08i<  iYt ti@@<@T 08i<  iYt ti@@<@T Uit`Aiii$ hiiiAiiiA.iiiAiiiAiiiAiiiAiiiAiiiAiiimD"Oiii (08@HPX`hpx0$TiiiPX`hpxN$ iiiK$/iii (0M$,iii8@HPX`hpxFAiiiCiiiAiiiAiii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii B!iii B!iii!iii"!iii"!iii"aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii!iii\?!iii\>!iii\=!iii\<!iii\;!iii\:!iii\9!iii\8!iii\?!iii\>!iii\=!iii\<!iii\;!iii\:!iii\9!iii\8!iii\:!iii\7!iii\6!iii\5!iii\4!iii\3!iii\2!iii\1!iii\0!iii\7!iii\6!iii\5!iii\4!iii\3!iii\2!iii\1!iii\0!iii\2!iii\/!iii\.!iii\-!iii\,!iii\+!iii\*!iii\)!iii\(!iii\/!iii\.!iii\-!iii\,!iii\+!iii\*!iii\)!iii\(!iii\*!iii\'!iii\&!iii\%!iii\$!iii\#!iii\"!iii\!!iii\ !iii\'!iii\&!iii\%!iii\$!iii\#!iii\"!iii\!!iii\ !iii\"!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\ !iii\ !iii\ !iii\ !iii\ !iii\!iii\!iii\!iii\ !iii\ !iii\ !iii\ !iii\ !iii\!iii\ !iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii!$iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iiiaiiiaiii!iii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiaiii\?aiii\>aiii\=aiii\<aiii\;aiii\:aiii\9aiii\8aiii\?aiii\>aiii\=aiii\<aiii\;aiii\:aiii\9aiii\8aiii\:aiii\7aiii\6aiii\5aiii\4aiii\3aiii\2aiii\1aiii\0aiii\7aiii\6aiii\5aiii\4aiii\3aiii\2aiii\1aiii\0aiii\2aiii\/aiii\.aiii\-aiii\,aiii\+aiii\*aiii\)aiii\(aiii\/aiii\.aiii\-aiii\,aiii\+aiii\*aiii\)aiii\(aiii\*aiii\'aiii\&aiii\%aiii\$aiii\#aiii\"aiii\!aiii\ aiii\'aiii\&aiii\%aiii\$aiii\#aiii\"aiii\!aiii\ aiii\"aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\ aiii\ aiii\ aiii\ aiii\ aiii\aiii\aiii\aiii\ aiii\ aiii\ aiii\ aiii\ aiii\aiii\ aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\! iiii!iii!iii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiiiaiii!iii!iii!iii B!iii B!iii!iiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiiiibpf!iii $ iii$iii~$>iii$iii$siii$iiiAiiim iii$iii $iiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiJWox>4*TSw]`)5_1:otD9G04:e$I2.HdY$ Jdus/8CY><(&L 3%=q,{cEWF.dkoWAh' ̶SG"Q^g/]N2gӗLF dmL8N@ƆQI2E% (nn}J:69;a58ww |8]f.+ne"ܬC,Cs3{,K F ?