ɉ9u 9AuhSf h:e _t6f~8t/sDžuQzjmWj$8VҸ6tt tVhVhDhWWhie ÍtY^99WSChn7e ZumudhОe E EGe[^_]e X=߸Оu PPh5d à Iى؍e[^_]UWVSljӉrhjd s3hud s shvd tsh]d XZ{thhKd K Cs31| C "C 8PhhSsShOc FPhhtWFWhOc Vh> hS$(VhhWWh>c WS t Sh/yc YXVhDhSWS軥t ShMc XZF0V4ut!RPhPPhc ÅtPhxc S e[^_]UWVSxƉ|PE_|t 9St[RhßV趸 T{ sډ5Rh۟}b $1Vs3щ¸A$1Vs sщ¸>(Wh> hV WhhtSz SVYZYuhhO VC SVha GPhhS7 ShOa $jmSj$G8PŴShxa ha G0W4uu hGi XRPhPP+i 1e[^_]UWVSxpPYps'2N xR vhխ x h ` hx h ` hh x \ tDžlpt Džlp@hhh lv6x l4` v vx l` Fp `Ph$_ N Fv61 f~ Wh> hS WhhtR tRSڡuhhO Sÿ PhIth*H_ ~tu-h*hhS ShIth9_ *ShIth9^ GPhhSU ShIthJ^ hIthY^ ƅhj hIFN x$$RPjSnJ(x Shʷ`^ XZdIt FN x$$ʹIdt SRPQhe^ `t;FV hQpщ‹x t Phm] [X ^jmSj$G8PưShIths] hIthu] G0W4 uuh/e YhRPhPPe Gh6x)] ËN Fv61Xd `FV hQpQщ‹xǃ ted؉WZƒs*\L 9sHt)))к WRhIPhf\  Ftw]F 8P%V 1󫋂ShhSxShIthJ[ ve[^_]UWVSX1ɉMMM *11huu bǃ x`HttWtA}ˠ뼍Ol$А!뤃럍EPu EPuE_Z@u7skc [`SKh*uZY4h0!jɿY_! F=*h Zuff'ft)$URjh jjj jPo }uEPhht@W輊 u E*u<ttu$*P"*x* *@s tE 9'th0!jپZYju8^_uEu ha Y؃tڋEn;EE}3uMuZt xuPt9pu 9uU@܋EEtى‹EniE ǃ>v> ÀtGu_1tq EVj@MQuщ‹E t P?Y9sNjFV j@MQuщ‹Ex tPZ9EsEv뎉}E?v? E?vE?%EuFs}sEhխ WhEX huh3X h_ uY}vv vv6h۠W N Fv6" yv뼋VOQMQSщ‹Ej tPWhW FV MAQMQSщ‹E8 tPuhlW  FtLPhCW XZ N Fv6^ vXZ7 h8xV Y1e[^_]UWVSD] }1 !}E%uh2uu ^ tfitJTt,Lte[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPShW4 uEyƒt CPhV# uJDžVW蘥ZYuh[^%BuhZAWh螊 uS PhЇS tShRp Dž@$A 9YrÅuYkuhZhD!hhP~ tVhhtW WhO StFPhhWWh&S߅bv$v hխ SFv,v(h S*v4v0hI`S̈́jmWj$F8P*u$Sg_ZWh& S0 uhg藈 hq[[c Yh ;萊 t9h L XZu&h7蹟S .X'VS _XX'tVDf ^SZ1ɉ Xe[^_]UWVS]} U ;1,hR$W,s @$t&Ftiu5,2Dž,9='tE x!1ۉ]e[^_](,$($jSMZYt,uh*jS/ZYujS!ZYt,uhS躜 1ɉHh ;VYZuV= Zuhhw Y^uh륋$1QRP  uh̦SC  1 hR XZthVlZYtjhPD u$hSV  4PhЇV@x F41$1$8Ph&Vy TP8Y^!1RW($0$( ,10$(+hq $_ZOhgPZY4P_u"jh !Rw umVCY8PhO WZ dR8ZYdt8h S 1ۉ,DPhխ Wu LPh Wu g,9DH0|;LPh,S莙1Vl$@P , uhCSXZ:jjjsBu @u ho1$ 9sP,Q3 ;$u9FjRPQHsBu @u h-hr$,<3 ;$uF9$shZ _X h RY^Pƹ,hR PE ZX+tPhWpt t,0PhGA Wu ,0PhWt ,0PhWt ,0PhWt a,0PhO Wt =,0PhWkt ,0PhWGt ,0PhW#t ,0Ph˥W8t ,0Ph٥Wt ,u/(~ǁ#,$ ,0PhWs ,0PhWs ,fǀUjjjpBu@uhSI$,0 ;$u ^u&H$,ȍt _Y4t 1󫍽@WhO Vz tuhSՔR@ZYu(Wh&Vz tˍEP@_ZYt@h S腔 fEPhխ Vr tEPh Vjr mEPhI`VPr SWh& V*z tj$EP@1 5 XZ h5 Xh5 _ut9ֺ})؉Rh> 5 ZY.hq5 X!rJu|1e[^_]UWVSVu{ _uh!hjyƍEPG [t hڹjyjuVENj] t>sV@wZYu+C xu"t s srEYXj 3 ZuM Xe[^_]UWV։P Zt hǩj)yj: MQE 0Xe^_]UWVSuE @80ƅ77PhuVRc t 7uHVH ,Z3V _t h0x jWh8 # Ttg81ƅ90 #@󥍅8Ph#jPS0Ph#jPuV VSh)jxS:E [t hڹjxT˅tdS zuW$(,sjuZY(u1$zu%B Nj] t>sVoZYu+C xu"t s s>YXj ~, ZuXF Xe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u h,!hʨu+^uh,!hjqsP3 s Ws h݃ u t.PjEh uE tZuHEYLEPhi?u[ }Chs@Pu\ @qh@uXZt VYhHucXZt QXMEPhi?u[E Mu {hE EEEM؍CU`EPu u @Muh,!hRfEftft5fu6t2C t Whajo}tC(UhC0ut3hjot C0sHtS4KL9sщ}t:s@shu+[ us@s`u[ @u;4{81t/sl`}t$CU[s@s`uZ @uEsd6CptSuZY@u s\hs8sXuZ @u s\h> te[^_]UWVSPu{Zu1du _tLVYt4WEWu  tPMQS uS[1VZtSKX؍e[^_]UPEPhVueƒ 1tEUWVSu\PhYV] t\Mfnj4Zu\VXtd$1jRVhVhiSeY@tt}f1RPhYu d1e[^_]US]uu S? @t ]]1]UWVSu u[^u yP5Y9Esy?V?Ƌ}M)1Ze[^_]UWVSu u[^u 6yPY;Ery?VƋ}M)1Ze[^_]UEPhpnuYƒ EuxUWVS8uEPhV~Y uh~hP!hhë6rhV_ZtP6ƹ}[E]ShiV4}ĉjSQPhu ;ƃ SYt:EUu؅y1ӉM]! EjEPXZuVhu VHe[^_]UWVS1Rhiu54 @t|j7RPhhSmހ>tVhDB& Vft j7RPhhSm;tShY& S[f\ e[^_]UWVS]hS<Y^tVPnZthih@!jVhëcpVtƍUܹRhiS<3@u hjRje[^_]UWh%1󫍅hPhiR2 t|}UWVS\PhuV uh~h!h0hodShiu2 tT\`ty1׉\`! ftShiu>2 @؍e[^_]UVSuV|ZtÍEPh{V,V uh~hl!hhnuS#1^Xu hjhCPSZYu hl!hPh@u  uhl!h1jhSՋ1e[^]UVSSu] EPSV @uh!hRjehhIVZYuh h!hhn@Eu PRS`He[^]UVSSu] EPSV @uhL!hRjgEu hgjghHV[ZYuh hL!hhmPhHSHe[^]UWVS}h`W [^usP,pY@vhSV"Zu hhj5gVPh`W@u hjfxtdPhiW/ th뮉`SX`e[^_]UWVS}h۲WFZYurrPjpVmYXuhDVSh۲WK@u hj:f1҉Uu]EPhiW#/ @u hӭj9fSlX1e[^_]USÉЉʅu It>QuRPSh#! ]UWVSu1j+Vhxi P;Q@uh UЉUP肀XۋUu hjeU]Vhxi WP @uh+ڋE9E~E19u~tj  YWh> q FXZj  Slj UVSPuVZt"ÍEPu V @u ShDjd@P8 UWVS$ƉUЉhPR[ZtPƹY1@]Shvi Vs-j SPhuà VmHZe[^_]UWVS(uEPhTVNQ uh~h!hfhjMԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EPXZtVhu VHe[^_]UVSuV[th݃ VZYuh h,!hh@iPQ^fx PSr+ZYu hj9cPlX1e[^]US]EPhZSP u *o&juS-,ƒ 1Buh!h> 蛈 XZ]Uhc% 1US]dPhSO uh~h!hh]hd|lPhiS8+ @u h X1]US]dPhS0O uh~h|!hhgd|lPhiS* @u h螇 X1]U1EEpPhiu* t hja1UhIuZYuh h\!hhGgPh@u HɃ0 v+BwBÍBwBUPm]UWU1ERhiu) @u hӭj`1}W|$wUWSÉЄtGjj hIQPj]SS~J zIt>PSh h_r¸u@Xe[_]g_UWVSkҾuh!h֮j5`jLh'l0_ZItʮjmh'P0ZY¸ЮuIWPShh' =h't VW?Xjmh' 0ZY¸ЮuISSSSSPShh'` $Vj UEU P]UEU P]UEU P]UEU P]UE1҉T'T'1]UE1҉\'\'1]UE1҉d'd'1]UE1҉l'l'1]UE1҉Pt't'1]US]Sh'.YZt j=CЃ v؃߃Av jh'YZ>uj '1]UE1҃t`*]UUp't H9t@]UWVS41ۉ]܉]E䀖*EԅƉ*EPj! ZY@u hEU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=*}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EPc* [@u hڹj>]}‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEP Y[=*tSZusu0 j EPjƾ ZY@UEM9u]9uE9E-9ŰMhtj\UWVSÉHP]ZtP_D 1D1V!LY@u h8!hʨ&RPHSƃ uh8!h+j[R1RPh9hWJfWVh jVWVWhiLF@u WhƱ t Phױi XZjVWUWh~iLF@tt Ph, Y_j D pHZ@uh8!huu =`'j:RPhhW`]?tWh~ WV| j:hhW]?tWhk WU| tHSW?YXjVWTDž@WhiL^Euh XZjS9#jVTW_TDžd1hlWhiLE @t|hYtXu hl@1dWhiLD @@u h˲@lhF @RJ| =*t%'w!Rh  Y_HS XZ=*u0=*u'DjHSDP jV`V0SV*-{k?PLC@u=*tPjPXh   *BXuthuXuth'uXuth uXutRPh h -J *_uthu^uth'uYuth8uZj 0 5X'XSV65p'tjHSVv e[^_]UWVS]S^t EPu S @u WhDjpVu  SϵYݴEtuh@!hBjVEPE# EZt hڹjVu1EVtRUWSZYU}tRUuaSZYURhVSQM tFE= *tFtj= *tFu[= *tFtL= *uE=*u+!Hu)}tj  XhX'vb ZY U6"=*tj p XSuu@) ja UWVS,ÉUPb^uh@hNSiZYucU̹ Rh8i(S @u`8t hXjTjhNuVSPhj TUWVS]U hS裵^_uhh`!h2höY‹ *ށ؃E u %ERUNjURWP tDPEV?ZYUu '9ERvE ËE É *X1e[^_]UVSP]U ChSδZYu [_WPSVP Ãt7EPS5 *@ƣ*S)v1FuBU *e[^]UVSP]U hS<ZYuhh@!hhönXPUSuVPM Ãt7EPS5 *f?ƣ*Su1FuBU *e[^]UWVSS]U hRS蝳^_uhh4!hhöWƋ *%EVVWP ƃt1PuW>ZYuEM É *1e[^_]UU EkEPhui> uh~h$!hhö!W *%у uсE ȣ *1Uh'h!.^ XZUWVS]hRSh^_u3hSWZYu"hSF^_uhS5ZYtP * **!‰ *d$1󫉕tVh7iS; @u hjjQPe[^_]US] u:Ph> X E tP:;Yt Phw5 XZEPl;YtPSh ܋Et Ph XZ]UWVSuV%[u h/VYu1P{4Z@u h!hʨp 81jS8PJ8Ph8i(4:@`%1󫍅`PhiV @uh!hjOtWph X!Ht#8tuP9u Q XVh XuSh _XjPbmY^u hzjrN\8Ph8i(49 @uhXHr8Ph·[ huW&7Phη h h4j  F뫃 u]e[^_]oe[^_]UWVSӉϋuu 0Zt2tVWP裮 u3V1ɉ [u1VAZV8[X Xe[^_]UVSu]}t 3XjJNPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPuWBpW豹Y_u W ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPf>Ɖ׉‰ 9иr E8tW8"uoV;sC| C 9s} V"WVsY^u V 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPIX1e[_]UWVSÉUMU1}E;E t[ztMUj8d^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PlXC$ue[^_]UWVS1ۉ@}u U'E@u E@ u*PE 0֪ZYu6PE 0轪^_u獅LPhpnE 06 u 10 L0t 1󫃽0 00_0nu8 [[Hh HP H,ZYu Dž, EXtj/V] [_ÅtC`1DžT0XDž\@PTP,V ǃu@xuPqTbTt/0u#xPVX ZYHufDžtt,Ttt ST]1Dž,tN(j DPSBr ,D (t8t1ҁ,v HS"1҉(VGjX(0tDž,1ۍ)EfEVh9iSƒ 1Bu hvj2e[^]UVS ]u1ɉ@uh!hʨjf2EPhS) t,juVM E؀8t-EPhnS2 uE>)EfEVh9iS=ƒ 1Bu hvj1e[^]US]ڋE6@t*EUfuu uSPh ]ËPtB Pt8LDPu+øǺPtLDPu øºËtO-tEºt8LDu+øǺtLDu øкUWVSljӉʋuFEE9s]19tc  ^w@v|USh_W"L K 1UvAE9s:2UFPhCy)ȉMP] M UuRWK u9utD7...}e[^_]+1e[^_]UVS ]uVhiS @u hغj/EPhS= uh~hا!hh5E߉EVhiS uEh7fU XE1e[^]UWVS$]uӹ!1j EPhfSuh!hGj%/EVhiS} @u hYj//1e[^_]UVS ]EPhhS uh~h!hh4uVhiS @uhغE؉EVhiS @u h7j.1e[^]UWVSxhShwuQ@uh!hwj;.DžDžDžDžDžShU_Zu?Dž1ɉDžDžDžDžjSh L u ؉8 P'DytRx:uL҃0jWVh Pt;9u8tMhj,jRVjP\ƒu#9;t 1҉Ŕ@|Phi8uƒ 1Bu hj,e[^_]UVS0]juVheSg@u h!h˻VqbZu Vh޻j>,Uf@fEލEPhiS% @u hj;,1e[^]Uh'hV9 XZUWVS] }1EPh8i(S @t&E1r r r1ʹ|󫍕[!RhiS @[< v Phj7+hۼ [P\P <fDžLVhiS @t%fNth=*t h XfDžLVhiS @t%fNth=*t h XfDžL VhiSu @t0Nf=) Ph  _X=*t h YfDžLIVhiS* @t0Nf=) Ph] XZ=*t h!F X|1󫍅|Phi8S @t}u(j 2 $PhiS@Gh( EEEEĉEEEԉEEEEE|Phi8SO@uh Xr}uMu u uuBEH~HEP'DJtx:t~&jPhyG uWh0* ^_1Dy h Y Pt`XZGj, Xh4 Y4t8h@ XZ h Xj _PhiSF @PhiS* @jh!PZ u ftePhP? [^Vf"fPA]PhZ  ft Phd ZYj  Xe[^_]U81EE1҉UUUUUUUUEPhi8uO @u hje'1UWU1Rhiu @u hj,'1}UVS]EPhlS uh~h!hNh,uVhiS @u hmj&1e[^]UWVSSÉ׉Ph>  S(")Í6 9})j< X)ЉU~&PhCy GZYUJuj> e[^_]j- XUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEhK XE1e[^_]UPEPhu# uh~h!hh+ME\UPEPhu uh~ḩ!hhH+MEUVSjjj"胥 y hJ \1ɺuBhPS y hJ ZuufiuSXe[^]UPEPh#uG uh~h!hAhq*MIE=@u hjr$1UPEPhu uh~h!h4h*M E@u hؽj$1UWVSƍt1fDžfDžRhiV y hj#h'v 1l)ƍJ(R!R _9l}l' Džl hӾhvhؾhtd hxhh1llhܾC (pp(dp@!Pd!pP Y`*t `*Ea*tI@tc@tC@tP@ tS@@tB@yA@pXx@`1ҋpv9}pL9}B\pfP@u uw%k pfx p@tp d#!= = w-g 1u=w_f?v-k 11u?1p%:=$v1"- 1p1p PVh`*SW`\VPPllh2 p@"Xp@!dǃ0X*w'Owt4tov2tW0 Z=*OGPySPh0h6x =*uWZdPh> = XZd9s ΃IyֺVRPh C Ȁ=*XGPGPGPhLhU G1d_19d&j> ^=*GPh?RKStRTRPh_a RPhiP F뗀=*GPhp+ Y[Gd<G=PuZh{h>  XZ=*WGPh GPh _ f`Wֹd5t-\PQh K \`f\TddTtHPtPtPtLDPQh K 봊`\d<"\TL=PuEGu:hh>  ^X=*GPGPht t#=*dhh> 6 Y[=*GPh XZ1t D ҃L dd`Idt#VRP`Q4!hĿ Cu_hh>  ^X=*GPh{ GPhh wW ÉTӹ\t-dPQh+ N dϋ\fd`T T`tHtttLDPQh K d\kT`Ph] ZY=*)w '$!(tx1ung6`;YFRQK[Dc=k6s/}(! 1OG)Xsj pp)hXh'"e[^_]UpPhiu ulh? Xl$Eu h jEwE1UUq tb t [l Jt1']á*t H@4rp *USE UUXt=EEEE1҃UjURPI$ 뺋]UE PujCC Ã=*tMUEE EjjEPEPjEP@ƒEBuhXÃUS E=*tF9Et:EE jEPjjjEP1@@uuSh5 ]UE PujCC UE PujCBjUWVSj= N^ _9ȉ|+)ډE܉UE9}| F@111F uEvh}[^E=*t*h*Yth*F$0h-j%"tvh6j? ~(]tz^ uvhiXZWuS1}}}}jSj' y hYF,P0vF,0hj!jZ1EEEEjSjF$P0vF$0hS jH!e[^_]UWVSӉι1j P1 f6j SP1 E8}u Ef4S{v\jSP P\uPh rXZXe[^_]UWVSQыX u X(uIpV0x}xtVuW e[^_]UE*tQMQUEUUEjURURPPtEph.XZEIUSp8C YtP 8s$8XZC(tP7s,7ZYS7X]Ã=*UWVSƉӍ1Ph<j P< fDž6jEPS ff>ff {u S5Y똉u b1҉S4}u *1C0 EX4C0؍e[^_]US]S<Phj S*P*~ UuÉ=q t5rOv t-tm t#mrp tT[l tb cðsUSPjh8!謾jS脾uShBjPZ@uSh)j!]UVS]E pt&I>v N![^]UShh*h^hS S]UWVSlE`E]U1EqEhR uSEPSjuVL8 @uh dUE`EEE1EsEEĴEhR英 uSjjjV7 @u h*Xe[^_]U=*t]]UWVSS*t `@41ƅG*1SBUP6 ZYUt؋[4׃K9tWPRhN#;CF t~u CC)Cu-shsKCZYXjPU[^I1ɉK?1*t#CuCCt jP XZ[4ٸrp e[^_]UVS֍XjRS: tjVhIhIS:S:ZthIhIS: e[^]UVS=*jh*jyI|Ph茆 @tk}u}t_]MUE9ډ} ډȍMMptAxjpPj I> *t{t C1s41**tPP^t hCYjjjjj *t =1=hhXZq =*t.q 'Fu؉Hurp e[^]Ã=*UWVSE*֍UUEj}WURPP ECCEE*jWPP tsh3^_1҉1ɉKCt-C0S4tP4*S4tB0؍e[^_]u '[l CjCPGK XZ؍e[^_]~e[^_]USQ1ۉ'u *tW{u/u '[l 9CjCPJ XZ[4jEPj tUk'tڋ]USS*t H@4jjhIh{h\7hIh{hG7 14,!j)ZY@t1҉*j Y8uM=*u)8 tjEPj? t؋U8 tCuh0Xq ]UWVSd15*W~11ۉ]]]]]E}W]SjGuVSj;H Ãjh1mZYu1>B1uuuujEPj˵E1}jhKh';EPh hhqjjPu6hT[jjj jWjtjVjjj1ɉ 'jEPj uD8tuhZ6UE$E9uV,PhBjWjjVj q EҀu+=t$h(jjS ='_ ='tjWjjVj'pÄt8=t1 TEEEEEP X*jWj5jVj+Ov e[^_]UWVS( Åu1EEEEEEj]SjjSj>EEy1=*upE1ۉ]jEPjf t%h*蕸Yth*hj VhQhyhhjhyhh jjj jZhU9t/jVjdǃ u8thyhh%ẺҀt(ƒuIhyhh82 q y=thyhh jS菳r=tt9u='b uEEEEEPXum e[^_]UWVSl1=m (E`jjEPh*hv @umh\Z8EPuVhf @t5U1}EEEEj`RjjjV-oVu*uh*_N9t h^-hh*ZYt=m uF1*1*jjhIh̑h1hIh̑h0 É؍e[^_]USQjj]Sjjh 'R,thuF*Zu hzjVjjSPjh ',u‹E*]USPhoh' h'h9 Shah' jB UE E ]]UWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9t!'  9$t! !11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t!/ $ 9L$t! !11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]! $09tu! E!11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t! $9L$t! !11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]! $9tu! E!11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]! $9tu! E!11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]! $9tu! E!11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t!9T$!uwy|$y|$L$ ˋL$ ˉ$4$19t!9L$tm$9T$t !11 [^_]UhRx jjh@'u 1҅tPUWVS jEPEu_X1E9}2uSP ZYt!SP ZY tG1EEe[^_]UVSQË0tRVhEPV"EROZe[^]UWVSQ1:nuzouP!X1҉Uh PVZYt98nuxouSP%ZYu}SP%ZYuE1Vx!Ee[^_]UPPPhh'ݼ jl UWVSÉ} u,PQ kcZY u Qh^1t VEXt*h(W菅 ZY1usu4h,P ^_u'~u M }jPZYt1ihKjhlW uU jZP,Pi t% 9|\ 뭋QRS) u* *u17hsWj VhS EtJEt&EtEt6O  uhV̜ Y[0'tShSh hV 0 ,Dž@h ,P XZ9 PWNjXZڄtVB L<-u.1j=V Y^t$S@\S4Q ,t1|=*t}t=*u}uD]h Y19~4h@M  GXZj Y=*tc$P\Z@u h8\ Xʚ t t6h8 X t XP=*tj}t0$j j(N @u h _',W3h^h,R迲 P,R8tV,RhR]u ;u8uWVWhS j[ t [PY}u, Ex](jj  WS$ۤ ~)t}u2hX',P XZj P$蒤 ~j,PN @uhc X,Ѓu ƀt&qttP4"PVh蜘 H}* *0SVHY_@uVh XZ e[^_]UWVSj Ph ;11to@!tZD!t =*t>H!Fuu QPhy !ǃ 끍GIt>Fuu WRPh& tGuu Ph  t 0h>  hа XZF=*KtSpuu QRPh)蟰 =*huh> 耰 sds`sTsPh;j slshs\sXhWT 0=*~chSjjh(ju.t%j S ^_tShv h 谷 YtElPh> 迯 XZe[^_]US] 1t-tPu ZYu*1=*]UWVSEt48nuxou *Ps X1uho X1Y,u@B uP_uhz S[^ljxj,S ZYt X1e[^_]U\ Phh'P jߤ UWVS]!11҉tE1ɉ02'111plhu u 0r=dhWlSh?,@uSVh5)jn@t(RPh!hS$Si j躡 USP]jEPS< U :9uySu hb)j]US]SZt@ huSZY]US]SZt@ hSsZY]USP]jEPS U 9t :uy Sht)jn]UVS]u VSUYZu Sh(jo;/t"Sh'(藐 XZu E@(e[^]逐 e[^]U Ph&'h' j{ UWVS EEu EE}]EEE1҉02'h2)Vu t4ouBjWh!5,2u hK'jPY붋'4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh"g,@uL- tV't" 0Zg't}'PSh'jj UVS]u VS,SYZu Sh(j;/t"Sh'(輎 XZu E@(e[^]饎 e[^]U PhWh' j蠞 UWVS]E1҉#11ɉd111lhhu u HuLf$M,9tQG.C|g$!UC| C|C|C|5,2CpXDžlL5,2CtXDžh.5,2CxX5,2Xjuh@!5,22u hK'jPX5,2G YDždC|'P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPWc YZ@u Wh1 jltECphtECtNtE%CxdupV V艑 @$XZK|ǃe[^_]UWVS SVdPhWu u&hWdShV,@uSVh5)jBf@tKRPh!hSSh 0j@ USP]jEPS U :9uySu hb)j]US]SfZt@ huSZY]US]S8Zt@ hSsZY]USP]jEPS. U 9t :uy Sht)j]UVS]u VSNYZu Sh(j;/t"Sh'( XZu E@(e[^] e[^]Uh jUo h'h8hUhhPhh'J j֙ UVSQÉj EPSV U:uVSh je[^]UWVSuEE@t"* 1VFe[^_]Pg _u hojVP ZYuj; ]e[^_] UWVSQ]E10u1'hju us 2F$!=*t*뷃=*u*c뛁K뒺a,2C8K t *hK\cPD,2jC@K@2K&g,2@P<' s4K I,2C(KK@KEPuh!5,2ƃu hK'jJEt *tctKtK@tK t=** s=*t*c@tKt1҉,'sc sKsC  sC shuV*Y_Eth7ViC$KXZEth.VOC KY_Eth4V5C$KXZEth=VCh tPg PVh9| Ct  EEĉEȅu(=*EĉEȿ)VhEPE @tUEtEȋ@렡*uEfPEpGCD +EȋPS@CC*XZu*ȉCC*C c1e[^_]W|$wUW$]EjjEPEPh\t hij+m}y ]EM}fE fEm}mEU}ɍg_U Phh'蘘 j' UWVS]S1E1҉02'1ɉl111h`dhu u= 5g?$`!5,2+XDžd5,2clXDž`뙍pP5,2ZY@u5,2hptCS[juh!5,2u hK'jPX',2jhR\C \uTxPR\xZY\t8t PRh vr Rh6jheR\ \xPR\]xZY\t8tPRhjjrRhju s5 P$ptX$pPR?ZY@u5,2hjSptC S5,2OXDžh 'E E)ȃth2\utu\r^xPuDO @u uhbhu}{duus`u EllCe[^_]UVS$SPPVu u{j VShb,@u Shj"@h. h h, Yu1RPh=ې 0hMʐ XZ^u1RPh[褐 0hk蓐 Y[hy聐 XZ1e[^]USP]jEPS( U :9uySu hb)j]US]SZt@ huSZY]US]SZt@ hSsZY]USP]jEPS U 9t :uy Sht)jZ]UVS]u VS9YZu Sh(j[;/t"Sh'(u XZu E@(e[^]lu e[^]UWVS]fU ffCffBCffBfCffBs s@e Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssmd Y^} GWssWd Y^GWs$s Dd Y^G W$CDȉGDs,s()d Y^G(W,C@ȉG@s4s0d YYG0W4CHȉGHsb YYPP40 b YY04<8a YY8<D@a YY@DLHa YYHLTPa PTXȉX1\ʉ\@uꋆȉȉ ȉ $ȉ$(ȉ(,ȉ,40` YY04<8` YY8<D@` YY@DHȉHLȉLPȉPTȉTXȉX\ȉ\e[^]UWVS ]} ȉKɉOCȉGC ȉG CffGfCffGCȉGCȉGCȉGC ȉG C$ȉG$C(ȉG(C,ȉG,C0ȉG01T4ʉT4@uE\TtyLup1TTʉTT 3M1ҋMfQfMffVBu@ uhPPw ȉ MCTȉEGTCXȉEGXC\ȉG\C`ȉG`CdȉGdshΉwhClȉGlCpȉGpCtȉGtCxȉGx^ YYMU tEȉEEȉEθ3M9$| ɉ @1\TtGU 4U9~ ʉ@EP1ɋE9~f4Kff4HAe[^_]U11ҋM ʃ=u‰]UWVSU ]u:LABLt ߉։U fCS_fCU ȉBȉCB ȉC fBffCf9Juftf=vfCDI] Y^1e[^_]UWVS]u u[`}u}u EP XV/ _=v1LABLCEȉC ffCRVCPK uu\ Y^S~fCe[^_]UEU 19s f3P]UERPZYW|$wUWVS,EӋWEUGW E؉U܋w 1҉j EPSck EЉUԋU t8zt Suh/]$! t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh/j1ɋuЋ} t1M3 8"t$M tM9uM9t Suh/맋E9ƉU}7=+tuuWVSuh/j uuWVSuh/?9u؋E}<=+tuuWVSuh0j uuWVSuh0j#e[^_]g_UVS =+tPhh'އ hPhh'ć h'h~0% XZ=+t !ttshIh'| jz =+u UPy UWV=L'uHH׉=+t&ɉ HffJ=L'u f@ffB^_]UWVSƉ˃=+t/=+t 1}oQ++Puq Rס+ΉRPSu5+z9t 0dPWVh%ق j"y e[^_]ÅtUWRPX Y_}Ã=+UWVSƉˡ+=+tQu+Pp M׉ΉRPSu5+%y9t A 0PWVhK0 j$Yx e[^_]Ã=+2W|$wUWVS#Å=+u+BB4++ + ;++ؙ=+;|*9+_1)։ؙ5+pؙQ Y@!JtRz!9t !9t ҋ1҉ؙ=+Q ;Xe[^_]g_W|$wUWVS4EU؉M܋ +A Id t15+/X=+t+5+PPW +xU thr3 X+H xU t@\U؋M܉M؃=+t+5+PP +A Id t15++ +JH,1_9M؋}ruuh +\Eȋ1ҍMQRPuucƉ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuuueK` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05+#5+Fx1҉$Puuc++\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu9 %ClÅt]SuOXZ1EtttpS Y_DpTtF u1ES Y_Fu @ߋu %CP+H05+EЋUXe[^_]g_UWVSQEӾ=+t1}=L'tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='Shh' ]W|$wUWVS x|+Hd0Q (,L04H8n ^_+ujhen Y[++B0 +J4PtPhnn XZ+@4PtPhHn k^_+@4+9}RPhn A +@0=hPhm  +@0=~hPhFm  +B0R49}RPhqm  ++s0;+|Pu 9\\=+ș9|{XCX=+~ Qh3m Y[+PX~~$X0ډPHp4ډPLS8<V@D1҃~BPP1Ƀ~AHTP81Ƀ~AH`~$ؙPSVhl 5+F4=+1ɺ9u8Nd++ t8<=L'A uPhj走9sRPh#k  5+dž\Tdž 1F0~tFx1FF8F$1F@FD<F4=+F|dždž1҉XdžLdžP3dž\Tdž1F0~tFxF8H HڋSQRP}VӋRPSQ[V؉^ș)ىN ȉFӉ‰牅k Hlj狽Ӊ048<k9}VRPhWi  ++@x<8@)׋@8tD11W+ӉʋKT t1҅u u1RPWVTuuDž1WVO9؉s(WVSȋƉϹ19s11ۉB,$1~ ȋʃƉ׋ȉډЃ1׉11~_H` tӃȉډЃ1 ȃƉ׋@0)Y+؃1SQRPM1Ɖ׋ȋʋRPWVL9sv Dž19s Hȃ1ɉRPQORPPȍy)׋RP}K؍CGȉ1~H`9}d))GSWRPP1RPJ؋ÍG1~H`9}Shc  +C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=L'(C|HL!ЉjjjhjC4PjO £ +uj'+X +H41+H+ ++H4 ډ+)ʉ+@`#PL ~ PhH'P<+PX+P\+1҉PTX HfǀƀK +%ƃC4D8<KC,ș)׋C)ȋ)ƃC8HK` tƉ׋Й)׉##11ҋ!~ ) 1҃1)׉@D04=L'>C s(H1+t ǃ^F=+s0Kd t1RP߭ڍ VV$hs^ + ؙy8PۅI4P WW$q,h.^  +A0= @ ++=+u\Tu k‰+jjjhjRjK £+ +u+9uhve j&S 1=+L++9|RPh0j] ++5+ +![t?  Lș)Ou뺸=+t?jj5+S=+Sb +uPؙV jVuؙ=+VY++Xlj=+t PRCXZ+x+\=+DžhHc X=+~݋ +A,XƉ׋ǁ\TtA!AƃAId t1RPhjjZ ff'ftRhht@Pn DžPu ft+=+tu 11=+1w,1+;x,t hX'(y +1҉牅8^9؉<}Ë\TtAЋ!AAA)uhy4D1ҁTtqփq9Ћ|ht'a (u^+1=+5+FU F )É^=+$~O`^p=L'u*VtGx9sЉFx^fFxG,H9ufVNfFFTVXЉF\KN`ȃ$~:=+uFh$\^lO`؉Fd9sh_ %[5+=+F t/)؋É1ɉ~U uF\+H xU u@\€ 5+N J~U uv`G`Y+$~%+Bl5+F=+=L'~&_89rOd1VT~U uVTP~U t FX1~JOd1111f# +A8P!tm)D4A8)Љ9s?~U tv`у >5+F$B1ҋ9r)=+O`艅FW897~U uv`G`a+$~%+Bl5+F=+=L'Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5+F$뵋+$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹+B+;+u^=+t+s4PPF +@++Z4Jd15++++H41[+Z0 } +؋5+=+t5++P5+ +X05+ދvxx +\t4Tu %Fl %CPO붡++𙋝ڋËƉ߁TtAЋ!AƃAId t1J+Y\Tt=+Ys8+){0ƉK`Cx1񉅰69s)9s+ %Cl뀡++9rߋ +A01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==+j.lN X܋ +ߋƉ߁\TtAЋ!AƃA׋Id t1It1ɉ C x+ 1( x+CX. +=d+$+9$9rPhX!hvt +D 1;|+si +tЉtF$9rhX!hX +‹ ȋ( x+GB돋$9(1҉G䋅$9s1 hh,u# 4jjP? ƃ t3ȩP6hhh,?# ,e[^]UQPȉEtEnPh= R$ XZUWVSÉU܍Esu{h+ EPEPEPVEPh)# fERf PhD# (EPEPEPhP# u֨Phb# uè Phɷ# XZvNE9sGGPhCym# ݍe[^_]UWVS0ÍEčs-tEătE<u/-FVPVPhij<u+-t{FVPVPh;uUEع}uCfE-t"fUfPRh" fPhs" XZe[^_]Ujh0-j4 @u hjgUVS11 \,A9ut \,‰Љ[^]Ë `'Q`'y ;p'| tX'J X'UhX'P' XZUWVSr ,~+,\'.,H,$t"),\'],xt%=,t >1ɉ ,\'hX'? h'? ,l,r XZe[^_]W|$wUWSøth -h XZ5,h 5,h! -t Ph7 _X,t?,9} hHo [() MMEuQQ$hkG j ^ ,Z0--EE,sH~-,]PP${ RR$S,QQ$SEWW$S h'PP$Sh~ <-$,0,"]<,T,EzuX ٞzuX =,\$=,$h e[_]g_1Ujjm XZ1=,P U=`'u =,ujhwul ,ZY9,~,-ueUSá,,xFأ,,T,` wh r\'y1]X]W|$wUWVS],,ffb,`,=p,9=d,u ;l,\,,f`,f^,]f^,1Ej]Sjj5-yh[jhH-jjh\,5-Ty-t h ؇ _EjSjj5-y h)jah`,j![^\,,f`,- s$ l,ɡt,ȉ d,h,sd,l,D-}f^,Bf^,,4fpjhh-jVP5-U Ã9t:y hE҆ YSVh -hL3 h': Z1`',% , -,@,T,l,H,=L,u(=H,u<,l,l,l,H,=v.}fE fEm]mEH,L,p 5,=,,]u}fE fEm]mEP, H,L,EΉ߃ɚ;~ʚ;Eހ}P, H,L,l,H,Bp ؉H,L,H,L, P,ى P,ɚ;~H,L,ʚ; P,,rW ,, H,L, H,L,,P,P,=ɚ;~ H,L,-ʚ;P,-t 1-te[^_]g_UWVS<ÉUM-tUUEčs}uyMăA}9}fE؍t E;,uJ1`,d,u5}t4-u+?EPuhf Ѝe[^_]W|$wUWVSEU܉M7C]-MQURuhy} t hl XWh` -Y_t,sE RR$Ph' =-y"uC'e[^_]g_ e[^_]g_US =-uIgg SPh8h'Z j UWVSƉP; ¡-_tEtPhE -9U|} Vhj \su4 1C@C1t )уȋKAPEFCCp1}~CpMуt[}D;19Ue[^_]USӃ -1҅w =w"=wj=w:=w R=wA=v=w.=w "tft uȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsPVh S̍PVh  BhPSjW9 PVh SgPCPVh)c hX'3 Xe[^]Ãt"¸Q7t7tUR訄ZøDUSљRPQhSdhX'Sg ] `'yUhX'j  XZáX'PX' UWVSDuhX'83 e[^_]ÉÉhh !a_E1ҿ!Es,s }uCEtHH1ɉ B u1ۋtЅ}t2}uK]1ʉj.h -EPj7 :]1ʉuܘVPh> j.h -P h -h@M  XZT5-VPh@M i C 0=-6UWVS$@<tPhu, Y[ C!tRhPPh ^_Ph XZCH<$!hIC Ph C! Sssh C! @!<t!<t!CTS C ACPhZ CZYPfwk$!hh0 X1Zhh hh2  _3h ^!h& Y Ph XZ뢍A9sh- 6EEEEEEEԍsEԈEӊEՈEҊEֈEEUMfsfhw.ffQRPEPEPEPh:H jfuVuVuVuVuVuVuVuVQRPEPEPEPh]  C !S Cxe[^_]]e[^_]UWVS0É։M1Eԣ-j5-jEPEPh-VS8EE"1EEE1҉U jj}Wjj]SC|yhEЅt?P2oXu hzjETjjWVjS|yh&݋EE1E1=-t#hH X=-tuhl [_}H1E92=-tC҅U% E-t Sy9=-C{PS5-1 u_ 87t{_ )Ph 9~Phl ZY=-u=-t GaSx5-jRU Ph CxUtHH5-RB Ph h0 VuX1e[^_]UEt Ph XZ3] hd!Phh'" j UWVSDE։ϋEE-u-0'E -t<t"t(E}u+E@E'E@EE@E@ E@EX0'UZh3V.O ZYu=Et'} -u1ɉ[cEXt""}uVk[^1ۃ}uj/V4ZYÅtUԹ1}EEE}WRh Vt-1EԅۍUt/WRh V}1ۅtVht/Exuxt VhjnPp}PjuA }~tCUj1}^Exux uxuxu xE@E< u2]Ĺ1jEPEP ¸` EE耉E 1}E@1}11FQЀ w0 QwWMQw7u&w$ !]@ }@11 @]M9ru)u}1ۉj/Vj ZYÅurEEPV Y[VXVOYV&% ZHuNp @0u] }u= -uVQ Yt- VxZtMUCUe[^_]/;}u = -BEXSZ{ X ?}u MUs1  -Uf1E e[^_]US'tuPQK ZYtC]UPu*fxu#@Phhh`!-i `!- Htu DP‚P觀ZU}uE u  'hhRRh0{ PPh I UEt#t#6@tPhF#-Rh[ XZUVS$!E׉Íu 9stMtJ@Sh\ XZe[^]UVS3}tJE t1@jjEPY" à tj.0 Y^ƅth` -@PI YZuUuRrZhPh`!-g`!-e[^]UUE Pjjhh`!-PR蜦thh} h`!- `!-UVSE UZ1t@ȅt  )ˉ t Eu7t3jSKZYt%u3hPh`!-f VRhmhh`!- mVPRhjhh`!- DσVQPRhghh`!- VSQPRhdhh`!- `!-e[^]UWVS$u} 5E ~y111119FtM |1t 1} L7tMw tLxw tHuGC@u?6ttxtu#  @@1u "5ω5KtB uh3h`!- [^vths YEPjjhVPPߣt h} Vq XZSVhhh`!- `!-e[^_]UVSMQ`-Qa-يۊ!BZ!XÃ@.)օ~=N -uC`-[^]UWVS uE Eԃ=4'tL1ۉ4'hh` -m _Zu(j.h` - ZYth@Ph` -c ` -uhh3h`!-c F<tX<t<u^EԉE FEe[^_]G]ع1}ʉfEu jS8^_uSZY6e[^_]VPFPhhh`!-H `!-e[^_]US]U MC<t,<t<u/MU ]]yMU ]]q؋]YS(PCPhhh`!- `!-]UWVS(uE MMԋ]U~u'ẺUЍ}عjuV7_XUЅҋEtt SVZY SPV" }yE E> e[^_] tEEԉE Ele[^_]h EEԉEE E0e[^_]I UWVSXEEE EEEEEEE"1EEEE1EjjuVjj]SmyhEt}tSyM9)sxEt  Cy;8't8'PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth ;h ;h[ `'H`'$yhX'j ) XZX'PX' }e[^_]ge[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һ~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(US@M Phh'2 Shh'" Sh2h' $ShQh' Shlh' Shh' $Shh' Shh' Shh' $j8 UVSƃ=d"-u j=AWuj e[^]UWVS|ÉPhV'4 uSh> f Y[1xPVO YZxt Sh.  XZt ShS  ZYl"- h"-t=h"-tj 1l"-=d"-tWVjP y]e[^_]UVSPhVV3 uSh> e XZ1'=d"-t5`"-VjP yȍe[^]UWVS \\W1ۉ`10ÅNshx V(= ZYthCV= Y^3hV2 uVƅhCs< YZuWt _hCs ! ^ZtWt 3h{ s ZY `"-Xt P_(X^h s Y[Åt"-thP;< ^Z@j,S ZYƅt S Xt,u h jK>;uh  SaJ\tBSVh hBhR Rt1Vh M Y[Vh h8 hP 1>dPSM ^Zy Sh> c 밋l%=`Ƌt"-t:hRP; ZY h PR: ZYu\t_X/ H tXRPh Y RPh h' \`G tRPh&  RPhF h' Dž`t0PJ_tPhn  ZYDž`9t S_X`tjtj jUWVS TPjhPjTI11ۉ`d`Ph|dVY' @ h;lu\1ɉXSi9dsW`[XZuh0\P9 Y_t X\X;lrt\h3hhW EPt`"-tE WPh tE WPh&  lS^Zh`PhedAV4& 1ۅ9usCaPTh3h֕ hWJ EPt`"-.t-E WPh tD WPh& M CiVXe[^_]UWVSV1}jj}Wjh!97uTEEPTjjWPh!7t S\[!h:E '$@E 1E EWS3 [E؃hƒl ˆOEXu1ɉMȉME r!S 3 Z9EsECEÚàھ}ujEȋU MԉSQRP$ T9ѹ |+ɚ;9ы]þ |9ы]þ |9u}uh h hVh VhVWuh uh   4 E Ex1EEEȉẺEEĉxM}DtH9G_GEGE|EptEEE|PTOu;xptM]ċM]M]̋PTM]pt }Eݝ`EݝXEԙRPSQPuWuh+  Mԉw݅`ܵX PP$EU)Й SQM]RP/PV|mЋM]SQRPPVEU M]SQRPPVh6 jj hISQjEP@u h\jj hIEU RPjEP@tjj hI|mRPj]S@tjj hIEM)ș RPjEP@xEPuWuhV o w݅`ܵX PP$EPVSVEPVh` ? <ǠqlMȋ] }tajj hISQj]S@jj hIEU RPjuV@VSh}  ZMȉ]̋uԉuEU WVRP>PWVMȋ]SQ+Ph h"M] }jj hISQj]S%@jj hIEȋU RPjuV@jj hIEU+EU RPj}W@WVSh  YM]uԉuEU+EU WVRP7PuEȋU WVRPPuWVM]SQPh < xEU EU}m]m]jj hIRPjEP@jj hIEȋU RPj]S@jj hIEЙMʋEЋ}EeRPj}Wz@hjj hIEU+EU RPjURG@5Eu QQ$URVWVSVEPuh  uh EԉEEEu RR$EU+EU uuRPPVEЙMʋEЋ}EeuuRP\PVEȋU uuRP=PVuuuu'Puh  uh0 T 4uYSXeY[^_]aU: PhS h' jH UWVSljU΃=&-u'jh&-R&-ZYuhxU [&-Xi &-}u-WUP- ZYUujtdWUP, ZYUu=tRhh"-J"ƒ "-uPh> j /K c1e[^_]UVSƻ@'tPV`, ZYt"Vh 5- -MC St8tPRh x Rh pxZYuj 3h-ICd-`- e[^]UjWX=-t%-fPftjhP jh(-\UWVS=-5-ÉDžu¿ RWh 5- 5-| PhPh'$y'1=p`-Sh 5-8 L'fDHfn,f?trfauH-Sh 5- (fptfqt#1҉-5-h 4: Y[C1p`-Sh, 5- &SSh6 5- e[^_]Ã=p`-tO=-tFUVS5---1ɉ -1U5--u1҉p`-[^]1p`-UF-j9Z=-ujȃX-t-j譃jh'-AUWVStEUtj1]ut=tP'TS!@u$EE%@ P't L'fBuӃ}tgh-& [ƋE]tC1ۊ-t8u9s&H- CuݍHȋ])=~ E봉EE} Uй 1u1-tltf$t\uDS8uOCDC<0~2S8u0x tF8tutt 8FtC1DЋEǸ-:[tL\t$HWыu)@,-x$uvXP'DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2P'DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5P'D^tS@0uU tZBGO])ف~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuPC EE 5-h /5 EZYFbEe[^_]USEU uM軠 =-u=-t!N tVWjVjjhRSyS X -e[^_]U}u]U}u h h h 5- 1-UWVSE]uu1҅‰uTpuCE xhWBZYu u0HhWAZYu1t/F uPVh 5- e[^_]Uh h -u uI-U}u-=-t-E E ]' ]Uh h,-u u-UVSE] u1=(-(-u{yt gshV@ZYtBhV@ZYu 1(-4V迻^sh 5- 맣$-(-노Ph? 5- =(-t5$-hU 5- 5-h| % (-Y[t1҉--e[^]Uhk h-u u-Uhx h -u u-Uh h-u u-=-t1(-Uh h-u uM-UVSE] u 1=-bu.shVI?ZYuBhV1?ZYt1sN-^hsh&-3-&- 뷣--t$t:u5-h ~$ 1-ZY4-:utSRQh 5- --e[^]Uh h-u u-Uh h-u u-UVSE] u 萏uHshV >YZtBhV=YZt6VZy+sh+ 5- 1=--l`-t l`-PQhE 5- 1=--e[^]UEt~-Huh_ E PEP޽ tЋE ph x_YZu9=-uJ=-t5-hp " XZE ph :_ZYuX--1-USUE -u O-Pt ]pMYt`P?)Z@u Sh : ; -=-th-h Py 1ɉ - Ph ! XZ]]7]UEul-=Huh E PEP荼 tӋE ph '^ZYu X-USSEu-HuhQ E PEP. tp`-hMjE[Xjh(-辘XYE tE ;u1ɉ p`-jju ٬à uu=p`-tڋetSh U][Zu X-=p`-u=-t--1ҋE tp`--tujOXZ1ɉ p`-]UEu-}Ht}6h E PEP uh E PEP t}E ph x\ZYu!E ph a\ZYu X-UWVS}M 1ME1=-t5--1ҋE ¡p`-t@p`-5-ujTZY1ۉp`-EM9t EP02Xe[^_]UWVS}u ̇.jj ƉXZS苼CYujj֔h43à uj/S{__ZڅtPhRW) =-t65-Sw -HQPY^y Pj : Y^ J }~j5-h?WS4 jWS& Shx 3 -j) ~P[Z9uWjZYFu h i3 X1ۉ-e[^_]UWVSPEEuq-Hh E PEP菵 EwɋE ph "W_X}h ^u ]E XSh VS} 1 uY}h Yu ]E X Sh VS8 1 tA5-h  XZ<u}u"E X Sh [VS 1 -e[^_]U-}t'=-t =-u#r=-u-E E 3 h-h 5- 1- U-}t鸄=-u#-=-uE E  h-h3 5-E 1- UEt~W-{HuhH E PEPx tӋE ph UYZu9=-u<=-t5-hW 4 XZE ph TZYu X-UEt~躃-{HuhH E PEP۲ tӋE ph uTYZu9=-u<=-t5-h  XZE ph 7TZYu X-UWVSu huS% 9}1hE4Sa&F 9~hh SY[Hu j5NZX-e[^_]UEu薂-/Huh E PEP跱 tu uhI- UEuJ-/Huh E PEPk tu uh  UEu-[Ht}6h'E PEP uh E PEP t}E pph R USEu腁-8--Hu h ORYE ph  EQXƞU} t}u5-Ã=-t jjXZj^Y=-t jjuXZjV UjjjC UWSREEu-=uE XhC Xu]Sh PS 1 e[_]UVSEu`0HuEUYYBu@t)EPC PPE ph; 5-! M;MU-UEU u$t-]Hu EA ]DBE EF ]DUS] hjSu1tsshN 5-菹 ]UWVSVEus.Huh E PEP̢ t݋E p٭[u -zhX yYt8uRU É4$ |<$舧WURPWh8 Ph jd]SC ~!-fJftPSR jh`)-yvUSdj+wX=-t> Ph jd]S ~!-fJftPSR覜 jh`)-vUWVSÉ֋:j:W YZuWh3 S臤 :WXP諗YZtj%W YZtWh< SQWF u FfP HuFf=tPh S hNSXZe[^_]UWVSQljUR [Ë7 <wsBSuRUU u8Uӊu <wrs C <v1e[^_]UWVSË@t P1s_stV Y1Ct P1CZe[^_]UWVSljӋu|-u<MP6uEPMQSW脨ju>y8E8 u@EPhG - XZ H< ws 1e[^_]Å8UWVSH%Pty=P'UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu h` jjh W#  uW1ɉK fCPjh W  uWC fCjh W  u WC _t36 vCvCF C FfC (Wuh P Ei$:j/RU/ ^ZEUu R菚8)ЉUHQMƋMQURP8{ uEuVCYj@Vؼ ZYt_{ u1҉\-Mq@P&j:Ep襼 t@PMAYE@yE@tj>[urVj]RU` YZEtH:UttWuVh )PERV茕 MVu WuVh fEPx:t1j:V YZtP>t3tJj EPRU} U:tM9u HvWuRh 蔌 ?fC*C tt-t-tIR՘CZ{u{ tP赘CX1e[^_]USZKJy ;J| t Y RPث XZ]UWVS\fDž1jh P _1Dž1jP* AZY@t(t 8tt 8uSh  7(8j;P:ZYƅh! PY_t>h) V_Zt4h1 VZYuh9 脊 _SVhf Sזj@PW t%1ۉ\-@P誖^j: ZYt+@PtXDž11Dž8ta8tVj/PY9[^9u*u+pjhS ts11ۃu t*-1ɉtf1҉uPt ;th SR ZY1ɉt >th V& YZ\-=-tjjXZ\- hPR u11ɉ-1҉-QPb--YZuu*LD#Hu9g uPh 蟇 Ou PjɿPj蚿_Xu1t ;t1j/SU ZYDžtG9hh Rl1X-Pj=X-u,;u=-uh'h ^_W4t3hSShhShVS$hha R1ۉ=- tS-1ɉ -t hh^  hhR R3 Pj?-G-uj/V|5[ZtP1ɉt PjPjXZ--cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh`)-gZY3u P* Y[@ S ^<$Zffu/t+;:h S ZY%h *t?u+$u =-uh  WeY,,-t <,j/P2_Zt@,PZ P Y- t 8uhA c1=-=---DžtDžx=-t0 tRPDY ZYu--Ox- ,h<P^_44u ,c4P處t$P[ Y[u/tx--5-=-ut84P51҉$WVP y,Ph  _Xj=-u=d`-d`-,Ph 5-\ -- -uu5-j Y [^RPh Q" hSh`(- -`(-D stdF*N TtRT Dtha r X $udh @ td ƅu u}tPXV~_Zt:H-,r)=-=-h t;u h )-P)-~ h; -1u>u$Pڋ(Y^'Sh[ 5-襎 ƅu  Shn 5-s ҃th p XZ h p X DžDžXu tSzYl_uRh DžDžDžDžDžDž 9-u h ;P6 _Zu Dž8X'\ 8|uQjj TZY h@POn[^88u @Phx lDž0 8<--u!t9Nj}5uPuG- -!΃9=-B5-h ^_+u t=-=-9u 9t Ph n  h  hPR Y[88u Ph7"Dž0Uhj-S[^hjS_ZD(-t9d`-tK@(-tPYd`-tЁ~=}D(-PyZ@(-1--$-@tPj~R^_DžjR[4P5D(-5@(-U u h  1ɉjP5@(- ƃ @(-9u h1  8"ty- "@(-R)PhD J  u @;u‰Њ B t thNP _Zt hV =P-u P-șuD(-1jPa Y[؉|tL𙋍|9Ή| ||=(-F|19=D(-|19||Nj4PWj5@(-耀ǃu4PjZ1--|)ډ|8@(-@DžftSmu u tڃ#u)uË9 Ph}=--9--|#6$-Rʢ Xb)f=P-tYjPJ [_++y @B19|@B)RJI Y맋c[1u9V4P5D(-5@(-蚀 uj@N${ hN5@(- _Zt h Ji |ft=(-u4P4}^tch  Q=-uڋ --19}Nj$-9|- 뤋-#[#jN8$7 Y0=Uxu tjS XZtx1ɉ08R18 $PP_Z@u*tPm $re$h 5-蒅 1;--|- -y )jFX䡐----9؉|1=-=-1@u @u"PjLY[㋅Pj wLXZ@tPj^L^_@tPjELY[4t4P{@t PsZ0t8t08RX ;-t t P1 X,t,P{1,XtP\1_$t$P=1ɉ$[(t.(P1(Zpe[^_]UWVSÉjh P jh S tsh SiL ZYDžt$jh S tS)Wh juh C_u?F t u8t,jh Sy uVj11҉/ZYe[^_]É؍e[^_]*US1EEjh@-HZYt-=-uEE@Ejj Y[h$jI[Xhsj IXZEE;EEj:M 4蚓 ZYtw1ۉ)-=\-u \-EU 1oE-t%h ;S ZYt;|tS41ɉ -[E~E@EE@E\=-uE]ËE@tjj'XZUWVS$} j hd uVuE1ۉ]]u7pÉEP D V ^ZPƋF-Y!ȅ„t tjYSj;XZe[^]UWVSDžX-XB-PB-jjB-PD5 F- yh  X`l`-tjXRjhPB-<t <=8-=4-5-=-u -h VÉ5-X~St6=-t---wD5-h  j4-^_9hG-hI5-r =-u}H4-h4 [=-M=0-=,-5-=-u -h {É5-Y~It,=-t#--w:5-h  XZ/hG-hI5-r =-uD,-h _=-=-t 5F-/5-h9 uڀ=B-u5-hP [^1; h S$ ZYu1l--w 5-h  븍RpRRRPhz hB-t5-h n:u:u:uҿB-4B-󥋅pffB-jB-PhB-5F-Zy/F-=-P_XF-1-m=B-hB-j5F-]ZYy h  + _B-= -<<B-<B-PB-PB-PB-PB-PB-Ph: Ã=-i)= -1ۉ -B-PB-= -t fB-F-tP{^XjjB-P0 F- y"h 1 _ -= -u#jXRjhP@uh $B-PhB-5F-W yh  ^l`-tjXPjh5F-DžhB-1󫍅hPR5F-n @ h 됃=8-D=4-2=0-+=,-<u\tB-<u1j j WhStPtP 5-=-u -WS\h* É5-~5t=-t4-_hG-hI5-Rm =-u Zu<ifB-RPj/B-P.B-P-B-P,B-P+B-P*B-P)B-P(B-P'B-P&B-P%B-P$B-P#B-P"B-P!B-P B-PjjhQ ÃX1t  -<uADžXjXPjj5F->5F-N[F-14-$ w=t5-h} olpRPRRRPhN hB-P  h SW ZY-$ jB-<lpRPdPRRRP`P\PhE hB-, R\x`kd^ B-1fB- Ћ Ћ ȣB-lp ffB-98B-C<vlpRPdPPPPPPPPPPPPPPPPS`P\Ph! hB-`\t5-h .\` dB-1fB- B-@ulp ffB-jh ^_뽡@-t9h`-tK@-tP輾Yh`-tЁ~=}@-PHZ@-j!_l@ujj m!Y^l=(-t=-t =-y $-1ۡ`-8\fxt \PTfyt T@S5H-5@- @- uu hgH XZ薦 8 --P ta\`RPPF @\@ @--TXRP4FPY^@u|u\`RPj vF @uc[pt95--|ȋ-#5-Ks _pt$-pt륅u!J\@ @u--pt9 --|- T@ @t0-# Xu hg衾 XZ\@ @t" `Ih( w XGj%XdtdTR^1T\P r 1ɉ\ $[zhPjXZDžh=t`-u -cF-xP FXF-\t\Pq ^1\jf[-1;--}jYh@u l@u"hPjXZ㋅lPj ^_F-xPsE[F-du \u)TtꋅdTRY؋\Pp XH-1҉----e[^_]UWVS1ۉ,4(0$-PTx-9, 15-5-L--- -hI u _ZDDu =-uVu=-t}t}u&E 8-u}tuh 5-T 뺋E Ph 5-T ɋDtE uPu} 1ɉ8Dž<Dž@1=-uDHjhA-_Zt=t`-tzj^hjXZhjY[<}tWE jPҩY[E j/PM_Ze 8tN[ 8 tDE Ph  [^- E h ;P舒 ^_E 8|utU 9t -utE jP:Y^t/x=-t Р 8 uW@Ġ 8 u"E hPF_ZyE Ph; P=-t 뽃=-tE PYE .D`-uJutY jjlXZd-9u&ju/^_---ujPlY[=ujhA-$_ZSDu}u/m--utRPh t vˋE8t8Puh8 P HTh<=^00uuh> Y[ȃ}E h ;P蚐 _ZuDž(X'15-5-E 8|uXjj !_Z@E h@P2Y[((u E @Phx A15-5-Dž8 =E uPQ Y[((uE Ph7) XZDž8U(fzt (@xRP3v ^_@tE%=t1ۉ--@-t9d`-tK@-tP%Yd`-tЁ~=}@-P?Z@-j'X=(-t=-t =-y$-$1$`-DtB--ut/(f{t (IjRPQ| 5P-@- @-(fxt (P0ft 0@$VS u0؜ 8 u--hL M ^ڃD =-u =-(jjjPt 11y4E Ph  Y[,RPY<[Zt׃ t;5--(|jjjPt yv뚃 $--04RP;XZ th(,RPj (< @tv(@ @uju04RP;^_tA gL@L Hu (,RPS; @um$uwPT95---#5-wh YPT$-ډPT롃--#PT95--|- H0@ @tN-#*W 4J 8 u-- hL ³ Y݋(@ @t ,E Ph蘳 XZjJX8t8(R^1(0P2g 1ɉ0 $[Lu--y3dLPha 5-L 5-h zXZ뾋D(uu=-uj# _苅8=Uju)[^X\Bu@j`S6 ^_X\lp1tE SPZY@XPX3 $+‹E $Ph 5-2K `jhA-SZYt$-1;--}4jE Y*hjh^_=t`-0PH[벋<@u @@u"h W苂 ZYEue[^_]P2ø=-t$ Ph $ 5-wC 't$=-t~ tPH2PS2 S%%YE ]e[^_] QMZƒMuQWh9$ 5-B KSu QWhU$ ދ}u#Uj PMQ葟MMEPjUR rPj h 5-B 릍e[^_]á- `-!t$uC-tJu6--%-P-'8!u'UVS t t @-tJt -1&-- tGtBB@"u\uXu@!@B؀"@tՈBut B1`--u/-tHt -1-1-[^]US--`-`-1ɉ -|`-1ۉX1x`-P5|`-/XZtx`-@ڋ]UVS =-t2-SPI0^Z8tPhʷ5-@ 5-[ jh@h-h'D)y}uB5-ho$ t.=-t -Hy Pj B Y[ J z=x`-?|`-0ZÃu 5-hL +u 5-ha x t =-u5-h P[^1ɉ -j 3uV胜|`-0P5x`-S = -t3{t--HQPy;P| J PjA XZ{ qh$jhsj e[^]UEt]1]US]u h& j'SZu Sh& j@]U='u 0'-fPftPN8Z9'ÍL$qUWVSQ0- - XjP + --Z^+-y @B ڽ߭ݕ --x-19}l؞vK߭ٽf f٭߽٭؉Ή߅uIt 11>RPSQh& hP8 ٽf f݅٭۝٭Q~DQ>uIRPh' )PP8 Ãt Ph!y)PP7 Ã<RPh' )PP7 ؉19}t  @~4H!%y)DžkddʉӉف1 Q%1 RPh' )PP6 8--19݅--5-=-9Z)߭߭ٽf f٭۝٭׉h.' )PPg5 à t!Vh!y)PPB5 Ã<RPh6' )PP5 Ë+---9}9}&h@' )PV4 à h)PPs4 ؃ u-fJftPVR,& eY[^_]aUSu 1;--}6=-t%-fPftjhP% jX( ]UWVEE왉U1E}ujEPj_ e^_]U0E E1EԉE؉E܉EEEPEPu踄 ƒ xEÍL$qUWVSQ@@u5jh-蹸 --󥡐----XZjP肸 ----+--_X-9}|-9=--sE-󥋵5-=-1~x9؋}l PhL' hS1 -fJftPSR#jjj%jh@-=-uh> jjujjj =-|NihВP -Y[tPh> hP1 x--19߭y ݝ݅ ߭ٽf f٭۝٭y1d~dVh' )P=Pc0 Nj-~--t Pq Z)Å~:ùdhI)Sh`!Ph' )P=P/ ǃ119ʉst  @~4H!SQh' )P=P/ +--+ -y @B ڽ߭ --19ظw ȉ߭ s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4H!%Ƹd PSQh' )PP- á--19‹--)ލ 19‹݅99}h' VQ%- à +--߭߭ٽf f٭۝٭?~~h' rtPh!yVQ, Ãh:xVQl, à <ЙRPh' )PP3, Ãuh)PP , à -fPftSVP eY[^_]aUS~ ji ~ X]á-@ `t1US-HyPL Yu1ZJ ƒ,uɍPv"u| --HyPL ZuJ"\u%-HyPeL ZuJCC-uh' M Y -!--HyPL Zu ZJ ,„t@Pv8\u"-HyPK Yu JCC-uq'= -th -Pm ZYuC ߸ ]UWVSQƉUh -P×[_tHj.Vk@ [_1ۅt6uP蝗ZYÅu#)Wh -Vc u1ۀ -1ۉ؍e[^_]À=K-tUWVSh<hK-. -^_u"{ 8thK-h( S Y[1$hS _ZyƅEj.S? [^pu DžpI1btH uuzG uҋp-uSpEƅt1;4 3*%u_3uGE uh -8} h -Pk ZYtE th?& Pk [_tB-fPfttRP,R ZYx|?th( F hG( w$xAE85h -}X -fPfttRPQ [_x"|?th(  hy(  E8h -}z=-t5-P]H Yt u -Hy t u5-h( Jɋ``-u5-hn Xk!_- _-)_--HyPG Zu@JP'DB@uGG9u u``-u3,_- O-=-HyPG YuJkPk0_-B,_-k,_- _--HyP7G ZuJ< u6``-k _-9,_-u@``- {u@``-KZCh -h(  _X-@tR.E [5-h) xXZ5- E Y 5-h( ۍe[^_]1US]P'uh;) SÒZYu-DB@tCjhf Sv u -Uh@) S|ZYu -8h{ S_ZYu -hL) SBZYu  -]USZKJy ;J|< t Y RP+ ZY]UWVS-=-u -hi ,^tIhQ) hG-lZYƺ9¸} G-.uhG-VhV) 5-( jhs) hG-B 5-tjhhG-$ uSt - -1d-j hT h-  t\h-h 5-,( Bt 1-1-t*j hx) hG-f u5-h) Zv^_ ----- -F-h4 躲Y1u< -u 1҉ -@u -1F--e[^_]UF-tPB X1F----=\-u1\-F-14-,--tPkY1҉-=-u1``-UF-jX=-t%-fPftjhP jh@- UVS]s 0jX=-tfF-t-fPftjPl5F-A 1F- F-x jPF5F-;F- 1-jX=-t>F-t-fPftjP5F-@ 1F- 1ɉ -1-j芾PZt Sh) jfr 0e[^]UWVS ]u-=p`-t =-u$u 1ۉ..Pu+.tÍC.C1ɉ ..h5<-W襁 /thhWh hh) WUW yWh) 蛋 XZ1qP=-Xأ-(--1(--} t1=-PXt!jjRPPh 5 ֡--cvtG-} t1=-P豼X=-(--h<S $ .S . uuh*  ^* Phh-m u5.> 1ۉ.j h-4 ZYu-e[^_]UVSQQMq-=-u -=-ut95-h>* GqPhg* YZuBj hG-34 ^Zuj UR@P M te5P'DN@tVu=-u=-u1ɉ -t=-u5-hG-p- XZz-eY[^]UWVSQ4MY=-}=-}=-u -=-u}5-ho* 2pfPh* Ԭ^_j hG-3 ZYtj.hG-3 ^_thG-2^ YG-uKjh* VZ_ u7Vh* 5-@! fG-20hG-h* 5-"! G- }1V] ZtVh* 5- EPh + V词 tEEP| _uu -u\]-gu=-u=-u1ɉ -t+=-u"5-hG-n- XZE-E-eY[^_]Uuh+ j2h- u h2+ ja-UWVSP}u jjyhjkWh`+ V觌ƒu&Whz+ V蒌ƒ uWh+ V}ƒ USj%Ee[^_]Uhh-wZYu-UVS-5--=-u -h'YZuQj hG-0 ZYt?8t:x"u41Ɋt t"u P"u @-A@Ɓ--5--e[^]UWVSu huSb{Shh-uPO] u]WS4YZuSh+ a XZ19/uV[ É$VWB\ uڊ/ e[^_]UWVS}GE119ut4Z Z9sFSU表-9r1uÍD1EkE1Eu9uE1E9]tzMt5-RUkYXU;wr- t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=-u EI$=-uM=-MtE-E}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL ;=-t -u ;}mډ)Ӌu N ty.uup9swBL ;=-t-)؋u ^ tA9sHBLE H9cS%"M I9OS%49sSڋMA[^_]ÃUWS$]؍U1EEEEPSh u^ƒ1uuXe[_]UWVSu] }VuSJ u1N tu4, tB, fN lSS ZHˀ; uLUJ9uD 'y h'03 Y'H ' t@u҅tT, ff t1҉e[^_]UVSQuh-;S [á-?vPhk, dj}uh, PI Cƃ- 1҉UUR@)R-Ph'yh, uh, 5- jx`-19|`- U e[^]UWVSD]} Sj j VhRuW蕱 t&hhLDRjP腔 +‹Y_+y@Biy1fDžRjP uY` 8u=|-~{` 8#tLVjSƒ 1BPPhnu` < tQDžPPhhS @u0` ` e[^_]UVS]u SXu ]e[^]GUWVS]} KyCS. Xu?C u8@t4_ 8ufc _ 8#tt_  P0e[^_]UWVSu }EÃu3F u,@t(N_ 8uff =_ 8#tt /_ [^_]US] h SqP YZ¸t,h SYP YZt;uEuh- zx XZ]US]S{mZu ShA- jR]Uu hh- jrRUS] Su ZY@u Sh- jNR]UEu h- jRP Zu h- jRUWVShuE ]E1҉UUUt PEXt SE_=\-tIEt Pu1ɉM[h?& nEEZt Pt1EXh -PGE[_EPEPEPVy$-5O- ZEUO--t\RVh. P 1ɉMEPjP]Sh'}yhuh, 5- -1 Vh. P Sj=-tVRU4L É4$*L |<$WURPlWh(SlWVSlE(tPsX]Rh ?^_}u-h 15Yu]SESK 1XZuh ËuVK 1 uq}u-h 4_u]SESKK 1[^E8uh. YPh 聙ËuVK 1 uŋEtPh O_Zuu--^ux-5``-9~Lk _-PhL ZYu0h@h h-jp|`-05x`-YC-1-Et Pq1EX]tS0J _1Et Pq1ɉM[]tSJ Z1EtPqXe[^_]UEuG-=-t%5-h*. 5- -fHhIE PEP7 UBw -t -u -u)E @t-t:u hU. jMPRPE pZY=-t"=-t5-hr. 5-. -j h-h-hd-`-j h. h-h-j h8M h-h-$j hh@-th -j h h-Yh`-=-tjjE p UWVS0u=-uue[^_]=]ȹ 1SjhVhu}uVh S 1E0ESXZEče[^_]UWVS,EPu EPrUȃ u#X ỦEЋE0ufEjEP5 |-EUXZ1ۃ=|-~yjEP E+E‹E__+Ey@Biy1RjEP uW 8tW 8#tuoW <__W 1҉jEPV u CW y4W 8E&W 8#7ËU9} )‰UEunX؍e[^_]UE]UE@(]UPEx$tEjURjj0W1USju[Zxj0jHiZYu SEY11҉P$]UVSPuEj0jiZYt,0@$jjVjEPhhVʚ ؍e[^]US]t&S13sms mSm1]UWVS(]=|-~jEP |-EU_XEE E̋C t 9EsẺEЋ}s)C C)E0}1u&uW3 t}R)EEЃ}umHU 8:U 8#tw0U C(&U 8uE9Cr">uC,'U 8#ushZYCEЉC{uMEЉC 1{UԺufU؃=|-~;jEPɇ E+E‹EY^+Ey@Biy1UT 1҉VjEP] u 8T 8t.T 8#t$T C(9R 5|-PhL' 5- S <C(<1EЍe[^_]UWVSQ} ]{uhlbCZC{({,C;C C1s sSjjEPu{(uT{,t Cu`E7 KSBCEC9Cu3pVsfZYuS C(1E2Cs} z뙋s )9|Gs}UC Ee[^_]UWVSSu] }VuS u-~,tu4, tB, 1ɉN(YSA ZHˀ; u9UJ9u1VjjEPat} ut. 1ɉN(t1҉e[^_]UE Puv j1 UE Puv XZ=.u .UE PuXZ=.u .UWVSSƉ׉ˉʁv )…tRUWV  tUu5 ؍e[^_]W|$wUWVS||xˋ7GEGEh_E_u h. h_EYtU 1u]EEEĉu1EEEEE11E11҉UUU}t }}uetWuu EE)PEW| u h. _XC1Ʌ}lj}EU1EMu9}uh. A^_EEu1ɉMCw$d!E8tJ1M9ȋM}uh / XZFh*/ .XEE@EO}jjj}E 1}Ett hD/ O@EO}E8t h^/ +@EO}oEU@EO}O=E.E0@EO}E @EO}jEu E8u$ Eu E8u @E"u  NEO}~j8hy/ jEPUu [h/ 1RjEP轀EZYwP$!}tR}uL1Eh/ XEE'h/ h/ h/ uh/ _X+}t?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuVx tVPPh3 HF9.s.e[^_]UWVS1ɉ /t($Xtd+Y9~T\uw@1ɉÅuh3 _1Ҁ8IuC1tmF:2>uj RPF h3 m؍e[^_]UWVS ÉUE9C;Yu5ApV' ZYu Vh15  뾉j & `.Xx1ɉH `.[sCt<\u hF5 Nj$j(&G1ɍHXZu h5 !_1t 1ҍCGDžhFc1҉P`.AhI%Y11Džȉy<\t uuFh<9  j2%Ph6 CPw1tV4FP'DJ@tC<;sh G1CZt<\u h6 u h6 HÅtP'h 7 DB@tCujjPjDIƃu jj#jjPjIt9t h/7 S='u?1@=utnԍ1 󫍕h 1V^HYBu17Fuދ8u P'0Rj P-H v jjUj"hPj H wӋuu@kHPNJkHЋ8Nj󤋅B$(׉XZDJ@t Cu<;t<}XhY7 `CH e[^_]UWVS1ɉ1ҡ.1`.t%;{ uCph7 :XZSDYFuǡ.tk Pp.Z.@P[.Xe[^_]UVSƉj =pX1҉''Ye[^]USj1҉P|'|'Y]UVS5.vtQh<6 YXtKyS Zt# PSPS  S X1e[^]UWVSu].Bt1.u t1ɉ 1҉`.PtJtHh<p4 ..RY_u Rh> jh..qph< jh. vhz8 h. XZh...@. 5.u VHƒ tC`.@`.Hu>#u~nu p..@ ..5. _1,.=`.u8#uxnu p.M 1M I t.`.t]Ut @uKf .-t.1ɉ .=.9G .`.t1BJM pЍe[^_]U塀.@ t=.t/=.t;HyP7 YuԋJ 5.P-XZ1UWVS|u=.uQ.8u==.t h8 j.'h.. |.X'd.)..tQHyP Zt@ J5.P5.h.h.3 Ã]F.='u 1~1P [=.tdh.\ h.5h. t ? .XZ`5h.h> jt.| uKfF u S5.V`.e[^_]USE PuhS S5h.5`.h8 jUSE PuhS S5h.5`.h8 B ]UWVSR]u .tP<XjEPVS}P.WPVSg.e[^_]UWVS 1;.s}k .tJtc5|.pjp Kh<p Y_t6Vh jW t5|.PjW V ZC{|.@ @t18$ ¸:t'$ PBP5d.hj1..e[^_]UVSu.uh9 j.5.1ۉ^] ^1ۉ^ 1ۃ}u.CQVSRPӕt 1҃t5.P_Ph3 j)Ѝe[^]UWVSE. .z %&\u.rEP'Dpt zu0y_<\t<&uG .5.V9r0M .P5.ã. ..XZM .C1.xutyPx utk .)ʋ .L 9r2U .P5. ã. ..YXURU.M 0QS趿 U. .=.W9r* .P5.ã. ..XZe[^_]UVS]uCP9SsCPsXCZY}u1CVu CP ss0 e[^]UWVS15`.4jh$.MZY01ۉ,..1ɉ .CSuu xK u `.)9BmuB5(.j1ɋ$._Zu `.9B St1s .C8u `.9Hs1ɉK 1tu*@5(.j1ɋ$.a_ZtЋCu,u `.9Hu׋@9`.pu x_`.C \u@5(.j1ɋ$.Y^u `.9HYCt t G ? C=<>1 $!.9.r.kP5..XZ=.k 5.1h,.15(.{u5|.s: Y[ =.uu =,. (.t5$.CPj Vr u,.g @))Ӊ(.SPV7 mj5@.5<.h$.;jjhh$.j5@.5<.h$.Fj5(.5$.h<. jjhh<.ej5(.5$.h<.M 5|.s"(.@$.D=|.X'uY'u[h6Zt8tP"'_9TPhht@j uVft''<u 't 11@tR@DPP5Lt%tv$DP 1DžLP u?F;5'r5|.hD Y^5|.j$荵5|.j 耵1W4ZtHW6X;5'r5|.hD ^X5|.LjD tdW#5YtXPh!d _ZDžtE;5'r5|.hD 2Y^!D9 Ph 9 5|. _L<;5'r5|.hD XZDL<Ph$9 5|.B G 9 j^jhs Hփ=<.ujjhIh<.r\$.$.0.<.0.<.\=,.(.Lu{5$.='u(.$.9PF1.TuD1*jjTPkH@9Ls BD9u[ jHC 3sXZ뇋]U PhL9 h' jd UVSQƉ" 1҉jEPVS >tE8t  1:"u#C؍e[^]USPaYt@Ut‹EBu Sh9 j?]UVS'tt2JughVPà `jh!jhVPNÃDh'hVץà u h9 jj P* ZYth: jtSLhjV| ؍e[^]UWVS Ӻ/: 'uIRPh7: hVH Ƌ{sCsCV <$jjjhRWPVs ssJPtPhJ: !ZY1@QRBPCCVP $jV{ hjR{ $V%Xe[^_]UWVS։Ϻ/: 'uIRPh7: hS9 ËNvBvBS ZuQQRPSGPP,Yu(h3h= j{ jh= W tVZu 1҉SjPR% ;uWh= Y[뭉 8uዅs Cj]ViXe[^_]UWVS~Éπ8u= h<SV XZuSh=  [^o1ɉMjh= EPEPVtL8tߍURPN7jjPEu׃UtEuSh=  EuR7XZ1e[^_]UWVS E׉M=T.vQRPh> 蛴 1EEEG ut`P8Ëw(X.XtJ9G$tR G(ErU9Y9EUurU8PS UuŋZP$!w93jjV8<XZE|jEXijw=8h<P\ uh#> VPEV;Y^Uu h2> j$R襜ZtPhK> j7Phi> W tKjj‹G$Uw 6UBZX.B tJ HX.BX.1r uh> h!h h>  UԋG$w,uEV58EV!8S$8ES8M܃QVu؃VPuu,UԉUth> vY1uu<7XZu[XۋUu% Ph> E^_}t uY7[1ɉM1}t EBE}t uS-8XZ0]fEe[^_]UWVS u V 1ZtP3*_uVh? —Y[K SjECP7Es7 =vh5? h!hNXC1E<GP7ƍGEPVSunK9thJ? h!hh>  E D>EPu hX'juV" Ht hjhX'c d'Ze[^_]UWVSu }th[? h!hh> B Ew*vhWià uWh< hXZ6}uhPVVpFShPPS=e[^_]UWVS)uFv}hy? }h@)jhPjE 0ÃtbDžPhF8S @t9u t'E 0h? 臕S. DžLS_E phS>H uSh< 95u(hHSeS?P6. E p&.[uuP,XP"L tX$YX'Zuh? 覔X"X@'t$t w r@0DžLE T@X@tPY3_XH PE @1ۉ\\S=\PXG^WHTZX@DH$!@!jjh ST藤y h? PS`Pr P=Tq=8 u=Tj=T_StURPh PT y h2z =wh? ܒX4= 8=T똃uXX1s1{t/tuAV1j#V1ڸ? kY.V1jڸ? cXZh? $s@VW1ZYDW#1s1s^_D[05jjh PT֢yh@ 5fUjjh PT蟢yh&@   DžD4`jh`P1i tDuhu僽l\u1p`AQ13!9u@th:@ ܐXTu%PP@@PۋTT9XPu LuTEPpPH!ʅuP tHJHPCX1҃Puąth\@ (Xh|@ _X? T謜[^zX" T菜XZ1ɉLLe[^_]UWVS.h.5.uE}9s_ t !f !t!UEE`!=~!! !9u !B뚀}tU.u5|.[^_]Ë..B.B.h.t..UPhIh'h j UWVS.u3jb._u nB 1ۉ.15.B.S9.r14VP* .ZYtT01.e[^_]UVS]g.tI.49t>t ..J .J..u[^]US]t5.t.;u1҉{t sX]]]UEt?1҉PPPBPP@1ɉH,.t .;u]2]UWVSÉ2 8S3C(.Zt .;t C 1ɉK$1tfVftPu ZC 8e[^_]UVSu j0nYu B Ép VQCZtCUC؍e[^]UVS].t .<u'..4h@5t.rXZ.t .e[^]UWVS =..=.u .=t.u t.'=p.u p.X'.t .<u'..h@5t.XZh=...}E !f !t"Uԉ}E`!~!! !9u!Gf!u}tEԣ.Eأ|. !u=|.. !u5h.)x..=. $!1.=|..5h..Xh..x..h..x..h..x..h..x..vh..x..Xh..x..:h..x.. h..x.. h..x.. h..x.. h..x.. h..x..h..x..hh..x..Jh..x..,h..x..h..x..h..x..5x.5h.%._X.f%d.5x.5h.^%P5d.3&d.Gd..15d..4h.J5p.j5x.5h.ٷ +h.HEܠ...Ez,uB.t.B,B.5.u5h.u4M9rz}܋Elj=.df !t .=|.!Y "!9t `!!5h.u=GRL΋M9s B uM)Ήuz(u N{uNM1ҋM9s ]BEx,uH1ۉ.XjZ u؉B UPQUB[Zt4.E]X Eu!J.)ȉƃzu1ɉJC  v 1ztct.HyP踿 Yu 7J . .JʋMDF9u t.@ @uW.ma 1҉5t.Sj..upV貟 .u5t.B @t) 8t /C + 10t.f` 뜋 ..B1ɉMu7}u5t.RZE..@,E5.] .. 9Z s6MVrU>UBMXXzu LC tr .B@D@h.}t$}tm}lj=.\h.]J1҉.t h...H3=.O5t.BX><=.¡h.EzC FMJ1 e[^_]UWVS]tU.t/.[  Uu}1}󤍵 Lʃ6 @@uSnR j@VSZ j jPQ j@jVQ (PSZ uuSZ jPSZ $1 Lʃ\ @@uSPkZ SQ j@VS@Z j PS1Z $SP=Z j@jVQ hjSQ E v }}Dž )E j jPP 1e[^_]UWVS0Dž*4!*󤍅4Dž @!󥍅Dž DžDžfDžDžR"`!R󤍅"Dž !󥍅DžP!󥍅Dž*^@!*󤍅^Dž !󥍅1ssss RtWu RsW"O u 9ue[^_]UWVSE ƒ} W}M1dkP]_1pd9p}$phkp]lEXSd‰NjuM󤋅hȋ}:Y1hhtVSR`uuhyK U`thrD h!jZhD  tl`jVl  `th1h;E ]RpX1e[^_]UVS$É1XPjgjVj@Pj@PSP4(u3EPjYg2E+Xi@BE+` e[^]UWVS h'hD E EY[E EEE-h'j.exXZ0uڋMωe ʉSQRPuɋE‹E )Й1)Ћ}9~Nuh'hUXZh'h ?Y[e[^_]UWVSƉωӅ~ Vj wKXZuWhD V蔑 e[^_]US ÉUMEt8PhOEPg @MUu jjuuXZ]UWVSÉU}E PzEPEP E ~USj wUJYXWhʷSԐ W Mt1ƃ19}~G2~(ShD XZ~USj vUJXYUSE8PvGUBYXShD XZEEe[^_]ie[^_]UWVSNjA tX΃y$wPPPhIShD W F$4P!hIShD W ,v,h> 1҉XZe[^_]Uj *1҉PP@ @1ɉHHHUWVSP]{uC{uhM= \C_{ t1StJP]^1k$'WRU ZYUuG C Fu3'PhE q e[^_]U9U]U*UP]UUP ]U UP]UWVS}WPhs} uCVhgd ZYuCVh"L ZYuCVh?E 4 ZYuCVh֗ ZYuCVh& ZYuCWEY{u VhHE pXZ؍e[^_]U-UP]UUP]Uj4?1҉@@@ @1ɉHHHH H$@(1҉P,P0US]t?s+s#s s s, s0]]]US]t&3Z sR s CE]뀋]US]H{$!uhE  {uhE VoX1{ uhE {uhE ك{t h#F $oX{t hIF oX{WhoF uhF 띃{t hF nX{u hF |{hG u h=G \{t hpG nX{u hG ;{hG t hG vnY{u h'H  {t hKH UnZ{hqH Kt hH 7nX{t hH &nX{t hH nX{t hI nX{ tLh>I mX?t hhI mY{t hI mZ{t hI mX{u hI V[0]UWVS]uhJ GP Ǿ'XVW ZYt $t'u3 PhJ Qm Cuh;J =m[1e[^_]P Y15.tW4X!\ YZFu WhQJ lXZ{ uhrJ 몋CEe[^_]EUlU]UVS]u H$!CjhCC PCPCPhFPRjhChFPCCu(hJ jVsCZYuhJ !lX [0S1e[^]USM1ҋt8u X0P0H0ЉU[]UVS]؅tsQw$!hJ hJ kYx th K @0u C C$C(jh C,u\[0tFjuVSxYZ@u h6K 돍EPEPVrrE tPh>K kXZf1e[^]US]؅t\Qw$!hJ hJ jX:x uhQK @0ƒ;ts, jh C, [0u1]UVS]u u tFPwCFPwCF PwC FPwCFt PCP^ XZFt PCPK YXFt PCPXZF t PC PYXF$t C$F(C(F,t PC,P XZ؍e[^]UWVS}:WPhcK  uVhJ  ZYuVhlK  ZYuVhK  ZYuVhJ { ZYuVh~K d ZYuVhK M ZYuWY;u VhK hXZ؍e[^_]US]u ZE ]]$UDUP]U4UP]U$UP]UUP ]UUP]UUM t‹@0uJ0 ]UVS]u uÅtet PSYXFt PCPXZF tC FtCFtCvsLCvCPiV؍e[^]UKUP]U;UP]UVS)u PhK  uC$C({$u VhK PgXZEC EC,؍e[^]USu8ZtI@tBxu@SP0xt!CSJH1ɉJP0C1C؋]UWVS]h<S谄 Y^DžuDƀ;/t0ShK h^hS4 h<Sz ǃu ShL W1W连 XZe[^_]UVSu]NSh'L 6YZP$!Sh/L vh: 1ɺVSh;L Sh:L ShGL vSL U v(3U v ^L U vٜ U vhG M 1҉ U ShjL uShnL Sh~L JvSL U ZYUuGRqDY1VE u0Z؍e[^_]US1;] }E4CX]USEU M9t0@B[]Uj蘽1҉PUWVSu} j|ÉxGWpKC؍e[^_]UEp0US]t3NX]]A]US]3E X]UWVSjËE @UBC@PU2JB} 7OC؍e[^_]UWVP}u VWEWPVJEe^_]US]S߻ $S]UE]USjRuhPC;u jj؋]UE ujp0X UWVSu} jÉ8WCJ؍e[^_]UE0pUS]tsX]]]US]3E X]UE@]UE]UWVSM] 1;u&9tqC8u B1҉[^_]UWVSu} jËY9sЉPjKCXZ19sʃ9sVO2K@׉؍e[^_]UWVP}u VWEWVEe^_]UWVSPu~W肺WP6"uhM _6h?M v_ʍ 9sPRhDM Y_ST1RCPES: Ee[^_]UVPuVkEVEuUWVSutiPERUȹËUUEP费EȉCvNjMuuURSuuSXZ1 PuES~uvEe[^_]UVPuVMEVtEuUVSu jÉ0V Cuj QRPxx Ht S*X1ۉ؍e[^]UVSh<u{ ZYtu PS, ؍e[^]UUM } uU E]UVSuu PVE ]e[^]yUWVS@EEEEjjEPEPjEPE@tEȉEEE1uԉuEjjEPEPjEP11@tN jUMU tt&1u.cN t%N kN t|N cK tsN ]UWVS0]u SWYwzK0<C,9s1S8U1҉UȋS(U}ԉEE܉MC4u9sMSuVl _ZuVbYuEVSXZEče[^_]UWVSLuE}(u(_EEE(EEEEEEEE E1EĉEȉẺEЋEEԋE E؉u܉u1҉UUUE8Eu4EPEY^u[}$t }$ދM(}0tE},t?u4EPu0u,[!t&u(Svu0u,kSuEu(SPSZ Ee[^_]Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUjju,u(u$ju uuuuu ucUjjjju(u$u uuuuu u6Ujju,u(u$ju uuuuu uUjjjju(u$u uuuuu uUju"UjuUjuUWVS]uSZYu)s;119t]  2 AJue[^_]UWVSLuV ÉEE$7ljES,EZYtOtKE EEEuVuV 1ۅu0]u‰EXtuSV* 1ۉEu!uS Ee[^_]Ujuu u-Ujuu uUjuu uUju uUju uUju uUE#N #w!]UWVSju ZYP覯 [uD u : u0 Ǎ\3u uj ؍e[^_]U E D$D$E$, ]UVSÉ1ɍU@EEU T uXZ[^]UWE }_]UWVu }^_]UVS]u 1ɋ΋T11TAu[^]US] Ee…u)҅uUR+hD$hT$l$PT@P5kAكD$@T$D$P\@X$5y!~[D$0T$4$0$4$$$P$T$8$<$$$X$\D$xT$|$@$DD$PT$T$`$dD$HT$L$H$LD$8T$<$h$lD$(T$,DŽ$ !D$X6_D$\:OD$p+D$trnB4F߹󪉍0T1󫍝dVRU[^@Uat ߋ0ߋuMhSRhS{1e[^_]ÍL$qUWVSQHAEQ}1};{T{P111C@SDs1C@SDsH{LtCXC\CPCT)ʍt `1S`U}E}j@P|hURnj@Sf1eY[^_]aUWVS] u}UEt ujK?w}tut@wޅtPRSPSPZY@tWVV @tSuVUà hP؍e[^_]UWVStu}E @wSPS*ZY@u'jPS @tWVS~ @tu uS 1@j@SZY@tjPS@ @tWVS2 @tj@VS} @p}E XEE )؉@Ǎv7jjj@Pj@PD@ jjj@PSP@1hP1؍e[^_]UVSXp@J!ȉ!ȍJG!! ȍJA! у>у+?҃/ [^]UWVS É׉ιE1EtuEE9}saEE11E9t/FFǃщU?6CCUwʅt)щ?CEE [^_]UWVSEU1EE1Jrz) ֍B!ƸZ) ! Jо9) у! +҃> /у? ЉъA! t>CEЉEEHwMNGu;>s.U}G}ك}wMЅEuE81ۉ؃[^_]UVS100 wwk r@9t90uA9u1[^]UWVS]u {CEjucYXd>$u}FRU $EURV u\MC8jh\R V uFU<ƅt+EC8jh`R Vɓ uFUƅu EC,jhdR V蔓 u܍FUƅtˋEC(jhhR Vi uFUtUS0S48$uH}CUz{US8$lHEEUPƅOEC1CCC C$Ce[^_]UWVS,]} juuxEЃ f$CE̍_V1 _9H}U)Ãv$v=BE̍SUȋEp8h> ]SS U9sIH}̉M)ƒv3$m=AẼUȋEp,h> S_S蟐 U9r EH}̉M)ƒv,t=AẼUȋEp(h> S SJ U9sH]֋}̉M)ƒv,p=AẼUȋEp0h> SS U9[H}̉])ƒAf$CrEHpY)ƃf$VC}whZ@EЍe[^_]UE1tu@]USE vA1[]UWVSÉ\RW1SW@WP}t\PXZ^f N ^$ډ3F`3VdN@^DӉȉ3F 3V$щҋډhl3h3lщptpҋptډx|3x3|щN^ f(N(^,ډ3Fh3VlNH^LӉȉ3F(3V,щҋډ33щҋډ33щN^f0N0^4ډ3Fp3VtNP^TӉȉ3F03V4щҋډ33щҋډ33щN^f8N8^<ډ3Fx3V|NX^\Ӊȉ3F83V<щҋډ33щҋډ33щhҋhlӉ11ڒҋډ33щҋӉ^33Nx^|ډFPVT33F(V,ҋӉpt11ڒҋډ33щҋӉN^ 33N`^dډFXV\33F0V4ҋӉ11ڒxҋx|ډ33щҋӉN^33Nh^lډF@VD33F8V<ҋӉ11ڒҋډ33щҋӉN^33Np^tډFHVL33F V$9mXXډ33Ӊ11߉ҋډ`d3`3dщhlhҋhlډpt11׉x| HX ډ33  Ӊ11߉ҋډ33щҋډ11׉ډ33Ӊ11߉ҋډ33щҋډ11׉ډ33Ӊ11߉ҋډ33щҋډ11׉`ҋ`dӉ11߇ҋډ33щҋڋS11ڋ33 ҋӉhl11߇ҋډ33щҋڋCS 11ڋ33ҋӉ11߇pҋptډ33щҋڋ11 ڋ33xҋx|Ӊ11߇ҋډx|33щҋڋ11ڋ 339XP\P\e[^_]UWVS uF t%1ɉ} }jPIjP;E 1E1E1F 1F1F 1҉ Dž} u}t1Lu<$(jى>jىډ1[_뽋NEFU1HCD.1vJu H u>$(jjʍjZYM1ۉ} }}1ڋ1 PE PV^  ؃~u^jXG;~HT71ҋN1SQRPÉJ} tj뚍e[^_]UWVS]h.2Z@ t@.....h.hlW S5f y h.2Xh.M2_@ t#h.h@W@Sf y hlR jzzh.2^@ t"h.h[W@Se y h.*2Yh.1Z@ t,.h.hRW Se y h.1_hl.1^@ t,`.h`.hRW STe t hl.1YhL.l1Z@ t,@.h@.hRW Se t hL.s1Xh./1_@ t^EPhYW@Sd h.=1h.31h.)1h.1h .1h. 1h.0^@ uh.0Y@ uh.0Z@ kh .0_@ Vh.t0^@ AdEܣ.tE.E...E.tE .E.. .h0./Y@ t/h,.hWW @Sc y)h0. 0h4.0_Xh4./Z@ uh ./^@ tvE 5 .V躒(.YtAh .hfW S;c ǃ t;ރ 8#u5(.1(.ZMuyE .e[^_]d/e[^_]UVS]h./Y@ t6h.hPWSb yh~R Eh..hwP/ h..Z@ t;h.h\WS|b y hR jvh..hwP. h.{.^@ t@.h.hSW S&b yhR h.B.hwP. hl.*.Y@ tC`.h`.hSW Sa y hR Thl.-hwP.. hL.-Z@ tC@.h@.hSW Sa y hR hL.-hwP- h.-^@ t9h.h]WS7a y hR h.P-hwP- h.8-Y@ t9h.h^WS` y h S lh.-hwPF- h.,Z@ t uVhYW@S` ydh"S #h.,^@ uh.,Y@ uh.,Z@ uh .,^@ uh.y,Y@ uOh.c,Z@ t .Eh.J,hwP, Etbh.,,Y@ t .Eh.,hwPS, h.+Z@ t .Eh.+hwP", h.+Y@ t .Eh.+hwP+ Etbh .+Z@ t .Eh .z+hwP+ h.b+Y@ t .Eh.I+hwP+ VhZWS^ y h8S z15,.h0. +Z@ t ,.h4.*¡,.YB t ,.tch,.hXW S^ y hNS ,.th0.*hwP* ,.th4.*hwP* e[^]UWVS]h$_/[*^@ t!h$_/hW@S^ y h/T h.)*Y@ th.hW@S] 1=_/h_/)Z@ t _/h_/)^@ t _/h_/)¡_/YB t _/t#h_/hW@Sm] y h=T jq1=_/h_/|)Z@ t _/h_/d)^@ t _/h _/L)¡_/YB t _/t!h_/hW@S\ y hMT zh')Z@ t<'h'h WS\ y hdT >..(15.h.(_@ t .h.(¡.YB t .t!h.hW @S8\ y hsT 1.h.J(Z@ t .h.2(¡._B t .th.hW @S[ xh.'^@ t!h.h W@S[ y hT 8h.'Y@ t!h.hW@Sx[ y hT h _/'Z@ th _/hW@SF[ 15.h.e'_@ t .h.M'¡.YB t .t1h.hW @SZ @u{ 8t hT r1'e[^_]UVS]h.&Y@ t9h.hWSZ y hT h.&hwP& 1_/h_/&Z@ t _/h_/}&^@ t _/h_/e&¡_/YB t _/teh_/hWSZ y hT j}n_/th_/&hwPS& _/th_/%hwP2& _/th_/%hwP& 1_/h_/%Z@ t _/h_/%^@ t _/h _/%¡_/YB t _/tch_/hWS"Y y hT _/th_/2%hwPr% _/th_/%hwPQ% _/th _/$hwP0% h'$^@ h'hWSX y hT h'$Y@ 'k ' 19tef0f9.uQfpf9.uDfpf9.u7fpf9.u*fpf9.uff@f@f@f@ h'$hU h'$hwPE$ 15.h.#Z@ t .h.#¡.YB t .tch.hW SmW y h U c.th.}#hwP# .th.\#hwP# 15.h.<#Z@ t .h.$#¡.YB t .tch.h W SV y hU .th."hwP# .th."hwP" h."Z@ t9h.h WSPV y h:U Fh.i"hwP" h.Q"^@ t9h.hWSV y hJU h."hwP_" h _/"Y@ t9h _/hWSU y h^U h _/!hwP" ='15.h.!Z@ t .h.!Y@ t ..th.o!hwP! .th.N!hwP! =.t4o/HfJfBfJH54o/PfVPfVfFPhfFY4o/HfJHfJHfJfBq) v Yc T0EEEPZxfo/9Ix o/1 o/@!tʁw9 !u 4!4!;(o/s-$o/P$o/p0o/P0o/o/P$!uɸ9D Bt 50o/$o/؍e[^_]UWVS\0@05d0uE}9s] t!f"tUEE@!~!! @!9u !B뜀}tUX0u5T0[^_]Ëx0p0Bh0Bd0@0L0l0UPhIh'" j UWVSp0u3j{p0_u nB 1ۉt015x0Bt0S9x0r14VPp0ZYtT01t0e[^_]UVS]gp0t@x049t5t d0l0J h0Jx0[^]u[^]US]t5p0tx0;u1҉{t stX]]g]UEt?1҉PPPBPP@1ɉH,p0t x0;u];]UWVSÉj 8S3C(p0Zt x0;t C 1ɉK$1tfVftP8B ZCj 8e[^_]UVSu j01yYu B Ép VyCZtCUC؍e[^]UVS]p0t x0<u'x0p04h@5L0rXZp0t x0e[^] UWVS =`0`0=\0u \0=L0u L0'=H0u H0X'p0t x0<u'x0p0h@5L0XZq=d0l0\0}E!f"tUԉ}E@!~!!@!9u!Gf!&u}tEԣX0EأT0"u=T0X0"u5@0)P0l0=d0 $!l0=T0X0똸5@0_u5@0hic fo/o%=tсy e[5@0:o/^@@0J^w Rhzc j%[Phc 5H0j5P05@0, 1+@0HEܠl0x0p0Ez,uBh0L0B,BEh0d0E@0u u9ru}lj=d0[f"t X0=T0!Y B!9t @!!5@0uG@utM9s B M)Mz(uIEuNu1ҋu9s uBEx,uH1ۉh0XjZ u؉B UPQyUB[Zt4d0E]X Eu!Jd0)ȉƃzu1ɉJC  v 1ztcL0HyPj4 Yu 7J p0 x0JʋMDF9u L0@ @uWh0me 1҉5L0Sjx0p0upVd h0u5L0B @t)d 8t /C Ed 10L0f` 뜋 x0p0B1ɉMu7}u5L0AZEx0p0@,E5h0] x0p0 9Z s6MVrUwUBMXXzu LC r h0B@D@@0}t$}t9}lj=d0V@0]Kd0\0H 4<=d0¡@0EzC =FMJ1 4e[^_]UWVS]tOp0t/x0jWV.zC 8,ukpjWVzC 8,uNpjWVyC 8,u1jW@PyC p <:tu _>t50hd jNPh$W9 y hd jvNh0_@ th0hwPD h0^@ th0hwP h0[@ th0hwP h0Y@ th0hwP h0qZ@ th0`hwP e[^_]US]h06Z@ t!h0h W@S8 y h6d h0Y@ t sDh0Z@ uh0Y@ uh0Z@ uh0Y@ uh0Z@ tEPh'W@S\8 yChFd 5h0xY@ uh0gZ@ uh0VY@ ukjLh0<Z@ tE죀0h0#Y@ tE0h0 Z@ tE0h0Y@ tE0h0Z@ t ؋]ph0Y@ uh0Z@ uӋ]UVS]h0^@ t=0EEPh!WS87 yhZd Lh0ThwP h0<Y@ tB0EEPh#WS6 y hid jbKh0hwPA h0Z@ t Dh0^@ uh0Y@ uh0Z@ uh0^@ uh0Y@ t uVh'W@SA6 yBhFd Rh0ZZ@ uh0I^@ uh08Y@ u%h0"Z@ t0Eh0 Y@ t0Eh0Z@ t0Eh0Y@ t0EVh(WS5 y hyd h0Z@ th0hwP h0x^@ th0ghwP h0OY@ th0>hwP~ h0&Z@ th0hwPU h0^@ t 4"h0Y@ uh0Z@ uՍe[^]UWVSƉӍ \ Y[aC8u hs'1۸t  C0XZ1۸!t 'Ph  _XC u1;>k ^f;u$f{uf{uf{u f{j i Whe =  f=tPUPh@M   CP=Ph@M  C f9Cu f;Cuf;CtQPPh@M  C f9Cu fKf9Kt)PPh@M  CPPh@M  GDž`C#t.'X tIPRhP 1`utIdVCp Y[t h}  Zj -VPhe jDj Xe[^_]UWVS }] uGhL(t<tQ=J=qiEPhײ S{ Ht Shϗ GUEPhSu{ Hu؋GUt\UwS _AhojC1u1:tqUO 1ɉj EPURn Et She jiCMO 8"Mu w؃~Qhe Ѹ ƋU: uB7j.S ^ZƅtF'EuShf 끋Wjj.VL ZYÅtC 'Eu Vh(f  "UƅUt&Ek, E@sE&EċE6EuȉEt-u k, BE}9}uE;EċEEEĉE@u F~F EaFk EV%N N W}}M ω}<}MI щM}WρM MI ʋMĊIEƉu؋uEЋuEԉ}UU0 EU0 MEƒEt‰ЃEtЃEuȉe…t wEk, ‰E@CEĊPB1$`" }uCCS$1 CXEfC\E@fC^E@fC`E@fCbE@k fCdEĀxCh@fClEĊ@fCnEf@ fCpEĊ@ EfCtE@ fCr`C NjuOu k, BEEă 9EtuȉEt뱃Eu9uCCEC$119~k, 9}B{XtSd9} fCdEEe[^_]UWVS,UEEЃEtE @E EE1Ut}E 1}_]E܋GEE }]4E1 JM1SQRPiM)ȃȃ1WVRPƉ׉E@EiE@BEȉډMȉ]EWVRPd‹E]E ]ЉEiEEMȋ]́Ƥ~WVSQ%MȃM1SQRP ։щʋMȃu1WVRPEU1}t}E1}E܋EH @]S)iU1҉UCMejh@BRPcƉ+u}؁Mԋ])ӉʉًE܉ډWVRPHE܍4EUEUE}G ƻd1)‹EPH p]XE%E }G}Nj]{؋}{ ] Xi@B1jhuujhuugRPWV[}e[^_]U$EEEEE&EXE(EEujEPuu uUSXu t%؋@+B $<$+ Z $\$,$]UWVSÉ׉1t )E1XJ~D>Phu YX؃t w t u F19tAE9uuUM7Phֲ lXZUM΃^Ѝe[^_]Uh'hu F<jb00t9W|$wUWVS01B015@'% 2f62 s f0/sf0 s/f0f00f002 erI00ff0f0=`0tijEPsmEȣ0Eȣ0ZYF000 00 00f01ۉX'X'p020U1E0uE0 0jh052à x9u hv SXSV50hv U62HujhT'j p0|0d0=h0u=d0u|0|0d05D'=H'u؉}mrqL'E؉ d0h0 d0h0El0l0=ɚ;~ d0h0-ʚ;l0|0d0$p we[^_]g_UWVS4ƉU)'hv 6Y>F hv FfVRVRPWSPhv  j.]SFPj uj.hLDSG Sh w j.SFPjj uj.hLDSF SVF^(ZU)ڃ<,wJ<w1tR<CSPSPhLw <+h$w "<:tI<50hdx .0t Ph{x XZ0t?09} hH_(EEUe QQ$hk 0=`00P0~4؉EE]-H0PP$=XZERR$5\05X0QQ$5<'58'hx 6$hX' _hX' X}ɍg_W|$wUWVST 00u 0h|0j80_Xv,-|0 =0ݝ(1@D ݝ@1ۉ(,h|0j腇0ZYt"jj. W jP_jl0t1=0݅(zt -|0 =0ܭ(ݝ@090݅@؞vw|0d0wX r 62t=@'t#62t_|0d05vܕ@݅@zX0k H' %D'ʉHL߭HvݝHp0|0݅Hܕ@v݅@2`fDžd ٽZfZ fX٭X۝H٭ZHPj`PF  ݝyo/ 8h)Džt|1󫋅Tt xDžDžjP52ǃ y&. 8Nhx SHj[^6Ӄ w1…{)uj{,ud,u_jh2CPW uS$t*2t!9t62C Phx CC(=L 9e62qPhx $1\jhP`PZYtuxt62hy ,62hPPWh&y n Iփ w1t7t1x)ux/uu@ @u7L 9rhJy ^tS~)tD 9r?΅u7~.ƒ  ˆtӋTHT<9hly T@f8f;0 Tf@f8ff40 @0@'=`0T@1ҋTI ɋp)ˉ8py$hl8@B8phl)Ӊhl߭܍݅ڽ8@0vٞv؋ 0`P0P0H0H08'v8'X0v X0482Ћ44t0 0 Ј262 tjhU'jNݝ P 8PWhy hy z62݅ tYݝ81fDžF Phy [^݅8=`0tQQ$hy  ؃4t hy ZT\1NjH9s:0@8t!t\SQRhy  B뺉 \ <jh0T PI 8T@f4f0C02s00 ڈ262 PPPWhfT@‰ffP ft2ftGfTffRPh2z TfPh z  TfPhz  hXz ,^62y TXW@<?<j.VSjVT@4"h}  T@f4fftfkfqhOz )Txh]z dX62tKT@thwz hz =X+81%8P4fPH9\H)T@uF=wtyh2#f9f4f4P=v 141P 9ȋ8"8ԋTp_62t3t uhz h XT@t hz X  hz Y1H1ۃHu ˃j.RVjIuj.hLDR4 Ph?M OXZHuu hz 5Y Shz 'XZ geTP\w닅T@P9TX\H9s&$9  P'DQtMRPCYXʻ\J9H4sb4PhIhd 4H9scTH\SHZuh2![0:utSf YƄ4\n162:h T@Z<t <uhz h XDž8)T@Hʃ8tHj,XHT@uRhz yRhz Rhz 8YXtj,Lhz !XZ)P\uj,&h{ _XRT@9@8j,VT@Ph { 62P!PWhfT <x2<w><tG<T@8Ph{ P $P"<rT@<w*$"h${ Bh<{ ;he{ 4h-h&Ph{ ,T@t <uh<h{ ^ Ph{ Y[THFh{ T@Z<t%w uh| <uhL| h#| ]_h7| Phq| H[^T@8Ph| *THjh| h| h| h| h| h| h| }h| sh} ih,} j.STPj_uj.hLDS/ Sh5} qj.STPj)uj.hLDS/ ShE} hU} 1hu'T@f8fZYfw2$"hl} h}} h} h} hz h} zuh} nh} h} S1ɋHQ t Shh} &uj.VSj*h} I[h} 9hu/T@fHfZYfw-$"hXz !hl} h}} h}  h} hz X62t-T@<m4"hbPh^_62 62uhX' [g v狝t݃{)!C2t!