*0qs* Ck8Z^Px6*?5&w^ v7n<c*H䷁oVDVR6}&lz.F\" !Y[g PZ4@j gwwT4@ф+uUGʳ4/8o!s~fbXuHcP Y]5!tʔt lFfPWa@~xot . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4"L4 (!wX!wX!x%%, &XLL!x%%NetBSDGwKPaX NetBSDearmv6hfeb4p@-D0D 0@`Qp(@P`F`F&a03/T@p$x$A-`0`` 0PpU(pGpG@Pq`P03/T@0US ֏$XH-x`Q MN h!h1 @`p0 0R0D1<  0S  /S 0S1Y Y9 T ,P(0PUH2H0@3(1*03/T@ 0地0 [* PC PE%Q03/Zd 0 P0 00$դx$X`$%Dp @-l dP`@P H]Y`POU P  M@&h(P@-@⒏O-`882@4RMt00t@0pWo  [P@tt@(k R J@PpZ0: S S`0SЍ.@P0`0x; 0xS0S P0S S0p WkP  0S;00 0 pP 0s s0T T@L   PpW&&\>'H&pAH0`  BR` pRp RX Xp/&&@-_0 &h 000/&pC-؀-`P p0M@ {@ (@{{z`P$0  ^Ѝp@Y&% &h@-@ M00@  P  Ѝ0A-` l1V0zP 0 @P@TV PC j W@@7^0S@ Z@0;0P W 0Xp^V p^0-S Xd:Hp 4@0SV  W %G=&QO-5MpY xTp ?`P` Ѝ  p` 0`$5XP0S 5%0 0 5X0S40S* D$尠D00CS0 @ Pp  @YT `0 @00CS0X}0 X0 p00p p@300 80: Sx h+xp@ p  Qt X0 0( 03,$0000x 00 Q00S> 0 0 `Dp2  tk 0Z 1(#00 H  0P \\NP 4 `+X"J R0  p0ZZ3r0S P $!Y' p00 R0S ``0S 0 >(d P < `V k`0 ?oR20S 0  0 0R0?P `P hh`0S H,` P0Rt00!P &%]&&&&&&h`&o&&&x&&&0@-MM@P  yp  ;0U$C dP TTۍЍ08 P ,(0P X%&Q@-@ TP DDg,P $ 0P@%&Q@-@ XP HHH0"P $ 0P@%&@-p\0 &h0$/'0$/'@-`@-v@-@-W@-0! 0  0 Ѝ'@-0! 0  0 Ѝ'@-0! 0 v 0 Ѝ'@-0! 0 g 0 Ѝ'@-0  0 X 0 Ѝ'@-0  0 I00 Ѝ''<00/@-0  0 30 Ѝ' '<00/@-0  0 0 Ѝ'  '0 @- 00 $0Q@>.Ѝ1%< A-`M!A!qX0 p! R0B=0B  P 0H 8 R8B 4!010,!0ЍoPP =K0P   0S  0 pP,0P      0 3/R ! 7000<040LD0''' ,=#`'<i|0p@-@PP0 00R00 p800 p0  B0Sqs '''0 0 0 /'' @-4@- @-,@-@-80M@0(@3/P $ "H08 : S( 0h 3/P   00 0Ѝ00 0 1/pqZ0S 00@8m@-@?PЍ@ PЍp@-(`Vp80@  03/PP8003/(Pp@-@P`P 80 (0(3/@Z P  ZPЍp'O-2 PM`P(`,PB  0S9P06 I0S +%0 % 0 R,P0(`R0 *0 A@ 000+ |tpx +?0x ЍO0 P % pHp 81/pq4 ` |?P p 4 TI-Z0S4 < p0 )0 )">)0 )'0 '0 %)0 VU)(0, SR '0 ''0 ''0 [X'y 00 0S04H0V004 4pX TЍ'9'R/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-hBM 0  P 0  4 U$0 0!( Ÿ}/LB/DPN#b`0@ R%H }//@#b`_`SP0!!!! d 4 !P`4 S4 " C\\ T!d44R4 " C  !d44R4 # C  d4l4R4 |? R8<@p 0 =d  dp@4N4R4 ^Ѝ'bM'0'@SjV@-@SC- A  `004P#"6P8P ( 1/pq$ 㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@0  Y $ B '' %@-TAM P!#"18 P (5/pq$ P; 0080 0( 3/PЍ80 $0(3/P`P4 00V0:0p080p0( p 3/p 4 00V0* ,0`/PRP `'m0P0@-@ P 4C*'pC 0OKTn\u@-pPP`@@! 0QP Ѝ`3MU@p@-XP8@T`@D p  QP<opQ<Pp'A-AP 0 P 00$SQ ( 0$P Uh d`P, R2DaDqU`0``000PU 00CS000 R   0,`0CS0000 (00L/U R rU8 4D$0 00 $0 '@&h'@'T0 S 0SP/P/S/@- '@p@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p'@'@%''p@-Ap@-@(P -P8P Tt 0TTlPsp`U(` 8:8`0 "p'@W&h_@-8@P(P 8P 8"080G'@ @-<<yP $000<0 P'&'@@@-<P8R?0 L8H?00CS0010" 0`00SNPT- 0@@00S  P P  P 0@0CS0h00@  Qp<mv'8''H&''@&hz'p@-Pd`d@000 PPPP0P0CS0p(00 2pq'@''G-@0` V VЍpePP 0崀 尐R`00 @`0SoP 0S 0 e0  0R?o2S @`pP '8'''P `00CS`0p S00 P0S X0X /X&O-p`㴢B崲0S@ ?pPG0`F [stlV000@PXQA4 0:,A00C0Cf 00CS010:uPU 0P1` 00CS00 P U Rt0V00PQ  00C0S"10 T00CS000 U0P 0@ {Q | V 0 00 0 @00S 0S YI'''@&h''O-$RM`0000100010S v@0Աq`0#0P 00)<0J?oT20ST SRP "}0S  RZ  @T  Z     0010S@@  0 /P000CS000 Ѝ S 0P  BR l  @0S Z0 0$''''''@&h'A-0P!S`P@P 0LpP0!S P P 0HHH <00S ,$0@"$&h,C'['A-P@dp`T0S P`P$  T'&h`O-`@ ؀P0S p0 T T R R v0pYP Ѝ PP P   P Pp@''''A-p0`!SPP@PY 0QX @` PP0!S P O: 0HH2H <00S ,&UpGPr$&ht'[O-@P b 00CS0 p0@g O  0`001 pTpP@0 pW2tQtTP0PP00PO8 , 00CS010 5 t0P0CS000x0 S0 0 @ X 000 0 T0 `0U0$0T p 0 &''H&h'8'@'''O-PpP0 SPEUP ЍE P 0C0 X2 Ub000]PO^ W^ 00C0S 20  0 0CS0L200 M Z0 P CPE P 000S S ( `V% V000P Nx tp 00C00 0CS0@100 0MX 0PFGP0 0Z CPF V'P尀VP0PP00P tNt pl 00C0m0 P0CS0<00jl00`6'8''@&h''HO-P@`p P`CT  0PS2zP 0@^S00\P0S @\[  b>P @P+0P00% &@-T @000 <P 0S( 0C00S 0C0 Ѝ'@th%L0 R QQP0R/@- 1 'G-P`P@ X 0S@ @0S @T@@DT ppP 0S 0 0 PЍ'G-@P tp0SJ`GPUP 0 @,P @P'X0000@-@ 40aA R    0/&t'40000 01h@- &t'G-dRdr@`0 0S0 "3( 80?Y+Y# Y{00 R  % M 1@sM0"Sr @`` IQV ^Y0^Y-Yj @ 0@^Y-Y00@R(L0 0嫷1@s@L0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 00;Y0 00 V@ T0S'&t'80@-@00 00UP0 000 ,R;R 0S  S   0;SPp' p@-P@0QS@@R0p`V P0C'p@-P>@P YL, ($ p 00 &hQ 0Q\S@-A /`@-0S*  0@000S! P|DpP EPP @P O0 S@/R/     0  '' ( Q 0@30/@-'00@- R 0C30'A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  `T0100CS00 2pP'&G-AP pRpGWR0`0`030` 001S 0100CS0H89  P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  %`p'G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P`'G-A 0`0P0] P 00CS0-0 p& 0FSbp _1S !0PEP0Cp00100CS0'O-HB`0pS52P UB!0SR0XPPP00崿PE 0Q0CS00LN!1& PP\00`F`0sP0   P*  0!0CS0P(P*TP; 0堑0 S- S   nPJo ho00CS00  0堑0CS00  H0PzP' &hA-ApaV&ʐ0l00+PPI, %,00CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p' &h0G-D0!10]PpЍ0S0  $SPPPPɾPqIX TP00CS00 # b0Q0CS00! P1ȃԓ 0 S)"Rʠc0U```00匾P 0b0CS00 (H 1Q !