#t1 h} 3th~ %C Yh~  C HC SRRPC Ph*~ H ǃxPhO~ XZ h]~ XCPhp~ Y^19~gVH YZuVhy~ XZCj.RPj8uj.hLDR, PVh~ = F땋L 9؋00t9~~62 qm00t 90PUWVS]u#062tP3^1ۉ062462S 462@$#+062Yu` U1҉,625P't:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSU}tIB<:u1ɍ4 E  8uAu t<@t:u <:tu9uF~@u1[^_]UE`']USE] u|À:u%u@C8t9EsH:tt @|u1[]UWVS4}!}u[=062tQu Wn[^u<5462P)YtHWP D3XZhY)^1u? Dž)Etw}xjjju !jh@PE xDž1ɉ1ދ9rqhQu`ƒ ?tuZZ 0S0z 0HЀ u%V1Iu8:ut+<Dž\t-Dž t t11:uΉ1҉V9r)ډ)ށVSv,ZYu"S/^uC[Ɖ‰.1<#kcu SZYPFS7/XDž`'M1j=h S ƊtV:t֍HX)ىMAQPuVË tF}t uXWi.^KtF:^Dž@DžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QW_*ZYu:W-Xt u*Xr-Z _<ljljƉlj )PVQz SRg ,Ymt ub^)؍P9s&PSD)ZYuS,i XË Dže[^_]UPUjujM EU(62tP{ 1҉(62Y1 62,62$621UWVS1= 62uE 62=(62uYh9 620(62^_u=`P5(62譽Y[t?Duz1=$62062t=,62u,62(62u@ @uP 1(62 62P 62@Zu 1Sh9PAًP'TZ:u#t =$62t|0\N$62G|0\u $62P1ɍt:uf:Y\tAߍP5(62tY^u'(62tB @R 1(62ZD돁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u wu ][^]UWVS j=u uy ljd![Edu!E l8]EdUru<:<^uFG<:wMu})ߍGdPS%ZYuS([w<\ůG<:HЀw+1ɉMF0MȉE9t HЀvE농w1e[^_]UPEPhh=2hA2uƒ1uEUWVS} uLu7uuW1ɋU à =A2u u1Ɖ>1e[^_]UPEPhh=2hA2uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙz߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס\B2EСB2E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSU} u]RE $URjwW1 $WjfV $VjU$S ZE] Ee[^_]2UVS@ÉjjjQjRP] tNtL9tHVPq ZY@u:M j@]S0 hSh Pd'=A2tq 1e[^]UWVSSÃ=B2tO1t ,B2<!jsơ,B2!0B2)Y9sRURB2Z9Uu)@uÅu,XB2!1ɉ1ƅtÉ5A2A21e[^_]USX?A29A2rA2ÉA2 4t1[]À=A2UVShIhIhIh( d'hIhhhI d'd' =A2t] =A2t|p  =A2t QRPhU Ӌ5d'/+ =A2t" =A2t {=A2t$% =A2t+ SQRP֋5d']ڡ`B2hIhPhn ֋5d' ڸhIhPhu ֋5d'ڡ8B2mhIhPh ֋5d' ڡuDC[^]áA2uÀ=dB24UWVS DžDžDžjjPh`B2jP-@u `B2+ \B2PXB21 @HTB21t3tShPh 誟 t!Ƅ9h Xu ƅ2 t5A2u A2FtB<97$"A2A2A2A2A2볡h' TB2Q9}H h'@h'A2A2wp'iHp' TB2Q9P@p'El'7Hl' TB2Q9@l'A2A2A2A2A2A2A2A2ƅ hҚRh Pd'GM =A2t h' Y=l'p'9}l'׸ÉD=A2tMjRP  M95 B2sxu@)lj|| >;$B2Fs"J| u| | DT>| T 9Ss$EExSW ED CSW;sss{uISC PXZ=A2uE@,t 0B2EX,0B2؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC TB2‰ى[^_]UWVS¡,B2!9t> TB2)su܋tu 9t)D @!u܋D UEPh B2@ZYe[^_]UWVSQӋ,B2!‹ TB2)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS Eܡ,B2Ћu!9`x }؋ TB2)‰WtA2]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w "w""1w"1;SsS |C@C;Fu ;u1ɉHt SFPXZNZH9t9sxt PFP5Y_SV"XZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPh B2Ph B2=A2t KZ{ SC A2A2e[^_]UWVS90B2t0B29kjjhA2ǃ t؋_ jWhA2EWhA2]A2=A2;B2r;B2rw1ɉÅuj}먋 (B21ÅuP=B2@u1j|Nj,B2!‰)[9tP|B2Y9uō3B2t]EPhA2XZt>G 9r7 39s0jWhA2EWhA2A2=A2}뾉؍e[^_]UWVSÉU TB2EC1t}9xts@Ƌuzơ$B2EF}}1U9s1k`;$"t @u-$$"$" sjtt 0@p00uHP@$u1S$0t9(s *\p0믋H@9(s(0띍e[^_]UUӆ ;\e#sD']UU ;/#s']øUS] uSh' hpS\t 0Phh'藓h'j yXZE']q UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt )wu PEPà Et | 1]UWVS ‹@EP'E11 =E}9s%9]D{t}tk Y DFɅt}uzuB hB2BhB2 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEPÃxuUSˋ@ ى[]ÃxuPhB2@hB29Ps=UVSÉjRp u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD Py C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$`,"sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj='t9s?MjC,@Ps( Mu e[^_]C(S,z{,f P{<tgFL'0='u9sH'0='u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E'HuVQM4 t uMQ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCChB2iB2hB2'8[u"x.u.K9r !f3r9s:.u z]u{uChB2ChB2[^]èu'B P'fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uChB2ChB2{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4," ZYuCC u1]UUE ft҉U,"]1]UWVSSɾ='t9rC,E5L'=H'113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh V u 1ɺjh V u1ɺ,S j@B@Pr W u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uChB2ChB2hB2<-t<]u{uChB2ChB2hB2CE؋ P'Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ='u˸jE@$E@PEp G u fMA Q$JuN$f8-P9x]x-t A -f9k='vNf9~;{uC hB2ChB2ff9UPF΃='uމEa~{uC hB2ChB21E7* UFup>-uF3-U;Cr{uC P8]u hB2ChB2{Ex8tC @tEHfE1'u9}~Ju9sE8}3G8GEx<t4t fEfu-GL'8EuޡH'8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF P'f tNt L' t< H'ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCChB2hB2GƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC hB2ChB2{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JP'DJt%9~{uC hB2ChB2PU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uChB2ChB2<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $,"^[m\p{|;{r{uChB2ChB2S B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)uhB2ChB2 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCChB2hB2Gu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM P'Dyu},t{uC ChB2hB2@}t{uC hB2ChB2?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJP'DJt%9~{uC hB2ChB2PaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPP'DPt 1e[^_]UWVS} UҀcE tEp9J) W虳 ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEuëDžh1C1DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 P'fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNP'DJ_bP'9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXP'DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ P'DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h( qERGPx u )MuMA}dM)ыU9uG PV}$ @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ P'Qu?f_t9f}fMQҋ P'Qu f}_zftQ P'WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgP'OJf_ f}_Zf_ 8u_CfCU P'DQuf}_f}u2ы P'DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 P'fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNP'DJ_bP'9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYP'DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ P'DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h( qESGPx u )MuMA}dM)ыU9uG PV @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRU} UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f P'DAu;f_t5f}E P'DAu f}_fEzftOP'DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡP'DHf_ uP'Dpf}_Ɖ 8uaCf7E P'DAuf}_f}u4 P'DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRU U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRUQ UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG P'AuE P'DAuf}_f}u4 P'DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRU U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 P'fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNP'DJ_bP'9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYP'DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ P'DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h( qESGPx u )MuMA}dM)ыU9uG PV @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF='lt1ۉ]tMEAEW| YE}M9MP F,EF4EtpF8EtfFu}D$U DEED$ED$$U}ĉ|$T$E$\ ƃtdE$x[ ƃt'D$ED$$1҃ډ\ MD$|$E$[ \ M\ 8D$ED$$o\ 8t[^_]z\ UVS  W ;, D$D$$3' t@, $ ǃ, $ǃ ƃ, 1 [^][ 0ǃ, $yǃ ƃ, t[ 0ǃ, $Dǃ ƃ, h[ UWVS<؛ uD$/4$H D$@4$ƃ%D$T$$Z 4$Ƅ=D$D$D$D$ D$D$ D$$(5 tVuw: ul<[^_]À, uMX Ɖt$D$ ID$D$4$=Z ?, Y UVSX ]u  3D$/4$ " t$, $J w, D$D$ $Y$ cD$ D$D$ $8 !Ѓ2, D$D$ $91[^]_ RD$D$%@4$ D$t$, $g W Ɖt$D$ ID$D$4$=4X ?G $tƃ  QX 8#u͉4$ƃ W W 0_W 0UE$]ffffUWVS$! &E@ E։υU };EE EU D$T$ $""""D$"""9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""_UM]9ȋEE9EE },EU D$T$ $D$9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""9BMϋEE}19}E UM T$L$ $D$G]u9M΋E eƉi`T$L$ $D$9MϋEEƉ]u덁݉a)u}T$L$ $D$kUM]9ȋEM""""9""")Ɖm݉]u UWVSHܓ D$T$|$|$D$${D$$H*)R)L$L$ |$M $7tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8 }܉EԉŰP'ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}L'UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$]> E܍I D$EЉ$]@ u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍I t#D$D$EЉ$]+? uKE܍I t+D$EЉ$]? u}g]܍D$EЉ$? t2I t%D$EЉ$]V? u uE܍]̉ލI tD$EЉ$]? uruЉ4$]< T:sE܍D$EЉ$]> 2u݀}u<E]DCt.E܍,D$EЉ$]> u1ۋEЉ tC.uu#ỦD$EЉ$]?> Uus5uD$EЉ$]> tu#GW ]ԉSG UWVS Ƌ'<'wwEVN)щȉMEED$$_t_FMȉFD$F$_t:F]؉F>FDF 1[^_]ÿ'E {UWVS% .D$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$`3D$@|$X\$LD$\D$`,5|$Txq|$X\$LtL$T=qwT$`9'-D$@tT$T=qw L$`9'tL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$X-D$\D$`t$\7T$Lk)ЋT$P ‹QD$dT$hD$) $D$$D$LT$P!ЃL$TD$t ] 1uUT$$]n;tFuɿ [^_]UWVSm` rДt:̔>t M1uU T$$;tFu̿[^_]UWVS` 0t:,>t M1uU T$$:tFu̿[^_]UWVS _ äE $jƋE%EEIUuUT$$s…0,U>t M1uUT$$9t1FűuUEEu54$i5E [^_]ËUt }1]uЋu9t!$Uy D$UT$4$胻 E0E렃}tE1҉UWVSc^ lE]E-E1҉؃E9UrLM щ߉θ}uVu=tft;WEVuWEVufv0[^_]f{똉$]f[^_]fffUSE9sGӃP9s*tf3P9s.t&.&f3f3P9r[]1҉[]UWVS'] ,u Ex}u 4t+D$4$7uE)E@ [^_]Ë0 t 1[^_]Ét$9D$$UWVS\ âE D$E$P D$ED$4$:NjE8tB 8"tn|0 uOt$ E D$TD$$҉[^_]z 8"u썇v;|뱋0 t[^_]ÍvҋE D$TD$$UVS[ åuF$2F $24$1[^]UWVS$d[ i}E 1t u$^)E[<$E܋MAnD$4$,-EMA  EU P8E܍IMUT$$ƅ>nED$=4$4 HE } M D$4$=5uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE j0 t(E܉$b0E$W0EE$[^_]Ét$9D$$  $#0ffffffUWVS8~Y Ãu D$TD$4$+uD$:4$ DžD$TD$4$*hF$ $'D$$fD$D$|$ D$D$94$3$&6D$D$|$ D$D$4$W3H8|$$8ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $Y  $貸D$$: |$$oƅOD$E D$ ED$D$$q$; UD$E$6tPT$$萫}$S-$E-- 8[^_]À>/uEt$D$<$t'D$<$ĶS 8E D$t$E$%}뎋E D$D$E$$E D$D$D$ ED$D$9$0BE D$t$E$n%r% E D$TD$E$`$Dž1D$ UD$E D$E$Dž1k E D$TD$E$#1;$@u t$ D$E D$E$<$1UD$E$D$/4$X E D$D$E$<#DžDžv E D$ E D$US(T EEED$D$ED$ ED$D$E$.x E([]øUS(S áEE>ED$D$ED$ ED$D$E$l.x E([]øUS(0S 5D$ D$$?D$D$D$D$D$ D$D$D$D$ $-x D$([]øUSR ÿED$D$ ED$ED$"U$x E[]øfffffffUSSR XE$U6R ?Ut ]Í6]UWVSR }|$E D$E$ 9s [^_]> ?|$ t$4D$$[^_]UWVSQ Ô}|$E D$E$!!9s [^_] ?|$ t$hD$$[^_]US Q %E$t []ÉE4UT$$EUS P E D$E$t []ÉE4UT$$EUVSP Ñu4$t[^]ÅtEt$GUT$$EUWVS;P @u} |$4$K"t[^_]ÅttE|$ t$T$$EUVSO u t$E$"t[^]ÅtEt$aUT$$EUWVSO È}|$E D$E$!_u[^_]É 0|$ E D$D$$[^_]UVSO uE D$4$xt[^]ÉEt$~UT$$E[^]USN ED$E D$E$TuEUT$$E[]USnN sED$E D$E$uEUT$$E[]UWVS$N D$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]* L$ EUD$T$EUD$T$E D$ ED$D$$$[^_]UWVS$WM \D$ D$EUD$T$EUD$ T$E D$D$E$Ɖ׋D$ u $[^_]h L$ EUD$T$EUD$T$E D$ ED$c]ÍR6]ÍU]Ík]ÍU]Í]Í]Í]ÍU]Í]ÍU]ÍK]ÍU]ÍU]Í]Íb]Í.]ÍU]ÍU]ÍU]Íj]Í]ÍU]ffffffffffffffffffffffffffffUWVS!K &ƉUx HEU D$ T$ED$9s)L$><$~F [^_]D$$UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS`I E}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s UO?VLwűEЋU t1҃1 EUȋ]9s U? CD$L$<$ t$jD$<$C1 Dt$D$$CũED$ UD$D$ $虫ruGt$|$ mD$ED$E$(뺉}UE$[^_]eK UWVS< óD$ED$$萜t{NjE88/tbD$/4$@…tL)JBU=wsG|wdD$}|$M$- Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS; ø}UtlƍxD$4$Eg tD%=`u'HR$U ytĄ[^_] O1Ą[^_] 1UWVS ; }U)tlƍxD$4$f tD%= u'U$U tĄ[^_] O1Ą[^_] 1US(j: oEEED$D$ED$ ED$D$E$:x E([]øfffffffffffffUWVS9 ÉUMP'ljEDWp1҉]=.t&.&.&.&.&.&.&.&]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(8 êEUM؋ufUވM݋U 1ɋU EEԋ}P'Et$$UEx}P$u܀G$蒻 Ut}EMU E‹E Et~MލAf qC\:ЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wC\:Dž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS6 ƆUE t\J;A t];tUZ {$u_Z[pۋtC R(D$ ƅ6t$D$$b1[^]ûu11U5 4 6 D$ ED$E D$E$1]U5 4 6 D$ 6D$D$E$1]fffffffUWVSQ5 FÉU:GEG<\<^ЍtP'z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PP' Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVSP- U`M2t@ t~9t $Q@ EED$D$E $!uI@ tG@t  (H2 < @x8 [^]É댋E[^]É@ @uUWVS(, ÊUEtBEE`M2u4$ UT$ D$D$4$M踵N)‰)LBEีNe)‹E)LBEgҍ),PUD$4$ ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$< UuG([^_]1([^_]ËH 0P([^_]UWVS(*+ /UEtBEE`M2Eu4$ UT$ D$D$4$脺}kLЍB)AE܉eЍBE)AE>)<; OD$4$- ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$ MuՋGy([^_]Ë;O@x([^_]UWVS() ΠUEtBEE`M2E܋{u4$^ UT$ D$D$4$#}-?L) RЍ)Ѝ;GEeE)  IȍE) GE*SRЍ)<;BD$4$ E܋;BAQ tUy$E܉uv.&9t(~suED$$B uދF E܃9u؋E܅tЉ)43 OD$E$< jEOMEuu4$ UĉT$ D$D$u4$ԲuĹ-?L) @)Ѝ;FUeȋE) @E)4FU։*SRЍ)43BD$E$U }tux}cur}ulVGEEt}fOMrBEER30P$AE'u땋3O$B3B$pCk}t EE$7UWVS! æE1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىU Uƍp@Hπwx9}몋E D뛉Ui UUWVS ޗ084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0t,8C,{0K44y0 1[^_]Ë0D 8a$0&8D t@0@4$08G,tG0ƅ`%0P' 1Dž$Dž(Dža`,4:~Jwɋ0TQʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0QV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0Rው,4O&4PD]Em PUT$,0 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$0蹈F8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0YÅ8X,4H0@44,-0T 1s0< ,40 ,1!4e0 1,40 14c,0 14,,0y ,&GwҋT1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]U U ]UWVS ã}u >}0D$$+D$t$$`‹U$4UtUuE2b$dƅ_EE[^_]Ë}ut$D$$M$E2@ x tbMut$4VD$$EQD$$h$> Ex tUE9ED$D$ht@E$语 tEftUft IA(Q uEt E1b$t!D$D$$RB(b$tD$D$$RB끍D$$O}D$$/t$IVD$$&VD$$UVS քEtD$ E D$ED$E$ƋEt$0[^]ffffUWVSq vƉEωD$$) tB4$ ƀ?u1)9tXzzt"D$|<$譐 …uۉ<$߻ 9t 1[^_]Ét$ED$<$^9 [^_]ÉUt$ED$<$89 Uu[^_]UWVS$ ƪuEUt E<t] $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%] ]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]eljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$Uu$EE܃@[^_]ËMAOMփ_EtfEtǤ$E܉$EP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$Ep@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMx议 11EMIuE4$E܃@[^_]px11Eu؉4$hѨu2u>MW$EUw r}fm밍W$E0UUWVS[ `eUJEtB9swt$U$dUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$讻U[EfUWVSN SduVzF9sHtT|$$bt8~VM f FHNMLF [^_]Ëu1[^_]É<$UWVST cED$,E$6 D$|$]: xD$|4$]p HM4$]$ =M t<$ = E$] =n D$$P])ÉE@ t$$Ut E t E D$,E$*E, EEEP'EȋEE u<.tk)ύ)ȍLD$4$J t [^_]Ub cUE=w l}]1]UWVS 0 5Uu4$ UT$ D$D$4$m}-?L) RЍ)ЍlvGEeE)  IȍE) GE*S)ύɍl}D$4$: t [^_]fffUWVS4A FTufF(}ȉ|$$t t4[^_]É<$K1".&.&.&t9,ufV(4[^_]UWVS Sul l *H2fV E(H2 4$&V(EfD$FD$l $U=UwDE |)ʉM싆t7T$UD$E$۪U9sUJM|M))‹FtIT$UD$u4$蝪U9r4[^_]1$(H2[^_]ËUыU|UVSz RutgF$F$ܱF$ѱF $ƱF$$軱F,$谱4$許9l t 1[^]ǃl Ql @ Ql @tÍUffffffffffffffUWVS æQlj$U_ D$$ ! Et$UT$,0U$c99UuED$$ 1[^_]ÉUED$$ L$8;UD$);UDS UWVSd P3EEEEƍLEE> tqE9D$t$U$|9Utˋ$:0$z:UDŽ0衘 8Euu>vt1< tHv0FFU$90$9UDŽ0C UWVS<" 'OǠ3U1ҍ Lt"uW Džg0uԉ@!&.&O@6ƒ:uƅ/nFu,$'>L$|+ .Ɖ$8D$7t$t$ 0D$D$o4$CE+<[^_]rD$@|$/$:tW.&P:uVpƅ끋1$6Ɖ$:Ɖ$6D$6$6D$9$6D$x6胘$[膘$~7W$萭ƅD$/4$V/tY1ɉL$0T$/T$T$ |$D$4$:t$XD$$1҉T$0T$ |$D$4$빉oWIUWVS P UKu}D$:4$W t!D$T$$$ t|$E D$4$M4 [^_]ËU t考 [^_]UVS JuD$:4$EW t!D$T$$褃 tE D$4$A [^]Uu vJEw0t ]1]ÃL]UWVSh- 2JEu 3M9}x,U0ED$ XD$D$@U$U?UƒE9~ЉLEΉ )t$|$ʉUM$l2MUӉϋʉU$r3uD$c3UD荑 !L}|$t$$1uU+u h[^_]ËEUWVS` HEM Ǡ37up,U0MED$ XD$D$@U$U>UD$$ EED$ML$ED$)0;EUT$$ u>詍 %!L`ut$L$$/U+uW`[^_]k LU$1ED$1UED UWVS`e jGEUǠ37t$\pwb0tNT$E UD$ T$XD$D$@T$$T$.=T$Mt>$LuT$ U MT$L$$n L$\+u`[^_]øUWVS âFExw|,M0t_0ƃtAƍLU$y0ED$j0UED [^_]ÃLu$90Ɖ [^_]UWVSp E}EU Ơ3u]]p3,M0mLm8@E3jEߺ81tEI}EL )|$t$ʉUM$]-MUЉ΋ʉU$]/}D$.UD !L\$T$$]=l ]U+p[^_]ê0f%CD$D$ ]*0D$D$@}<$L:mo8뎉f>~%E~LSC9u1Yf7k]*  ]US ÞCEPw*0t -[]ÃLu$0[]USD ICEPw*0t薋 -[]ÃLuU T$$Kc []UVS BuD$:4$_O t!D$T$${ tE D$4$[ [^] - [^]UVS o tBuD$:4$N t!D$T$$F{ tE D$D$4$k+ [^]ËE D$D$4$ [^]US AEMPw*0t8 - []ÃLuL$U T$$i+ []US ËAUBw0t1[]ÃLu$Ta []UVS > CAuD$:4$M t!D$T$$z tE D$4$2 [^]W - [^]ffffffffffffffffffUWVS Ʀ@uE1ҋE xtGEljу1Uvt 2uU@u [^_]UWVSĀ$ !@}E|3xƋE p: E* E|1E]EB Eƒx  EB A ǁE9uʋE%u    EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËU 1ۍU @tBELtʍЉʍI$ wu1묋}: E@1ۍLE* EEEu1}}}8KtDAuEƃ@E}t,ى%I$))9D E9u }C\uE^@],1҃DD  u̓E9uE& :*.&@t$EDu۸@u܋} Ƈ ,}8T 8 0u} ] ]E M }~Et M  ЋU 1ҋMDŽ DŽ  r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹ELlt a1v`,tEUEEt @Eǀ -] UWVS` 9uE EM3ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE& EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEE  E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3 3 ]3 1EEԋ ]3 ]3 ]3! 3" 3# 3$ ]3% 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼 u3 E1ljE3 3 3 3! 3 3" 3 3# 3 3$ 3 E3% }m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1 E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEE ?UWVSP &5EЋ}] ]3EƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍ'X]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝ }}̍?tLD$ D$\$$.t&Ҁ09u$?uE]Ј E؃  }EủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝ ]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍ*XN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍ ${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]oUWVSM V0EǠ3EEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]UWVS,˸ /E؋U3E]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSD .U uU3‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$ @D$$   @D $9sӉ t׉D$@BD$ <$L$  $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$D$$Ѿ(D$$P4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$tD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*UWVS裳 Ǡ*Eu 3E1D$D$B $DžDž4$8$u eXt$4$YƉ$a DžD$$8vu[x=uUT$$l D$$ DžDžDž DžDžI|$4$\-pt5tmuIT$$x'멍T$$ye뇋$1U+Ĭ[^_]ÍT$$.x+t$w$a uDž't$o$a DžOD$$ ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$t*D$ JD$D$p$$^[4$] |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$]D$D$4$?D$D$|4$!D$D$p$)$&D$-XD$'$whUVSK P$uv$舷‰)Ѓ[^]øh`UWVS4 $ÉED$AXut$u 4$\ u3D$ ED$$EE8$E $]h`)‰UE E h`9t$u+E E܋E$][ NjED$ut$u t$u܉t$ HXD$D$bD E$1D t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃QXD$D$b}<$U^D$O O ȉD$$EPU9uD$]D D  D ȉD$$dEPU@D$D$4$2E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVS 9ЍLPH USDlf`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂlE $2?ƂnE aDlE ƄlE $,T$ \XT$D$$% 7H4$L `D$HD$T$14U+[^_]Íxƅ?n)nOPEȉHTDUWVS u(} 3E14$K $?$u 1H t $t9u틽)x  @4$1$D$(|$4$D$cXD$4$qT$|$4$U}<$$D$(L$<$.T$T$<$$D$(L$<$|$0, $ $lj~T$,D$4$Dž0Dž4Dž8Dž<$D$#,D$<$Gu։fǃ F $1ƃF $ D$D$F $ iD$xeXD$ B$ ȉD$$TE E D$39 ? ȉD$$E E D$4: 5 ȉD$$E E D$;T$$E PE @D$D$,$hE+[^_]D$,D$<$$ ɋ$D$(D$<$|$,$$D$(D$<$p D$D$<$ ;$D$(D$<$h[ D$D$<$A &(D$<$$$Dž0Dž4Dž8Dž<Dž Dž DžkffffffUWVS: C MMUu3ƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$荣D$@|$<$E D$D$<$ף|$$<$@D$@t$<$詣D$t$<$菣|$4$誥E+[^_]Éu4$͢UT$L$4$1t$4$FDž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\T6fffffffffffUWVS  utJD$ED$4$NjE9t58u0…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSXˉ M $8 ƉEE$WljE4$WƉEE EEEED$ML$}<$/t.1EM $_M $_4$_EX[^_]ËuE$AWEtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSY ^}u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVS }u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVSb g}u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úU E##+PፂQ]ÍY1]Í]Í]Í=]Ív]Íc]ÍR]Í@]Í]Í]Í]Í]Í(]ÍL]Ít]Í]Í*]Í]Í]Í]Í]Í]Í]Í]Í|]Íe]ÍN]Í5]Í]Í]Í]ÍT]Í0]Í ]Í]Í]UWVS 蒅 ×EwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu$3 tffUS ߄ U T$D$U$# []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVS襃 êu Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG XU< EUM ltt M U],]UWVS4  MU 3ËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&DlɋtxD$$lҋtFD$4$2Z ltt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$T؍UWVS } E}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$]' [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0| }wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;HultD$$]E+u <[^_]Ë9UEU Mt t]%]UWVSXw uU Ǡ3E1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS EFFFF F$F<F@FD4$t? [^_]øUWVSXkX p}EE 3UE1D$E$ƋẺ$E]} Kf$OME Eĉ4$ U9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$ UĉT$ D$D$u҉uȉ4$xn4$0 ‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$m4$ 9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$fm4$ ‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$l4$ ‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉfUMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVS[R `Ѝ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSLZD _uE Ǡ3U1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFTcuUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVS@ lj(UE uà3, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(pUWVSd> çML$U T$3D$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$D$0"D$04XwXcX:ك,\$0V!D$0X!ك,R!D$0\$0!D$0\$0!D$0"D$0zX\$]$XED$]݃6/%!D$0"D$0X"D$0"D$0"D$0"D$0"D$0"D$0z!D$0pf"D$0\R"D$0H>!D$04]ك(\$0$Wt E؋zt ك,\$0>~!D$0 "D$0 !D$06 "D$0p!D$0f R!D$0H4!D$0* !D$0 6!D$06@ !D$0I!D$0 "D$0q!D$0v, b!D$0XaD"D$0:b&!D$0!D$0|!D$0g!D$0N"D$0!D$0r!D$0h6T!D$0J6!D$0,!D$0!D$0!D$0,!D$0m!D$0"D$0x d!D$0ZF!D$0?EEE@D$D$$]@UBu܉F0B??E E@}EmEE@N?EP B M}]؋u.t&.&.&Fǃu}M]؉uKwE*]ЍuFPFX FTF\FG?} mmUԋE@H?}؃ U E܋]ȉX PUԉxu}~<}~@ỦT$lj$]\/ }ȋPU]ԋ@E؋Fߋuԃ(tftE@t E@ >)UUԋExD})щHDE@uFDF:?E@}W$tB}GDG;?uV$tB$uFЍt&(M9}U؋u.t&Fǃ9u}MU؉uffB " f= fuN9}U؉MuԋE).&.&s9u}EEUȋ]4EuFD]FH?.)W,WUUMЉ‰EE!MUЍ D89U\ uuUԉ}}|;v.&.&.&.&.&.&.&BEME!MMȍ MDM9 uu}؉U)11]؋uvFǃuu)ƋE@DCE@ E@ : t$EԉD$UB$]gUB)uuԅRuU؉]ԋE@$t]XE@t @ E@7?11U؋] MU؉]ԋUvm)E]艃{DE@M?UuMU؉]ԋ}EG<0EЍju܉FE@Q?EuMU؉]ԋ}uVdFh ^`}mw EЍDE@ E@  t$EԉD$UB$]DfUB)uuԅRAE@G?} EEuFHUVLFK?fM9}]؋u7t&.&.&.&Fǃ9u'm)EU艂zD Eǀ@??N}MU؉uԸЋU!Ћ}GDGDU)]$}}M]؋u)&.&Fǃtu[}wr}M]؋u}M]؉uԋ]̉؋u)}G}G E@O?EpEE11]؋uh}]؉uԋu]^DF$tXVt ]C }G9?EEG}M]؉uԸЋu!]CHu)U[EЍ[EPD@B?} EESz@EЍ[]܉CE@Q?EL}M]؉ut }1uF$t @0V EB))9EEЍj>tBO)ڋ]ڋ_ۉD$T$ $]b]CU܉B0S 1 EH];XEЍ@\U܉BE@Q?EEE)N9'}U؉MuԋE4.&.&.&s9u{EЍu[]܉CE@Q?mmUE}ȉU؋uԋ}Q })EM9MBMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋u}~lbuu}؉UԋU}]Zf]m)uUT$UEԉD$uF$]`FUUQfU_EȋU;B4EE1}}!EED$ED$uF$]w`FEЍ6[ ։u!މ Mt M9M]]}}؉EEF&puMu!MM΍ MtM9ou]}؉EKEXL@I?E@l@E?1N9{}U؉MuԋE6v.&.&.&s9'uv}ȉU؋uԋ}Q})E_]MU؋uԋUwHEЍQ&].&.&.&fDSt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]r[U܉BGQ?uE u5UEP$t EE@t @ E@6?11ɋU؋]E@ TfvPEfED$ED$uF$]p]FF7MM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)u}twruԉփRu=E@l@F?XdPhUuEcE@ y%E܋]ȉX ]XUԉ]؉XEUP<]X@E-UUEEyYEX(u@(D$D$$][uFfED$UT$$[FF5?11U؋]]]EEx@O?]Yf]^}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$] UM[]܉CGQ?pmEUB(uJJ(vLmEЍM[-EfED$ED$uF$]ZFw9ȐruF1ɉNL$L$ $]aFU܉B0eF??1҉UAE]ԋEЍl\]}GpGTG\L$G\D$T$ GhD$GdƉt$$]V [U܉BGQ?;f tURGmm1EĉUeE@=?11ɋU؋]E@O?UVS]iu9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0t?t*U UMu[F [^_]=>?u>D$D$$^ML$M L$$t^9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$f o`EԋMM3E܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$IExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffffffUWVS& #XuMx11D rt"E pt&.&fDU9ux.t&fG0UofxZUWVS4A >H}̉ÉEЋ@,E܋{t-Ek@^S,sutftߤEw uEH,@lu6^};s9sӅz}G8‰ىuFl؉Flv,)9_ʋ}?EE؋})EE@,u~89Edž3)ƃj'E@,uFl‹uF\l] Lus<9S} 5E19믺}O\)ȉ9ۋuVlv}4M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^t]FDVLfDPTT$D$$,dž% @9E,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS ! *EuE E]E}}}}U M$:18FV ~$h}uEMQ~HHtk_} U}KB/&} } M}W} }؉1MD$D$F($V ÅMF0@*x@H0x,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]M„?V$M]?V F(d V [^_]øCE*'@F4$U ED$ED$D$D$D$ D$E D$E$j]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8 C,{@uv@ CL{DMqD-{uvueu^CMQ+QS $ | 0 E[^_]älfbft.t&eft&W(f.t&fu5AfY{8f3f+0f(-f%*$E1E%ffffffffF O UWVS<, 5 EċM uS}׃]f.&.&2A3Ѓu߉׉MEEEE]čUȉEuϋ1EԋM3OMЋU3WŰu3w u܋u3wu؃4E‹EE܋EE؋EU} U E34}Nj<1}}Nj<1}}Nj<1}Uȋ1EEUu} m Eu] 1}3؃uU3Q1к}3؃uU3Q1к}3؃uU3Q 1к}3؃uU3Q1ڸ}3ڃu߃ȋ]č1UM 1ω32P3<H1ω32P3<H1ω32P3<H1ω32P3ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+l øU)9fGHOWGHOW)ULuuJE0uTUU ھ])9 fOY_wWJOw)ًUML fu苜l]u'ME;uMU]u+Ɖ кu)f9OWrwWGpw )щfEDE\uΉ.EuE]؉E$]ˉ]ERD$U_NjFD$U$בtE 8Z% [^_]1 [^_]UWVS e }GtUD$UN_ƋGD$U$qt+4$艦=yarauE 0$ [^_]É4$諣1 [^_]UWVS Ie N}GtUD$U^ƋGD$U$t+4$ =tciduE 0h$ [^_]É4$.1 [^_]UWVSd ED$E D$E$ntSEt4}D<$;^ƋED$<$atE01[^_]#[^_]#[^_]UWVS8d =ED$E D$E$tJEtZ}D<$]ƋED$<$͏t54$=yarauE01[^_]7#[^_]É4$ #[^_]UWVSc ÒED$E D$E$/tJEtZ}D<$\ƋED$<$"t54$:=tciduE01[^_]"[^_]É4$Ru"[^_]UEU E MMM]GUEU E tcidMMM](UVSb êE D$E$gwƉ$舣=tciduE0[^]1[^]UVSUb ZE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS a E$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]USa çE D$E$dvUT$$c@[]USia nE D$E$+vUT$$@[]US0a 5E D$E$uUT$$A[]US` E D$E$uUT$$;A[]US` E D$E$uUT$$oA[]US` ÊE D$E$GuUT$$xA[]USL` QE D$E$uUT$$A[]US` E D$E$tUT$$A[]US_ E D$E$tUT$$PB[]US_ æE D$E$ctUT$$B[]USh_ mE D$E$*tUT$$B[]US/_ 4E D$E$sUT$$B[]US^ E D$E$sUT$$B[]US^ E D$E$sUT$$B[]US^ ÉE D$E$FsUT$$B[]USK^ PE D$E$ sUT$$B[]US^ E D$E$rUT$$B[]US] E D$E$rUT$$B[]US] åE D$E$brUT$$B[]USg] lE D$E$)rUT$$B[]UWVS ,] 1E$D$9t,ƉD$E D$E$rlj4$7 [^_]1 [^_]UWVS \ E$D$09t,ƉD$E D$E$rlj4$Ԛ [^_]1 [^_]UWVS f\ kE$D$8t,ƉD$E D$E$qlj4$r [^_]1 [^_]UWVS \ E$D$l8t,ƉD$E D$E$Yqlj4$ [^_]1 [^_]UWVS [ çEU$T$ 8t,ƉD$E D$E$plj4$讙 [^_]1 [^_]UWVS @[ EE$D$7t,ƉD$E D$E$plj4$L [^_]1 [^_]UWVS Z E$D$E7t,ƉD$E D$E$2plj4$ [^_]1 [^_]UWVS {Z ÀE$D$6t,ƉD$E D$E$olj4$膘 [^_]1 [^_]UWVS Z E$D$6t,ƉD$E D$E$molj4$$ [^_]1 [^_]UWVS Y ûEU$T$6t,ƉD$E D$E$ olj4$— [^_]1 [^_]UWVS TY YE$D$6t,ƉD$E D$E$nlj4$^ [^_]1 [^_]UWVS X E$D$5t,ƉD$E D$E$Cnlj4$ [^_]1 [^_]UWVS X ÑE$D$=5t,ƉD$E D$E$mlj4$藖 [^_]1 [^_]UWVS )X .E$D$4t,ƉD$E D$E$}mlj4$4 [^_]1 [^_]UWVS W EU$T$x4t,ƉD$E D$E$mlj4$ҕ [^_]1 [^_]UWVS dW iE$D$4t,ƉD$E D$E$llj4$o [^_]1 [^_]UWVS W E$D$3t,ƉD$E D$E$Tllj4$ [^_]1 [^_]UWVS V âE$D$M3t,ƉD$E D$E$klj4$觔 [^_]1 [^_]UWVS 9V >E$D$2t,ƉD$E D$E$klj4$D [^_]1 [^_]UWVS U EU$T$2t,ƉD$E D$E$+klj4$ [^_]1 [^_]UVSuU zE D$E$7jƉ$X=gntst 1[^]É4$'tU[^]UWVS U E$%%t,ƉD$E D$E$tjlj4$+ [^_]1 [^_]UWVS T E$$t,ƉD$E D$E$jlj4$В [^_]1 [^_]UVScT hE D$E$%iƉ$F=atadt 1[^]É4$kwtUEt 4$+wM[^]UWVS S ED$E$iut,ƉD$E D$E$Gilj4$ [^_]1 [^_]UWVS S ÕED$E$ut,ƉD$E D$E$hlj4$蜑 [^_]1 [^_]UWVS.S 3E D$E$gƉ$=gntst 1[^_]É4$$P$U !DžtڋUT$D$4$$t U:[^_]É<$8)1UVSR çE D$E$dgƉ$腓=gntst 1[^]É4$=$tU[^]UWVS ER JE$R"t,ƉD$E D$E$glj4$X [^_]1 [^_]UWVS Q E$ "t,ƉD$E D$E$Fglj4$ [^_]1 [^_]UWVS Q Ôut*t$E D$E$flj4$謏 [^_]1 [^_]UVS?Q DE D$E${Ɖ$"=loobt 1[^]É4$WzU[^]UWVS P E$lyt,ƉD$E D$E$蝊lj4$ [^_]1 [^_]UWVSP ÏE $yt%ƉD$E$Plj4$裎[^_]1[^_]US7P <E D$E$sUT$$.