@o!S/ %S !`V U 00 0]P 0帡0CS000!000\Q00`PR# !RU``0``00.Pd 0a0CS00km0` 1 1S 0S21a0S S`l   P7 0a0CS00>@10`! S:`Fp00  1S pD0"S:b-pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 /P00PP2P02 aP P 儺0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& HPP0 nR' pR lR! 00 S1S"P20 2 2020P0PPP pPPP0SR `V0V pʈ0 nR pR lR 00 S]1SMcP0PP RPӰ nQ pQ lQ 0 S?:P0 PP&t'Z%%' &h -L3''xf'8%x}QP000P0P@w _`P 00 00 P 0 nR+ pR$ lR% 00 S1S0!S .0S1S| aWWv FP0S0P0PP1S 2SqXP R$ l Br R0"0 S0@PP0010CSC Pܭb@p C0"S0mPP00 nR pR lR 00 Sx2 00S =PPPP0  nQ pQ lQ 0 Sa0S jPP0S6PP^0 nR pR lR 00 SBP ],2SGP0PP P6 #-@- 00 ЍЍ/''-0^S0]S0]S S]S[S .0Ls0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0堷P,HB塺( $ 00CS010 [S \S @@P`0 S @ #0(a0CS,0p00,a  A L0 0@S G 0('8''@^&hb'.G'p@-!0 P= P@01SE0p0 SS t`P@0P 00S P0P00 WP0 h0T >00Q㛵P0A0 ,('8p''''^&hbO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00島P? 0A0CS0l10G 0P \QH 0 SP 010S vP/ 000S S)00 S [ U 000tP At mt00CS0L00 0`00Pp8 P'8''@''D'H&&h0A-P0 0p@ W 0 `@P 0 R00R00 1BQ@@ @P含@p@0"S,"@gR000'8'O-@SMpcȳ00 0GS TcsT`0``00P@` \X00C0+0&SK   BR  D R: XJ@p RPg@ 00C0S @Ѝh20  S  BR   0 \SH 1B\C00 BR?"p L\ DQ-WppB@ \ p gP  @fD @_<f00C0 AQ 0 T0 Tpppp  5Pu p BR   @W0 `0CS0(00oq 0 b''@'&hO-M 0@P0P0u <40S 0 0 000 (0pP ߍ0P0`#2Cij 00 S(0  pRN0Y01 Y | $ ƴP$m?ƷL HD  B R+,30 # ]  BR 200S 0 4k ?> 0 0(PP. 0Y0 Y D $ xP$  BR 200S 0 5 > P4 (0P'0 p1pG Y;ppZ >P81>=( $6 =00C0SuX   R    P< 00CS000^`W#00S xyL00S 0  =8 0%X  '''@&h'O-pᬡA0M0CQ` 01 00C S00`NlЍ.  0P5 P!` 00000`P00CS000  M[  0S00CS0x00` P  P'''@'''O-RB0M00bsp 0shЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S Z0p0000000CS0C01;  \" \   " L\ B  @      0C LN '%'''@'L'D'A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT ᔳ@ 0''%'G-@p0 PR` 0 P (S%0  d P 0 ,(^'&h@-=0 uv7&hO-eGM0PS@pM$Q403/P 壦0: S<00W +4( P8:<?0P0: S 0SP0: S 0S 0S 0/S&P70p0o7P- %P 0#v PvO+'0P ]D#P]uP //>P/>P 70P+I [(H Z% U8.<. 0NPT9.<. 0BP @DP ^P!T1QP o R00S$ 0SS 0: SO{PN 6  09;G=00 04K -;G=00J0SP. Tq .XG DXn00CS0 gp Pp  pYW hX0 X p00CS0O0 0S ᝿P0SGݍЍ0c ?o2500៿0 8'd&F&hS&a\\60\\6X X0p@-DPD@@@T ` U H H0Rp@\\6ppX 0Xp@-DPD@@@T ` U HH Qp@\\6ppX X0p@-4P4@00T ` U 8 80Rp@\\6ppX 0Xp@-4P4@00T ` U 88 Qp@\\6ppX X0p@-TPT@PPT ` U X X0Rp@\\o6ppX 0Xp@-TPT@PPT ` U XX Qp@\\T6ppX X@-p0tp t\@ ^0@\\?6X0X@-p tpt\@ ^ @\\)65S %R R S R SSh -^L^S R 0/0/0000'0O-QMTf @ `u @ 0 @0L0@@@ @@D@H@,@0@<@@@4@8@5 SS$\ 0 !00`V0S8 0 0刐0L0St 40D0800$0S00(00 C,/3$pp&4,0S `4 @?C000<$0D0p0H0D0p 40 $pp4$0S00<00@0#0pp3,0S 3 @?CZ㸰张 0t#pwp3 0X#pop30 \ 0C0CQ0B003/040 0S :YT R|S0} 00 R0! 0L0S XP0 |0xR, H  ,00\DD5H 5 @P ! t p\<@  < * R," $\  " &p P 8 04  # 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$^3[(Y3 0R  P 4P0r@K30S00P00P00lPP\0.S0S0 !|0P$0 ,0P(0 $堮 (囮 R P0咮፯P000Ѝ'0UUUVG-@a!80S s$PP 'tpW GI%<0SB|%@P (9@=%$9@"90S>5!0CS0 \~$ h  v00L0S \0.S0S &@0S40S t&%<0Y?o20S X (040'0 G-`L-P0DL0 P0S$00D0H0庼P0pP〔0t$pZh4T H0 `F0P 0 H0P Y$4X0 s0X00 00dt |  P PRPS W( ?R004(0'R S S S3 L0St3 T0Sh3 0S\3PT#QP30V < 00Ѝ10@GS  0$ 00H00P0L0 0T0X0s0X0 00P0L0T0H00 00P0L0T0H00X0v0P00L00T00P0L0 0fb0d0_PP\0<0Y080 PT0 D0h l0N0D0h0000000Bp=0p$0,p80$00,03000@0-0 0*0p0'0t0$0D00h00x00|000000000D0@P 7  00D`0S0\0S00S S S0 30`0St0\0Sh0h0'0@th%V&zxz'XxP\% &h0\p80p@-@PT @@\p'80p@-@PT @@\p'-L0MSM\0 + ⿺p>7嗯0 ލЍ 00 z>04@pl0l 0 0  xL00S   &h'''t$0\ 0S '0L0S/0 0 0/@-00 SM 0@$ +4@pЍX0T0P@ CH0@0C/ 0Ѝ@l'<'@'T'\'XP `00CS`0p S00 P0S X0X /Xx&: S@-  S  S/ I* S  S%|@=A-x1`@TXPM !X&@P10S D10S- 0qp'p * @0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0|0xC//0 H00S '8'@'T'''''\'X'ts@- P@@P `TU00S @KT GЍpx p Q \0 \@3U .P@*U''p@-P@Tp!0C0  $H @C-@4Mn 330S`sV4Ѝ!0C0{ 0XPS !$W0S 20Sm 0$ 㠒 +4Fpx *;*0( P2D20S 00*  &20S  0 : SK ,0s# 8#44 10S10S:1!0 0H 10Sx10S : S0: S }`y41萟 0IR 10C/.0  'Q ㌐p| , *LN\,|00S ''p'8'@'T' 'P'''''''\'X't1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ 0P 0 L`0SpPQPU% Ѝ  B 10`    0S[  L0  $R,   V '8'@'T''%%,'010G-S$0@010S 10S,0000 0 0PM0`VGepP倠UG x!0C0 W pp0S$,  `YpP ``'8'@'T''%0G-@0T$@0@SP 00S,000@p0`0堀S㠐@VG 9!0C0 W ,1p0 00 S (p0S$,  Sp` '8'@'T'%@- M @ ᅪp ЍT P 0@  QQ  00#$T P S  &0p@-0PS``S-@P <.P PAp@P4 P1Ჩp'$96C-CM@-- `)2 %2PȐ`T *F 0pPPCߍw ? P@2w0S ?