[]USO E D$E$:UT$$I/[]USO E D$E$UT$$/[]USO ÑE D$E$ȈUT$$/[]USSO XE D$E$菈UT$$0[]USO E D$E$VUT$$ 0[]USN E D$E$UT$$A0[]USN íE D$E$UT$$0[]USoN tE D$E$談UT$$0[]US6N ;E D$E$rUT$$1[]USM E D$E$9UT$$"1[]USM E D$E$UT$$.1[]USM ÐE D$E$džUT$$;1[]USRM WE D$E$莆UT$$;1[]USM E D$E$UUT$$;1[]USL E D$E$UT$$T1[]USL ìE D$E$UT$$T1[]USnL sE D$E$誅UT$$`1[]US5L :E D$E$qUT$$m1[]USK E D$E$8UT$$m1[]UWVS K E$D$((t,ƉD$E D$E$qlj4$̉ [^_]1 [^_]UWVS^K cE $D$'t%ƉD$E$lj4$p[^_]1[^_]UWVS K E$D$i't,ƉD$E D$E$貄lj4$ [^_]1 [^_]UWVSJ äE $D$'t%ƉD$E$^lj4$豈[^_]1[^_]UWVS CJ HE$D$&t,ƉD$E D$E$lj4$O [^_]1 [^_]UWVSI E $D$I&t%ƉD$E$衄lj4$[^_]1[^_]UWVS I ËE$D$%t,ƉD$E D$E$7lj4$蒇 [^_]1 [^_]UWVS$I )E $D$%t%ƉD$E$lj4$7[^_]1[^_]UWVS H οEU$T$1%t,ƉD$E D$E$zlj4$Ն [^_]1 [^_]UWVSgH lE U$T$$t%ƉD$E$'lj4$z[^_]1[^_]UWVS H E$D$t$t,ƉD$E D$E$轁lj4$ [^_]1 [^_]UWVSG ïE $D$$t%ƉD$E$jlj4$轅[^_]1[^_]UWVS OG TE$D$#t,ƉD$E D$E$lj4$Z [^_]1 [^_]UWVSF E $D$S#t%ƉD$E$諁lj4$[^_]1[^_]UWVS F ÕE$D$"t,ƉD$E D$E$@lj4$蛄 [^_]1 [^_]UWVS-F 2E $D$"t%ƉD$E$lj4$?[^_]1[^_]UWVS E ּE$D$9"t,ƉD$E D$E$lj4$݃ [^_]1 [^_]UWVSoE tE $D$!t%ƉD$E$/lj4$肃[^_]1[^_]UWVS E EU$T$|!t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSD ÷E U$T$!t%ƉD$E$rlj4$ł[^_]1[^_]UWVS WD \E$D$!t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSC E $D$ t%ƉD$E$~lj4$[^_]1[^_]UWVS C ÛE$D$F t,ƉD$E D$E$E}lj4$蠁 [^_]1 [^_]UWVS2C 7E $D$t%ƉD$E$}lj4$C[^_]1[^_]UWVS B ڹE$D$t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVSrB wE $D$#t%ƉD$E$1}lj4$脀[^_]1[^_]UWVS B E$D$t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSA øE $D$dt%ƉD$E$r|lj4$[^_]1[^_]UWVS WA \EU$T$ t,ƉD$E D$E${lj4$c [^_]1 [^_]UWVS@ E U$T$t%ƉD$E${lj4$[^_]1[^_]UWVS @ ßE$D$Kt,ƉD$E D$E$Jzlj4$~ [^_]1 [^_]UWVS7@ <E $D$t%ƉD$E$zlj4$I~[^_]1[^_]UWVS ? E$D$t,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVSw? |E $D$'t%ƉD$E$5zlj4$}[^_]1[^_]UWVS ? E$D$t,ƉD$E D$E$xlj4$$} [^_]1 [^_]UWVS> ûE $D$ft%ƉD$E$tylj4$|[^_]1[^_]UWVS Y> ^E$D$ t,ƉD$E D$E$ xlj4$d| [^_]1 [^_]UWVS= E $D$t%ƉD$E$xlj4$|[^_]1[^_]UWVS = ßEU$T$Lt,ƉD$E D$E$Kwlj4${ [^_]1 [^_]UWVS8= =E U$T$t%ƉD$E$wlj4$K{[^_]1[^_]UVS< E D$E$vƉ$}=gntst 1[^]É4$ytU[^]UWVS < ÆE$ t,ƉD$E D$E$9vlj4$z [^_]1 [^_]UWVS&< +E $3 t%ƉD$E$vlj4$@z[^_]1[^_]UWVS ; ײE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVSw; |E $ t%ƉD$E$>vlj4$y[^_]1[^_]UVS$; )E D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS : øED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS Q: VED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVS9 ED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS9 ÙED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS99 >E D$E$urƉ$z=gntst 1[^_]É4$ P$UDžtڋUT$D$4$ t U:[^_]É<$C1UVS8 òE D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS P8 UE$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVS7 E $t%ƉD$E$rlj4$v[^_]1[^_]UWVS 7 æE$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVSF7 KE $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVS6 u t#t$E$qlj4$u[^_]1[^_]UWVS 6 íut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVSQ6 VE 0Ft%uFt$ 4$ 1[^_]ÍF <$֜Ft<$ǜ1[^_]Ét$F $<$補FUS5 ͬD$F $<D$F $01[]US5 ÅEU 9t8J 9H u(Rt<@t-T$$[]1[]ø[]ÍUˍUUS5 E @tUT$$[]ÍD$ D$D$t$US4 ûE @tURtFtAD$$U赃U [^_]K4$l [^_]1 [^_]ÍUUWVS . utJ9u@~ G$…t,Ft/D$$U,U [^_]1 [^_]ÍUUO. PEt 9t1]Ë@ ]U3. (Et9uP@tt ]1҉]ÍU]US- Et 9t1[]ËU tH Q9Ur@tD$E $I[]ÍUU- ‚Et 9t1]@]UWVSI- N}t;9u1G $JƅtGt"D$4$輁[^_]1[^_]ÍUU, Et9u @t ]1]vÍU]UWVS, íut 9t 1[^_]ËU tM 9uFtA F EP$UDžtŋE HɋUtOFt@L$D$ mD$T$<$KF~}~ t$sU븍UUWVS+ ut 9t 1[^_]ËE FtE $xF EH $M…tFMtI} |$D$ mD$L$$U膘FUV}~ t$oU믍]D$ `D$D$;$3US* Et 9t1[]ËM tM 9uL$$mUS* úEt 9t1[]Ë@tU T$$Q[]ÍUUSa* fEt 9t1[]Ë@tU T$$[]ÍUUS * EU tG9u=t99 u5Rt@tT$$[]ÍU@uፃUٸfUS) èEt.9u$@tU T$$G[]ÍUfUWVS S) Xu~(Ft  [^_]D$ED$ D$D$4$tȋUBU$DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ ƅt'D$4$PfFF FE 0 [^_]É<$D$D$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]US' ýbD$$膑F $V[]USz' F $0[]UWVS4R' WM EpAQAtp&]D$ T$L$D$ uԉ4$'D$,|$E$Bqt2t$E$"nt|$E$7r4[^_]Í^14[^_]ÉD$ T$-]D$D$ uԉ4$襓y4D$ D$D$$zUVSB& GE 0t$F $? 4$1[^]US& D$F $|D$F $p1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVSJ% OƍbD$$F <$t$F E$t $Eb<$躋UЃ[^_]ÉE<$袋$ Ut֍ D$ $MbMAFAFA<$\t$E$AMt+$Egb<$3M $UЃ[^_]ÉL$ME$AM9uE<$UЃ[^_]Í2]D$ (D$D$M$!UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS" ܙut 9u4$`[^]1[^]UE@]UWVS" ‘Et 9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YU! ɘEt 9t11]ËP@]U! œEt 9t11]ËP@]Un! oEt 9t11]ËP@]UA! BEt 9t11]ËP@]UVS! Et 9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS †Et 9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS Et 9t1[]@u%P@Ӂw݋] []ËPH9иrE US ‘Et 9t1[]@u%P@Ӂw݋] []ËPH9иrE U$ %Et 9t1]ËHP@txE P]US Et 9t1[]@u%P@Ӂw݋] []ËPH9иrE UVSp qEt 9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS Et 9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS^ _Et 9t1[]@u%P@Ӂw݋] []ËPH9иrE U Et 9t1]ËHP@txE P]U ±Et 9t1]ËPH9иrE ]Uk lEt 9t1]ËPH9иrE f]U% &Et 9t1]ËP@uE ]U Et 9t1]ËP@uE ]U ´Et 9t1]@uP@xM A]ËP@M QUa bEt 9t1]ËP@uE ]U( )Et 9t1]ËPH9иrE ]U Et 9t1]ËPH9иrE f]U žEt 9t1]ËP@uE ]Ud eEt 9t1]@uP@xM A]ËP@M QUS  Et 9t1[]ËM tM 9uL$$\US ːEU Mt 9t1[]@t Xxx3P3H []US| ÁEU Mt 9t1[]@t Xxx3P3H []UVS5 6Eu ]t 9t1[^]ËPH@uxx11 [^]UVS Eu ]t 9t1[^]ËPH@uxx11 [^]UWVS$ ÒuEEEEVt $[^_]À~(u~-+0u xZE܉D$}|$F$kEUщ¸9иeEF>t"D$D$4$VJE@U $[^_]E E܉D$ED$F$SkEUE܉U}9EX8"J&|8"0flE܉D$|$F$>EU!Ѓt4MEFc&D$ED$ 8"ut&4fffffffffffffUWVSP^ c<$Wf#H@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$A_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS< 4$cB BBB$BBB(B8OwuBfn'"H[v*BDžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{B"JHJx"t_xaucxlu]xsuWxeuQHBzB(Jxru+xuu%xeuH̃BB(P)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{T<$O1USEt&.&.& w u[]US  ÎE ;Et1 []ÉD$ED$E$< []UWVSD I]u}E E $VEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]e;?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]<]D$ D$D$$)щN$x>qUWVS,S \EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$prvvxEpD$\]t$$t}(u GtLt51E$[^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVS( -}$Jhp$'tD$D$E$)fǃxD$<$ aEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$qaƋt0<$/fd3D$L$d4$jlp ȋdE D$4$aNjtPD$T$l4$jlT$4$T0t$Ĭ[^_]1)<$zet$1Ĭ[^_]D$D$D$D$ D$hD$l$J`lthȋtGL$4$/t$31nUD$E$U]fffffUE 9E]UWVS` ezƅtBD$$eEt E$@MDžMu% $1\$@,DžtED$<$@D$G$4kEG,w0G4G8G<[^_]US åyF $Vi[]USz yD$̕$HlF $i[]US< AyD$F $hLD$F $1[]US xED$E $課[]US xED$E $z[]US ÜxE$jE $j[]UWVS(a fxUM܋p4@,EEGEt@E<E tDMUD$E$ϱUMtLօuE܅tE܉1([^_]Íl]D$ D$D$$$ӹϋE܅t([^_]1UVS ÅwPt@9 u6p 9r]D$ ,D$D$$$苴UWVSR WruFt09u&x<$cƉ<$c[^_]ÍTD$ D$D$$$UWVS qƄt1XƅtptC[^_]ÉUx<$u1<$\0[^_]D$4$=t؋E EtɃF E䍃lE؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$D$4$~D$4$=4$<U܋T$4$P tEO49H1IEq<$O[D$4$ ?Ɖ0[^_]Ë}4$Z<E$5m#$D$4$9n}э4D$ D$D$$$^}E$5n 4$;EԉD$4$|=]D$ D$D$$$UVS hE 0t$F $F,v u0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃TD$ DD$D$$`|D$ DD$D$$6U REt9u@]1]US QEt 9t1[]ËM tM 9uL$$US ÕQEt 9t1 []ËM9H uU tL$M L$@$ []UWVS 3 8Qu>t=~(u7Ft=D$ MT$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MҧEtFVT$U$MUs9}D$dD$4$ $iƅD$4$FEF~ E 0%zD$ED$F $(%ljEt\UF$F 9:" Y^D$ ,D$D$$őE$ [^_]8"uE$$肦ƅtEE$Į1!1U1 2OEt 9t1]ËM tM 9u9]UVS N t$G $ƃG t$G $ƃG 1[^]US ßNE xtt L9t%$c$Y [^_]ÉUMGE$2UNjE$k2Ut$ M9t;E [^_]^D$ D$D$x$訂A$衸MA8,uA1)UE]UWVS> C@}L9GE$1G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$>1UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS` e?ut L9t 1[^_]Í~<$0v0<$0[^_]UWVS ?ut L9t 1[^_]Í~<${0v4<$p0[^_]UWVS >ut L9t 1[^_]Í~<$*0E 9F0r<$0[^_]ɉUWVSV [>u~<$/Ɖ<$/[^_]UWVS >u~<$/F8uF8<$/[^_]UWVS =u~<$`/v8փ<$P/[^_]UWVS ã=ut~UWVS <ut L9t 1[^_]Í~<$q-U Ɖ<$]-[^_]UWVS ð;ut L9t[^_]ÍFE$-~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$v,E$[^_]ËE$X,%^D$ PD$D$x$|^D$ PD$D$x$|USY ^:Et L9t1[]ËM tM 9uL$$FUS :D$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]US ê9lD$E$A[]US x }9D$E D$E$ []USF K9lD$E$[]fffUEU @]US 9E$ t[]Í^D$ D$D$pT$zUWVS0 ê8$}`HtыpG$``tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$Ku}DžPtҋ@w4$节)T$$PtЉ4$NtaNjPu냍^D$ D$D$T$!y^D$ D$D$T$x^D$ D$D$T$x^D$ D$D$T$x^D$ D$D$T$yxtыt$P_D$ D$D$T$&xUEt]1]UWVSD־ 5$UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]ÍD$ D$D$#T$vEEU D$E D$E$]UE]UE@]UVS螼 Ɨ3]C$$[^]fffffffffffffffUWVS> C3ƀ8$jD9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$jP /.pl@istX@XXXXf@ X ${ƃtb|$D$4$9<&M䍙G_D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$Vuύ4T$ T$D$#$nt][^_]UVSu ~+]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍4T$ T$D$D$lE >][^]UWVS舳 *]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]Í4T$ dT$D$c$kD$/$9E >][^_]UWVS = B)UyEx i} _$,ƅI$+FFF E Ft.ED$4$ׄuG$214$( [^_]Í< t~D$4$uD$ 4$tFu.|D$4$tD$ 4$wpD$4$_DŽ^OT_D$|D$4$G)D$ 4$Ex 4$81 UWVS 螰 ã'ED$E$;t>Ɖ$I_E oU4$݆oU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSį &utFwyM MJ]ZMJ [^]$}t|] X]XMH ]X뼍b_D$ D$D$A$3h D$ D$D$B$ h1fUWVSɮ %Uu }t`t`tAtA}tA uutA} $[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍TD$ D$D$Z$fUWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ Ɖ2[^_]Í D$ HD$D$:$BMUVS< A utD$D$^t 4$1[^]Í D$ TD$D$8$LUWVSՒ u} t~(~$1[^_]ÍgD$ `D$D$7@$L~(~$1[^_]UVSn s utE F(1[^]ÍgD$ lD$D$7h$LE F(1[^]UVS  utE F$1[^]ÍgD$ |D$D$7$KE F$1[^]UVS誑 ïut$&ff gFF[^]ÍgD$ D$D$;$FKUVS@ Eut F([^]ÍgD$ D$D$7$JF([^]UVS ut F$[^]ÍgD$ D$D$7$JF$[^]fffffffSL$D$ t9tEAf.&€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US ֏ 4J D$E D$E$蕔 []fffffffUWVS葏 Öu} %=PwM=@/=O= ctGrGƀtGwE===lu-Gƀu-G@GAEGx --PP@x-uX-tXrx BZf [^_]øpwwurT뺹ryw2r@s?@Gs@-!GS@SG--Drt7=`ubCs9d/?%uQtSa P:D$ D$D$90$FMGA-fffffffUWVS 葌 ÖE(D$E$gE=lAD$ED$E$Aiǃ3uE$gOEtMEMED$UT$4$;Mu E<=tX4E8E4uϋM9|>) ‰L$D$$/0l1 [^_]ÉM4$,gM랹čpjD$ D$D$>T$%E넍JUWVS EhKold]ptDžxAEEEEEE|(D$ut$$H]E$D$t$$HDž<Dž@DžDDž8H|$8D$$DDž\Dž`Džd1|X}t Xuĉ4$XD$4$m|$4$D$04$i3D$hD$t$ D$D$0$bL,i4$!,4uH8D$t$0$tD$(D$$.GD$$D$$GD$|$$4[^_]D$$!P[^_]Dž4cG,Dž4GD$(D$$uFyD$(D$$MFD$$D$$/FUWVS@跇 ưt$(D$T$L$,D$,t "|$GD$8UT$$\$(3uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$[D$L$8D$9\$(D"D$8D$D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(@"D$8D${ CljD$D$8HL$L@L$8t$@|$D<*tXD$=E$EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $u֋U$U9t5EuEEEuU܅/EEUUыr/Eԅ0't*E8:t"UED$ED$$轿MA420E<-<+<::[B9FB 9F  E;u~#9EU'0tE8:tD$W$42WE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$Et 1pu-/Z`ED$ t$D$`T<$#EED$ t$D$<$i#*'t$E8:tED$ED$$42?U`D$ D$D$aT$"Eԅd}؉:t0Ex q yMMMyM؋EUEEEЉE $MЋ+)kExu'8tE8:tt$$u420'E8:ED$$7qx:#EE9E:E MM؉:ŨE uЋE؉'t+E8:t#MED$L$谻EЋMq142EЉE<-WKZ`ED$ T$UD$`<$ EUuU`D$ T$D$a<$ t$ t$D$<$w U`D$ T$D$a<$T  U'E8:t$$袺A U`D$ t$D$a<$[u ;UWVSe } u*u[^_]Ír$@J :u>u t2E8:t*"|$ D$w`D$'$?[^_]ÀxFU$_>uTx:tL9MU$E8: t!|$ D$T18J U$[^_]ÍG`D$ D$D$R|$uj`D$ D$D$S|$PE 4l:bUVS2c 7utD$ D$4$HA[^]ÍVD$ D$D$/$UVSb utD$4$%e[^]Í`D$ D$D$/$sUS nb sE D$ED$'X$pL []US7b <ED$ E D$ED$'X$L[]UWVSa u} t(ED$ 1D$|$4$L[^_]ÍtD$ D$D$4$UVSa Ëut'D$ D$D$4$kL[^]ÍtD$ D$D$A$UWVSa u} t)D$ 1D$|$4$K[^_]ÍtD$ D$D$6@$US` ìED$ D$ E D$E$C[]US n` sED$E D$E$u []US=` BED$ ED$E D$E$[]UWVS` utFD$4$ nx$P8D$4$)[^_]É4$%ڍtD$ D$D$7d$}US x_ }ED$E D$E$I []USG_ LED$ ED$E D$E$vG[]UWVS, _ Et8uj}ԉ;(`$ FQFF )t$|$$芽,[^_]ÉEԉ$W E؍#$EEu}w`끋,uUF^ GEx9(`]Ë,]Í`]ffUWVST^ UE }}Ǡ3}7uցE0 tS9utOD$2@D$u4$T,4$L PEt8UED$t$E$),Uu-p4$ PEuȋ}E+TЃT[^_]Ét$ %aD$D$2u4$'4$ P볅U@E 7t"ED$G$ ut$ ̐닺R}UD$ D$D$$QUET$ T$D$$uE7M,ET$ T$D$$EfUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSZ ut;F)F3E uF F[^]1[^]ÍcD$ D$D$Y$c$SUWVSLZ Qu} Uts~F<FF DWPWPW P F F 1[^_]ÍBcD$ D$D$v$c$U`UcD$ D$D$w$c$[U+UVSHY Mut~u@~w:E [^]ÍBcD$ D$D$$c$뺸UVSX ut~uAF u9<.w5[^]ÍBcD$ D$D$$c$빸UWVSxX }}u t5u%G u<.w~9|D7[^_]1[^_]ÍBcD$ D$D$$c$UWVSW u} t*~uPF uH<.wDx>9؃[^_]ÍBcD$ D$D$$c$몸UEu E D]1]UWVSdW i}utQEu@D69E r4E D$D$<$6GfGG[^_]1[^_]ÍcD$ D$D$.$c$UWVSV u} t;~uaVL\WQWQW Q F1[^_]ÍcD$ D$D$M$c$K뙸UWVS49V BƉEԋE} Ơ3uЋU1҅x%PލT$D$<$]DzGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍOcT$ tT$D$h$c$E܅ E܋]ԍZcT$ tT$D$i$c$Em]܆UVST ut~uEFu=:Fr6[^]ÍcD$ `D$D$$c$`뵸UWVSRT Wu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍcD$ LD$D$$c$ fffffffUWVSS Ɖׅtat1>t F9rF9s1[^_]ú䍃iD$ XD$D$$K 뾍fcD$ XD$D$$ pUWVSS t4ljփt3Rw0FGT$D$<$[^_][^_]ÉUrcD$ D$D$$ UUSR ËE x[]ÉEcT$ T$D$T$6 E[]UWVS(R -u} Et,tYPσF)F 71[^_]ÍcT$ T$D$b$ EuEcT$ T$D$c$ ErUWVSjQ sEu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃cD$ D$D$$ MÍBcD$ D$D$$ M}]썃D$ D$D$$  {P7f/UWVS]O fEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍBcD$ xD$D$$FME]荓T$ xT$D$$EjUWVSN u} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃BcD$ dD$D$$0LcD$ dD$D$$VUWVSL U} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]ÍBcD$ DD$D$W$UUcD$ DD$D$X$UUUE ttuB]ø]UWVS$tK }EEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]UMi1ɉM]썃D$ 0D$D$$"MXMUEE썘 \$ 0\$D$$MUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUS G D$D$ED$ ED$E D$E$訦[]fUWVSPF ýƉЉ3U1҅[ƅD$D$D$D$ T$D$4$aTt1U+<P[^_]Í1ɉ D rFDžDžD$ T$D$<$ՅutjƅD$D$D$D$ t$GD$G$Sut$$Ctu<$$ӄcT$ T$D$c$j wUWVSTD Ɖ3E1 ƃlJ ƅD$D$D$D$ lJ D$|$4$RD$D$D$D$ L$|$4$CR;DžDžDžDžDžVDžDžDžT$ D$D$$褃tjƅD$D$D$D$ t$GD$G$`Qut$$thuGtLD$ D$,D$$!$耂1U+uXT[^_]Ë묋$PʍcD$ D$D$c$tUWVSvB {ϋEE uE3E1,VD$D$ D$D$<$B4D$ D$D$$7t6D$ D$D$$ZǕ $YD$$D$$w{$D$I$CG$ݡ$ϡ~f$$蚡t$股D$D$$U+Ą[^_]Íc @$/D$ $uD$<$rD$/$CPt:D$LD$:$$xD$D$D$D$D$ eD$T$$D$XD$d$$@D$XD$d$$$XD$id$j$pdD$ XD$D$yc$dD$ XD$D$zc$ dD$ XD$D${c$0dD$ XD$D$|c$z{D$D$D$D$ D$T$$Q@$8u D$/$RAD$t$ KoT$D$$qD$D$D$D$D$ e|$XD$uXp<+%<-q<@nL'PHD$ D$PD$r$؉DžL<+<-w҉ht$`$hyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$DžL<+F<@[hU\l K4$\ u9F<@t$`$2qU\l<+<-t$`$>qU\؉<+N<- t$`$_Z<+<-DžLDžP.hHD$ `D$D$4$hQ7F<@uhHD$ `D$D$4$>؋h]PFF'<@hHD$ `D$D$4$hU\1PU\PF]<@UHD$ `D$D$4$N)F<@ DžLDžP11eD$ D$D$c$]eD$ D$D$c$.X#eD$ D$D$c$aVUWVS# M(E<}38ƋE1f<!ǃLJ U@D$D$ D$DD$<$ @D$@ D$4$D$PeD$4$]40@@ $ @P T$${@@$D$4$,t$D$4$N,|%=neLJ $#4$U0$g8E+[^_]þ뿍D$?e$a…tE|[^_]1䍃^fD$ D$D$NAf$c r?UWVStT YEUUƠ3M1ɅtBE}<$yM L$ED$<$eyED$<$RU+u:t[^_]ÉElfL$ L$D$hAf $E>US ôE D$E$[]US ÊE D$E$[]UVSZ _D$vfD$P 4$D$ t$ED$$V[^]UEȅyt ]%]]ffffffffffffffffffffffffUWVS0 E؋}u 3EԉËE1|$}܉<$]&1$&.&.&.&.& F TFuF(}ԋE+uW0[^_]$)]ƅgы]؍8fD$ 8D$D$F$+]<UWVS ÐEE u}3U1ҍ$iD$@$jE E19xu}_D$D$$iD$D$$L)׉ 9|KD$D$$`iD$ D$$19 })׉ qu0$$j`0D$$%U+[^_]É#0$i0t1D$ t$|$$Ub$i1농D$$蓟tыptEU:,:UD$D$D$D$ E D$E$H]UWVSx ~EUUƠ3M1ɅtBE}<$M L$ED$<$.ED$<$U+u:x[^_]ÉElfL$ L$D$ $:EI9fffffUWVS #~8]du 3<ËE1dENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ ]]Ћ~$|}ԋ^(x]؋~,t}܋^0p]^4H]~8D}v<@u식d3`s\s{ l{LȉEl1؋\!1؋`LyZ؋u\ɉT1`!1l yZTىˋ`MʉX1!1ыXP:yZω}ω}E1ȉ!ߋE1NjE0yZEȉ1!׉M1ωEMyZω9EEȉ1щ!1߉EMyZNjMu}ω}1ϋu!1׋MyZ߉Mɋ}u1!Nju1hyZ׉}ωM1!ߋM1ωuu1yZ]|ɉ1!1lj|]yZωxωxU1ډ!U1׋xyZljutʉ1!ω1߉t]yZ߉pʉU}1!NjU1׋Up2yZ׉4:u‹Hω1Љ!1ωuu0yZE]Dω1ߋ]!1׉EyZωE@ω}]1!]1߉EyZlj}X1u1u1Ƌ}1!ϋ]1߉u]yZ߉MT}1|1u1lj1!ljT1׉uUyZ׉ :X}1׋x1u1lj}1!ߋu1UT2yZUu1֋t1֋U1։‰1މX!1ƉUM yZΉTXMu1΋p1΋M1Ή11MnTƉXEh1NjE1NjM1ω׋X1ϋT1ωEn߉TE}1NjE1NjM1ωXT11En׉h|1NjE1NjM1ωT11߉MXnljh}x1ϋM1ϋM1lj11׉MTnω|t1׋U1׋U1ljh11lj|2n>Xxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVS D]} 3EEGWEU?@)ƒw)ƒT$D$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼnffffffffffffffUWVSB|$8ED$@] ED$ED$03D$‹$ D$D$4ƉߋD$@D$$\$8I| u|$4D$ )= |$|$8 W T$(9rxD$DD$<1$H$|$@H&.&.&.&.& ˃6\\$@ =tN9rܻ6\܍T$DT$<$L$Tt$\$t$<4$Wt$$H$WwRD$ |$4)|$88|${|$,9} T$4|$|D$<$׋sT$(T$T$4T$D$<$֋UT$T$T$D$<$֋[D$Rjj& [1Ít&.&T$D$ Zbj rz $z(t RPS[H>jRj& [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ó=Rjj% [1Í&T$D$ Zbj rz $RPS[n=jRj% [Xt@US @E=ED$E D$E$豪 []US=D$ D$ED$$臅[]US<D$ E D$ED$$-[]USß<D$ E D$ED$$[]ffffffffffffffffffffffffffffffUWVS,!&<uEEED$D$}|$ t$D$EE$EE ED$D$|$ D$D$E$藟EEED$D$|$ D$D$E$H6EEED$D$|$ T$UD$E$UEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$d؃,[^_]袂8 u>ƆUNpjD$ D$D$<f$|fffUWVS9} Ơ3E1}D$D$HtHE$Rat=ED$D$<$D;Es1U+[^_]ø"㍅D$E$Ytt@D$E$qYu[ED$D$<$Ԑ;EsED$|$ H%D$`d$T$GU.I D$ D$D$B4${UWVS {x8D$ Q \$E$qƉ؅u [^_]É諀01UWVSp%*8U U ut$$ U @B1NjEEE1UЋUME1EHt$$>xx U @B1Ƌ}E1NjExME1EH D$E$u( U ]ٸ@B1E1؃p[^_]øp[^_]$' U +qD$ D$D$Hf$yUVS 6uED$D$D$D$ ED$E D$E$-U [^]fffffffffffffffUWVSAF6D$D$E$АuE'".&.&.&@t&tD$E$"u܉[^_]D$gD$E$Vt 1[^_]ËEpD$D$4$&E@<-u?EPP'DPtEPD$ ED$$UYMU9p9g^My+th)ƍF߃1BD$D$4$xE@t<+ !M?!fffffU{|4E?w't u]Ë u@u1]UD94EP>w ']1]UWVS( 4u}܉|$D$4$U{xINE uG>wl(3EظE! EED$|$4${([^_]Ã>w2(3EظE E{{UWVS<A3u9zD$ to'D$D$LU <$-)y),U @'t@,U [^_]ÍU T$ t$)‰T$$(뵍JD$D$LU <$(fffUWVS聻Æ2ƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUgT$ T$D$tT$>tEF!FUWVS 1u] "<-EEEE}|$EԉD$$$'|$E|D$|$$EwD$D$Ẻ$wMẺE0EUP'DPщMEE1E5NjEMAE$V Uzr u苆L] L] $2([^_]Ë]荃D$ZEU ,D$ED$]荃d]D$ KoD$D$$$i]j0.$2t]荃D$$E$]сE$r E$g j01-E$]4NjEMAE$5 D$Ex([^_]Ë]荃0dD$ D$D$3g$d]荃aD$ D$D$3g$wdUWVS ir!Eu]UEuEE$2 ]?rƃthE8rD$E$]2NjEMAE$ Myq U苂L] L] $2 [^_]ÍEUED$E D$E$]q $g]h0$2t]荃D$E$]E$e E$Z h01j]荃D$E$]1NjEMAE$ ӍD$Ex [^_]Ë]荃0dD$ D$D$3g$b0]荃aD$ D$D$3g$Tb UWVSJO}$21L] 1.&9~uMU<$4UҋM} :g8u/D$|$F $tډ4$$~E[^_]É4$~M썃D$>L] MHtD$f붍D$ ]L] HQgD$ D$D$3g$`UWVS\EEEED$ }|$E D$E$YƋMt|$ $kƃt|\[^_]D$ $Mx…t݋ED$ T$UE D$E$#YUMtNMT$U $0kƃUt$|\[^_]ÉU{e8UtB9udM밍]gD$ D$D$>t$_U$qU~9E~T$$jƋUfUWVST}Eu}]E E bEEE;E܅~ 0MU tEEGz;EGEEUEUEUEUEEEE EH8E؋E$]:S 8MЍD9E  0^EUM]L$\$ $T$]O9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]vgD$E D$E$09} T[^_]ÍEEEE2EEUE7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]HMȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;EUEbEdEE Eg]U]EdEEUM]/w$OUЍD9E ỦUM܍_׉F u ,[^_]Ë]Uv]YՃmu$]p,[^_]ÉUE$]ohUtÅT$D$ $M]'MgD$ (D$D$g$Sn]gD$ (D$D$g$S*uf~*u1f~*f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$_=P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 T$ D$)L$pP$ gf[!~ʉW-0i$]…jHD$D$ D$D$$=<T@7pf@!fH9"!h|$ t$D$g $^>|$ pD$D$ $&>gT$ D$D$g $=pT$ D$D$ $=gT$ t$D$ $=|$ pD$D$ $`=rMUWVS4,1gU9U‹)߃r)ڍHPftDΉ1ff}tYFftf[tWf{uFfuM E14[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1Gf,f[uSf]efً99S{f{vf}uͅt8Ĥf}Xׅu9f1TffuM M1B:qQf]tىC)ȉD΃tft F!hT$ |$D$g4$9ɋtFU1hT$ |$D$4$9ggT$ |$D$4$d9^g눋yuI󥉽SًfvfUWVS~ƅtyB tA xy f>{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃!hD$ D$D$g$ 8MUQMU썃gD$ D$D$g$7MU8=NUWVS(}êu} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍!hD$ D$D$g$(6U} UhUWVS|EtXEPtF@1([^_]ÉP] }nƉT] 8ǃX] ǃT] ǃ\] ǃ`] ǃh] >E䍃E7~fu6~fu0NUDJ@uu\] ƀ8t;>otĀ>ouw~nuqNUDJ@uu]\] ƀ8uŀ}#d] >Jd] D$ 4$tP] ([^_]D$ED$4$O&uNUDJ@u;t7D$ED$4$ &u,NUDJ@t\]  \] tD$BD$4$%u8NUDJ@|\] f  uD$SD$4$%uBNUDJ@\] @e$LN1|D$t@D$ T$AghD$ D$D$EL$3ffffUWVSch$^;tƀ8u^UMT$D$ hD$D$] <$ME tE 0[^_]D$ ED$4$@x]MultQyuJ&wɋ⍻] 뚉t$h$覶D$h$萶t$h$~u=@=~ӉƍU=[j= {GtD$h$ "4@D$h$޵j@sD$h$賵U@@HD$h$舵{G@UWVS8`3U1ǃa a DŽa r捃] Ya D$ D$D$$苴a T$$D$\|$4$2DA8t߉a 8#mD$\|$4$Dt8t㉃a D$\|$4$Ct8t㉃a D$\|$4$C8t߉a ǃa ǃa D$\|$4$Ct>8t$ a D$\|$4$VCt8t$a D$a D$4$-ID$\D$$Bƅ8tщ4$j uċ|t| >t|$$0uቻa ?x{U+8[^_]ÍD$\|$4$u 1[^]ÍQ$[^]UWVSY}u QD$<$ t*>D$<$ u t1[^_]ÅtUWVS8XÌ3‹E1D$ D$ED$E$+8…uZDžDž$.$.E+#Ё8[^_]É$%T$ D$ED$E$ƒ$%aE1Dž9~&t$$i* t$|$ D$UT$M $0ƃD$|$ D$ED$E $A99 yt rtftƄD$D$ D$ED$E$_ƃv1҃8-DžDž1Džև1UWVS@UêUE 3ƋE1D$ D$ED$$D…uZDžDž$+$+E+/Ё@[^_]É$# T$ D$ED$$rƒ$"jB1Dž9~&t$$u't$|$ D$UT$ $ƃD$|$ D$ED$$'99 yt rtftƄD$D$ D$ED$$Bƃy1҃8-DžDž1Džل1UWVS@RíUE 3ƋE1D$ D$ED$$D…uZDžDž$($(E+/Ё@[^_]É$  T$ D$ED$$Uƒ$jB1Dž9~&t$$x$t$|$ D$UT$ $ƃD$|$ D$ED$$ 99 yt rtftƄD$D$ D$ED$$%ƃ|1҃8-DžDž1Dž܁1UWVS Oó}"D$E D$<$utut [^_]UWVS KOP}"D$E D$<$jutuJtЍ [^_]UWVS N}"D$E D$<$utut [^_]US NÆ3D$E D$E$N []UWVSINN}U Ơ3E1EteMyu )čD$UPtMP}y:u}D$<$U+ue[^_]øUWVSMïEEM Ơ3E1EtgEǺu )ԍT$ MJtJx9uD$T$E$PU+ue[^_]úE!USM ED$ ED$E D$E$US LED$E D$E$AUS LíED$E D$E$+BfffffUWVSqLvƉUtmEb}u +t"D$4$uM)[^_]P'DPu 1[^_]É4$[^_]ÍgD$ D$D$p$dUKEt8t 1]ø]UWVS\KÒu3EE1(t$D$Ẻ$y b }e1󫍃b EЋM̍#b |t:tEЃ9s EЄu$b t$*iD$Ẻ$FD$VD$Ẻ$EЉED$iD$Ẻ$x,uЍD$4$Xdb 4$ D$:oD$Ẻ$Cjtdb EԉEȉD$D$Ẻ$蘄ZEԉ4b EȉD$I&D$Ẻ$jt EԉEԉ`b EȉD$D$Ẻ$0Eԉb EȉD$qD$Ẻ$Eԉb fEpxEfEbxEfEfxEfEoxEfEtxEE`ab E؉EEEčEElEEԉ<5uǃ b WEVǃb WEVẺ$EMU+r\[^_]ËEȉD$t$Ẻ$Efb GEG ED$T$Ẻ$4zUEG EЉ$15t&Db @b 8b 4$T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)vc 9u(Ƅc [^_]Éր>/tJ95c ǃs$utǤƄc [^_]ftt鍳jfffffffUWVSBֹE$}LtP'DBt;L'0fkfbfgfE@ E1ɉMD$ ED$E$,Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZENE0US{AÀD$ E$3[]ffffffUWVSAAF}?t<$D9uzf.&9ti8/t9t`sc~/t9u)=vg ׃rtftƄg Ѓ[^_]ø95€8/t Ƹ봸jUS̵utE D$D$4$[^]ÍgD$ D$D$1$i붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[$@[Ḯ̀rS[@[ḭ̀rS[@[̀ffff̀ffff/̀ffff^̀rS[Ô@[̀rS[t@[Ḥ̀rS[T@[<̀rS[4@[̀rS[@[ḇ̀rS[@[̀rS[Բ@[ḓ̀rS[ô@[̀rS[Ô@[`̀rS[t@[R̀rS[T@[2̀rS[4@[ḩ̀rS[@[P̀rS[@[ḷ̀rS[Ա@[Ḷ̀rS[ô@[ḉ̀rS[Ô@[̀rS[t@[Ḛ̀rS[T@[̀rS[4@[Ḩ̀rS[@[1̀rS[@[Ḍ̀rS[԰@[òrS[ô@[ìrS[Ô@[l̀rS[t@[t̀rS[T@[s̀rS[4@[r̀rS[@[p̀rS[@[j̀rS[ԯ@[m̀rS[ô@[̀rS[Ô@[Z̀rS[t@[ ̀rS[T@[!̀rS[4@[S[@[f.&*̀r׋L$Q1fffffỲrJ!QS[ή@[UWVS7ưk k D$$ k k +k k s$uu[^_]ä[^_]ft뻋k Pk D$D$D$D$ D$ D$$k 11k D$$D$$薕$Cf;USF6Kk E)9k t$ []à T$$a[]US5D$i$k u $M|[]fffffffffffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVS|4ÁEU1UE $M)ƉD$ED$M $t9} uˋUtE붋E8E[^_]1[^_]UWVS$3Ɖà3E16P'ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $臌Džtҋ0F D$<$xF$F(<$誌떋dUWVSX2٩E؋}E }EEEE]P']wu8EX]E]܋DJ@u2<%uEUMYC~MP M>~MIH??? G??? G?? ?G ?:??G:?? G????fG 늍9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ D$t$<$:9xT1D[^_]Uk D$E$]US8ƕEЉD$E D$E$xtUT$$8[]US4}ÂEЉD$E$&ytU T$$m4[]US@EE$Cxtk T$$4[]UWVS@ UE uǠ3M1ɃtHMċNMȋNM̋N MЋNMԋNM؋NM܋NMN MN$MN(MMuătFt+uSt$D$t,$(U+@[^_]Ét$D$t,$׉t$D$t,$믉E UgL$ XL$D$;  $E U L$ XL$D$:  $E UNfffffffffUWVSÆu} tkt;1!.&.&.&t  9t)ʉЃ[^_]ÍiD$ dD$D$8H$뙍iD$ dD$D$7H$fffffUWVSƒEUE E0utt4$]]x]pt/9u+]|$t$F$]KxN9Mtۋ]E t&t#P9utFE0E[^_]É1]iD$ lD$D$Il$;ÍiD$ lD$D$Hl$fffffffUWVS ÖMtU D$E$ED$}|$E$6ƃE $EL30t6Eu1 [^_]ÉL$M$UjUM $…tU $lUMȉ׋usYtftE|=Eu stf`Z뉋E|떍pjD$ xD$D$C$U biD$ xD$D$D$D$E$f5Ef,zE UVS %E UtuD$E$5 [^]ÉT$D$E$'ƅu E [^]ÃTt701 [^]' 1UWVSßuE 0E,E(34‹E1wD$D$4$xjhDžDžD$$v}D$h8$C~hǀPǀTǀX8<$8Dž@fDžDfFHDžLTDž\ddDž`DžX(D$ ,D$0D$<$ƅx <$ uT4E+u[[^_]Í D$ D$D$D$f GUUT$ U T$@'D$E$]US KPED$E D$E$_ []USED$ ED$E D$E$\[]UWVS,uw}t}ED$4$ު4$F0tN@9t $ F0F0ǀǀ FF~ >\}IED$ED$4$ NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$UE UπUE댉E䍋iL$ M܍T$UD$E؉$BEFEF3¶D$4$xE,[^_]ËF$\}Ef~ FFCFFD$4$E,[^_]ÃUML$ T$D$E؉$}EFHUE$E UtRπMtD$ D$D$?$%ZE(E9Ut'$*E UtπUEEUVSшuD$4$V(4$F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$菧EUw0E[^]ËVPNTUMutt+FEUVTD$4$*4D$4$ UWVSß}?ew t>Et[^_]Ft$V tQFtB1ɉωMT:0$V T:($V D: $MV ;Nr$xF,t$iF4t -$UF8t$F4$>[^_]ÍiD$ D$D$M$~?e[^_]ÍiD$ D$D$K$@UVS7<4$u,l D$E$p4$u[^]UVS4$u,l $W4$u[^]UWVSø<$iu,l D$$Ɖ<$Ju[^_]UWVShmuED$@$6wED$E $w…t?t$U$Ut'zu Ńtt$$ƾuUEHutU$贚EUЃ[^_]ÍpjD$ D$D$< $7UVS Æ4$7tll D$E$Iv4$t[^]UVS< A4$sll $cv4$s[^]UWVS <$sll D$$vƉ<$s[^_]ÐUWVS0 öUP'E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍiD$ D$D$FL$ULuԍE9s11UWVS ΁D$'D$'<$|E tED$E D$<$D$$ bE$oUSR WUT$ U T$D$E$f}ffffUWS l 1󫋃n t D$ D$D$$_[_]UWS €l 1󫋃n t$uǃn ǃn [_]UWVSh mn tEl D$ D$D$4$ x=Č[^_]ÍjD$4$s{n ,$AxT$$$n nE Et[T$ D$D$l 4$wul utmpn $X1Č[^_]Íl 1fǃm ,l 0l 3l T$ D$D$4$贌yl 0n n |n n n jD$4$'zn D$4$zn t:ǃn l xfm ]l l UWVS27~utmfFt5=l FftFfwftf9t1fqu1[^_]Ãfwwڋl 9F uύl ԍjD$ D$D$j$dUWVS{À}}tY5l G$El FwD$ ED$<$Ftũ[^_]ÍG܃[^_]ÍjD$ D$D$j$xUWVS8|u3‹E1/var:󥋳n $0D$ D$D$n $МDžLn D$ D$D$$觉ta1t7n $7D$D$ D$$|E+8[^_]Ën $萑tl Njr/run/utmmpx>n tKn u~l $Ȑǃn ǃn Bn tn %1n l t D$ D$D$4$$ƅn $D$D$ D$$qD$ D$D$n $|DžjD$ D$D$j$蒼1tn nD$ @D$t$<$VtND$T$$vwl R41t$ |$VjD$ $cB$UWVSx}&E D$@<$aƃt;D$E D$4$`4$b؃[^_]D$D$!@<$aƃtql 1fǃm ,l 0l 3l D$T$4$_KK84$b<8^jD$ D$D$Xj$苺bjD$ D$D$Wj$\UWVSRWwut~4$=w|xt 1[^_]D$t$$l 1󫋃n t$Ɍǃn ǃn [^_]ÍojD$ D$D$xj$蔹SUWVSÏv}u tLtvFGF G$G(FODNOHNOLNWPVF V$[^_]Í}jD$ D$D$j$ujD$ D$D$j$͸[UWVSu}u GG FF$GF(ONDONHONLWVPG W$džP1tftdžDdžHdžL[^_]Í}jD$ D$D$j$˷%jD$ D$D$j$虷SfIUWVS(sxtuU!D$D$ D$D$@4$F…E EED$ ED$ED$$UR Uuf}uOEtZ}u츬tftu$R([^_]OU1މU$EUu1ojD$ D$D$j$8UjD$ D$D$j$1\f-Ex UWVS$r}uD$D$ D$D$"@<$虌ÅE EEuED$ ED$ED$$S$S$[^_]ÍojD$ D$D$j$UjD$ D$D$j$̴&fffffffffffffUWVS æq}u9cEt' [^_]M M@LEkE} ; c ‹MlEEEME}u},v.