@ͩP?oP@&@-3 剿㊼H&h 000/'@-30 xy&h@- MᒷP<1s@-@ `PǵP0Pi U޴ܴЍpU 墵㟵\@дδ0 P4厵ድ@%0G-A~M0MSP 0p`E 0E} P1d!0`~܍Ѝ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@H~,tP 0 !0 0E~P0 ~,\`P0 ~,SP0pE 0E~ʵPYp  Q \z/0 00EᵵP0>$ /%0m+T00CS0 p0 /G-XD`HMp )0004T4$4t0000 00$0S0 V"3`0p Q 30Sa3PZbPZ^00#o/000 0Kx#ճPJ00\#[/V 00@30p Q  #帳P0 0+00" D/܍4ЍT 2 R - 1[ 0`# #t&# 0S1堁  0 4&p 0   0 #T=0!@ #>(1 a0 0000p01尠(00C0 з  ʷ,  ,0( $0%$0  ḷ 0000p0 #⭷#&# 㼯T%|&h'(Sd'Ѱ(S'''Ѡ%0C-LRLb0HBS0000 Ѝ((0 0 0S  2 r0S 1 } 0S pP (0: S)0 p10S10S P㑯塯P 0 0 0S q4W 1 00 0S000p000 S(00(000 P@0S .000S x0&P 0 0t;D%P 0X%0''(R(S0(R(R(S>'%|(SLn(Sdu'Ѱ'ѠzC-M M\ P+H#*H P+#*SC$0`SH 0`E0S2 *p&Pu &Pp 0 m S( 1))2r0t0CS G)|)p)5)])\)PLx&P0000$2) 2 `ލ Ѝ)&0S  R  sS SS YSP )yS)Dq儁)3)P)P@5&P00000S()( )0S0 &P $0Pt)GPP P0000)P0WZ)(R%0'(S(S%D%<%| E(R5UtG h00@-@BpMp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S .)@DT  A0d#0UPTP)PV0S p )@X`ꓢ" @2/PL0 !ᓢ#, 0&%p%d'%|'(SdG-鈑0@`pP@FQU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ A6P 80| 3/PzPPTT00S\ T(R <003/P 202(Sd' %|2U''{¡@-AMP/M+@P+ p`pP/0P0 Uh0h (AލЍT0_"$/0P0 0@0 `(''00CS0 O0 /0O-S$M00`Y P$ЍP0,03/P00L30S,0@@z=0 CŠzA @7Jލ Ѝ  "r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00ǰ(S(S8(S 0(S(S%UZ%//O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 @0 X2@0@/P*@0 0嘠P &P` hЍXX ᤏ  ` `@ʐr(S(Sʂ(S(SRs@-Ѝp@0 @`PoP08  P0 ʨ(Qʐ0@-@MPP!00800S =J"Ѝ0(RG-`QM MJP㠔@ Y #p ߞP 0p 0PP=! RS J( ݍ ЍBPJ=8 N= $L H0QP J(L0 00PJ!8 PTʿA-QP '000p@T+`00CS0WpT0 0S0T@ 0S@ 0 dP 0S@ @T@ S +P (Q%& (Q0 0 S00@-@R00000S0@000S `呎P Ljp 40P(S8(S<(Q(S, +(Rp@-PP 0S|Lp `h@P` 8@P0/S000000f PR @@@pZu(Qh0 RX R  H R/< R/ $R/Q/ (Q(SL(S4(S\`0@-0S L0@0T R S$ 劦0@(R(Q˜&hG--b@ 0(MS 0SzB((Ѝ0 0p5"0C S60 |20S 0X0 00!P 0 ! " ZPPp  0!$$! 0!㓭 X (4 : S=  S7  S$  S03 0`!  0J 4!010P7 S  S/  S04=! 0400S -ЁЂ ;Ѓ"040+04 P~0h 00  0 0 Y (Q!(R# (SQ7p@-8M@  >D 0`P`U`$ $ @ 0⫎P8ЍpV`C-x1lM0@S X句lЍC% `Z(ώ="(<Mp@WpP00 0000p084 j40CSL$0r"60"$\ 0( W4 CR+p N lЍB>'"ES+0  f(Rmḷ̛̕@-@XM="r:(p0 aXЍ̫7@-@Ppp P Q Ѝ0 0 D Ѝ0@D0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Pp*-0C\^* 0 \!00W0 00N0 00N ^*N^*/@-@P0*Q@H? $0S\?:!  Q0S:R T 0 Br\  0B~ \! AB~\ " !. Ta Br\ ! -0C\0S* ^!02W" 0C0 0C S*CS*80P @-  //(SD̴A-@((PQ U?-QQpW :WP`0 ?`S A<Aؔ0:S@0 R  0 `-(R&zx&h/s@- `p0QP@ Q10*P@ЍpP mR bR kR%$+ *R xR R wR!$/QPP@$+*$& QPP@0PA- 0S`Pp 0P  T @R p00T0p0S ,1@P0=0+PP(R,Us@-@`P0l C300PЍp@00S S@@PP 0 @D 00(R@-  B&hl0 Rr @-/%|@-<@<B0bB BB&hG-p p{0@d \P;p`v0, Z/00 `8:O-lM/oPO^PP< P0@p`ጟ/100 PP@  h?h/@pX?T?A0sR  S  R0?0/0( CR 0K?zP< N>Q ,a>@>0 -R.Q0 000p> h>h. `>\>X>>0SDp0 0>  (> > 0S > 0.0.0-0==P}===x=-=   D-  g= 0@T pPPXby,  0!-1 @ L<-=@=<P? <;<,<,|<,p<,d<,X<,|x%Ǜnq%(S`(SP %h(R(SH&Hx'Զ(S@'(S((S$G 0 .շռ(S%`K 0|pdnPW0000 S \0 0P  /(Rd0P/X00@- HP808 P(  /4(R(Sd(SW&hA-`  @?\, \PA *\.  Q R( [\SPQU !\@@]^.!Lo \0QS8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U (S\p@-@@0/SN00N P`pPQP`Q*C0CT3A"0L0AS*pSp@-1MPMVP/X P  0P0SۍЍp.S@T|`l @ @;(S @pؒ ؛؞ O-cM M 33 "@p3]PW1`0 00S  g  0 ߡPa`$0+QRV~ @ +  T*Q`DV;  bcݍ Ѝ&Q* \Q% 1B\ 0 BQ "P P BR00CR 6 0@&R\R ,  BP+T- R* ` V$p0!#MS@ 0 8TS 墜8TS p  0i 0 x呜@T *0S0T00  R S 0 }(R A~&hٔ[C-`PMM RP  \SP R P0S ۍЍ؃@P p ~P ;e0 D  0S\S R PP喹P ugS PS" SS GS g0 x0pS sS0S080 R @@@ٞٷ/(RA-PP 0SpE`p`@PL P- 40  R p`@@ @Ti(RL0@-@0T  S  嬛0@(Rږ&hT1 RP p@-ZDT 4\p \Q Q 0T*  Y04P  0S/  00p0S/  0`0 @0/S000 0D0 R /(R(SL(S\0A-j40@TPp 00S0o`0 00/S @Tt0T0o P0 SD jp04(R(SL(S`2A-0@SP' 0`.S0.S0S/S XVP 0 Q CR S.R  S.R0S/S D 10S510S ;P:4 CSR ! Q0S 0/S0S.00 ` 00C00S080 `V">_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@&tGA-Q@pW :0 01 5  dz (ls <tn @ |pq}  ^=/$4  0 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $@ q++@@04(4 :(40/S0004084(49)($ q++ k$(S (SC-Z4$#0C@EMS$0 30S`` EߍJ(YJ(J(J(`L`0``L\*0 J(P0r ;; A41  =db0(p ~0P0<0x w0P0@0 pP00 0 g`P 000 [Pd ZPPuPP P D(S6Ur(R(// Qp@-(0PS$ l` @P|t 0000X0x `:V0  i@p(SHO-P`p Ѝ#I:0J84YqW V#/00p0K0CS\3g P}0<0003$ s  d ( | pq  }? 