&.&.&d09uM}u}s [^_]à t [^_]ÍiD$ TD$D$j$!jD$ TD$D$j$nE TP'n} X} NU P'DP] Sɨ E nO} ;M P'DH9Ѝۺ/)9 ] DCЈ} ?VU  ЈxE m} -}} ^dU P'DPE P ЈE PЀ ZˆE 0<kЈE TP'hE 0 } #EEE } d= RE +E TP'E PEu } \Et } %Et } &Et } =_E P'M DHQE 0yU\GOD       ME}u΋}9|dtH9tud^EcdME P2 ZE P*(L'WEL'W E' UWVS(kE܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]o([^_]ÉxÍjD$ HD$D$j$讬U U ]܍jD$ HD$D$j$sU ]ޱj  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]fUWVShun n/>3)Ѝ)Ѝ:~ 9w$n ug U$Ѓn U4$Ѕt9w$D$ D$w4$[^_]É4$uljw$t$ D$D$ w4$]E t1붋n t9U$(ϾNjU4$Y[^_]Ëǃn 뭋U tuGEǃn n hD$$=Bn `ǃn 11UWVSfun o))Љ):~ 9w$n ug U$Ѓn U4$Ѕt9w$D$ D$w4$[^_]É4$uljw$t$ D$D$ w4$\E t1붋n t9U$(NjU4$Y[^_]Ëǃn 뭋U tuGEǃn n hD$$\n _ǃn 11UWVSdu4$讜Džn ED1.t&.&P9u/>3)Ѝ)E:WɉM~4T$U4$.UuMG$U 1[^_]Ën u$U$Ѓn UD$ t$$ǻ4$@G$됋n u$U$Ѓn UU$(NjUthP뀃n tn u/D$$=舾En ǃn ǃn 4$tՋ@UWVS cu4$輚Džn EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$=UuMG$U 1[^_]Ën u$U$Ѓn UD$ t$$ֹ4$ @G$됋n u$U$Ѓn UU$(ϸNjUthP뀃n tn u/D$$藼En ǃn ǃn 4$ tՋ@UWVSaUEtЋn t'Ǎt$P9uǃn ǃn n t'Ǎt$9uǃn ǃn ǃn EE EE1[^_]øUWVS(-`UEtЋn t'Ǎt$e9uǃn ǃn n t'Ǎt$*9uǃn ǃn ǃn EE E E1[^_]øffffffUVS$27_M EEEUEUfEtxuR guAfEED$D$E$Ht'f}t u19uW1$[^]$[^]úfUUT$D$E$9H$[^]ú¦#ffffffffffffUWVS#^pUE  DžXEK/tBD$E $p-E $腕uv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $p!%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pDDž`D$`pDD=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p?t9E DtX$p1Ĩ[^_]tN~uPf/tp誡蚡?p脡xrzUWVSX}E ttrD$<$(xX[^_]Et$<$}شDžMtAt$$h(ymt 8"tƉ<$1[^_]Π1fffffffffffffffUWVS!&X}<$ُn $n ǃn 7tyP'E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]Ën t$öǃn ǃn ΍yU荟 UWVSWu} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]ÍIpD$ D$D$t$/[_D$ D$D$t$UVU]UWVSUu} to.&.&8u$ u|:9s :t|tu[^_]ÍpjD$ D$D$t$$b_D$ D$D$t$-1UWVSpTƉE 3E1=m}! Mu0n t |$$U$G UD$ D$D$E${DžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$ lj99D$D$E$;^Ѐ txE<#=D$ $,#DžuD$=D$$yS<:uA)ljED$L$E$:=w!C:SDžDrpD$ |$D$$FD$D$ D$D$@$jD$D$@$9qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$+5L$t$<$5 $菮OދDžމ:DžD))))T$<$蘪o<ljljÉtE$8)ȍP9rH8E+p[^_]ÉEDžD$$蠩됋n $`!n D$<$*|70ƋY10$40DžƋ|$Dž>UpD$ D$D$t$apD$ D$D$ t$܎cpjD$ D$D$ t$螎.IpD$ D$D$t$mtp@a$跪DžmE$C5;E$-5n땉Ƌ$a>$腂D$ \$|$4$V Pu Dž$H $>Dž L$T$$/4$V18Dž4$VDž鋝pjD$ D$D$t$W‘0<$˨賑0$諨tE$<3r M4$VV 1ϋ$Hu%$됋E$2UVSsxHEM ut.t^UD$t$$F[^]Í_T$ T$D$t$M EuM EapT$ T$D$t$ŊM ElM EpjT$ T$D$t$臊M E1USy~Gn t$B]ǃn ǃn ǃn ǃn 1[]UWVS0 %GME 3ƋE1Dž]n n P'n tn uD$n $ 8D0Dq@:#n ux|\u ǃn ׍:\tWut$n $I7lDҀ|\tǃn ǃn n $BƋn u$.[ǃn n Pn @&L$$@n dǃn ǃn ǃn f:wu<:tAt<|uD$t$$}ƍ@E+0[^_]Ën $@uhn $Yǃn +n n 0D$n $E?n 5n t$Yǃn ǃn ǃn ǃn apD$ D$D$t$CtcD$ D$D$t$7ǃn ǃn ǃn ǃn $Xǃn UWVSóBu} tPtzn t$iXǃn ǃn ǃn ǃn } u[^_]_D$ D$D$t$uapD$ D$D$t$WUWVS$AEu} (TED$=|$4$ƅl$d]賘Dž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]8ljEEd<:u]WF<:XЀvP2MҋMFE1]MVD9ut 0v]M :]U})rtT$<$]KEEM$[^_]Ë]뽸 y]䍃VD$ tD$D$t$衂Í_D$ tD$D$t$p]䍃IpD$ tD$D$t$;z1*E$]蝞<$]舞]k UWVS>Eu} uE0D$=|$4$Dž$d]賕ƅ<:d <:tCZtsu)Cd]D$4$]zUn‰ƹd<:uЉƍX)Ӎst4\$$U]7U@Љ)ӍsűE[^_]Ë]썃IpD$ hD$D$#t$茀E]썃VD$ hD$D$$t$TÍ_D$ hD$D$"t$#Z]썃xpD$ hD$D$`t$)D$4$]t-M14$]?։4$](]  UWVSÈ<}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/DžDž)S$K9>:hf̀ 81Ƀ4uA )čD$pxr󥋵t$D$$!D$pD$$|$t$$D$pD$$pjD$ 8D$D$E$KzudurP95195rBvBDžqfzU 西63D$E D$E$]UWVSot6}U Ơ3E1EtqMyu )čD$UPtMP}y:u}3T$D$<$U+ue[^_]øfUSþ5D$p$Js D$ ~$I s []UWVSHqv5}}ԋE E؋uu3EЉƋE,D$,$(s }M؉MufuUT$U܉T$ D$ UT$$Luu vU܋9El} u s tUԉ%9s t1MЋE+H[^_]Á} u s uD$D$$4XƅtDEĉ4$"]AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UmDžuED$UȃT$Ẻ$蟋;Es4$O[f % ЉD$pD$ XD$ED$Ẻ$)x ;Es1"B9EBf9EzJ Uȍ~|$D$ $M.JNMMčD19C9}rỦ׉΃s$tft1V4$rZDUuuB r EfUS菻2D$ o \$ ED$EU $T$u؃[]1[]UVS4D$\D$d@ fD$h@L$dfA ȃ9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -JUWVS,1}D$<$M1ED$ ED$E D$<$D$<$G1[^_]UWVS̚}D$<$0ED$ E D$@'D$<$D$<$0[^_]ffffUWVS afU J}2D$$U ]0U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$lU  0Muωƃ}EEu2J0B0upH MHBD$$/E [^_]ÉU U fb ߋrEt9spE9-J E F[^]UVS誖ï ut$t#Ft$mFFFt$lFF[^]UWVS(>C E Eu Ft$lD$D$ D$D$$5FNMML$$tpt&.&< t< tED$4$PU4$F(MAE HɋUEHM@1MMG< tGE xG9t[}FE7ED$$Put< uuEE([^_]ÉUE x:TED$|$E$kMT}E xExUS4$H'MAE P UE @ SD$D$ E $Su*E HEHMUT7kS0E t$ E E @t$PjE @@E @t$-jE @E @S01D$p$M 61zEPfUVSBG E$ tKtE@t>UT$ U T$UT$V$Љƅu E[^]\R0E[^]ÍlD$ \D$D$8$L@U 螒 @'D$E D$E$2]UVSpu E$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]ÍD$ DD$D$p$K@$Uő@'D$ ED$E D$E$$]UVS萑ÕE$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]P0E[^]ÍD$ ,D$D$y$J@(U@'D$ ED$E D$E$$]UVS谐õE$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]O0E[^]Í8D$ D$D$$J@4U@'D$ ED$E D$E$$]UWVS(ϏuEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}MN0E([^_]Ë$ 1ҍ}uU썃D$ D$D$$H@HU]EU썋L$ L$D$J $FHEIUpT$ T$D$}p$ HEX qD$ D$D$[p$GUUʍ@'D$ED$ED$ ED$E D$E$]UVS臍ÌE$ tKtE@8t>UT$ U T$UT$V$Љƅu E[^]L0E[^]Í D$ D$D$$F@8U @'D$E D$E$2]UWVS贌ùJD$'D$'<$Et8ED$ED$<$v|$ D$D$#$$E $0jD$ D$$0E$US D$ ED$E D$E$K[]fffffffUWVS0}u t$E$6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw"Nwq\E@VP'PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$/atU@}ظ^DE@uS4$0auV tQFvIE %Fv7 ,-}ԉ}؉xE7P'DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$w_rF<gE\}؉xE^E?uE܉$]_u'UEf@HO(EEX[^_]EEEE@]uaMЅW$tEЃtUX[^_]t]&E4$=5EEUE}MЅuW(EċpDuG$]Y}Ef@H }0]X&UĉB }EEEOGt8f.&.&.&PXT9t+PʉPH@uUЋrDyЋXDPXT9t+PʉPHPu׋@ԋ]ED$ D$D$q$} }fGH]Y%G @E}G(UċrDuG$]EЅEċ@hUTZG(UċZDuu떅uEċ@뽅?~t&UWVS$e} EdD$,$7ƅEF$~(EEt=}1҉Eu׉ $`9sǃuEuw1ɍUE‰EM@DEwE1}EBUE$UUQ…U@DEBBTBN(U?fUufBHEuBMEPUEo}}Ut E1ɋUt9xf@H F(EuNE$9A}" $9uE$p9F$e94$]91$[^_]Ã}uω$9sǃuu0UU~!릋}|\1ɋUYxf@H F(hD$D$@95$qFN(H`D$ tD$D$q$H`D$ dD$D$q$1ɋU@f@H F(ZE4UWVSdai}tH@JHDy$7VDxpup$7VDy4$7wtv$v7uGt$c7G$X7G(t&<$J71[^_]Ë@$$dG$ ƃtCG$뻍ED$ (D$D$ q$UEvEG$k<$6EbUUUWVS `}57KW(?FLfFL;NHtlfv$'6NDFLf;7tȍqD$ D$D$q$Affu@F83G N<3O FJ"Gt uƉv$5uuGfFHPp$l5~DWF(VD{G(G$O(1[^_]ËGt+tEW(uƉv$4uuGGIG)t룃8N?wGGENQ(BI|/u‹E/N,QT$VTT$$Ϻ7[^_]ÃED$ D$D$Uq$1ɉfFHG(uG$F,F(NTD$ML$G$7D$/M $at;9EP$U @MD$UT$E$MN,GFFF8V}DF)uGHf fű~t$#0u} EHDu@8/tF(tF[^_]ÉUD$D$@95$莹ǃUttF<$b<$ugFF)E@[^_]ÁN(fED$ D$D$1q$F߹UWVSXàutp$2u4E4$u(4$.E$臹[^_]ËF$$ 뿋F$$F$$F$$.뵍qD$ D$D$B $aUS W@'D$ D$D$E D$E$l$]]US WáED$ D$D$E D$E$l$]]UWVS8\WaƉ׉t,MO=U= =T$E؉D$E܉D$ L$|$4$諒=ƒu܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1"ك(8[^_]1U.V7@'U E]UMU E]fffff̀rS[@[̀rS[@[ ̀rS[ô@[UWVSUÖu} u !t9u[^_]1[^_]Í:D$ D$D$* $+UWVS$U)u} ttB|$4$[^_]ÍiD$ D$D$B $uiD$ D$D$C $UWVSTÙu} ttB|$4$E[^_]ÍiD$ D$D$B $9uiD$ D$D$C $ UWVS@ Tt$(D$T$L$,D$,t "|$GD$8UT$$\$(uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$( D$$T$ D$0T$4D$T$ $D$豥D$L$8D$9\$("D$8D$E܍ 0MU‰T$UE$]XU})ljEuUD$ D$D$E $]MAQt$|$E $@t~")Ɓwf] 8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$];…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]/ D$ D$D$E $hm$뫉EX@$]}MA }E@@eBE $]RD$@E$_E |EMH ]cωu]zD$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]BuDG uNjUtG~uU܉$]}닋]썃xpD$ D$D$ $$] ‹EE1]6UWVSGô}G $ wt6$ uG[^_]UWVSgGlu} t"tL D$ $[^_]ÍqD$ D$D$:, $uqD$ D$D$;, $UVS8Fӽut&}== = ED$E܉D$E؉D$ T$E D$E$=t3w Ef>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[Ô@[ffffffffUE]UWVS$XE]E։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]ÍXqD$ 4D$D$rP $EP~D$ 4D$D$sP $T!UWVSXFDOEu Ud E' } E EE̋EƉE$]Eȅ E? Ef UȍBEԋEЉE؃)֋]ދuމuED$E$M!EȍDU؉UT$}}|$}<$U1Ʌ9uWuuEȉEMEEĉ}NjE4u܋E9MuЉEËE9s#ED$;D$$UU9tΉMuЃ\97]ˉ}}܉+uED$|$4$UM9t#+EU‹ErUENjE9r}܉ً}}M܋E9ED$u܉t$)$UbE‹E+EuEuE9EԋM9KEEEUčB}9EU}؉EC‹u)}U92؋u)uEԋ}9}EЉEM]}9}ED$}|$]$U}]UEE܅U؉!ED$|$$UU9~S}E9rՉ߉ËE9M̅fU؋E.& 9r}G9T)E؍LEDEEUv9uM؉E}9}M]U9UU̅U؋E}f.&029r}Gu9!F)u؍DE؋EԉEUEE9'EUċ} :9t?Eȋ}ĉ}ȉEED$E$ME>Eԋu؉0EȉEċEEȋE9E^Eĉ$]1X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$]}~]~D$ LD$D$yP $ÍD$ LD$D$xP $k]~D$ DD$D$&P $i]qD$ DD$D$'P $7h]U9UT$CD$ ED$E D$E$]fffffffffffUWVS 8ƯEuVtG~^ЉUv.&.&tP1H1 uN9H u [^_]ËUU$]|t"N^HXNH UF [^_]ÃUWVS8"u$2uu[^_]*F$$踞4$NjF$$裞[^_]UWVS7Ʈ}E wu v.t&6tk9uFVO9N uO1MO1 MtGD$ D$T$$<GWG1D$<$KtG9F [^_]ÍqT$ \T$D$it $E GffUWVS6uE8F}9FiF FD$ D$D$$tFVFD$F D$$FtotfxWFvthV uAzN)91F Ju M ]z u F MЃ[^_]{1}i81F u1UWVS5ݬ}$2t2G$$肜D$<$ƋG$$e[^_]D$<$Ɖ[^_]UWVS g5lE$20E@$$D$E$,ƅ@ ‹} 6@E@$$荛0tiEM 1D$E$ƅt[P } uWuYu}8닋E@$$t= [^_]äDf9ftl8Z}8E1E xIE xfff̀rS[t@[ḃ̀rS[T@[UWVS$136utqEEE E}8D$D$ED$ t$D$E$ ƃt 1$[^_]58 u+81ፃpjD$ pD$D$< $`ffffffffffUWVS0]2fE̋]} Ơ3E1u9 &t8u)؋U+0[^_]ÍM1D rE̍.&TЃutS؉].t&.&.&t\="t]W$].I1B]YcfffffffffffffUWVS!1&}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU jD$ D$D$= $U 끍jD$ D$D$< $TU KfffUWVSA0FM} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$Ɖ[^_]ÉUMjD$ D$D$A $xUMPjD$ D$D$@ $CUMUS5/:Ey \e#9~)ML$D'D$E $1[]ÉD$ qD$ED$E $1[]UVS.ťEy \e#;}.D$@D'D$,s 4$U[^]ÉD$ qD$D$@,s 4$ [^]UWVS@.Eu} taEtHL'EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍiD$ D$D$?4 $uiD$ D$D$@4 $jFfffffffK̀rS[T@[UVS5-:tu,imNA90%[^]Ë40(9r,40[^]9r싋,UWVS,ú],p^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓l404819u[^_]Ë]싃l40u޸UVS+à 4$Qtu,U4$4[^]ËE4$[^]UWVS >+C} ,E[ E$ڑt,tt0)ЉȉB}H}wQǃtǃpǃlG,(EG1E$aE [^_]1뜍Gƃ}?v8}}E?EG EEtpl,E艃(E=0)ЋM@G@EE띍 rD$ D$D$Yt $vE$VEEE3UWVS N)S,EEẺEыE)ȉE䍃 E$ɏt,U0)ȉAtplEp,t)̋E014(E$.E [^_]1끍 rD$ D$D$t $"UWVS( <$ΎƉ<$迎[^_]US 'ED$E D$E$t []US'óE$[]ffffUWVS'Æ}tHD$<$ƅt&tt$<$[^_]1[^_]ÍpjD$ D$D$A $UWVS&uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]"썃pjD$ D$D$V $+NfffUE U9r 9]ø]UU E9r 9]ø]UWVS%Ϝls ls uls 3E1ɍpt-ωD$4$>t ls PEu׉MD$D$4$ MtMljMuD$|$E$ ls 8Ftt$E$ 4$~uMEts 9t$$`ǃts ǃps [^_]Éps TD$D$$K[^_]UWVS$Éu} t%%D$4$tt=t1[^_]À=t[^_]UWVS*$/ut4t$p<$ƅtD$<$ 4$v[^_]ÍrD$ D$D$ $UWVS#ô}G$ƅtx @D$p$~[^_]UVSb#gut/t$p$tU 9P [^]1[^]ÍrD$ D$D$ $UWVS "U3E8s7i1}ƉUE D$ED$<$u E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVS16ƍD$or$f$čD$or$>U) *E]UWVSh Ơ3E1D$<$=@&EtFyL$$L$9~L$ T$D$<$U+u h[^_]Q=f+̀ffffj̀rS[$@[ÒrS[@[UWVS }u t$<$u 1[^_]D$FD$<$ tۍFD$<$YtȍF D$<$FtnD$D$D$ FD$t$<${z7rD$ D$D$G $6:D$ D$D$H $ffffffUWVS ö]}E 0|$E$Ctp?9}raeto1Ɖ\$E$U]9suM9u+EE $]E E E8t 1[^_]ÅuUuCtD$$]ƋE 0i]D$or$랃t.t&:똸vLE8qw .UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVSu Ǡ3E1V F\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …x^D$dD$ TD$XL$E$6 …x'hD$t$E$‹\f8tVE+oЁĸ[^_]M.֍F\DžTDžX\ P\p9{\hD$t$E$x\NP\6DžhhD$pt$E$Fx'q\D$ hD$D$4$$\D$`D$ TD$XD$E$ \87Jffh̀rS[d|@[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS zu}F9r+)F|$E D$F $`~  [^_]1 [^_]UWVS Ýzu}F9r+)F|$F D$E $[`~  [^_]1 [^_]USWLzEU ]tHPP UP[]Í fUWVSz}u tgt$<$kt6tu*t$<$L[^_]ÍFD$<$诬u 1[^_]Ãt$<$蒬[^_]ÍrD$ hD$D$< $Oj7rD$ hD$D$< $ 7UWVSy}u tnt>t$<$脲u[^_]D$ FD$t$<$腴[^_]ÍJpD$ D$D$X< $葻떍7rD$ D$D$W< $ecUWVS[`x}u t$<$u 1[^_]ÍF D$<$褱tF t6u$FD$<$tăt$<$뵸[^_]ËFE }F[^_]7rD$ |D$D$w< $荺O<`D$ |D$D$x< $[ UWVSQVwu} t tJD$|$4$葱[^_]Í7rD$ D$D$g< $urD$ D$D$h< $UWVSþv}u tet$<$蝩u 1[^_]ÍFD$<$t~uD$0D$ F D$t$<$U뵍7rD$ XD$D$< $qrD$ XD$D$< $߸BUWVSu}u FFt 1[^_]Ét$<$藨tFD$<$ tӍFD$<$qtF D$<$^tt$<$K랍7rD$ HD$D$< $VBcD$ HD$D$< $ܷ'UWVSt}u -t8GunG toFF[^_]ÍrL$ M썃8D$D$%< $UIGUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ ,L$D$$跶E GFG F[^_]ÍCcD$ 8D$D$$< $^G EL$ L$D$ $5E   FFfffìrS[r@[v̀rS[r@[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVSruM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1эiD$ D$D$:` $0M E9M rD$ D$D$;` $M fffUWVS(pƉЉǠ3U1҅OD$ |$D$$ċ<$D@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ rD$D$ $e4t9um΃tft%D012 (dT$ 0T$D$ $vrT$ 0T$D$ $-D$ rD$D$ $duoN }L$$ te$ff^N mF.t&(UWVSþmƉE 3E1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$Ї4$P9E{ED$t$$+1F5EDž*FfEMfD$ rD$D$<$a<$蘣9EED$|$$sF<<p EED$D$D$D$ T$PD$$v~0wDžFȉсI<<9fE|$ L$D$$U8<$9Er8ED$|$$$mj$m~LED$E$NDF <Džytt Eut2ED$ D$D$$st1ED$E$1$UWVS<huU EEMEE܋EE؋E E3E8}1w~wF}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ rD$L$M܋E$]M܅x9lEE܅t E؅aFfVT$D$ D$L$M܋E$Z]DžMn9fFfF fV ffuu҉T$D$ rD$ȉM)D$4$\Mx 9EtEc҉Uԋ}^UT1UE܍rE؍" E̋E܉M܉u ET8ẺT$D$ E؉D$t$ $MA\9M)ƃ9}u1hȃiviD$t$E$製1?FD$ r EEEDEԋ}1UE܍rE؍" EЋE܉M܉u E8EЉT$D$ E؉D$t$ $MR[M9)ƃu1yMFD$ rD$D$}<$[<$覜M9L$|$E܉$腼MFUU܉D$ rD$ȉM)D$$ZM9\D$T$ D$L$M܋E$lZMHUWVS@',dlj΋E3EG uY$fto|$$gt9wuҋtD$G $lu1ffh$=@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$t$ |$D$$gu8u Dž11fBUVS aut$F $eE $MUYF t [^]ÉE4$cE [^]ø̀rS[da@[UWVSAFa}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$>q.8[^_]1[^_]UWVSÛ`ut7D$4$FftID$4$[^_]ÍtD$ |D$D$@ $띿ffffffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUSpu\PtStɤ/[]PtfHuX uHuxuπt[]Pt#u[]@ tOED$ ED$4$0uEt8u x[^]ø[^]Í:D$ LD$D$ $%qUWVS(# [tƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJ8 8 f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.븍UWVSZƉׅt5tet&u 1[^_]É $GuMrT$ $T$D$ $藜MuMrT$ $T$D$ $cMkMVT$ $T$D$ $+M6UWVST Y։ 3E1|DžDž F F`FD$$D$ D$D$D$F D$FD$ D$D$<$u G @u}D$D$ L$D$<$O @,1ƒ $VD$D$ D$L$<$t~QG KD$D$D$D$D$ T$L$<$A負E+ȁT[^_]ËQu7Iffft#fFPЃ6tRrpjD$ D$D$ $;UJߟ+t't܃t&u貟襟蘟UWVS(UƉЉ}Ǡ3U1҅t\D$t$ #sD$D$4$K=1U+([^_]É4$PwstP|.ut$T$ `D$D$4$%K댉pjT$ T$D$ $×fOUWVS4ǞT}ĉÉ3EЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ]UWVSRƉ׉MEOD$A M$…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftugcD$ DD$D$ $0rD$ DD$D$ $Δf mUWVS&âQ@DϋE$E,3ƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} u-(Dpf@fPff[PD 8Hx LD$ |$ T$L$$蚖…P @@ u+!<$菖f$n莏t,$ډL<$軌 LwdmPu .8tX<9 u拽4t t҉tH9Y PP1 UWVSpùDƉ3NjE1>$裛$艛`11D r틅FFtGGFUCFV胍1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$_8=.t&脌G au$1ҋybK;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$$U+cp[^_]Ã){$芠$|1녃1(@<tcE D$ D$D$$u|d@=1$1ҋ_/@ P$1ҋ|f8pjD$ D$D$ $|$1ҋR@uu*$HDPDE诈$l茈1gUWVS>hEdpPt%=~hnDž1E1 Dr]`1 DrV]pdMEE`]MEE$E]1 DrFdd<$h讆dU[^_]É<$h腆h.[^_]ÉЉ`6`fXh΅\G]1}`X D r틅hLHOT`@pPsDXLHHX9HHD$ PD$D$L$h)dL$P T$ D$DD$l$:xq]1EDr틅lEEE!$\Xl$h9TX\d\$hPEE؉E؉d<$h dS|dMEEdMEE‹`MH@A‹@u@<$h{UWVS`:?:ljUMMME EEE3E‹E1EE$Uu\WtU&t89uML$MML$$OMt u܋E01}U+`[^_]ËG;t?OƅE$1ɋU "D@u듍ML$ME$1r)sD$E$T4M<MMG;tƅE$1ɋUv.t&@urD$ 4D$D$ 4$H{EErD$ XD$D$4${%uܸEvWt$v<$nuEaME뺋M#U—7Ew ]ÍCs]UWVSej7ut(vGt$ɖ<$u[^_]ÍrD$ D$D$r $yUWVS6EdE tEpMh3lNjE1x1󫍵1҉D r퍍T11D r틽dpPu x x$9Dž hlE+[^_]ÍdD$ tD$D$ $x t]DžDžDžDž|wHt;u Džx$tT+ `XtGt`u\W9tCu+w9 t  | t1҃1҉ TL9G9}Gw9 uuttdx$tTf.&9u`q@D$%d$%?gd$T…^ d)xD$L$4$tPTP `pLH@D.t&.&vZ~u~ x G<_x$tTt&.&9uiJTƅyx$1ɋtH`phG <t`V9&ut뎋x$+- r8vDž:@D$`ptu t Džx$y,vGt$[<$Sux$%,Dž|.Ix҉$+Dž>$ȇ8JosD$ D$D$x $j>x$z+Džx$]+DžX`A{$0"DžDžt?G t,Gt&H?wB11  ?uNj<$7QsD$ hD$D$f $iG H닋Dž(D$Dž{vGt$<$ޅu DžDžvXx.fǃ8 4$1ɋt.GtuŋG@fuXHS$|D$D$D$ L$D$ $薉ȉQH9rs$PY| xrHH9s $aGDžP,Ptp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$x$1ɋD$D$ $y|$L$$ ~D$|$$FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $7 ctpDD$ D$t$<$>&)ʍ0&J9uB<$Xt;1AtF0 $Ft4$ʀX@FXVDž|1dH1׉D$ D$D$$TT$D$Ii $THwjNxa 7 $x$#V5x$#DžFB0$et2Buቅ߉UWVSp踨MEׅ M11D rEMEEED$ E$]+HMt$E$]oX@t\}}< < ߉ډt$$]t!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍsD$ D$D$k $i`]rD$ D$D$l $4`UWVSp*/uE$C>FEu11D rE@tmEEEE<$TML$ML$D$ |$sD$E$?twEЅUp[^_]øp[^_]É<$EuUE@ u*x(9P,ӃDtftEp(ff} GуcF9TNO F|?L)09"A)‰UtEPE PM1EE/E P FD ]t)É]x9EEPB9uҋEPU@E]`AED$UT$E܉$莑M9AuTUEPE Pa@ ]AD$D$ E$;@]@0E$E@$WE@@@0$WE@0@($WE@(@,u@01$[^_]ÉT$<$]$TDžqEx(UP,ӃuCu*E $[^_]ËEP fZUVS_du F tcu.tR4$tEED$4$tE[^]èu?V$ED$ ED$T$F$q t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$a[^]fUWVSpEċUOD$D$}Љ|$ D$D$]č4$bZEЉ$YMrD$D$|$ D$ED$4$ZU1}9U1EEމU]̀{u9S4u'ft"Uf9r!ŰR UMщM9rƋUE]؃{UEU$]mLEUuUE0U]Ӊ]t$D$Ɖ$] űUfEU{u4C<<u$Eftf9C/!C %E9rU$]-Tu̍F}9FE81p[^_]ËUBtnr uv ]ȍUȋU]TUMщM9bCu=fE9T1MщM9*vC fEȍM114D rCEEMύEtfEt}DE}}E<vtft}d}Ds!E󥍀EEEEE9MEE$]qR\E$]XRC]̃ ]1ɉE]txà uыE]E1ɉEfuuà tu؃ыűEFEFFCFC E1ɋ}ƉtRƃ uE1ɋEt\Etwupű}~utftEEEu u}̍G E9Yt#tfE뽸ű}~ utftűN yu }̋uwEEű}~utftEEuȋEuMщM9Eƃ E̋up1MrEtfEt}}EXÍtD$ D$D$]$2]EErEu<u"M%$]>O&fmHMUVSvx{ut4$N[^]ÍtD$ D$D$/$'24$N[^]fUSxED$E $ܣ[]UWVS,w}} 'v?NBCDt=71,[^_]ÁB u$<EƋEEFOM؉NGE܉F G EF$G$xF(F,}EE=V-~U V O(N1utE)NE܃UȉF99U9} 9U܅TEE = =w=wUUE=?B 11 +EUEUEUD$T$ $ED$=F4OF:ON;Jz54$L0}vPEF(V,}{EF-~E F O(NEEE뮋EAE܃= =w=wU܉UE=? @11 +EUE܉UEUD$T$ $E܉D$F0F8GF9UF0F81F4F:1tx11 +EUE܉UEUD$T$ $E܉D$TF0dx11 +EUEUEUD$T$ $ED$F4[F81F:1UWVSsöD$E$ƍxD$4$ }и9ED$D$t$D$ D$|$$t4$IttKD$D$ E D$|$$ƅt/Ĝ[^_]É4$:21Ĝ[^_]É|$t$肞뽉4$1UE@ ]UWVSvrEEU ;P snH,X<3t;t-?39r09Pr+HE)E1[^_]?SӋ?̋]x1Ӌ]c1UWVS$quF$ED$ F(D$ED$E $X}f4N:^;)ЉMMЉ]MF$)lj}]f4)MMF$)É]Ef4E)MMF$U)‰UF-NσthtT?<߉f0ED$ ED$)N8N9^ )߉|$4$D$[^_]Yf.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴,1EE<2w]EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVSEgJljE 3E`M!t8$ 5D$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,hhLDžD$ D$D$$]j uit_atP%xrt& r; ut$uD$$u f})D$|$D$ D$D$$ g:t$$%t$$ Ht$88f$$BD$tD$$t$A;E+Č[^_]}v'.& p;8u}vI .t& P;8udt$T$ D$uD$$n#8<$p:=!$1uD$ D$D$t$B|$̐D$ D$D$ $uz|$uD$ D$D$ 4$Iz|$̐D$ D$D$  $z|$uD$ D$D$ <$y95 D$̐D$ D$D$4$y}艽EЉT$UT$ D$0D$$[0^uP'9D$TuD$$)U frffXftD$D$$1NuD7D$D$$t9|҉ƋD$ D$D$$1D8 DAu.L$$*9|ȋD$ D$D$Q,$saD$$ 5 D$ D$D$=u $fuAD$ D$D$Fu$ D$ D$D$ $v1NuD7D$D$$9|҉ƋD$ D$D$$1P'D8DBu.L$$<9|b$D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,1`ẺEEfEEEfEEEfEEEfEEE`t3 u'^" Uo}uLUt& x;uED$|$ 'D$\D$E$E`t eED$$;E`AED$ D$D$u$>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^;D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,7^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,g]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\aD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,/\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[=E`Lek‹wt& puED$ t$uD$E$k‹w p8uED$ t$ut$E$jWc& PJ8uED$ T$t$E$ajWuf Wz?uED$ T$t$E$!E`t tED$$ ED$$1ɋuEzED$$ E]ED$$@E@ED$$E#Ef Ef Ef EĈ[^_]Í T$̐D$ D$D$<$=n D$̐D$ D$D$$UnU D$̐D$ D$D$4$m D$̐D$ D$D$$UmUP D$̐D$ D$D$4$]m<$+4D$uD$E$.Ĉ[^_]ËED$ D$D$u$ED$ D$D$u$rED$ D$D$u$HuED$ D$D$u$ED$ D$D$u$QED$ D$D$u$ED$ D$D$u$-ED$ D$D$u$vED$$ jIUWVS$TàuE }Ǡ3U1D$L$ t$U‰T$$}xVD$t# $U+u#$[^_]$.1UED$ D$E D$E$]UWVSSõ}ED$|$ ED$ED$E $x8Ɖ<$FuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$,S1EƠ3E1D$|$ D$E D$E$&…tD$<$HE+u Ё$[^_]跄UWVSRÞ}u Gu 4 Gt*D$4$?uUt E[^_]ËEtE[^_]UWVS(R-uSd~M u7&.& ~t9uUt E[^_]Í L$̐D$ D$D$<$hEtËE[^_]UWVSQÈu} cVu5f.& Vt!9>uMt Ev[^_]Í|$̐D$ D$D$4$hEtËE[^_]UVSPu cI t& Bt ;2u[^]Ét$̐D$ D$D$ $gv u[^]Ét$uD$ D$D$ 4$Ng[^]UWVS&P+U} tfLUBb~U f ~t;u[^_]Í T$̐D$ D$D$<$f[^_]Í UVSOáua'&.& Bt ;2u[^]Ét$̐D$ D$D$ $?fv u[^]Ét$uD$ D$D$ 4$e[^]UWVSN}auwX w t& @Bvw- wi ueAv@w, u8Vv\u(&vLupv<uQv,1|${vD$ D$(D$4$d[^_]ÍjKv捳vލ v֍u΍uƍu뾍ŏ붍ص뮍\v릍-v랍cv떍v뎍7vUVSMuE_D$(YD$4$_x#_Y[^]_t$ rT$D$(Y$ݹUWVSLë}^}uLv.& rt;:u[^_]Í |$̐D$ D$D$4$Lc[^_]UWVSL#L(Ơ3E1E <tmD$vD$ D$.D$M‰ $MbMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$Mv}UWVS4XK]EEEE$E܍U}}؉HEU;EEU t 14[^_]ÃuuU<-1E<+u JMBP'DK+r1&.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF RGEuuESt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVSAG>EU UHMHMHMXˁHɁ@ ='-E썇UE)ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)MEC$xEE-$xEE$lxEÅU܋MXE^}d\$DD$@ED$<]\$8T$4]\$0]\$,]ĉ\$(t$$L$ ut$ut$uԉt$uЉt$ủt$ uȉt$D$u4${%E$jEt $YEt $HEČ[^_]ú)‰U썇EESEW-L uVE; er@ror:@ unk@ nown@ LOC@ RR @vers@ionEČ[^_]ÍXEX}\$DD$@XD$*t<.tȅx%[^_]Åt<.1[^_]ÉMvT$ HT$D$$E[^_]UWVS0BùTE荰EEEE$距PlPHH8|$ x|$x|$@ D$L$T$ vD$D$4$g~ Eƀ0[^_]UWVSBu' Gt-D$4$轥u?E tE [^_]Ë?D$uD$4$aukVP'DPtMD$ ED$4$讍ҋMyE8m1Ɂ]1VUWVS)A.u I Gt-D$4$ͤu?E tE [^_]Ë?D$[}D$4$qukVP'DPtMD$ ED$4$辌ҋMyE8m1Ɂ]1VUWVS9@>u D$4$ZFFy ;F|/} t)P}D$4$N[^_]Ét$E$3US?ǶEM QQy ;Q|< tZ[]ÉL$$[]UWVSp?uEu E$*EEEEED$4$pF0u ǀED$4$D$4$a[^_]UWVS>PP@3uV@ttuF*V@uuOFuuFuFf~@t8D$4$`lj4$kP[^_]ÉFu뺋F몉4$^fF@UVS'>,@3Fu t$'XD$ D$ED$4$'[^]UVS=ش@3Fu tE D$ D$ED$4$[^]UVS=Ê@3Fu ztED$ E D$ED$4$[^]UVS,8==@3Fu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$vP,[^]ÉED$4${EUVS<î@3Fu t2ED$ED$ED$ E D$ED$4$C[^]ÉED$4$EU7<@@3U]U<"@3U]US;ED$@3$ []UVS;Ҳ@3Fu t$ED$ED$ E D$ED$4$g$[^]USz;@3$[[]UVSS;X@3Fu Ht2ED$ED$ED$ E D$ED$4$pI[^]ÉED$4$EUVS :@3Fu t9ED$ED$ED$ED$ E D$ED$4$dE [^]ÉED$4$8EUSg:lED$ED$ E D$ED$@3$AQ[]UVS$:)@3Fu t4$Y[^]D$$US9ְD$ ̑ D$ED$@3$0F[]fffffffffffffffffffffffUWVS a9fE8tj׉ƅt|$4$Ot@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS8ӯ}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$E}T$ D$D$$'EE룤u9sftuu_SfӋ]QKUWVS07ƮE׉΋UU܋U؋U$]EM9L9My }E荃EEuuE9D$E$论t4$ME*t4$MuuE$E4E؉Eu܉00[^_]ËuE$Etu)y9uΉET$ T$D$$BE0[^_]1UWVS$.63]Uϋu M MUL$T$ L$U‰T$$"EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂}D$ D$D$$'Eډ)؋ux$[^_]ÿ뛉댋]썃$}D$ D$D$$~뷋]EE}8UWVS(U4Z]}u ӍR9M)ÃM'E썁}EЉU u2D$ED$ D$D$E$EJBs1([^_]É4$EG8t+([^_]ËUU]UE([^_]UWVS+93>E}E(M,u M0p3tU1҉u$t|$$I:ƀ?YE4$k~}DžU4T$|$E$-Eƅ9s9D$}D$ D$D$$'7)U4E$NjE$|$D$D$ D$dD$$HNj $‹>|$ $}wyEt}wvM򋽤(t#t<.z<7|0.}u$P}U$UD$T$t$O~D$ D$dD$4$nG‹$i9Nu}xP'|f @)~ DžƋD$D$<$9u׋)lj4$}O<$xJ|$4$1ɺ0f; @|01x DNu.9uՋʋ)‹4$9gƋp)p93~D$ D$D$E$ }+R"}$4$VD$(~t$ D$dD$<$D‹$$D$t$ D$dD$$nD‹ $eGD$t$ D$dD$4$D‹$9z!~9[D$|$ D$dD$$C$utE+-Ĥ+[^_]ÍE4$955tD$$1ɺ~l8E4$3+D$D$$U &Ƌp)93~D$ D$D$%$ }$ 4$VD$(~D$ D$dD$4$A‹<$4|$D$ $Dž- Ɖ$H8H}u ;}$$|u$)@},D$(~t$ D$dD$$@‹ $ GGD$t$ D$dD$$R@‹ $IG$D$t$ D$dD$4$?‹$_wGo"!~D$|$ D$dD$$? $9u}3$H8;x nG GGDž====Dž$`lj9L w\&79&&Gt1Gta$D$D$ D$dD$$~=‹ $uuO}$<$fOwG$$T$t$L$D$}D$ D$dD$$<‹ $$9 E$p@}}$4$V~NL$T$D$}D$ D$dD$4$;‹$TD$ *@D$E$pt$<$C-Dž##?#H81>)0~0 $a09"$‹ $#u|$D$ $U R<$H80|$T$ $ H89$sƉ9$)u}$@<}$D$(~t$ D$dD$$9‹ $GGD$t$ D$dD$$K9‹ $BGD$t$ D$dD$4$8‹$bGG<o"q"}4|$ t$D$$軳4$C9s?D$}D$ D$D$$'։)׉}49)= $~S@u$D$~D$ D$dD$<$y7‹$t6c'92@Dž@DžDDžHDžL@)‰t19rE4D$ |$L$$賱<$;9s3D$}D$ D$D$$')U494$H8Pt$|$,ED$D$ D$dD$4$5‹$@t$$4$븃}$u$f}$v}4|$ t$D$$.4$9s?D$}D$ D$D$$'։)׉}4FD$}D$ D$dD$<$n4‹$iF9|Dž1~p}ƀu2$BDž |$D$ D$dD$$3‹ $|OP9w|$D$ $U v<$H8T|$T$$U Y%<$})‰Ѓƍ@}@t$D$E$$+4$D$D$$U r)j1L K:f.&.&.&.&.&.&.&9t؉4$QD$D$ D$dD$$$1‹ $u}$4$F$$D$t$|$}D$ D$2D$@4$x0}$<$.G$ D$t$}D$ D$2D$@4$ 0‹$q4$Mlj4$H8$zlj$H$0lj<$]|$D$$U ^8%<$cG$UOWT$D$t$}D$ D$(D$4$8.‹$3E$p VUUU)ȃ= $~[Ht$|$$U C4$H8z4$2~$bD$wD$ D$dD$$ -‹ $o<$~$D$T$ D$dD$$,‹ $<$IfF $7 4$)D$|$D$}D$ D$dD$4$,t$|$$U a4$H8CF$~t 4$o4$dD$̐D$4$4$*9E4s3D$}D$ D$D$$'>D$D$$U v9pL F9Gt1Gta$bD$D$ D$dD$$5*‹ $,uOE$ VUUU)ȃ=F$~>+}$e}4|$ t$D$$裤4$+9s?D$}D$ D$D$$'$}~F$B= g$~}$+4$%VD$(~D$ D$dD$4$(‹<$}$ )ƍ@}G GGG GG GGƅ=t9yG GGG Gƅ=fDž==fDž==Dž====W GGW GW GGW G$g<|$&~D$ D$dD$<$$‹$eD!~9D$|$ D$dD$$w$ $kuD$ @D$t$$Dž  H81F)0~0 $K09 <$m‹$uD$ @D$E$D$$ H81F)0~0 $09Y <$襺‹$uJ}$(~4$lj$}|$ D$ D$dD$<$5"Nj$‹*T$ $1ɺyk$ }C4$Nj$u4t$D$<$9Dž9s3D$}D$ D$D$$')u4t$$1ɺm_4$ }=$Nj 4$u4t$D$<$3Dž9s3D$}D$ D$D$$')u4t$$1ɺgY4$}7$Nj4$u4t$D$<$-Dž9s3D$}D$ D$D$$')u4t$$1ɺaS4$ }/$|4$u4t$|$$+9s3D$}D$ D$D$$'lj)Ɖu44$}Mt$$1ɺ7)4$ }}4|$ t$D$$$H)$,~qT$ @t$L$$X…$ЉPzD$D$$U 9ȋ$r} s}$ f<tu$`}!<$r $D$w|$ D$dD$$x‹ $o4$-r$WD$|$ D$dD$<$‹$ t4$D$(~D$ D$dD$<$‹4$t$D$$U )D$ *@T$t$$ H81F)0~0 $D09<$f‹$u $x<}Y}4|$ t$D$$Z4$9s?D$}D$ D$D$$'։)׉}4<$@}~($}eD$}D$ D$dD$4$$ w$O<};|79})$v<}$C<}D$ @D$L$$ƅ[oH81>)0~0 $097$>‹ $uu@}$955<u덍D$D$$U R$}'0$|<}UWVS80-uE  U8u95E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$P8[^_]UtM8E#lp]UWVS]btu}'|EtG9E r'Gf|t+E D$<$պyz([^_]9} r+Ey;}uE\~T$ T$D$l4$讶E뵋E9E r1UWVSsEE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]>(UWVSrEu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]07F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,b8M] ](UWVS pEu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cN]]ٶ(ffffffffUWVS =FnE}]} 1E䍘L;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃0u F|$;zMUWVS).f}u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉE~T$ T$D$g|$Ee UWVdu o^_]ø1d fffUWVS\ædϋMMƠ3uM1t$D$D$ D$2D$M $MaƃM9r,ML$$A7M)11}U+u\[^_]øUWVS dEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: E E+Ju}: w) ]u$M EÉ$SrKE}~=Ut3}P'L'w\DAtu܋E Ƌ})x [^_]9u]䍃D$ D$D$e$聥 [^_]ÍM U$WEM E$DtiEEM E$HEbt?EM EÉ$MM7tEMffUWVSöau4$qH9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} 1(yUWVSã`E Ơ3E1D$|$E$tGD$T$${tT$<$LU+u [^_] fffffffUVS_EuUMx#L$ T$t$$Ux9s[^]ÉL$T$$[^]fffffffUWVS qv_utcEt\E $)ljD$4$*u?|$4$Q&u%džt$|$E$# [^_]É4$%flUWVS ^utcEt\E $(ljD$4$)*u?|$4$%u%džt$|$E$" [^_]É4$O%ܦUWVS OT^u t\E$'ljD$4$)u?|$4$6%u%džt$|$E$! [^_]É4$$SUVS ]uD$4$o!tD$E D$4$5 [^]D$E D$4$ [^]UWVS_d]u} tAv-u3D$4$'tD$4$3(F1[^_]{US\EU tttu P1[]6UWVSî\}u t' td@t/tZv{Nw u6ߤ(D$<$&tD$<$R'71[^_]D$<$&tD$<$"'΅uʍ&UWVS[u} tPD$4$a&t͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈\$8؉ȃD$xtD$xj݄$D$| tru|$T݄$L$PtT$0D$4)‹D$|Y#Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|b:ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|G$$Kt$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـ4\$8ـRD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|Z#S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|LD$`U|$p|$$LM1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$| D$4$-$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|JD$`Z|$p|$$2L$%|$x==p$$\$|CD$h$xCD$p$lCD$H$`CD$`$TC$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaU|<@'U E]XUMU E]Fffff̀ffff̀rS[4<@[̀rS[<@[̀rS[;@[̀rS[;@[UWVSö;u Et"4$dsEExu4EE[^_]ËED$t$<$ottGt8Eu׍GEE[^_]ffffUWVS!&;u} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]ÍD$ X D$D$e$|D$ X D$D$f$|UWVSRW:u} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í4D$ t D$D$C${TD$ t D$D$D$~{xD$ t D$D$E$T{1sUS9ET$ D$PT$$P=[]US8E$uE []1[]UWVS$Û8EpEEEEEE1ҹEEuxw88 w38 E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`USQV7EU} ~\wEBu - t wJt Bx1[]ùr u-JuB-bP UU1Ʉtt'4$mD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US;@5Ut/9E t*#D$ D$D$p$$wE []US޽4M E%t.9t*#D$ D$D$p$v[]UEtt]1} ]ËE ]USAF4E ~>uTEtK#D$ D$D$p$ v~Ewǀ[]ËEǀ[]US踼ý3EU tt 1[]|UWVSw|3$ 苊Etc@@{D$D$4${u E[^_]~{84$臒o{81EUWVS2uthF~O9tHNM 1[^_]ÉU{ED$|$E$LUzu=FUF맍AD$ D$D$Z$>ui|UWVS*/2}t;t-M tWt1$聑;wr$o<$g[^_]UWVS̺1}tJWt7E1U9}t#E4E D$4$`ku߉[^_]1[^_]ÍAD$ D$D$$BtUWVS;@1E@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$( D$D$0T$4D$T$ $D$E D$ T$t$8L$$}t$80 1fkPLUWVS 383fD$'D$'<$EtE D$ED$<$D$$  [^_]UWVS轧u D$4$=FFy ;F|/} t)P}D$4$=[^_]Ét$E$UVSEJutDD$4$b=D$D$4$Hff D$4$^=[^]ÍtD$  D$D$6$`US輦ED$ E D$D$E$$>[]ffffffffffffffffUWSbgDžt)tYBfBfB B [_]ÉUjD$ D$D$M$_UuUjD$ D$D$N$_UrUWVS趥ûlj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]ÍLD$ D$D$`$^UWD$ D$D$a$^E+cD$ D$D$b$^UWVS\聤~ÉEEE Ơ3E1fjDž9E]qA D$.$U'zP'8tGt3\_u<.uuy.u}fD$:$&tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $P@)9x‰ ȉ@ M`/1U+\[^_]À:>E4$OL$D$t$D$cD$ sD$LD$$蕏A,Dž9E_pjD$ D$D$B$>ZD$ D$D$$褬TIf ugx.fcD$:$5#?fnbUWVSlAFZ‹BcB $(lDžmDžDž D$$mDžtUpЉD$D$$<+Gt< tu򋽜$H@)49O)9y )ЉA V1ҍ;tftH<@ lj)9t?9rr ΃rj놉D004$K@9U$,s@ \Džl[^_]à f.&< t< t򉍼>D$4$* P8 t$$L19<)׃ D$$nT848#Iu‹tft‰)‰DžNtftR :)9&44$TI@9‹f&B0tP< t[< tW< <9s>z2D$4$ tpu׋)ʉ׃ (D$ $l8f cFt$$J'9Dž1Ct$$Iz90CsD$ < D$D$^$RwP$nf0x0k$^nGtxf\>0N7L1UWVS`@EE‰EuǠ3E1FE D$ .u‰t$L$E$')}~EE4$EML$ML$D$ t$ED$ $/‹Et]$mE@ U+`[^_]ÉM $xM<ʍqE`MUƋE$lu눍1hD$ H D$D$$OUWVS(ƕ uE>FE苳 }tgsUE<$ODML$ML$D$ |$UT$4$‹Et)$kE@ ([^_]Ís뗋MUƋE$kt([^_]Í $t: E1hD$ , D$D$ $NqUWVSh藔Ü ։} }}U 3E1} o-$(.b 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$e<))9yrtft1'$ae1U+ h[^_]z 7t$$,*D$t$ D$D$$BK@ 9N04$<=3׉T9E>f t$$#9P }u,04$;tp9J90Љtftפ9P'$1;NjE$$;$[<|$t$D$ D$ D$$%qj6<$:=9sD$ l D$D$$iE.sD$ l D$D$$1ED$D$ D$D$$&Hg@ 399x04$]9=1Ɖ$=9P)9| At$ D$ D$$%hr<$8p)9L$L$<$X8f&($ЅwDž$_H1Ht$ D$D$ D$D$$EDž8@ ?9$Q7x9D$D$4$W>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $YUlj$ FfDž 1DžD$D$4$T0։9^f 19s<04$CJ=)σ (D$ $EXljUWVS$u}6EGBEB $RE+lDDžD$ED$ED$ D$ED$<$貒…F D$FD$FD$ D$|$E$MElEE$Z<$,DEt $[^_]ËF t:$[^_]øEE$3Z<$C$[^_]Í1hD$ x D$D$$f=E$YF 뮸xUWVS@5>Mu3‹E1kFB FBPƋ}ۉ\$D$ D$)D$<$~HNj9s4$3V@ 1hD$ X D$D$$a9`4$U$w?@ -$J?@ t҃$?2fJz 轰UWVS~ä{>ƋEtvF u>ED$ ED$ED$E $Elj4$w>[^_]ËED$ ED$ED$E $EDžt뼍pjD$ D$D$$7[E1UWVS}=t@ËED$ ED$ED$E$ًU EƉ$=[^_]ËE1[^_]UWVS0O}TE}u  t</10[^_]Ã} uyMMUUUUu|$M L$D$D$D$ sD$ D$E$skuE0[^_]Ã} t;a8t{bPWPtD@ 7 E #cT$ T$D$$5Ex{UWVSX{}E EЋEEEE3E‹E1$(I1E؍EEȉMԉ}܉<$QD$D$ D$D$E܉$qDž E؉D$<$ƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$:Pu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$j(@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$'@9Er7‹}ԃrsSt}MԉM܋E$'OE܉$O8E1uU+X[^_]ÃỦϋU)׃E (D$$Kt 8E܋UEȉD$|$$7P@ EĉỦ $8ŰEMEЋPEEE$2NE܉$'NEaf{E̋EM8Mԉ $MEEu6ufiK1E܉EШUSvùS7D$D$@̛ D$ D$ ED$E D$E$[]US^vc6D$D$ @̛ D$ D$E${[]UWVSv65tDÉt$ D$@̛ D$ $ًU EDƉ$5[^_]1[^_]UVSuÞ tpǃ ǃ ǃ ǃ ǃ 5D$D$ @̛ D$ D$ $?Ɖ[^]Í $C t5ΐUWVS0tƅAqP'8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]Nȃ+Mt2UW0/u܋U+H[^_]Ë}܋E+ʉH[^_]E9L1뽉|$ $M\tM:fM؀9t‹}ȍGU9rUffMEE1W~:uFE؃:MЍjẺD$ \ D$ED$I$U"*MЅɋU؋EM؋ẺD$ D D$D$$)M&tHD M؋EЉD$ |$D$$)MEąE؉EEȉEmMԍjD$ D |$D$$U])U؋M댋}ȍEEfuM.]EȍxEE9IMԋUȉ1M*1ffffffffffffUWVS8n։Ǡ3M1ɅUHL$HL$HL$D$ D$D$M $MU9ЋMs%T$L$4$/=U+8[^_]-1މU؉E܍jL$ t L$D$i $(U؋EEU؉E܍jL$ t L$D$h $'U؋EϟUWVSmEu} tM|]x3EËE1t;l],/1}U+Đ[^_]ËE ]jED$ |$D$I$U&UutEh ED$ t$D$$]&U1 Dr틽tE.&ك Tu111M<<t9t0u}t E9|uӃ}E:Eþ}} ]9p}9P}9:EtE׉]U)MD$ ED$T$U<$]]U97}Mfx]9o:뗋]E+mx|tĐ[^_]]jD$ E |$D$H$U$|ҋUbtED$ ]h D$D$$G$,t;E@ fu+-dt2fufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$=E@0E@}Gfg D$<$?1İ[^_]Q}Wf9xD$$‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09FFUWVS4T9u} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍DD$ D$D$e|$ y7rD$ D$D$d|$b FUWVSXS]u} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍RD$ D$D$|$ y7rD$ D$D$|$ FUWVS|RÁu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍PD$ D$D$|$ y7rD$ D$D$|$ FUWVSQå}u t/tYEED$<$Ot E[^_]Í7rD$ | D$D$|$. uiD$ | D$D$|$ xUWVSP}u t/tYEED$<$t E[^_]Í7rD$ p D$D$|$ uiD$ p D$D$|$V xUWVSLPQu} tdt-tGuP1EFUT$4$P[^_]ËFUT$4$t1U[^_]1ȍcD$ d D$D$|$ m7rD$ d D$D$|$n :UWVSdOiu} tVt&t9uBEFUT$4$P[^_]ËFUT$4$tE[^_]1ύcD$ X D$D$ |${7rD$ X D$D$|$HUWVSNÏuE }t )щʋUt7uzN|$D$4$Q tuUtQFUU u@ 1N|$D$4$QUt?tFU U u@[^_][^_]1[^_]1[^_]ÉE7rT$ L T$D$*|${E EiT$ L T$D$0|$FEUWVS9M>u}U >E E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$7#E 1[^_]ÃuEt$#E ԅtEuT$U$EM U_nD$ @ D$D$`|$ 7rD$ @ D$D$^|$U bD$ @ D$D$_|$@ D$or$$UWVSKÇ}u t'tQD$ t$t$<$ [^_]Í7rD$ 4 D$D$|$uD$ 4 D$D$|$UWVSJ}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃D$ ( D$D$|$UpU썃|D$ ( D$D$|$UE1U썃D$ ( D$D$|$UU썃7rD$ ( D$D$|$sUUWVSfIkuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$_E 1[^_]Åt<$E냉<$3E ωЃttkE녍bD$  D$D$|$S7rD$  D$D$|$$UD$$=NjE 8Ut Eo D$or$ UWVSGվu} t tJD$(#|$4$4[^_]Í7rD$ D$D$?|$mubD$ D$D$@|$?UWVS8G=u} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍD$ D$D$X|$ZB7rD$ D$D$W|$+ UWVS!F&u} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍD$ D$D$||$CB7rD$ D$D${|$ UWVS Eu} tt@} u[^_]7rD$ D$D$|$uD$ D$D$|$UWVS|DÁu} tt@} u[^_]'7rD$ D$D$|$#uD$ D$D$|$UWVSCu} tt@} u[^_]7rD$ D$D$|$uD$ D$D$|$gUWVS`Ceu} tt@} u[^_] 7rD$ D$D$|$uD$ D$D$|$ffffffffUVSBǹuED$t$ ED$E D$E$E~>.t[^][^]USoBtED$ED$ ED$E D$E$[]UWVS.B3}E D$E$St u)x[^_]9u􍃰D$ D$D$$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]US?E D$E$[]US?E D$E$[]US?ÕE$r[]USm?rE$@[]M?V@3UֵEE EEE0PE }썿L}Uuu9E }9sux.tb@tx U9sS@}AnVUBc} 980]n($[^_]uuG뒍V>[U|$M $*U:M)ȍ<FtOD$ $t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\]( [^_]ø!!"UWVS(&4/EEEE܋E9ErME 9EsEEH0}}]EEƒ@dt(].(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]D$ 4D$D$$EKuV]ڋ]9 }9;] }|>}uE~΃s/uuUED$D$<$tE+uЁ$[^_]ú]UWVS$+ƓE MUà3E1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]É]US]E M9r 9s9su[][]UWVS*EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS)uE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É()[^_]UWVSh)qEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]3[^_]Ë](1[^_]UWVS (Æu}E9E |2&6D$D$$umtF;Gt1 [^_]ø [^_]UWVS(U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]É(?UWVSo'lEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]Éz(F[^_]øUS&E D$E$( []UVS&ÿuD$D$$NtD$T$ tV[^]øffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS( &}EU܉΅lt F"}uFEUT$$]uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVSǓ}D$<$|$ ED$E D$E$ND$<$ݲ[^_]USditD$ $[]UVS38$2u [^]ÍlD$ $ $蘅ƅu$ƅtD$ $LFFF US ÞU T$UT$$ []UWVSbgbD$'D$'<$DE t8ED$E D$<$?|$ D$D$#$$裟E$D$ D$$ތ[^_]ffffUSøE D$E$h~[]USÊE D$E$:~[]UWVSUZE։ϋUt%T$ML$$w[^_]ÉD$4$DƅtU1UWVSu} GD$F$uD$$}[^_]UWVSḁ̃l$NxD$4$-EE9  E h$сD$4$蝋¬3d$ ( Džt`t\Os1Wp΋ t $ApP9uዽp$#Gt$tt ;( r`t4$ǃ( ǃ$  t\1tt:$Ft)NtF D$F$ыF90t$; rtt$Xǃ ǃ yWd$苤( uAEU  h$l$<~Ĥ[^_]ËWjnT$ D$ D$$ $袒UWVS,(-Ơ3U1DžDžDžDžDž$It3D$D$ D$D$<$较=~h$   D$<T$@D$dFE)ED$ ED$ED$<$yƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F1Xe]؉E܋؉0 }<$}؍L0 1ƅ~ F(EUjUWVSS\$pƉ׉L$x<fPHЅu1e[^_].&t>u)Ӄst$tց|$twō$2D$ltCD$hL$xA!TT$dDD$`L$xdP1҉\$\t$Xpt$x RpdPhPt$xlP 9ɋ\$\t$XDI`PHL$X@D$TfGD$l<IPHЅu.&>u)щL$\T$l6u*t -~0 w)KL$tD$dD$`GG$؉dFLJhFLJlFLJpFD$hG dNډD$xat |$xf|$xt|$xD$XD$TD$dD$`D$XD$TD$l*t -~0 wT$l)щL$\L$\L$0Z$-$D$p$L$(d8, $L$>8G$D$؉dFLJhF$D$؉lFCpFƇqFfLJrFD$xD$|D$p\$PӃ؃D$HukQ9(D$xT$|{D$@T$DT$@D$D9T$dT$`[T$@T$xD$|؃D$HtD$xT$|D$HT$LT$HD$L9T$dT$`T$HT$xD$|4*D$x|$x|$xx,t@;t;$`,;C.t&$$i)\= ף)D$HD$xT$|D$@T$DT$@D$D9T$dT$`\$\$PL$@L$xD$|1҉T$HD$pD$PL$\$8t$4|$,ri)\P(\wf= ףt$P)D$xT$|p:σ|$@p/|$d9֋|$`}D$x\$|L$@t3빉L$\$8t$4|$,`D$,L$,9L$hD$D$PL$pL$\$4$Ɖ|$pi)\P(\= ף\$)D$4\$@9)؋L$49ȉ؋\$PT$HЙD$xT$|D$8T$<D$ T$8T$ T$CD$PD$HșD$xT$|D$ D$8T$CD$Pș\$X9ىЋ\$T}D$,D$H\$4ؙD$xT$|D$xT$|D$HD$,9L$T$( D$@L$T$D$43IL$@dD$41H|$xf|$xdNeN|$xT$t\$4$|$pD$PGlFpFdFhFGD$\L$hDG dN\$xƒs`D$xtfD$xtפ T\$\؉׋t$lstftD$\uluSҨu|udL$x눋\$4$|$pD$PGȋL$)=AfG6fAyD$0f l$xdNeN|$t|$xe\$\$PL$HL$xD$|D$H.\$\$PD$H\$\$P \$\$PL$@L$xD$|\$\$PD$H{D$,D$,L1G-UWVSH|$8ljD$T$\L$XE \$\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}7)à u\$hT$P׋T$h)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 L$@\$<;ؙ\$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9T$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 2D$pT$t9D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`PD$D$e|Xu$hF1dN-00tDXFt>8t$|$lG$D$\t$lD$dk XPD$T1$D$H\$hD$X$(D$TT$dT$t ;H Pl$ty1pYD$tT$pFP~L\$t9\\$p}3=H\$t\\$p\\$H ;N>VD$\9W\$hD$lP~7|$ldF$ Ttft|$lGD$l@C1T|$49|$Ht*|$,9|$Ht|$lw|$Hx|$0x >|$p|$X40>D$@D$h$t$|$tȃ|$d)w|$Tf.&.&.&%1 ڃ9t$tuމ|$Ty\$pC\$hsK\$l\\$T\$l\\$D9D$Tt$hL$h\$lDT\$d߃D$pD$p\$t9D$@&t$D$l>71t$t":t|$lt$t7>~|$t9tpyt$H9|1D$hu ؃ux\$T9؉ӋL$DG\$p*t$t|$lw|$ldFT$|$HT$tt|$@9~{9#|$D_GD$tt$t |$D|$l;7D$@L$h\$Tt$pȃ ؃uytT$@9t\$`D$4$BcD$ D$4$`bu!~N//\$`r3/Rd$dD$|D$#D$$D$(|$pD$lt$t0Pft$4D$(t$lƄjF9ut$lkFkF\$,u59uv.&.&9vit$H$L$(t$ljF9G<v|$h׉É|$t΃sstft|$tt$HD$x D$p‹|$d9\$0t$D$t\$`dN$u0uqT$3f X1D$t*T$tRlP u6u\$hD$l@Rf$ $ 11҉T$pfE|$ldNeND$0UWVSLQ&]ƉMӀ:M‰9Džt;:tgEua1ɉ2tRN 1MU |9}D$>dN$]I=uҿT[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]M1eDžuAM荆dNdNt_9t:*~+uـZ @ҍt&Ƀav뿅f1uUVS̭$L0 $u[^]1ɉ[^]苭$$2USpu$$2t$[]øUS7<$}u[]Í$[]UWVS$EuM V~FhFhF1.&.&P9u dN9ut [^_]Ë]l1[^_]UWVS苬Lj#UM Z~>dFdF&.&P9u09ut[^_]Ék[^_]UVS #}u 1[^]Í4$4${[^]UWVS(̫"EEM EH/ mEE1u,(ǃ0 1}tME"}t,ǃ0 Gp7>Cu, U1)ЉH/ ([^_]ÍNRE؍L/ E܉΋E؉$NjE#D$<$ EEH/ ~|$E܉$[tm}tM썳4$4$MN([^_]ËWrHy}D$ D$<$HOGGD$]u } IXP v.&.& ;r B}y1ɉ)߉pe[^_]ÍIlP݋\$A_TUWVS貟÷$2$(H/ D$tU|$RXPL$u} *v.&.&.& ;p H}!yL$u} t1EU [^_]ËL$u} R|$lP)EU uύ$j1L$D$D$ D$$L$$H/ t7D$o D$]L$PUWVS=FD$}Ã@XP\$y{l$D$ t\YؙE Up݋1y$T$t$|$ |$9׋t$ |ދ\$}t$L$1t$ 1 tF$T$E UE Ue[^_]Ë\$]TE EE Ue[^_]Åt D[lPD$9T$L$ )ƒ$L$UWVS/4$2D$$ƅuyH/ tDt2UM T$L$$Ɖ׋D$$a[^_]Ëu} D$D$ D$$떾[0ffffUMU t"1&.&9t<u‰]ffffffUWVS!&}u tSL'.&.&t(TSNLKf9t)ȃ[^_]1[^_]ÍiD$ 0D$D$B$U끍iD$ 0D$D$A$WUNUSOT u#$ tЋE$>YUWVS e=t:F$V FtD$$j4$Fquƃ[^_]UWVS衚æ}ƃ $htCƉxtD$<$]jE FEF e1[^_]ÃUWVS+0uE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍ8`D$ <D$D$H$rS멍 D$ <D$D$F$FS38`D$ <D$D$H$SD$ <L$MD$G$ERUҋEM8`T$ L$D$H$RffffUWVS衘æƉUM, <$GEtC$fpupMH L L <$1[^_]Íl 1#.&.&#txu8u돍3D$ DD$D$$Q7<$uUVS裗èEU Mt [^]MUE@t$ \t$D$4$IQMUE[^]UWVS<5, E$H L 1l E0E}ML DL { uZMUCЋMUL 9u`H tgߋt}Ct9K ttFߋteC9K ut2L MUCS$ЋUML 9tVH uE9rRE9sKu}샮H E$H ut?$rlu[^_]ËE]1H tߋtCU11ҋE]ffffffUWVS莕Ó UE0}E,Ơ3E1M zhEED$E$D$h8$hǀPǀTǀX71DžD8H@L,D$ |$0D$8$"8U+d[^_]ÅE ((hEED$E$D$h8$hǀPǀTǀXE (pD$ lD$D$Q$MW(LD$ lD$D$P$nM((pD$ lD$D$Q$3M(RT'U UT$UT$ @'D$E D$E$>]Uʒ UT$UT$ @'D$E D$E$]UED$ED$ ED$E D$E$]UWVS\a D$'FX$w(F`F`y ;Fp|4} t.FXPVX}D$FX$f([^_]ÍFXD$E$HUSבE'Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US ÄE D$ED$'X${ []USHMED$ E D$ED$'X${[]UWVS M} }E EEEeD$E$&E@ E@U~5M19E}EtfEtME)‰UE$UE@몋U tE eMOTEfH @1[^_]ËUulj7wWU<$\UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $%E[^_]Í_D$ |D$D$Q,$(IltD$ |D$D$=,$HE)1u E MOuo ULD$ |D$D$,$pHE@UUD$E$$EU)1u .fBefm7MyHMUS ED$E D$E$w []US贍ùED$ ED$E D$E$x[]UWVSzEED$E $ƅxDžt}D$ED$E$yxY=?fGfw cG$dG,2fG(gG Eu/[^_]É$CLfG 1[^_]D$ D$D$<$)[^_]ÍbjD$ D$D$>l$\FUWVSRW}t6D$<$o"G ƃD$<$|"[^_]ÍtD$ D$D$;$EUS ׋E9ErD$E D$E$ []蠽ffffUWVS葋Öu F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9uD$ D$D$W$D+V9Vs4$u^4$qgtD$ D$D$<$ODI fffffffffffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS gl UM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$]F0`UWVSL). ljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$801ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$W1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$=NL$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$I!L$D$$9$IL$D$$9$IL$D$$9$IL$D$$9$IUUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$IHL$D$$98$I+L$D$$9$HL$D$$9$HL$D$$9$HL$D$$9$HL$D$$9$pHUWVSHq $M$} |$8}|$<]\$@3D$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$"HD$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$⋼$<$$ "SG f A$fx/D$<M$$DŽ$DŽ$D$$$$D$$8$O$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$ 󥋔$\$l{$ [L$8L$ D$T$$4$$";FD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$9@$4$ 9$RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pd$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$j$$|$D$$4$$H2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$3$$D$l@$3$"$T$p$$$*ÉD$d4T$p$$D t$8t$$DD$ $D$$D$$ 5<t$d$$h$$$ $$$x$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$̦$5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$̦$4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$yX$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$ 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$LPvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $pD$ lD$D$$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVS }ED$E D$EE$$4E܋̟\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$ܠD$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$$B@Ɖe[^_]ËED$E D$$@Ɖe[^_]ËED$E D$$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS,# }m|$D$%U <$Y!cm܋̟|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$$d=Ɖe[^_]ËED$E$D$$2=Ɖe[^_]ËED$E$D$$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`CH E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$Xg¿፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$$U:ue[^_]ø랸뗸1fffffUWVSp> C 96D==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$Pأ@܋ԟ܃ܟ݃T$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$`Y#\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$`Y#D$D$PD$ D$`|$Nj} t$@ ;؋H\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$$6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0كڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$`Y#D$X Z#.&t u)D$@L$$~YD$`D$؋T$HL$H؃D\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVS&+< u} G9F}uuFV|9s]B9EE)ׄtdD$D$$UhREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVS38; $}<$D$t$rD$dDŽ$ݜ$DŽ$E$E}É$-wʋ$牜$}D$p0E@D$0D$h/$D$xDŽ$15$DPЉ$K$C‰ǃ/ ˃9?~ыL$xDPЉD$xU tE u0e[^_]ÃL$t8et ED$PD$TL$hA$Et$LD$t1|$F$ߍN L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$D$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$Z#1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$*=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈T$@$L݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـD$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈D$@ؠTD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$بP\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$zXD$$4$$$?_D$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$Y#݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$Y#݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`LD$h$$$ $$D$x$$G)‹$Y#݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$Z#fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(]f E܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<]f E3Ex0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVS!& uEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS0 }u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS EM]E TsCD9sf9r)؃L9s&)D$D$ $]][^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVS)* 0)ˉf.&.&.&̅ u썊a)ˉ.&.&̅ u썊֎A)ˉ.&.&̅ u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVS UBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS 衅æ $2} w. U4tfMt@'$#0E $iSƅEFEFuFF [^_]øMEPUу ‰)U= w|'$yt'$`xUWVS胄È ut"F w"$2u& 4[^_]É4$Z[^_]'$UN? 4tU$[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8FK } EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $MnMUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVSgl u ̆ 'Eut?t|$E$EE$`EtsEu$2Eu?|$<$r‰EtUE$gUu'$Lu먋E[^_]D$D$E$ E1[^_]$2EuO$rDžt@q@̆ E'$'$̆ u딋En'$m1Xǃ̆ Eu1>UWVS$t}y u EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVSv utD$E $zDžD$D$4$hptt ʃ9t*xD$4$ t|E%=at`fx ttpu ffx fp@cP$dP,2fP(gP Ĕ[^_]K51Ĕ[^_]Í D$ D$D$ED$/514O1USmur E UD$T$ D$E$[]UWVS2u7 utFD$4$O nx$P8D$4$X [^_]É4$TڍtD$ D$D$=h$.UVStë ut&nxP[^]É4$[^]ÍtD$ D$D$Ih$@.ffffUWVS1t6 u$'- ffffffUWVSs uf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $IF0F0$HF0ǀǀD$4$FFF [^_]ÿF yF$Hi4$Lǐ8tD$ D$D$8$+81 fffff̀rS[ä @[UVSqÇ ut8F0u ǀ4$uAnP[^]ÍtD$ (D$D$;$ +뜸fffffUVSp ut#1V ҃ t[^]É4$[^]ÍtD$ 0D$D$;$*UWVSpÍ u!2FF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $\FF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$ke=<1ɋ8tBD$D$ N|$\$4$_ y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$W8t6D$D$ V\$D$4$?O8t6D$D$ NT$D$4$I_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS gÛ EU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVSg Ƌ4D$D$4$-EtE$C=Gu͋$"=tMtf~ 18t$<9⋎t $4$^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ $ ;F@tNO$4$=+%81[^_]Ë'NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$!p"X<-P,x ,H Q,X$PX!p[^_]Ë8f8F8FF F FFFF4' ~D1 󫍾$F~ 818t181D$4${dž0M8?8UWVS$Qý uF(x~(V0!UN9F9MUD$N $#MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$EEtlE܋UT$ML$E$袭ME)UЉL$D$$AM $ 'EUVU(_US]ED$U $ #C,9C(}#C0[]fUVS "P' EpFtD$D$$F u  [^]IUWVSOþ EPwhHtwSuNP L~8xpXpTPtYtQ1[^_]1DžLDžP!Xr!DžTHDD$$$ ƅtǀHXdž$$ljFHDt dž wzG#G8G G 0GJGKGE UtAtCf\ Ft$Z$t$4$?$ XxD$ ED$E D$E$XE EUuM, Pdždž QXTtt!ЋTDTT9QX1XA1L=f+fdžXD$ L$D$$T PD$D$$fxuu fxD$D$$E t @E@t E DžLxpX]r!pTPO AfXmxD$$s XD$`D$$` =b1уX`abcddefghhijkllmnoppqrsttuvw `b1d}h=f]t_LX Љ lp&D$$ 88D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$O,t$ T$T$$X +!XFTT$ PT$D$*4${TfUWVS$^Gc EpFtD$D$$FUED$E D$4$kDžEtuD$D$ED$D$ D$|$4$踜‹!@u FЃ$[^_]ÉUD$D$$LUЃ$[^_]D$D$$'Ѓ$[^_]fffffffffffffffUWVS!F& uE U VfFFVVfFFVV f F F V V fFFfFFfFF=6F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\Nt&.&"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍՂD$ \D$D$b\$F lUWVSCݺ uE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\Nf.&ɉHɉH@tH ɉH H ɉH "B9uȋF mՂD$ \D$D$b\$F ƒl'UWVS(AÛ EpFtD$D$$%FE  D$D$$kEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$f$u ([^_]1([^_]UWVSg@l }wFtD$D$$FD$<$tr$tcFt$t$wt$eE4$T<$LE$[^_]øUS ?â E9ErD$E D$E$* []fqUEtu]11ɍT9r]1]fffUVSE?: UE Xh1rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4Q>V EE@Et } 9x 1}EEEEE*EP}GA у@3=0fuftpfuE@E܃!‹EH}<}0}}Gu kUzu@G GGBPWxG8GBW}O ME9kOft DAfEtD$D$ E܉D$L$4$V1ۉ]E@Ex#} EHU ꋀEEƒUƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$ E0E@ D$$ MAt MM} y AUtiUJAUQ}Q D$ML$D$ M L$D$<$E4[^_]Ë}GMWW:D$UT$D$ M L$D$E$蚰!E ]}؉0fuft tpfuu^/Ex }OE@D$ D$D$$D$щT$ |$D$E$耳lE@E܉dU܍D$ D$D$$U/B $fUSEP M TH}[]UWVS196 uE9G Ut OuhM Gt"V T$D$$vG$?GB<$-9}thG tkMtOtD$L$ D$GD$4$n"?9}tG tUE?9}u1[^_]1G!,USUE @@ @HKYXBP[]fffUWVS 7Ʈ }ED$E @D$E$t7ƅt|$$t [^_]84$薘8UWVSDF7K uE 3‹E1k*t$D$ D$D$<$ =5DžDžDžDžD$D$$ܕ<$*ƃtI<$)D$D$4$$tntD$4$tSD$D$$fE+uqD[^_]Í$^L8D$D$$ 4$8?gUWVS,5É ]ƉUM܋ED$T$4$YNjE  &ЉUUD$L$$]̷EGfEf}UBM (9tD$T$$]肷UBD$D$$]cXMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉MEՂ\$ \$D$b\$E؋M7UE:98uDE܉ufp뛋PUD$D$$];UuT,[^_]ÉUD$D$$] UE܉ufp5UE:98to!D$T$$ZtfGUE]ՂL$ L$D$b\ $UED$T$$]bsUWVS<2Ü }EpFtD$D$$#F w8t<Jut(F( GvЃ<[^_]F(ǀF,}Qf3G !DGDE䋆fHD$|$$DD$ED$$軱DžUPuՂED$ E܉D$D$b\E؉$GG 9=7EED$ M܉L$D$bU؉$WUMԋEDGDE䋆}MԋED$ M܉L$D$bU؉$uMtUMVE$Mƒ7MɋMEVUfVD$D$$ϲD$FD$$F[FV(VfxD$D$$ZD$|$$̯hP OfMEMfMMF,PfG fGTU䋆f@D$|$$覱UD$T$$Dž@=zՂD$ D$D$b\$TEfEEM8FtM$F FMF(~UfVF(D$D$ED$D$ E D$L$4$‹E!@uxFЃ<[^_]ËE @ME$MU *‹MEfEE'D$|$$ApUD$D$$UOV(UVfeEfEN,MKOD$D$$ίD$GD$$EWfPM9uD$D$$}7}fEfEM/}fMfMMV(NfMHUUf9UǀxD$D$$D$|$$WfEV(ENfMfMMgJfMuljȉEMED$ E܉D$D$bE؉$EME܍ՂL$ L$D$b\ $WEEMfMN,MaOD$D$$D$GD$$WHwf9M9uE܉UՂL$ L$D$b\ $E܋U뫃fU@ ) G OfPDWTUD$|$$D$UT$$iDž@=vU䍃ՂD$ D$D$b\$UMT9fQTP|D$D$$OD$|$$ɩ1҅c8@ tfUEfUME䍓ՂT$ T$D$b\$&EfUUVS) uFt$|F FF(U VUfVF([^]ffffUWVSh(ö E EċEE3EEEpFtD$D$$$F &}Et&}U+uh[^_]ËEċ@}O9E}9|$EĉD$4$tEEEEȉEEċ@EME@Eă9EЉE0} D$D$$諧DžnFfN @EW)‰UEċ@UB 9EGfVT$UEĉD$4$~fdžF fEE̋UF(h`Eċ@}O9ED$FD$$谦Dž$FfEEED$ |$EĉD$4$1D$|$$ӨGdžD$|$$裨ẺD$EĉD$4$KJ…Ezf}:}% EEEċPMQ GO)MJ9MsBED$T$UT$ML$ EĉD$|$4$> 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MUՂD$ D$D$b\$ZMU.fEEfF fE~EUčՂD$ D$D$b\$U'UMՂD$ D$D$b\$UMSfffffffffffffffUWVS8}! EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋ՂL$ L$D$b\ $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸Ղ\E܉U|$ L$D$bE܉$]UE@(EuU]䍻Ղ|$ L$MD$b\E܉$rE9EM؋UB=VVU]䍻Ղ|$ L$D$b\$UUfEED$E D$E$rUEH(EH(]䍻Ղ|$ L$D$b\$U;U1҉T$t$E$]8UUWVS jo }u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0 ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃ՂD$ D$D$b\$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃ՂD$ D$D$b\$UMUWVS@Í }EpFtD$D$$JF Tt:t@[^_]F(tڨ1EEՂE؍EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b\ $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃ՂD$ D$D$b\$7MTD$|$$ו럍ՂD$ D$D$b\$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfEՂ}Ѝ}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$b\$MMԋU<ՂD$ D$D$b\$D$ED$$D$T$$術D$FD$$Dž]2FM䍓ՂT$ T$D$b\$tVMMՂD$ D$D$b\$>BHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍ՂD$ D$D$b\$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[Ô @[UVSr w ut5D$D$ D$ED$4$Ot6E[^]ÍgD$ D$D$5$럸fffffffUWVS  UE pu3lE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdr,d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?hgD$ D$D$X$hMX\pD$E  D$\$i8 X9hƋ`,d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS\Y Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS ç~ ,4$XnD$$D$F $3 [^]UWVS ^c~ }$ L$K#1$KD$$D$<$h3t$<$2 [^_]US} ,$m[]US,} EEVEEED$D$ED$ ED$D$E$t}u E,[]ø,[]US<A} ,$l[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9tL9t,EȋU+u0<[^_]D$$D$$.#ԃ $](UWVS`ïm EEƠ3E1} w6}̉M UERE9t~L9ue $!]XM̉MG} EME9tXL9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $y\'UWVSDßl Ơ3EE1uUč}̉qMȉM}ǹU7UȋE9r}9t"L9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $[U&UWVS8k Ơ3>}}̉11҉EE9tL9t)E+u18[^_]D$$D$$ ׃ $;[fx&UWVS1D$ED$$`iFUWVSp] EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN  EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]ЍՂL$ XL$D$b\ $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]ЍՂD$ XD$D$b\$ϗM"M]ЍՂD$ XD$D$b\$藗MTME̋]ЍՂT$ XT$D$b\$\MEMUEEЍՂ\$ X\$D$b\$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]ЍՂD$ XD$D$b\$nEMċU6MU]ЍՂD$ XD$D$b\$'MUrM]ЍՂD$ XD$D$b\$MUԋ]ЍPD$ pD$D$q4$贕UűEԉE}EE:50UWVS4|ÁR }G,EЉՂE؍|ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$b\$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oMՂD$ |D$D$b\$M:  GEu\uBMEt H(x)Z]fmfm sMM Z]IUWVSZ_D E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀǣ? |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVS芽Ï4 } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVS2 } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVS/42 MDžDž<< !z DM E5"x  D$D$D$D$ D$t$ $(uVD$D$D$ 0D$T$4$Bt0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$wL0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$i$'3DžDžEDžDžDDžDžCDžDžBDžDž>p DžDž DžD$D$D$ 0D$D$$Òt0p DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$$$2D$D$D$D$ D$t$$#4D$D$D$D$ D$t$}$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$$"3oiD$D$D$D$ D$t$؃$!D$D$D$D$ D$t$$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$}RPLDžDžDž D$D$D$ 0D$D$$D$D$ 04$T$1t&=S,vD$$ `DžDžyD$D$D$D$ D$t$$D$D$D$D$ D$t$$7SfffffffffffffUS膯Ë& \ []UWVSPjo& EEEE}|$EԉD$$7Ẻ$1u} }Ƌ u%1ð uBfEʍ M MM9MMfJM^MHHu u p Puupħ0ħ@1Ẻ$D$|$$ P[^_]j D$D$D$D$ D$D$$ ‰ f@ fN9fEȧħ@EU tdM HUPMH Uup ħȧħ녋uMHxħ0<ħ@\ uM M  M310ħħt ħȧED$D$EЉD$ D$D$"$u}u tE E E~ vMiM DUWVS ot" <$%ħt V6uj$Et+t V6u<$E [^_]ׁt V6uD$<$lE [^_]US$Ū! , t$[]EEED$D$ED$ , D$D$E$肅t, u,D$ "D$D$A\$$d, mfffffffffUWVS! E }0@DFƅtGFU M U9BFD$F D$ $GEUtRFE VJE}9OT$T T$$EFMAE1[^_]ËM!@]GF MtFuV]SF }WT$|$ MQT$D$E$ u>E]놋ED$ED$ GD$F D$E$LE!@F aD$ ${t̋EUBL$${t}VWVUVS$ uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 訦 E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$]yEt͋]E0U=UWVS(谥õ E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVS莤Ó }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[ @[̀rS[ô @[US 蓣Ø EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[> @[f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVSPU tMƋuA~8t:F4@9s3`V8F4@9r$xF8[^_]ÉUWVSء E}}u3ENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]oF86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$]{NjUN8#UV4V0]D$ D$`T$ $F4~81.& @rPu B8~8BX;F4rEyF8$]vF8UȉȍB=]I_8 4U]0_UF8$3v_UF8$]mF8tgD$`||$t|$ D$xD$E$mzDžuUN8]^N]^{]UWVS@ EE M3NjE1lI%;E" = 9#ƅDƅdD$$"8BƅC8 D$BD$d<$mv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $^kt[U+ @[^_]Á}$ @ Džh1Dždd ׉<$iD$`D$D$ t$D$$vf 9?D$ D$`|$4$ $9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$[Ju"dhD$T$<$hFPp @?.T$GxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E ED$ "D$D$l$>~D$ "D$D$m$>U芄 UT$D$ ED$E D$E$9]ffffffUVS BG EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS( ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$]ӋE111 ufEUD$ T$ED$FD$$];u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVS Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$TÅt@C؃[^_]ÉډSu1V룋KT UWVS u xD$4$HE%=D$($SDžtz@@&@9uE ED$D$ EЋUԉ$T$EČ[^_]@1Č[^_]UEU U U$]UVS ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D 'D$ D$%D$$$U D$E D$E$]UWVS# E HMPpt)rP@t6B E$kV1[^_]ËxMt P@uʋMAUWVS4ï }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$U11MM1 MMEԋU؉D$ T$E܉D$AMD$$9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVS}" ut PtH J H $ySu4$kS1[^]UWVS| uu2&.&[tCtډu[^_]Ë$-[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS { U EtUM"t&.&.&.&t.ZYutD$D$ $ E [^]UWVS E{J } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS(]zf E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]/E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]I‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍtD$ "D$D$G$.u ]܍2D$ "D$D$H$.bf%BBff+E XffE]F3G]33 4UWVSsí utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]tD$ #D$D$Z$,[UWVSr utWD$4$ F u#f~t(1D$4$ [^_]É4$2 ƀ'4$E$Tlj4$[^_]ffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSQqV u2tfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉F[1맋V0 t~@9t $*GV0F FV덍tD$ #D$D$<4$T*=fffffffUWVS.p3 u}E FftRxT$$<xD$ #D$D$X$)ND$ #D$D$X$(UWVS|n uǠ3E1F t)fF FCFFE+e|[^_]ÍED$ED$4$9EF u 9vEE$~<s3 UʀFMEFEt"Fft!U$ UtUʁf V S؍tD$ #D$D$|X$'FfKD$ aD$D$@U$UU$E.MP'UQ/wҋ#MUDJEUT$D$D$D$ D$D$D$$!UuEtM MEwF PMDQtE뀃EMDQeM M.EEщUiD$ #D$D$X$K&U j$Df:UWVSl! Ɖ׋@0$F0PEV9EED$$F0Pt$T$8$F0PuD$E$qV0UU쉂PF0ǀTu Xt$[^_]ǀX\D$$ F0NjF0TXtXUj M$2u]1҉]UWVSj u$28u [^_]ËF0$nF0PV09t'Pt($<[^_]ÃT1݉UUPV0ǂT1UVS.j3 u$2u[^]ËF0$F0Tt$[^]ǀP8$F0Ui MU $2u]É]sUVSiÕ u$2u[^]ËF0$.F0U t XtTt/$[^]D$\$F0ǀP8$(F0UVS8h Ơ3EEȉD$E$>U+u 8[^]f̀rS[ä @[UVShÇ u tt$D$t,@E$[^]ÍgD$ #D$D$9|$$"UWVS4h" D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"'D$ 'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]9&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍_D$ $D$D$K$ L$(=_D$ $D$D$M$E"UWVSe EU uM] $\$M] @'}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSe u} 9vtGFfuUT$|$$xFP^T[^_]ff [^_]Í_D$ 0$D$D$C$s덍qD$ 0$D$D$A$G9vVD$ 0$D$D$B$'UWVS d u} 9vF t5Fft\D$ D$D$$!Ѓt<F fF FfuUT$|$$[^_]ø"8F 뱍_D$ $$D$D$V$%DqD$ $$D$D$T$9v D$ $$D$D$U$?UVSbõ u9vufFftEȋED$ E UD$T$ $QF !ӃtNPVTfF ȃ[^]ù뷀fF ȃ[^]ÍD$ $D$D$j$kqD$ $D$D$i$7UVSa utO9vuFfu$[^]ÍD$ $D$D$|$f붍qD$ $D$D${$:f6̀rS[4 @[USa ED$E UD$T$ D$E$[]UWVS@` t$(D$T$L$,D$,t "|$GD$8UT$$\$( uL$8ǀ-[+nD$,L$8D$0T$4D$T$ $D$\$(艸D$D$0T$4D$T$ $D$D$ T$L$8D$$11҉D$8T$<0D$,9tmD$ \$$9D$8|$e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(D$D$0T$4D$T$ $D$袸D$ T$t$8L$$}t$80 }1th]R|$ D$t$E D$L$T$ PD$D$4$D$t$$RUljUED$ D$E D$E$4UWVS8E Eu}3E1>']RT$ t$D$E D$D$|$ PD$D$$u(u~E+8[^_]:|$D$ D$D$4$D$t$$t -H󥋅D$ JD$D$$M#:Uǃ_$…1A<+w,.uىD9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVSwN#4 t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USB ;UT$$L[]A @'f̀ffff7̀rS[ĸ @[>̀rS[ä @[USAÈ D$D$ ED$E D$E$[]US@AE ED$ ED$E D$E$+[]ff&.&$D$4̀D$̀fffffffT̀rS[ķ @[PS[í [US@Ê $2u 03[]&[]f̀rS[T @[US3@8 $1[]UVS @ L T t [^]É4$jpu1fffffffffffffffffUVSÉ13v.&.&.&.&.&.&   lLLLL9r[^]UWVSTE8}x}x}@ EM]+v.&.&.&.&.&Br 2 r 9u֋EE}M1ˋu!1Eȉ1!1E1!1 u1!1 ]ĉ1!1Mȉω1!1֍ >Ủ׉1ډ!1ƍ> }lj1!1ލ> ]ԉ߉1Ӊ!1΍>M؉ω1!1֍ >U܉׉1ډ!1ƍ> }lj1!1ލ> ]1!1M1!1U1!1 E1!1 }7yZ !Љ! učyZ !É! uԍyZ !ى!  u䍴yZ !ʉ!  uyZ !Љ! uȍyZ !É! u؍yZ !ى!  u荴yZ !ʉ!  uyZ !Љ! u̍yZ !É! u܍yZ !ى!  u썴yZ !ʉ!  uyZ !Љ! uЍyZ !É! uyZ !ى!  uyZ !ʉ!  un11uԍn11 učn11 u䍴n11un11}܍n11 }̍n11 M썔n11U2n11U؍n11 ]ȍn11 }荄n11}7n11un11 uЍn11 un11}lj}uO}FEЉF T[^_]UVSZ:_ ut0FF#EgFFܺF vT2[^]ÍfD$ /D$D$$UWVS9 EEU rP?ωMM1ÉPHUʉP@)|89]riڋu uwuoxEE);UEމ}E} ]7E@9r})uu Eu sLtft[^_]äftvU] E]DEsfT$ .T$D$$ZEU E|tT$ .T$D$$EYf7u S,f$UWVS$7Ʈ EE} Ơ3E1WEEG?78)‰T$,/D$<$`D$ED$<$IE|X1tftE+$[^_]úx)rfD$ .D$D$$fD$ .D$D$$tWZfPghffffffffffffffffffffUWVS6& uN^~/.&.&S C1ЈC01 2 Ƀ9u߉u)1^]^D2VVҋM].&.&.&2ӈ9Mu]҃t[^_]UWVSJ5O uFFF F~01uWu]΃V9s"t G9sD9ruTuL[^_]ê/tf뜍fD$ /D$D$$i4fUWVSX4] MU E1 tftu؉ tO;Us]E )])9sˋu|}M щ؉΃ru.u<똉U4$U;Ur[^_]Ctf볍|tD$ x/D$D$$NfD$ x/D$D$$UWVS3 }u tc +D$LD$4$yD$FD$4$bVVWVWF G u[^_]JfD$ l/D$D$$osfD$ l/D$D$$=Dfffffffff1ø112 1øUWVS<1 @ }}1fE9s't G9sD9rEtfH E̋D EB fE؋L EЋE D$D$(Ẻ$U<[^_]ÉUs!ƅUu't<uF=fB t/tv=uFL ދFD ӋFH ȋD t@B 9s0.&8u +P 9rtH 9ƃ@ UȍD$ 0D$D$$FFU.D$ 0D$D$$L ƋUfffffffffffffUWVS/ D$0}|$hu }]\$83D$Ë$1M}D$hD$DD$,D$0H\$P2D$<%t,P D$,t$h\$D9s FD$h<%uԍWGD$CD$XD$<D$\HZwt$00T$(D$$ D$l1D$X|$lD$Pt$P\$<9}L$,L$\  \$P\$HT$Ht6\$DT$h.&.&9s  sT$hD$\|$(1ۍHЍABHЃ v\$< T$(D$$D$\0|$8GT$`D$d|$8\$Xd$\t$`|$d D$X\$\\$4|$CD$HD$P$3D$Pt$P\$<9}L$,L$4t$hL$D9sL$Ct$h|$4L$X\$DL$h9s0sL$hr\$`T$d\$d|$Xxd$\D$C- t$`|$d9$D$4\$`t$d)щ1҉ىD$PT$T)iiƸ1҉D$HT$LD$HD$P0T$`D$dL$`\$dc19dÍxD$`0CD$4)D$HD$Pt$X9}t$Pt$H)t$XD$XPF\$\\$4|$C@D$\hD$Pt$P\$<9}L$,t$4L$D9L$hAt$hN0\$D9 L$$N^\$h|$4L$<\$P)ٍYt$DL$ht&9s0sL$h\$'UWVS,"l }U MEƠ3E1GED$ED$ L$T$ $+cL$T$ #sD$D$$a=E D$D$ED$ ED$T$<$qU+,[^_]Åx$=wttH|.uT$L$ `D$D$$`UD$T$ $bqD$<$C9%UWVS(chj E E3‹EE@ pwc$MT$$ne-EP'D$ D$D$4$F ,t&.&.&.&DA@tD$4$j.t&DJ@utSFNu tDJ@tEpt$|$<$v7$~$~1U+u ([^_]#UWVSPh u} E3ËE1ưD$4$1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#辯8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$ED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$膭AFDFD`DžDžD$4$9yfffffUWVSlQVc u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$xƉt$E$XEEFD$ $@U(fBMЉU(E,) X}|$}|$ D$t$E$p,Ɖt$$ ЫFD$E$辫FD$$辫FD$$蘫 U(fB )Ѕ9E#T$ |2T$D$X $CEl[^_]ËE$HEE$ML$D$ ED$ 'D$4 $pXU(E H E, 9(B B U(D$E$ĪU(BD$E$讪U(BD$$諪U(BD$E $肪E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS _ U }E@4E)Ѓ FD$$)觩FD$E=s$苩VfFE@ uG1T$$gF D$$T G fffG )~ [^_]èu2밸9u1 [^_]Í=$K^U *UK$2^U븸UWVS^ M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$aGD$u4$OW׋u$ssuXuQ}׉+u9~ED$4$+E~[^_]äft9}u1[^_]urpUh$\UM 9}t D$ h2D$D$=X $[SgMAyEtflffffffffffffUWVS(] ljUM܋EGkE8u䍃|EE썃E.t&< t< tD$ED$4$蛕D$ED$4$|D$ ED$4$])D$ŏD$4$;G~$T[< t< vtu([^_]À>6F$w~d ʈdGtD$$S띍F$Yw~GtD$$RiD$ ˏD$4$ZtD$ cvD$4$D$4$)ItDž0]t DF 4DdLʃ Јd8$3D$D$ $9x8$e,D$x$ot<hlp` d h DDx`0DpHH`HD@H@`tg.&<.ǃu~DD$. $W[DFHGD$.$2[DqPALD@]$߯t q‹DHDH U+h[^_]Áxservfxer< t< 9 < t< tЉT$L@$VLt׋$ˆL,D$ $(CL <4,LTDD|$@$V<mFV9xDw@ut;u㈕$<,t$$vB<$TDLD 44 K}D$ D$4$D$.4$UD$D`$&Dǀtǀx|Dž0Dž( $GDxD@DtVD$4$?u덃K$G< tt< uDž0]L$,D$ $@Ltċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž0)@DDumuT>uvuYLpD$D$蛐1ɉffL LsUD$E$]UWVSXQVF }u h3` l3d t;D$<$t` d Fh FX[^_]Ëh 9puttl|ED9EtztI2D$D$ED$ D$D$t$rkBt` d Fh F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]ffffff̀rS[äD @[UWVSd~ÃD .D$4$?@$GDžDžDžDžDžx@ N L$T$ VT$D$$PT$$B0F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$d/ut G74$-z@9 W ‹Atft‰)@0Dž'Ztftlj)@#tP4$Ty@9r5‹zV$W@ $蛠胉Džd[^_]‹)ʋ;Wf)f f{\pjD$ 2D$D$!$$U0P@~~ 9V)ȋ 9cVʉ)ȉA1҉=tftH<@ lj)99h΃r낋$T@ $B%@ 4$Ov@9:ƒ{tft‰)‰DžJtftR<lj)944$uu@9`‹wShf`f% PD$quKu2ifM/f릋$XR@ XUVSV[< Ơ2t$[^]ÍD$4$7[^]UVS < Ơ2t$Q[^]U; U4]UVS; ut$R[^]ÍD$4$6[^]UVSot; ut$9Q[^]UWVS=B; u}t5W¸t[^_]ËF [^_]Í1hD$ 2D$D$|!$}UWVS: }uENH NHD$4$5ƅu!yH L$UT$@$tEG D$GD$ GD$D$4$PGu4$ PG [^_]É4$O[^_]ËG [^_]Í1hD$ 2D$D$!$|UWVS ð9 EC38 ,':)lj}싓 u2E D$ $^  [^_]Ít$E$%t$ $%t{ t1= ;txED$D$%uًED$D$ED$ D$!D$$1 [^_]ÍX!D$ED$ D$|!D$$ [^_]ÍzD$ 03D$D$4!$${ED$SUWVS  8 ''w} )ƉT$U$tn  UT$ $ϓtG  D 1 [^_]ÿ'y qUWVS(;87 LJl LJ| LJx z 11ҍ 9E: 5 )Ћ t ڍAw 2D>ЉD>]T>ӉT>,;MHL>@CD>t Cx d9։‹x xztx =w ;L3Etx =w ;L3| tH~kx LJx x yU !ȉx UeU$l | ULJ|  M싗 1ɍL3]MEUtwM<9ErMtu艷 Ѓ([^_]LJt 5 LJt D>ED>ЉD>]]Ӊ\>,;8 :;D> rU=UsD>HL>PD>HL>t HL:=Ë ; e 6H P H p HLJx | L:| MULJ D>UMD>ЉD>]T>,;8]ف9L3 6LJ| 롋p LJ LJ D>ЉD>]T>,;oMU,'E3E $bUMD$1ۀ} ËE)؉D$ D$|!D$$UMLJt D>ELJt D>ELJt D>ELJt D>EqMUD>@E싟 ]X] É %LJ  6 l mUUxzx Mt ; r tX 6 H P H p HL:Ћ]!LJx E$fffffUWVS0蝹0 EЋȓ u䋸Г }9E?u؍ > u̍>EE]]Ef}؍?} >} <UuE苈ȓ uȉE}uuf U8]U& U ]U U ] Uܦ U ]UWVSʦ ܓ u"$ uމ4$ }LJܓ LJ8LJ LJ LJГ LJ̓ LJȓ LJ LJ 1[^_]US E$)t[]US E D$E$y[]USǥ E$;|[]øUS螥ã D$ED$8D$ D$D#D$$[]UVSJO ut,D$4$g;ff D$4${;[^]ÍtD$ $@D$D$5l#$^UVS ؤ EpFtD$D$$g'F!u  [^]cUWVSot uM5D$ ED$E D$E$klTl>LDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$SDžH V€ʀ UTLbD$ D$D$T$BM P!ЃLP[bPb0<$_bT$3b01[^_]À Vba0<$b  PxD$T$9P^E E DžTED$D$ D$D$$RDžt HƁ S;a0a0Ea01 6G3GG +G iG)G4GD$D$L$!PLPP LЃHtfD$PD$L$#H  D$ $PP D$_8LlPu  PHRD$T$>)PD ƒ@ uv-h0,ffffUWVS }EpFtD$D$$m"F 0@  D$4$uc  t$un  T$U4$DžU9B(E \^b1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$ [^_]fffUWVS EpFtD$D$$n FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$UЃ[^_]É>\UWVS$豜ö }9EUEEEE;E MmG$&u݋M…tEL$D$<$)UUD$ ED$}|$4$9uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$$nt㉇UWVS(kp uE䋆EMM܉;E E苷EHMU$%ƃUtY9Euȋ})lj}苊U|$$nU}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$a7u@EE9E 1([^_]D$ ED$ED$$%7l([^_]UWVS$ M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $Mp6}9} MUu1$[^_]Åt#UD$MD$<$&MU눁 $[^_]ÉT$$lMt$[^_]UWVS(蛘 EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]G5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVS轗 EU EpLB< D ?ZU )ىL$D$$]ef}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]MU ̉EU ]썋̐L$ d@L$D$# $9PEU QEU ]썋̐L$ d@L$D$# $OEU U E]썋ՂL$ X@L$D$b# $OU EUWVS譕ò D$T$$tV@D$T$U4$NjUuD$T$$ [^_]D$T$$UWVS "' }EpFtD$D$$Ft:tST [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSD]b }wFtD$D$$F}  8GuD$4$D$ D$D$$2 F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$G;EtD[^_]ËMN$tD$ D$D$$1Љ!ƒtL$D$$Wu 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$‹E؃9tD$<$`PD[^_]UWVS u~GtD$D$$}GD$4$C uUEu@t*$]u*4$PtME[^_]Ë$tE͋D$$E EUWVS  uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $lU]C1[^_]Ë]C鍆D$D$ ED$T$4$jul}D$$?cM UtEdžU|$ $ctU#DfffffffffffffUWVS } EE,E}1EED$ED$$]ƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃ՂD$ p@D$D$b#$HU]nME}E9}twu})D$D$$]o9utAFD$FD$$] tVTP‹}u뙋u]L}8 [^_]ËEpE )}fG w [^_]fUWVS$-& uƉЉfMy} ~ϋX9U)ω\$D$M$]EfH]UT@둋]썃 $D$ @D$D$$#$[AEx _]썃 $D$ @D$D$6#$AE@ ]FO1UWVS 9~jƉ׋@ $TWLDUtMD$D$D$ ~L$D$4$UDu[^_]É$\1[^_]UWVS,Xa u} 3ËEF =u Džn~FfEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]%9E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]oD$ @D$D$#$.Mt !EEfEE:M]nD$ @D$D$T#$:.MdUWVS$ t% Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$LJED$$EEu>E9G ED$E@GD$E$]E$[^_]dž(Efuhdž $D$ |$UDBD$4$4…t EME$EPEwD$ |$UDBD$4$d4 tʋ@f8 $dž 2UWVS,{rÀ uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$UU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$#U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍̐D$ AD$D$yd$$d*M UaM ̐D$ AD$D$d$$)*M VuM DOƃ=Fu ̐u䍳AuDG)fET$UUT$7$U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$d$$u(UED$ E܉D$D$d$$F(̐D$ AD$D$d$$(D$ AD$D$ed$$'E@E̐D$ AD$D$kd$$'~D$ AD$D$bd$$|'FE!UWVShmq EE @u E1OftsDPND$ t$D$E$].ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃̐D$ @D$D$d$$%E@ M]f\Q=맃1fM1UWVSmkr U EzMq uf+4GMM9U t$ED$DM$肗u)uD$ U T$MDD$E$~,…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS3j< Eu} 'D$ D$DJD$4$]+tDPfzuft,ˍ< fED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$U+EZUUT$L$$H#T$ $z0GE$3]]iD$ D$D$p$ US\ {vql]d$XSNID?ff]2].t&%].&fffUVS(\- EEEEjuVjJ 0 uǃ0 3tjjjnjVj jjUWVSEE] }3t>ur'j/V_ZYtp t0MPV3 ZYMu}] EEAe[^_]VhhUh'6 'UWVS]u 6_hVS( tfu,2'ۋ=')u''u%h53Zt''hjP' @u5'hj hXu4'hj MUW6 ZYMtUBk u6h/jH VKSW P蹾UWVS] 3趝hIj4hISu@t h'DP2'Zu'. 1'' 5' jjP޹' y 5''p5'4=0@'v'u hje 'u#'')' ' ('HthRP=' yQ'P('HthP5'ң' ' y5'h> j '4'3('u/'u'H$4ã'uj'D5 ''9'$'s3ã'tá'3't''='u = 't$;='u ='t<('%h=`u; ' ''''%'RP5''P ('t h jh'Jhjh$j1='='= ''h\X0@'P0@'5('t'H'L'@'D';0'4'ss '' u15'5'5''P$lj uu15'5'R' rPPh> M/6Y['u9j5'5'5''P ut5'h> /XZ*'''''''^'E'E܉}E''EUE9Eu:E9u3 ''EUEU''@'D'L*'tM]܋EU EUEU ''''H'L'('t1''''j}11='='XsG''EU1҅uth'l'EU'uRR14 ''8'y8'=&uA/=uf/=uv/*'t=' '9ȋ''s")1='󪡸''''='u ='t j|0[` '5$'utL '1='󪡸'''' ' ')։ '5$'uu='uj'PY@u8th#5''PZ@u h:jjطUWVSX ] 3ҖhIj-j{hSu" G-$ |'1l'H'x't'1l'H'@p'z<'l'1=H'Yh'J15l'H'3d'$`'1ɉ l'H'\'X'T'P'L'=D'th~=,2tu hj1nuou8'j,PYZFt@jV{#D'^Zu hX8pj,WZYt x>1>Phh'j螵p'T'=t't t7h/Bt h't+hY,t=h'th\''jWW@'ZYu h|;R=d'u6=D'u-=|'t$=X'jW[^11ɉ=|'u >=d't =C?i ȉ=X' &XZ=x't4011Dž8hhNP  L'5x'8i@' 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t/=t't&t'@'=x't701$1;@'si a1C1e[^_]USEEE EE0[1҃vU|r҉'UEhRP? tvpt.Et?SuF'Ƀstxu0F '볡,2'''Ph h'豼 j=E'EE)ЉEEt9E8-u/'EH~')EEEHEjW1ۉ$3ZuYh.jXZjjY[hjXZh@'+Yt1h'h#f XZh'S~Yhtjo[X?'Et^E8tTE0SjYtEEj0NYZyj}Z4E8!tYEh0h'$ @Et9h'h$ YXE8tj(ZuhC}Xx*'tPh> kY[hX'XNQy"='th'hIh'Һ uY='='h'h$ ZYh1}1ۉ$Z.f% '1'냋'| th|Xf% '^1'JZjx$'PRRV tt t6j1ɉ 'h'h$M[Xh1:|1$d='ujpjZuh'5'hHh'蔹h'hIh'{ h'h$Y[jRZf='uj2=h'5'hHh'+UWVSXu} 7越hShYZu fu,2h WV utt ')Nv虌E8}WnZE1  tAB9EsEUPQMW UuMt6QWhjsփ빅u Wh3AE@t1j URPa$E ;F|E8tEphGj"E1~PSqYXF=mw2=m=m@w=m@r=m8@=mF dUuFfEERhmWwv UWEffEERhm+fEEERhmW4v 1!EPhm8@Wv x E 6Shj?f9tfuPhYEPshvu x%uSh蚲 ,URPWu ySh> jMPhjj蒨UWVShu E1E1ۃ}~F8-tEh.$_th@PtZYu 'hD_th@PJZYu hNXjh@hD(EPuhj\0vE_t<1ɉMMMMMMBhzdE ,2Mt&t"QuZYthjEhWE)PE @}w}c}6t^%}4E뷋Edwy$ }8tEKv_,2Eh5,2EXZnEbEV''}uC'Eu4>tj@u~Y[t}u U9sUPUxtă}uEE1ۋtP}Z\tSXzEt'U)RPS@S:Ã~t C}u"hh*)EZYu hK}uEEuh'WuuEpEPNu{ yj='y h}tLjuVjhSDy hXjVjh5'Dy hXh(juVjpSwDjVjw5'dD,ui1ɉM̉MЉMԉM_1 H>v  DGu΍EPEPjG ='t}t.D1}tEjEP4 2 Gu4Ey hjVh~f5'NVh~fSBUSME}u j uXZjUE 0j*UVSEU DJ (uc1E1ۋ4 Vh\nuUb `'H`'Y^yhX'j -XZX'PX' Cu  1e[^]ÍL$qUWVSQpq14,(8,(@,(D,(L,(X,(0,(T,(H,(,,(DžDžDž1h V7 @I&/0$ S'$ 1=A'A'A'rA'c,,(jP5,2褉 :uy5,2h /A'0,( ,(D,(X,(@,(<,(P,(14D 4@ h. *C uDL,(vH,(k8,(=,2j/WY[ÅtC?t t`@tj/S¿_ZDžtG;tt@tqtj/W腿ZYtA?t(t @t.t9h7 O4,(Ph ,(h$,(h(,(hT 5,2&u,2<t h_ jc=(,((,(Ph`,(Phd,(h| 5,2%~!,2<u`,(d,(9sh 뉅`,(=,2j/WCY[t4PW`f_Zu!%=@u,2A'Y,2 L (T,(6A'A',2\,(5,2A'[=~ PPh j- ')ˋ@,(=D,(t X,( T,( L,( 8,(t3 =0,(t t$h 4t=L,(t=8,(uh =8,(t=A'uh* Ku A'n=,(DžtDžxjjVjjtSN@t,GYtjjVPjS(@t=A'=,(u4P5A'd_Zu%=u ,(0,( X,( T,(1 L,(t1=\,(A'=,(uRjhh@(PRA'y'8uh@(hQҌ>h@(hn-A'@(-jPR|A' u5A'h$[^ =,(tRP>ZY@u5A'hE̋UЉ1ۅuthRP5A'h-M̋]Љȉډ%1 .(1x,(.(t,(.(.(p,(.(nh.(hrdAP @uX5A'h6h.(hedA5A'@u-5A'h ^_5A' A'[ .(1ۉ ,(,(=.(=,(.(,(.(A'.(,(?w=x,(t,(p,(!ȉډ h,(l,(\,(tJthVP荖A' @u=5\,(h> 05A'GA' A'A'jA'~SP (Yu Shj,(11; t +(1V,(,(`+(;4,(t#(,(x,($,(t,( ,(p,(DžDžjjVjjS<d0D (Zu hj@jjVPjSy5D (Y 1D (XA'j/S 9^_ޅtptuIPVSh[Iw1=G(~]h9xnw X=TRPhvIJwG t9rj TvYu Sh{IwXZhI~Ph&r@ ~~tLEPE; j褰((hĂ(hQ@P J'y@J'Ԃ(t1MPRUZY UMu܃ SEPQja'@J'ui RPhujUWVSXu] 3k@b7_tjPhޑj蹯,2(hSV論 Dtb$`!،(((Ќ(((܌({(lČ(]̌(NȌ(?'9Z=،(t( (u (=(t=܌(thPjZ=(t,=(t#=Ќ(t PhO5Z4EPsh>S u$1ۉ((EU((ڀ;+u[CKP'DJP謍k<((EU((Y}Qȋ=P'DOt Bu/<:0RUZZUBBBBhBmEPlT1S  $!0k SDЍ~=Pd80k SDkd-lGS0k KT ЉGW0k SDωG0k SDЉG 0k SDЉG0k SDЉGWU((_u uiX+EU((y hEj]Fh ;PY[u~tO(t5PҧZ)ǃv%(t CRU6SUUӃ f @(h'()PSM t!;t (sC(uf( h(R[Ԍ(=(u =(th(PhZf hnnYI(urPʯZ2t(jjj菼 =(u6Luh|>j\tPhMfjv\ j jh{ ,;((| X5( (9Ȼ!} VG9ƉS}M)Mt1jjs snQM9ȃM} DVuqXS1Vu,;C| XsB^{u;t̑=(u!{=(tّ=Ќ(th(5(Shj0jhl=(thҒljhW=(t3hhhVƃ xjhPGUVaWShjQh(BcP(h8Tlj$h(jjE hZ/l[=(u=(ّӑ ̑ƑEE=Č(t EzE=̌(t }=Ȍ(t =،(t (=܌(t t=Ќ(t }t (PtPH1ɉ hjEPSV0Shjk0Sh$ jjoUXZjUUWVS@u} E@hݓWV׎ tTHth wT$!ЁȀπÀ5,2:K'X뫡,2|K'1ɉM똋')HtV4jVh3A tVh3hj h (9a (jVSTXZy Vh> j9 ]1uȉuԉufE5K']S`SjWyh^jhyt Wd y 8th95|K'hCt W; yh}tjj^Y[t hj藦1҉UUUUčEPeRXUWVS8]u 1E66Xh[VS2 x`At$M4(ăa$!@(<(8(K'e 덡,2(!0(v,(k((`$(U (J')Ӄ= (t=((tV@( =<(t =,(uu 4( 8(.#=(u <(U1((hXUu hij =<(tEčURWjj115o1(tjh<Pc[Xu5(h> j贤1ɉ (jjh(jV耐Ãt;tM{SZV~X"4~MFc{K1= (K'X'e[^_]UWVSE p(EX1=|(hPGZYu |(蔮hPOZYu t(jj(Zw蔖ڰ6vA5(*hPu (=(t~PL_tPoX~5+u!zt~KhX W莠ZYt Wnunt nhh(_t8u%hh(PZYt h(Phơd(PY_t d(ϡ1=x(tjhޡO_Z~Pv=jK =(u&jzYu'jj=Ȓ(t( t(ujhXZ}jOjT^_=0(uh ;5s'JY[uZ~jhj苋50(臱̳Ztjo貱((Bu@td((6Mu΃=(t$2H~ 1(=X(u %`(=,(~jhC}j y jsy@jۊUWVS]u 6F1ݰ(C(蹰(((ohP* ut(VS[^~Uj,Y1uhj9~!vu0(hVS# u%/~k |Љ=x(vhSAXZš')KutmP'DPu^Sv_=vhhhSh@(O ;tC(@(5x(hj ]SwYhFjhFjިhFjҨhFjƨ S^u hj$@uhjhX'NJhT u w'(hs[=l(t"5\w'Yt5\w'hj踞}t Phj=l(u5\w'Zu€=@(t8jj5($L y h3Pj5(L xh (j菂`( ( `(%l(%`(%d(f(( f~(x(h(跲h(譲h(裲hUj?v=t(tjPh> X>(^_L?f=\x't jt裸[ÈE8w'utÈE͋t(u t{8,x'u1f=x'x'< t< u=jEP5( f=y'yI} uВP_]tu8w'u ÈE5w'PZYf=x'tCۡP't H'fEjEP5(H f=y'EPVX\hqjTUWVS E 0,(W1(t(hB5^_t A (Jh` [tT (MBug,28tpjRP4 :uS1ҋ (buV(( (hu uTà uC$K!5,2hx((먃 (륃 (뜃 (듺,2 낃 (v,2u)hhL!h0W (hSYZYÀ;+hS^_ƿL!t&VRS u <2t&h S謴ZYSPh; ( G(O3u<=fRh <=tRhS;_X\3h S>Y^Ɖtt t.iSQZSO^hoHjPS2‹ 3 9r(<,tuxG (QRhSV7h4:5,2uhShxL!hKh1k$@(t!VP莖ZYu@((kGhbVhe:j1J,2hhhL!hq둃 ('='u)( uM~=(u,PY@u hjWI((Z!Ãt~L!t%Ft!á(0Rh@9  s(0h!9XZ s(0h9_Xt Sh%8[^jҀ uhRtthv8jHE uC(3hR臊ǃ u R3hkPhP' u((t k 1 {(hRPC( uW5(hjזh(PzZY@u5(h(t&h(P_ua(05(hj]@(=(t:(8th(P¡(Yu$݃8u5(h j=(uh2hL!h0hjsCt( u shJhx(Py_Z@u shi(%=tE(Bt,=@t sh\5t(}Ct(Y sh7Cp((5(hP(_Ztpp 0heP (uB(%I=@u&up(uRPhP (t Ph:PY[((th(P Z68th(P_;#Nu@u hSjah(P^xu Rh}((%=u5(A[@u5(h@?5(BY@u 5(ht(tPAZ@u5p(hjjMEUWVS}u 1ۃ~^;-t'114<Dž8hMVWz 1҃i!8y't+:t!;B tBu ,2BPr5σitot8DuFDž4뉅u ,2zShh/S4 bDž<Sudx1jSVcCtjjj ǃuh VhiP~ @u hej蕒Wt@Yy'7tvFtjNt^HuT`ItBQqZ.0Q-Xɋ0u htj돃넃<t8t4tj/CUWVS$u] 3)"hIj hSVx Btb$N!jj5,2a(((((((s(d(U(( 螵(XZ'(׺ 1EԉEN`UVjXUW =(t u} E1E؃=(tb=(t t&EuhhX'M d'@t3=(tDhIhhX'M d'@t u!=(t$ @ w u=(ti^@t|IW=(tLvM@tZ-@tMP'DXt^@t1?t ؃@@tHF @t!5(h> (ff [Xd'@'t VgYf% '?hX'cgZU(e[^_]UWVSE 0 hIj 11td`p11jh|'hru ujR,LtzH1밃Ptxe~3HuIhDždeXt#dDž`H=,2= 'lM lL9-uEQ9u=yu7lJ'(DžpDžt'U)tJu upt.tt hjDžl-t1)ttDžl`,Džl-u 4u.~RhX1\hu4RhxPWZY@u Whj~E\1jSWrh tdd1(hs ݵPsh`,hwXCHHf wO$N!pu ZY(n8t hj7W;UWVS]u 6hIj\1҉(((( hVSp >vBeR0G.f"$,O!H $pO!a(((G(1((a(1( (?(1(1("((1((1=(((((')Ӄ(=(t*th( ( (tih7j$t:Dž|=(u Dž|=(t=||)Dž|=(tDž| Dž|4՗(jI(P>Cx<hSh}'0=v Sh{h}'Y}'}'X/u!}'= }'vx/uP}'@ߣ}'1hj蠐XZ=(t Ph}' Ph}'ZY@u68t%E%=@tkxtHZxM=(P63Y_@%=@t&/h}'hj^Džx0Džx=(u1=(x/lt$PāZPvЀ8/uj|Vmt 1pluv6h> jlQh}'^Zh}'ċCHfuFs PPsh&lDžpltrZu)wfush&Y[ftf tx)}'C,-}'=~TSh}'hG& o{DsC(huTxtClj/VYZlt)xlh>P=YZlhl>h)8/t z/t/Bс}'vPh}'h% VPRl芪l}' }'= }'vx/uP}'@ߋl=(xt Ph}' Ph}'X^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh}'h$CP@% =@B%=@t,M1@ush}'h)1Jl΁@w `||t {DPS6ZY+=((h}'sh= sH ( (u&fNush]#Y^jStTtfuV5(V((Mh}hO!h6kE%=@V4Bfuk=(u%(H((y/hhO!h?jR0ZY+h萇CPph}'3^Xsh"Y[=(t'PR=(tPR`PS{c8t hj,tclpo21x=(t( ((P6#x:DžxxUWVS|]u >j/WYZtxh W~_Zu^hIVScg @ui')Ãu]p0L0ZY@u jjYje;LtEPtIFu'<)hPVSg w~*fw$O!10)0)@)14)$)8)4)1@),)t()e$)V'4)Ã=,)t )-=<)t, )=1=<)=4)u@)1ɉ $)tt-uV1ɋEP|=8)xt)SWYZuE%=u SW9XZt Wh> j~E%=@9t ÃS/hUWVSu 6hIj覥jĎЉÁt1hh}Vue tVmtDžhptc5,2Xu5,2hj}hWdtW 딡'E%=@t "st/$tS..^Z@uStSJZYy7h> F[^DžlOt?t7-ZY@)l-UWVSu] 3 hIjj hSVb tUit)ft5huT)σvuC)1))1=))뗡')ƉlN4jF_)h jۄ =)tluˋVP+l|tP7pY[uË|%=@uh7R蕖à =v7hjzhtx/tlhƄ/C[9t H@>8/tj/WZYtPRd"vY dv1WhXZDžplt5>WuZD@PRh# p p+UWVS@] 3 *'Suu]Sj"uEUEUSj^_Sj"ZYuEUEUSjΊ^_Sj"ZYuEUEUSj誊_XSj"Y^uEUEUSj膊XZhu芞**1=*=*=**P]1E؍}ȹEľ uVSj=xVSj- x"}ujVj y}tVSj xjVj y}tVSj˃ xjVj踃 y{}tVSj蠃 xjVj荃 yP}tEVSj n y1jVj[ yVSjI x胼y y0h}0j ^='tUjh-u$'[^y h0j謼* #='u=x't 4@hW豜Yt8uVrZÅt @|/tCP5*_uhj7*ZYtlj؍P*/h)h) jh' t! ttBGuB=@69=)t hjv;='u'$=4t **e[^_]UWVS]u 6hIj贝 1h3 VS0] tLtPt9't赻h'>_8/u|h$PY^ukh S_ZuZPSOY^@tHxPh-u9_Z@t2|9u;xuM9 u;EtjjCY^uj Sp8hX'&OXZd'@t h)jQuj&UWVS}] 3hIju 1h|%SW[ ft]/WPtwR)d*벃vtbit6rtxu{**1*p1**Z*K*<*-'9=*zu8Quth%Xt*؋Ht ʉA?jW*[* *u t1=*t =*t@jPWZǃ uh%C =*t.u)Wr_XCHHf $V!PDs OPshjmr=*tC ƒ?uts Psh*k=*^KPSCHjSW dC 1ɉK +{uD{ u>=*tCHSft\wlfucKPSC蕷usʃZ=*u&sh> Y*Y[R$ }8X=*uswZuKC1~tl=*t`}8UR}8?GD}8r4* *#1*s3X }8t hjpW\[\xVS¡*YYu3t>jJPSh*_uEE%=@u"=*uSh%*Y[뱃=*u=uE%=uS2ډصuv=@uS=*u SZtXt?=*uSh> xg{8{8? {8u=*Sp2X5* 1e[^_]UVS@jjx^X1EĉEȉEEjEPj* tE9u w9EE *j jpY[(*H (*jE$*$Ij ZYh01֓V'1ۉ]$h@*^Z*tt3Hu:*.|*x*1*E H***t.U='v=x*i`=*tEPjX1**tA:'HyP'X'H J hЇ'XEHm*@*|*x*(,EPiXu u{XZu uY[}um='t,Eh@1f^E= *u PEuE='u}rEjOe^=''7= *uhթ[u\[!jhM1Pj:kÃP f$hY|=V'uL= *uCEPh$W1Zu EPiX8tEP$eXE*1ۀ=n't$=*uEPdhX*n'u'j4Z!s^XC̈́RPZY=n'=*4'*5*h$Ї'XUWVSpE 0hIj赒1ۉ]' 1'] ;E9hEWY*ZYEWf_9EuphFSuQ tZftatDeuI렃gu=j5,2EZYz5,2h> jj^'E ]SuNZYy hFyEPhBt @uU y hF-X}Whht@uU y hF XEPht@uU y h(FXt$FvE 8uVEPuWSS-^1ɉMME 8URu VYZURVYZuURV^ZuoE 0P'DPt"VIPS#VS$E9jh3FV*f uVSEZYVh*Cv E E}tSju y hj i}t WhgtumT y h9F誎Xj8UWVSu 62hIj ws* xo*11ɉhdtlp11ۉ`jh'hFVuE`Rtf(LtntMH1һ뮃PthtPdtXfuuDžl뇃vudDžds=,2hDžpYMDžt@Džh1'M)tIu u` pt$t*tt hFjDg t)ˍ4**>=*tzj:Wm7YZt@0j.WYZ`t!h*W_Z@`u BI >t0<#u *h*WmZY@u ۉ 8xPWZY@u Whjf=*tE*E*jSVNǃ tl`1h>pu jSW!X WRX CHHf wg$q!s 訐Psh+Džl-=s ~PshttDžl@, Džl-*ht)KPt9Qu*t;Au A<5*RslЃ t"`tsh> Y[ds(Z5q8t hjdVQUWVSu \^fT*h*] P* ʈP*d*^P* ʈP*`*-]Q*%$*fV*\*hB膉[t hvQrYs!t7GtPSaYZu  ShPWhPjc1hQVuJ A6$ r!*3(*|** x**ˋ=,2hW`YZuhPW`YZ< 댡,2 j j5,2 ǃ uCo8"u 5,2hPD=d*Ej j5,2ǃ t =h*!n8"u5,2hPjbj j5,2ǃ un8"t=$*5,2hP뺸l5,2]cZ@_Pt*`*1`*y*jp*_t9t  $*v jh1QuhOQ \*tt hQja *P*ǃ;=`*u/;d*u"T*;h*uQ*9rt1= '**  '=t*t!Pu=|*t'U)…4=x*tt  1Ljhh@*PQmPLy h@*v=*uJLxPPwDZYLu&%=u**w($r!J$|*PJP5!hW^uhQPh^hSSǃuSh> vY[hPX5XZthWsh@*h*VS25(*h*V6 V8X1\`dDžXhVXPj5 _Džy0Ck8#tjVj hDŽj5_jVj nP nPohƃuPSVh8 TPh!Tu hzjjPh?hh\ÃuVeYSxTPZ9ujVj@ TH h<V?LY_uVh> 迃XZ*e׋H󫋅LL^7XtPDžu V[ghQhX'Q7'H'ZYyh'8X'P'0t- t( 'y h'i8_'P'΃߃NP+^ JP5=,*u ,* =0*u 0* Ph*h+Y[J*l*P=l*X=*t * ,h@*h*hX'D/5(*h*hX'3h* Zxd-h<vR[_uvh> jL1JPhmdP hvPj[^~W\Yu Wh3N{*eȺ*t jSRH, h* ZIPjW UWVSjj]Sjjh{!@u h\j [uuYtjjSPjh{!踂@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ.MQh> U1G맅u) `'yhX'j wXZX'PX' 1e[^_]UWVS ƅ]-ƅ_1ۉH*L*H*15P*T*P*1=@*D*@*1h]u u@ ycPtJTtgxPl${! 0*뫃 0*q 0* e 0*Y 0*M5,288*Ye5,2>Vj:V)[Zuha]SHP*t)XV3VZYXu C[ӉP*=H*t h~jX,2tuh1Ҁnuxou܈'h P^_tIH**3֋=,2u 0*iI,2@*2Obh|!Phw]h'jx ^]4* 30*t 0*t 8*'M Tu)tP1ۉXhW h?V 58*P6;XRrRh&RLUZYTLSG8jjLRPV29X}XTPT0VhP3Jà uj/SZYuSh3hhSVwHXu"VGXu9S|G^ty2LhVIà LVh> juhLRSZYh\LRSZYSh]jjhVjScǃu Vh]jUh`*hzd@P\A uWX*`PhedAW2A @uVh]WV(QH__9~Vh](:Y1҉jjS&X\ \UXH8uX8u2X8$Shj$8'`9!ЃPu#@'TP`9P'T !@HtPSIZY@u֋Hxu ShSUZYu[jjnUhU u=jhUY[ujhh Phh%j :jURPy @t-Et PhfXZjh>*UZYtj }Kh(afj lKj jhjk hcu VU' t1ftsu'q *Ph>'YX95't hU'Zjj hj7j0u.EE EjjEPEPjEPf$@u 5K1ۃ8É*'t*- '-3* 'Ӊָe[^]UWVS]} DžhDžT1ɉL11PXDžDcx hWSJ% ubfFt/RODžPg7$D!5,2>DZu5,2h|Xu,28#t5,2 vCZYt PhaYXCt PhLXZj dXF 렅?usv7\jWLP`KL`ҁGYYxu^ 11Lt`L$`[XjIYHt`\[ZWV`\KnE8u Pu\h> j(9xP\ ZYuHu9}u9ut1EE`1€u%P`9tVW\J&\xXHt`\BY[WV`\JAhT!Bt*TP\ @u\hU^XZ1e[^_]UWVS ]1XPL1 jjjTXP6hP'à tTh'6QY_ uxjSXZu3@8Sh]ju4rjWoXZ5h *hzd@W W!X*=*NjjjjXPډ5Ã&E$ƅ ~h&WY1ZYt"hWH1ZYth\W71Y_uTv?_ZuF 4u>hW0ZYu%F 4\u vhWhPb&ƒ NFjjLWv XP4 j\Pp^_1u?hj2i T\P'>ZYu \;F9|1hSWNj/WtPRT-YTD9HH\PhedAW @uW_=4+u4+u hjdtX uuh`+hu.h~P^_`+thO$Wh`!j`+t(4+1RP5<+58+8+<+8+5<+19|z<@u t#4+1RP؉ 8+<+19| ht0 8+<+9sSQWRPhjtOtF <+ 4+8+%4+RP% @u5<+58+Wh?j*0PY[@uWhZR>XZ à |8uy5,2h|hj  - - -@j|P5,2d |8ud5,2h`j|P5,2= |:u Pv5,2h#w. -jjX-,2 - jjh-,2YX|P5,2Tx,XZ|8u5,2h-Dž`-,zutx ,t!t hO,vs!t h91=,~W!t hhٽrfr fp,٭p߽h٭rhl,,PT߭P ٭p۝P٭rP ,hl ݝ(uu hm-Щu ẖX,t,У,\Hu 9't 9}hh -x-I辥|-%Y^=u - - ux-h-fH-L-u8D-`u ~ - 1~ -5@-=-Wq*-Zu Whj-@-P't DKt@9t)Ѓ ~hX'5-hjEMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh%R?FƋ@-D-H19}Ld,@91B-uQhVY9~@-d,PhCyCXZj Xt苣9} d,Fc,-xt&jSjh5-^@u hb3X-t&jSjh5-^@u h3_-t&jSjh5-^@u hb3^-t&jSjh5-b^@u hP3Y- t-f,,|-,,,t',ƀ,')ˆ,ƀ,,( ,H,)ȣ,,jSjj5-]y h)q,,@dB-f@fJwuJB  \-J l-J s*EjEPj j5-,]y hwt)jwPj j5-\y h-tTjh\-j j5-\y7h{ s'jh\-j j5-\y hND-5|-LSPh -hjhd'hh5-K\yd'-d'h5jhd'hh5- \hj1= -=$-=(-=,-=4-=8-=<-0-EpEĀ1EEEEjEPj(hpj)臣XZ19,~hl,jl§CY^h`,jlx,XZٞzt,-`,݅(=h,ݝ01HL ݝH104hl,jul^_݅0zt -l,݅(=t,ܭ0ݝH,9,}{݅H؞vll,H,謞X s=`'t#-tl,H,svܕHvo݅He,  ,vݝhT,l,݅hܕHv݅Hr jLݝh-EfEjh -j @݅hu hX] ٽrfr fp٭p۝h٭rhPjEPzN ( 8 ӡh)EEPURj5-5-5-輴Xy3K8 |hs-h'Y[ hl,j0j-D`_Z~9XU8-L uGPXh|! X`)dDhh@;, hfX,Hff9u `'0,l,$,=(,u=$,u0,󥡰,\@,-1PT s)hPU@ EʉU1ɉMiE'%Uthp U0,2ݕP,,݅P,,h'ܝPv ݅Ph'݅P,v,؉ff-!@t-\,Dž@ff-,@1҉\9XDpfuETPV@d葧,PЋX)t6(uR-u-t@-h XDž\7- u- t -hRXh 뽃@uhhf@fXffX')Jf~8-t1KQ@PRh艿-t 1}ufX'-uY\uFDphfXfuUDTPV@d;Dž\5D-Fd9{-n@-)Pd,PhDP| A9~hd,8DuC烽\uODxhf@f\fuCTPW@dohDPd,P+@-ShQ@-;D-}+u hS) _hDPhsCY^Dž\`<$!jdhZh@<$!hchYhOhEhf@fPh7h#h7hO hhhhhhhhhPhjdh_h:袼dh.^1ɉPTDž\1ۉ@jdhZh@<t%w uhH<uhhYXhgPh ^_h Ph.jdhE[FhfPfh@fRPh覻 jdhYhjdhΡZh jdh訡_h@t <uh<h&^ PhZY[dh菗]jdhCZDh@Phv輺dhH^_jdh[hjdhԠYhjdh讠Zhgjdh苠_h} Djdhh^ih!jdhE[Fhɹ3jdhYhPh蔹XZ-dh&Dp`<wg<`x^FXsI\s)`hXX])k`D`X) 蛖뺍FX`xFv<9~<Mtj$Ph> j}tVS(h̑j}fDžu P_2t8=-tj jhّU$Wh=-t j jh6$Whj$8j jh̑$ tVWhjm$Whj[$ hIh{hG%jjhIh{h0% }uVjj%jjjjjj  jjjj jjԥ@u hj}jj蹥ZY@u8th=j^X}uУjK_j jzZY@uQ8t+hY2 u hBZ WXVSYh$ 0"jjƒ IBucSPhjUWVSDu]  '-hd!SVa v~jm cStITtbLu-뼃dw$')ƍv-=-tjjh~a訣- >Ejjj"v-jURh@hP1G @u h:Y=-y h jF;u=-! . WDZ) '    ms / =-t1ɉڸ1ɉMhjE؉EhjE܉EhjrEȉEhj`EĉE hjKEEhj9ljEhj(EMU ʃ} ʃ} у} хuu h]E1҉-8gtj5-ȣ_X1ɉMEIEIFEȅCEċS:-%BRU軦ZH3U$!-"0'-0'-0'-0' o-dY-J-;-0(  @uCEċSEP1ɸ uCEċSEP1ɸxuCEċSEP1ɸSuxCEċSEP1uXCEčM̋SEPpECEu$CEċSEP1ɸ=X -uCEčU؋CܕEusuċs t^-hw$X!]1R-F-:- .-@"-- - `- - -t - -t1-jjV荊1s R-uM̍EPUEuM̍EPURYuCh s^Z=-uhDhYhw@ -DHw*=-uhqhhw 1ۉ-SEP1ɸ^Y]ċu-Ã]uh1];au uh- -t]ȉ]thj1uąu}t }ċ]=-uMEȉEO18E0@1҉-1atctguTE-Eģ--P-@P------`--tyUU9sHxt)Ј-tKU؊B<w r7ED T 9sJU L }؍W9sIH X--tM}tHpVWhX-荘 =-t =-tX--tKMtHxWQMV8 =-t =-Mt 謓-tKMtHxWQMV =-t =-MtX-tKMtHxWQMV萗 =-t =-Mt)-tKMtHxWQMV< =-t =-Mt:谒- tKMtHxWQMV =-t =-MtG\-f5-=-t!=-u=-t)-贔=-Vh-5-艘 u(87t聒PhӍY^9~kPh轍XZu83u =-tH8t- - - -PSVZ 11ɉډe[^_]Wje[^_]UWVS }h PYZYƅh/u W t.at"t=t"-,2t"-þ뼡')Džt>upt"-t&hS^_th SZYt2=t"-u)U `"-ujOuSh h'踨Sh h'訨j7="-u."-h u W t@A3w$0!z="-u"-먃="-u"-듃="-u"-{="-u"-c="-z"- Gl"-8"-)|"-"- ="-""-@"-d"-h"-x"-5,2`"-X="-"-="-"-j=t"-,2t"-hPY^>p"-/="-F"-5"-)'EU)tHt:t#u =x"-=l"-t =h"-=t"-tEt hWYZt&h WYZthW_ZE U @7@tCƀ5|"-jj5x"-5"-5`"-ne5|"-jj5x"-5"-5`"-4>5`"-Sj ISh> j/`"-ɥ=p"-jEPj} @u h  EUuuh 躨[h`RPvh) Ǡt S菨YE  1SQ%1RPh9 臠f1=p"-t=TWphCV_Zt)hx VZYtquShP 2j Sh{ #jLjEUWVS u] 1ht SV tRtfu2&-ֿϡ'9td1ۉ`uXVSIZYVxPV\ZY%=`h=@uv/u^Phw A[^Dž`ddPhS FSh> j0hٺ豳uٺ蟳Åjhh hVCl=&-u Džp6lPV `e[^_]UWVSd蓇hIj# XZE 00s1ɉ F-- -$ 1ۉ-$$ ^u$ -------1ɉ - - -F-1ۉ----$-15P-L-1=H-D-8-0-14-,-F--K-h$ Xt/hShK- =vj?( $Sh$ 9|`-hWZ<-u <-h$ f_h PY^u -hS_Zu15-1ۉ-QhSuZYu -4hSX^_u-- Sh$ ߁Y[_h$ P_Zu-15-h6% SY[u -h$ yZ-t8u -I=-t-8uh$ VX1-h1_thtP|[^1ۅf'ftPY--X'ff'ftPcZt!-ub_t -$-111Bh5,2hK- =v#j? $5,2hj-U Eh% RP HP̃D1$0!-1=-=-\-jP5,2 't8{5,2h?%  l`--YT-J1ɉ -=5,2$5$-XZ1-1=-5,2܋-$ ;PZY-',2--1-j P5,2 |-~8z5,2hT% ji-Yj P5,2` @-~8*5,2hg% 뮋5,2j hW 5,2Ί_h PrZYt"8u5,2h{% GujPWY @X|,-m1-5,2>XDžI1=-=-6--5,2~Yh`-y5,2h% d`-42?uX'qU1Ph% ,}XZ'SUb542h% Ph% +jjj5-{E')ЉEE E 1t`--- -tq1-DžDžh-RjVgt& uH0P-g_PVh& 1ɉ O- O-hթ^t8t P蕈ZO-uPXu;P~Xt߃=O-uF t8t PJ_O-6=YO-=K-uyO-uhZO-ghPhK- =v&j?$5O-h1& `{ K-hh)& hK-m =w=O-tj @$ h?& P_ j h(V/ hI& X :Sh XI Sh XI Sh YI Rh u_I RhU& YXX Rh[& =X#  Rhe& !XI vRhp& XI ZRVjrzXZhj^Y^hj^_XhHj^XZhHj^Y^hj^_XEt7U ESRPà F-uS蜉jjz^_XjXE j:0g[^t*E 0$YuU ERPXZGjh@-\^_uh$j^^_hsj ^XZE 8j@WY[ƅt @]hPS E @1ۉ-t1ɉ \- -EQ@PֈXZ-=-u u @-ujVW =-t 1ۉ@-71҉``-Ph& 5-蛕 5@-ѭY=-\뿃jh@-[XZh$j\Y[hsj \^_HTe[^_]UWVS}u hPZYtWhSZYthSZYu.)~3ltXnuzh3 VW du.׃Vt1PσwB0'뾃cu3..h!hIh'cjh!hIh'HSh2 h'8jdž'9u#=.t 1v#M1"};u5.~UWVSu 6~ehIjY1ɉ . 1hg8 Vu˻ ua`Gt+It2EtHa<$t! l.먁%l.뜡,2uI..zx.kt.5,2$b5,2PuhWS,21۲ l.,2uI.1҉.jjjhX' h7 /p.jjjhX'Y h7 AX|2PPh7 h'%j贄'4 t.ut  v>tt 1载j5.VhX'萬 t h)j5.6UWVSP}1ɉMM1h9 u W薹 t3gt!utGu.,2E,2;u,2E85'9Et3S.Zt@E%UCMM@uSh9 j 1}1ɉM}t E~E1}t6h EP,gYZt"8tu h9 jGCDʋE 46'Z@u6h> jh-uY@ttEPWY_Z@uh9 }tu菀Y@u h9 jztuCZ@uhFtVRPR^vh> jCh4^Xujh9 SS|Sh> jUWVS EE܋} 7baN[th@ 61uuuuEPjZY@uh@ jA[t h@ j11ɉMMԉMh@ Wuf C3$! 뷃}5,2E\.뎅 |j5,2PYZU,2E@zuZiPS'}B5,2EY&5,2PPSYÃ5,2PYZPCP XZ`.t}5,2~E\'Hu}:uo ,uaT.'U)‰U܍<}uEI}uEI}u+ \.tbuEEHFvhA (=\._h+A aoX묃RhLA Kow$!jSWu jjWuw7l X}u#UG%@uhqA uEC S^3}tDuY#PZuVSV\Í@P {u8CujC_s PY^t hA *=\.uSZhA C}tPP?Xtq`}c7XtYCt#tuhA mV2@0ًFttIt؋@0VYu7hB mXZN Vj9B F3 s 6 v CF C FC{uFCVf_}t]uLYtPvZuW?uh? l cSWÍ@P {u=uhA 4{tSs s jCYu =\.uJK SjBB Cjvs# GWCPSu5hKB #C}tP9PZZt"lXEԉE ]e[^_]PS|LU܉؍e[^_]ME*M9}4hI7h:  U܋E؍e[^_]ȍe[^_]UWVS 1Eرe 1E111EEh)k u u t\n`~3a w+$("ȃwt.,2빾1E1LEEE댡'EԋEM)ȉE܋E MI~ 2k }~ }tXk MMtrk مt&uk 'EE Ev '`t&uk 'EEE0E.'6}t&uk 'EEE0' 1ɉMM1uWjSuƃyjSuXZy Sh> j}tuG 1ɋ]9}uAVEY1ۋE9G tUURPRhk i%=u uW*XZC벃}aE Mԍ}1ɉMj=RUD_ZUu hk j19s x+u@}HM3$P Yt 3hk t+u 3hk P EVEЋE؁` ZWuPE軂EH ʀuʉP EVEЋE` EY}9}*~3~@ ZƒUt 3hk JA EU9UuVEYs uW~XZE]9]}"G t7hl jVt1Vt1e[^_]ÍL$qUWVSQ,Y1P01 0108@<4ho S, H0"$"62%625,2f001Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f00F누0f00%1ɉLj LP5,24^ƉPY 8u!,28tL8u ;Ph~ kj LP5,2,2 ~:t L9t Rh~ 0 62@sth~ jf 62jhX' 1D'H'L'XZ#,2@ 62j LP5,2P',2 :t L9t Rh~ j@=Rh ,2< 62 8LP5,2J,2_X:tL8t Rv)ݝ z݅ t,jPh4  v RhX EٽFfF fD٭D߽ ٭F $5D'=H'߭ ٭D۝ ٭F L'xy5,2h  uhn cL'^ 62[th j LP5,2V4,2 4x8tL:Ph '0%62 62 62 62 ,25P'tDFu h 4B卅(R$R RRRRR RRRRRRRRPh%QƃH1Ʌ~ )162hVL|Y10@9u919~0PhCy|GXZj ){ 62t1DžtDžxDž|Dž:h2Vj5,2,MtPLPh 2pH2P2PL 62@Yj LP5,2X',2 x:t L9t Rh =hh* 62% - 62z62%62% 62RLP5,2F@0XZL8u 5,2h@LP5,2dF80^_L8u5,2hQ ',)Ht̏462j.VY[Åu VMZ)?wSVP蔏Ƅ t@P't L'fA۹1󫍅PvKjKPPPwSVPBwPdPNy$TVh j轗 Hd`hSVjۜSe=X62t=X' h ^Xt1DžtDžxDž|Dž:h2RjVJtPmIPh> j2HtΉ50pu h؀ H2p ppN=2 y h G62@t"52h2P t h @1DžDžDž:PtPj@!ItP~HP@h j&xt62t h j]Xppj0j)52 t h: Y;HX62tVDžjSj'j)52 t hS jSj(j)52p t hp PdPY62^_Шu h  u0X'1҃‰`00@s Dž@0 1ɉ `0X'@,Zu h Rtdg001J0@0Džd62@t8jdPjh52_ @9s0@Dž@=2u(jPj j)52 @u hƁ 20t/҉jRj*j)P @u7hځ YDžjRj+j)P @u h ,62%u) t DžDž j Sjj:52< y h 62t-DžjSj&j)52 t h- =P't188tb V_u hH T$05(01҃8t4P 1 C)C.C,ރ 9s11ۃ<t/8<-|8BYu ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgfsckfsck_ffsgptifconfigmknodmount_cd9660mount_ffsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsswapctlgzipgzcatgunzipchrootcgdconfigwsconsctlping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %stotalcannot seek temp filecannot read temp fileinvalid addressline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark charactered.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicmbr_bootselmbr_extInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedasyncgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizefragment sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:more than twoexactly twoUNKNOWNdisremainstat failure on: %sinvalid device: %smirrorFor RAID level %d the number of columns must be %s. RAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpare%d %d START disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered newNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]releasepreventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParameters%s, %sError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENALIAS, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexINTSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGTERMhcxndaNR@8MOUSE_STARTMOUSE_ENDcmsobc|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGutf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done_(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-c%s %s %slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshiftquotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] /bin/sh~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberhddvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf record%s: unknown variable %s/.tiprcset %sbeautifybaudratedialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftprawhdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymappasswordresetvideosunsummodulesbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: not found%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil done; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %struePScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilfor";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalchdirletfalsefdflagsgetoptsfcinputrcprintfsetvartestulimitumaskunaliaswordexpPPID20220122 BUILD:20260401230650Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrqfsck_%s-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fs** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%jx %*jx %*juBKMGTPE%s: %lluen_GB.UTF-8 (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %lUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: Long_Type: %s Attributes: %s Could not find index %dDetails for index %d: StartType: %s (%s) None %*s index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]gi:b:luaxAhHpW:wGPT not found, displaying data from MBR. %ju %ju %u %5dshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressvltimepltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEinetnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedmetricSIOCSIFMETRICmtuSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:N%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics 2easector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkexpirehopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesSO_RERRORassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen%s/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSPriorityCapacityBadDevice%-*s %*s %*s %*s %*s %8s %s %-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetformidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expectedread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%s%lu: %s: %sfirst RE may not be empty\%c\%03o\%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-ifailed to read passphrasepflag set inappropriately? (echo)%s's passphrase%s:failed to generate Argon2id key, error code %dfailed to generate PKCS#5 PBKDF2 keyusage: %s [-enpv] [-V vmeth] cgd dev [paramsfile] %s -C [-enpv] [-f configfile] %s -G [-enpSv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] paramsfile %s -g [-Sv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] alg [keylen] %s -l [-v[v]] [cgd] %s -s [-nv] [-i ivmeth] cgd dev alg [keylen] %s -t paramsfile %s -T [-f configfile] %s -U [-nv] [-f configfile] %s -u [-nv] cgd with alg %s keylen %zu blocksize %zu ivmethod %s can't open cgd "%s", "%s"%s (%s): clearing opendisk_werror(%s, %s, %zu) called. getfsspecname failed: %sfailed to parse key lengthfailed to read key from stdinencblkno8encblkno1CGDIOCGETnot in usedev %llu,%llu keylen %d blksize %zd opendir: %srcgdbad name %s/etc/cgd/cgd.confcould not open config file "%s"\\#action failed on "%s" line %lugetkey("%s", %p, %zu) called command failedcommand output too shortcommand failed with status %dunrecognised keygen method %d in getkey()sk != NULL/usr/src/sbin/cgdconfig/cgdconfig.cfailed to derive HKDF-HMAC-SHA256 subkeyunrecognised shared key derivation method %dinvalid parameters file "%s"nbits <= INT_MAX - 7ret == (int)nb64flags == CONFIG_FLAGS_FROMALLwrong number of argsdevice %s already in useparams invalidcan't read disklabel areapread: incomplete blockre-enter deviceunsupported keygen methodcan't read mbr areacan't read gpt areaunimplemented verification methodverification failed permanentlyverification failed, please reenter passphraseCrypto self-test failedCan't disable coresCan't lock memoryCGP:STUV:b:ef:gi:k:lno:sptuv-P is only for use with -g/-G action-P only makes sense with -S flag-S is only for use with -g/-G actionFailed to parse key lengthno keygen in parameters file "%s"Failed to generate defaults for keygeninvalid parameters generatedcan't preserve randomly generated keyinvalid old parameters file "%s"old filenew filecan't generate new parameters fileout of dynamic memory in yyensure_buffer_stack()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()foo%s line %d: %s at '%s'yacc stack overflow%s: failed to parse parameters file tmplen == PRF_BLOCKLEN/usr/src/sbin/cgdconfig/pkcs5_pbkdf2.cpkcs5_pbkdf2: calibrating iterations...%s %s; %*sshared "%s" \ %*salgorithm %s \ could not determine key length for unknown algorithm "%s"re-enterparams_setverify_method: unrecognized verify method "%s"keygen argon2id must provide `iterations'keygen argon2id must provide `memory'keygen argon2id must provide `parallelism'keygen argon2id must provide `version'keygen argon2id does not need a `cmd'keygen argon2id does not need a `key'keygen argon2id must provide a saltkeygen pkcs5_pbkdf2 must provide `iterations'keygen pkcs5_pbkdf2 does not need a `key'keygen pkcs5_pbkdf2 must provide a saltkeygen pkcs5_pbkdf2 does not need a `cmd'keygen pkcs5_pbkdf2/sha1 must provide `iterations'keygen pkcs5_pbkdf2/sha1 does not need a `key'keygen pkcs5_pbkdf2/sha1 must provide a saltkeygen pkcs5_pbkdf2/sha1 does not need a `cmd'keygen storedkey does not need `iterations'keygen storedkey must provide a keykeygen storedkey does not need `salt'keygen storedkey does not need `cmd'keygen [u]randomkey does not need `iterations'keygen [u]randomkey does not need `key'keygen [u]randomkey does not need `salt'keygen [u]randomkey does not need `cmd'keygen [u]randomkey makes no sense sharedkeygen shell_cmd does not need `iterations'keygen shell_cmd does not need `key'keygen shell_cmd does not need `salt'keygen shell_cmd must provide a `cmd'unspecified algorithmunknown algorithm "%s"(warning)unspecified IV methodunknown IV method "%s" (warning)unspecified key lengthcould not calibrate pkcs5_pbkdf2can't generate random bits for storedkey(u)randomkey keygen cannot be sharedstoredkey does not make sense as sharedkeygen already shareduuidgenuuid_to_string: %ukeygen not sharedargon2idpkcs5_pbkdf2/sha1urandomkeyshell_cmdunrecognized key generation method "%s"hkdf-hmac-sha256unrecognized shared key derivation algorithm "%s"/etc/cgdfailed to open params file "%s"keygen storedkey urandomkey; argon2id { iterationsparallelism}; pkcs5_pbkdf2 { pkcs5_pbkdf2/sha1 { keygen_fput: %d not a valid methodiv-methodkeylengthverify_methodunsupported verify_method (%d)could not open outfile "%s"encblknobits_decode: mangled base64 stream %sbits_decode: encoded bits claim to be longer than they are (nbits=%zu, stream len=%zu bytes)/dev/randomcalibrating argon2id parameters... failed to calculate Argon2 hash, error code %d failed to calibrate hash parameters: broken monotonic clock? failed to calibrate hash parametersargon2dargon2iArgon2idArgon2iArgon2dUnknown error codeThe password does not match the supplied hashSome of encoded parameters are too long or too shortThreading failureDecoding failedEncoding failedMissing argumentsToo many threadsNot enough threadsOutput pointer mismatchThere is no such version of Argon2Argon2_Context context is NULLThe allocate memory callback is NULLThe free memory callback is NULLMemory allocation errorAssociated data pointer is NULL, but ad length is not 0Secret pointer is NULL, but secret length is not 0Salt pointer is NULL, but salt length is not 0Password pointer is NULL, but password length is not 0Too many lanesToo few lanesMemory cost is too largeMemory cost is too smallTime cost is too largeTime cost is too smallSecret is too longSecret is too shortAssociated data is too longAssociated data is too shortSalt is too longSalt is too shortPassword is too longPassword is too shortOutput is too longOutput is too shortOutput pointer is NULL$v=$m=,t=,p=WSDISPLAYIO_GTYPEWSDISPLAYIO_SFONTWSDISPLAYIO_SBORDERWSDISPLAYIO_PARAM_BACKLIGHTWSDISPLAYIO_PARAM_BRIGHTNESSWSDISPLAYIO_PARAM_CONTRASTWSDISPLAYIO_SSPLASHWSDISPLAYIO_SPROGRESSWSDISPLAYIO_GMSGATTRSWSDISPLAYIO_SMSGATTRSWSDISPLAYIO_DSSCROLLborderfontbacklightbrightnesscontrastscroll.fastlinesscroll.slowlinesedidmsg.default.attrsmsg.default.bgmsg.default.fgmsg.kernel.attrsmsg.kernel.bgmsg.kernel.fgsplash.enablesplash.progressWSKBDIO_GTYPEWSKBDIO_GETBELLWSKBDIO_GETDEFAULTBELLWSKBDIO_GETMAPWSKBDIO_GETKEYREPEATWSKBDIO_GETLEDSWSKBDIO_GETENCODINGWSKBDIO_GETSCROLLWSKBDIO_SETMODEWSKBDIO_SETBELLWSKBDIO_SETDEFAULTBELLWSKBDIO_SETMAP +> WSKBDIO_SETKEYREPEATWSKBDIO_SETDEFAULTKEYREPEATWSKBDIO_SETLEDSWSKBDIO_SETENCODINGWSKBDIO_SETKEYCLICKWSKBDIO_SETSCROLLscrolling is not supported by this kernelbell.pitchbell.periodbell.volumebell.pitch.defaultbell.period.defaultbell.volume.defaultrepeat.del1repeat.delnrepeat.del1.defaultrepeat.deln.defaultledstatekeyclickscroll.modescroll.modifierunknown_%dBackSpaceLinefeedEscapeexclamquotedblnumbersigndollarampersandapostropheparenleftparenrightasteriskcommasemicolonequalgreaterquestionbracketleftbracketrightasciicircumunderscorebraceleftbracerightasciitildenobreakspaceexclamdownsterlingcurrencyyenbrokenbarsectioncopyrightordfeminineguillemotleftnotsignhyphenregisteredmacrondegreeplusminustwosuperiorthreesuperiormuparagraphperiodcenteredonesuperiormasculineguillemotrightonequarteronehalfthreequartersquestiondownAgraveAacuteAcircumflexAtildeAdiaeresisAringAECcedillaEgraveEacuteEcircumflexEdiaeresisIgraveIacuteIcircumflexIdiaeresisETHNtildeOgraveOacuteOcircumflexOtildeOdiaeresismultiplyOobliqueUgraveUacuteUcircumflexUdiaeresisYacuteTHORNssharpagraveaacuteacircumflexatildeadiaeresisaeccedillaegraveecircumflexediaeresisigraveiacuteicircumflexidiaeresisethntildeograveoacuteocircumflexotildeodiaeresisdivisionoslashugraveuacuteucircumflexudiaeresisyacutethornydiaeresisAbreveabreveAogonekaogonekCacutecacuteCcaronccaronDcarondcaronDstrokedstrokeEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLstrokelstrokeNacutenacuteNcaronncaronOdoubleacuteodoubleacuteRacuteracuteRcaronrcaronSacutesacuteScaronscaronTcedillatcedillaTcarontcaronUaboveringuaboveringUdoubleacuteudoubleacuteZacutezacuteZabovedotzabovedotZcaronzcarondead_gravedead_acutedead_circumflexdead_tildedead_brevedead_diaeresisdead_aboveringdead_carondead_dotaccentdead_hungarumlautdead_ogonekdead_slashdead_cedilladead_semidead_colongr_Atgr_Etgr_Htgr_Itgr_Otgr_Ytgr_Vtgr_itdgr_Agr_Bgr_Ggr_Dgr_Egr_Zgr_Hgr_Ugr_Igr_Kgr_Lgr_Mgr_Ngr_Jgr_Ogr_Pgr_Rgr_Sgr_Tgr_Ygr_Fgr_Xgr_Cgr_Vgr_Idgr_Ydgr_atgr_etgr_htgr_itgr_ytdgr_agr_bgr_ggr_dgr_egr_zgr_hgr_ugr_igr_kgr_lgr_mgr_ngr_jgr_ogr_pgr_rgr_teliko_sgr_sgr_tgr_ygr_fgr_xgr_cgr_vgr_idgr_ydgr_otgr_ytgr_vtShift_LShift_RControl_LControl_RCaps_LockShift_LockAlt_LAlt_RMulti_keyMode_switchNum_LockHold_ScreenCmdCmd1Cmd2Meta_LMeta_RZenkaku_HankakuHiragana_KatakanaHenkan_ModeHenkanMuhenkanKP_F1KP_F2KP_F3KP_F4KP_HomeKP_LeftKP_UpKP_RightKP_DownKP_PriorKP_NextKP_EndKP_BeginKP_InsertKP_DeleteKP_SpaceKP_TabKP_EnterKP_EqualKP_NumbersignKP_MultiplyKP_AddKP_SeparatorKP_SubtractKP_DecimalKP_DivideKP_0KP_1KP_2KP_3KP_4KP_5KP_6KP_7KP_8KP_9f3f4f5f6f7f9f10f11f12f13f14f15f16f17f18f19f20F5F6F7F9F10F11F12F13F14F15F16F17F18F19F20PowerHelpExecuteFindSelectAgainPropsUndoFrontCopyOpenPasteCutStopMenuPausePrint_ScreenCmd_Screen0Cmd_Screen1Cmd_Screen2Cmd_Screen3Cmd_Screen4Cmd_Screen5Cmd_Screen6Cmd_Screen7Cmd_Screen8Cmd_Screen9Cmd_DebuggerCmd_ResetEmulCmd_ResetCloseCmd_BacklightOnCmd_BacklightOffCmd_BacklightToggleCmd_BrightnessUpCmd_BrightnessDownCmd_BrightnessRotateCmd_ContrastUpCmd_ContrastDownCmd_ContrastRotateCmd_ScrollFastUpCmd_ScrollFastDownCmd_ScrollSlowUpCmd_ScrollSlowDownCmd_VolumeUpCmd_VolumeDownCmd_VolumeTogglevoidSymbolL5_GbreveL5_IdotaboveL5_ScedillaL5_gbreveL5_idotlessL5_scedillaparse: %s [%.*s]keysym %s not found%d: keycode too largekeysym expected%s: not a keysym%c: illegal character in input%03o: illegal character in inputcould not list calibration samples%s%d,%d,%d,%dWSMOUSEIO_GCALIBCOORDS%s: invalid calibration dataWSMOUSEIO_SCALIBCOORDSWSMOUSEIO_GTYPEWSMOUSEIO_GETREPEATWSMOUSEIO_SRESWSMOUSEIO_SRATEWSMOUSEIO_SETREPEATresolutionsampleratescroll.reversescroll.distance.xscroll.distance.ycalibration.minxcalibration.minycalibration.maxxcalibration.maxycalibration.samplesrepeat.buttonsrepeat.delay.firstrepeat.delay.decrementrepeat.delay.minimuminternal error: field_by_value: not foundkeycode %u =internal error: pr_field: no format %d%s: not a valid number list%ld: number out of range%s: not a valid encoding%s: not a valid variant%s: not a valid color%s: not a valid attributeinternal error: rd_field: no format %dhilitblinkunderlineblackbrownbluemagentacyanwhitenodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepcolemakukczbeponeouadec-pm-monodec-pm-colordec-cfbdec-xcfbdec-mfbdec-sfbvga-isavga-pcidec-tga-pcidec-sfb+generic-pcinext-monodec-pxdec-pxgdec-txgeneric-hpcarm-vidcdec-spxdec-gpxdec-lcgdec-vax-monosparcbook-p9100egadreamcast-pvrhp-gatorhp-topcathp-renaissancehp-catseyehp-davincihp-tigerhp-hyperionamiga-ccsun24sgi-newportsgi-gr2suncg12suncg14suntcxsunffbhp-stihd44780vesaxilinxsgi-lightgenfbsgi-o2pxafujitsu-ag10displaylinksun-xvr1000omron-lunagrfvncapple-valkyrieimx-ipuvideocore4omap3530windermereclps-711xallwinnerssb-mgxamlogc-mesonnvidia-tegraplatinumprimcell-pl11xssdfbvideocore6dec-tcps2usblogitech-busms-inporttouch-panelarchimedeshildec-maxinemaplebluetoothlk201pc-xtpc-athpc-kbdhpc-btnriscpcadbsunsun-type5sgimatrix-keypad%s: %s Usage: %s [-kmd] [-f file] [-n] name ... -or- %s [-kmd] [-f file] [-n] -w name=value ... -or- %s [-kmd] [-f file] [-n] -w name+=value ... -or- %s [-kmd] [-f file] [-n] -a /dev/wskbd/dev/wsmouse/dev/ttyE0adf:kmnwonly one of -k, -d or -m may be givenexcess arguments after -aonly one of -a or -w may be given"%s" not shown with -a; use "%s %s" to view.'=' not found%s: read only%s: can only be set%s: write only%s: no kernel support%dx%dx%dIVMVendor: [%s] %s Product: [%04X] %s Serial number: %s Manufactured %d Week %d EDID Version %d.%d EDID Comment: %s Video Input: %x Digital (DFP 1.x compatible) Analog -0.7, 0.3V -0.714, 0.286V -1.0, 0.4V -0.7, 0.0V Blank-to-black setup Separate syncs Composite sync Sync on green Serration vsyncGamma: %d.%02d Max Size: %d cm x %d cm Features: %x DPMS standby DPMS suspend DPMS active-off Monochrome RGB Multicolor Undefined monitor type Standard color space Preferred timing Default GTF supportedChroma Info: Red X: 0.%03d Red Y: 0.%03d Grn X: 0.%03d Grn Y: 0.%03d Blu X: 0.%03d Blu Y: 0.%03d Wht X: 0.%03d Wht Y: 0.%03d Horizontal: %d - %d kHz Vertical: %d - %d Hz Max Dot Clock: %d MHz GTF2 hfreq: %d GTF2 C: %d GTF2 M: %d GTF2 J: %d GTF2 K: %d Video modes: %dx%d @ %dHz (%d %d %d %d %d %d %d %s%sH %s%sV) Preferred mode: %dx%d @ %dHz Number of extension blocks: %d %08xDELUltrascan 14XEVSC17GS17PSAACAcerViewAPPApple ComputerAST ResearchCPLCompalCPQCompaqCTXDellDPCDeltaDWEDaewooEIZEIZOELSAEPIEnvisionFCMFunaiFUJFujitsuGSMLG ElectronicsGWYGateway 2000HEIHyundaiHITHitachiHSLHansolHTCHitachi/NisseiHWPHPIBMFujitsu ICLIiyamaKDSKorea Data SystemsMEIPanasonicMELMitsubishi ElectronicsNANNanaoNECNOKNokia DataPHLPhilipsRELRelisysSAMSGISNYSonySRCShamrockSUNSun MicrosystemsTatungToshibaTSBViewSonicZCMZenith1280x1024x751024x768x751024x768x701024x768x601024x768x87i832x624x74800x600x75800x600x72800x600x60800x600x56640x480x75640x480x72640x480x67640x480x60720x400x87720x400x70640x350x85640x400x85720x400x85640x480x85800x600x851024x768x851024x768x891152x864x751280x768x751280x960x601280x960x851280x1024x601280x1024x701280x1024x851600x1200x601600x1200x651600x1200x701600x1200x751600x1200x851680x1050x601792x1344x601792x1344x751856x1392x601856x1392x751920x1440x601920x1440x751152x768x541400x1050x601400x1050x741152x900x661152x900x76320x175x85320x200x85360x200x70360x200x85360x200x87320x240x60320x240x72320x240x75320x240x85400x300x56400x300x60400x300x72400x300x75400x300x85512x384x87i512x384x60512x384x70512x384x75512x384x85512x384x89576x432x75640x384x75640x512x60640x512x70640x512x75640x512x85800x600x65800x600x70840x525x60896x672x60896x672x75928x696x60928x696x75960x720x60960x720x75416x312x74576x384x54700x525x60700x525x74576x450x66576x450x76-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype truncated no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedIPv6 addressIPv4 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signleft-parenthesisright-parenthesisplus-signhyphen-minusfull-stopthreefourfiveseveneightless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflex-accentlow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaymotuesdaytueswednesdaywedneswedswethursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselectmanual10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.NAME=sysctl hw.disknames failed/rdk/rno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format stringsysvv71kv8otherhpfshfsraidframejfs2minixfs3vmwresv%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%s^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$acosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llx%llirpn == pn!((*cp) == '\0')?xml !DOCTYPE plist