0$00004JH1(P t@0 B(1<P l<0 㓍 H K06S0S 3 CRQ  gSt K CRW0 40r;; (49 xS!04(4:(404(49(408400C /Q000T($4S::  $ R(42 @,0&"**40 p0 2S($0 *4($040)($84  R KS 0 0 40r;; 4 KS0B h$ $ (S(Sr(SwC-j4@SM- S 0cS:t& SR0d0C0 PR/R0R E?o2R0S% 0CS@0 @P*0 J(. R00700=0 s++  Q 10>B 0BR* 0A>.0 0~P0<x P J8P0@ P J-1  =0 0 0P J<a@l1XPE vH1UPM v}000 ~PP J}yPߍ P$PP P cP $P Px 0q0cRaxP(Sx7X (R(6p@-PMM@ d =\\  0P  UM>@ ; 00$0$0<0 0 0ݍЍp$ (Sp@-@e PP hp@G@-0p-S0S( P@P#y 0M0` S0 \B"PhPP00T Ѝ@`z.&-@-0@P   NЍ@Ѝ/(Sp@-@ATp@0 R PNP ` `P`p(S-P@- 00|0 x0x 0 0 h@0S X(O00L0L <z ,巢$ O Ѝ@ Ѝ/(R(S0(R(R&h(SOp@-x哄@Pl*hPP X#P pᗄ000S   pT](S_(SX -P7@- 000@ 0 0 0 P0S xN00l0l h$ XaTyD 80 N Ѝ0@Ѝ/(R(S0(R(R&(SO&h}@- &h0@-MM@P@Mߍ00/SHPtHP np Tip  0RP 0RP  000/(S@-J 忌&hC-q`@$MT pp尌hAPDF00CS0>᥼@ Pp< @Y@DOoB0S@$Ѝ0P: S 㥄P 10S u pW M0圀 SHB@  0A@ GTi0 @00CS0,\0 (S&h&O-PQAMpY :y0 pz! 8 P-pY :y0 pz! 8 P!  8PpY !\8P1 Y:v0P P! 8NPPV` pႂ(SE@- 12&h 0p@-@PT 0Q00S0P0T`00000ttt00CS000S p(T(TA-pPd@d`0000SP'U`00CS0$00SA~(T(S(Tp@-@PD`0S@'T`p QP(SG-,a000P50@ R'QS n\! 000CS000S 9 0` ㈐pDVG50lU0W00CS00 U 0`(T(S(T%|0@-S R'N (SA-pP`V@ 6@P+Pp@-T<@P jDP0P 0@00aT:@p(]A-ppP`0005@$50 05000@0CS000SA(T(Tp@-P`@T PV 0@p@@-PG-a<0PU:"0S TP0@ T =PP0 TTWV00CS00 =T 0 00{Pp(]%x%|C-brP 00B Q U2@0 @@000 DE @p2 l2 00pD4< 0@ Ѝ/R#RR@  :BQ &@ B&Q @0=S0  "?R|R& ~RR ^R X!000P00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 (T Y(TA(T(T0@- (T0s@-0P`0X0`0@S P 0R@P@h  vP@`0S00S X0ST P000 R  Ѝp(T(`%l Y@-AL ^ ld rs^< \  " Q?0 CàΌ c1Œ? l1 0\PQP̠Q  S  S Q PQ PQ! ):O-p`t됰P0@%Sv0V0&S T1j! f0 00 @ P@P@(TG@-0@!4Mp MT` 0 P@4Ѝ0@P S:WP@V P @0 F<P@$ P@⿆ U(TUp@-@P0)Sp(TO-@`(r,MTS TV T( T* #T! @$TR "T 0P#S@    ,Ѝ'0DS[D pP@VP@P@'0KSV'[`000`!`0 R U! y! 0  P@@! 0  @PVZ'T`@@@P, P@   (TZhUO-p`M8P젟찟m!@ i0 T@ 0DS'00^* PU @ 0 \ 0DS00Y Ѝ` pUU (TC-销`P 0BS0`0S@! p 0 00 @@@@@  Ѝ(TG-`dP0@S! p0 00P@@(T@-@MP1`PLv0P  IR NRpp gPpEp@@0PS@ $1Ѝ(TPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P9272Sp0@31PH0P@4 0Q@ 2%`%h([(`@P/- 0/SSS00(T0@-@PMMMߍ00/S \}~p x~p  0RP 0RPp@-`\0@hP 0D0p@ 1 1q0"SP Vpjqz(Tp@-T` RpH0@Q 8 PP 0pp@(T%G-pWR 0S)P moB000000000CS020S @T  |S pS\|Uq0Cn424b0000@/Sp=FpPJ0S0/p0CS0pppW00N1000pA0P00 o0070 l]S `YS00CS0<10S 00CS00W00 pR0S/S0@D001@P  R*0000t/S0S P 0/0CS0 pG0S 00CS0000@0@0@(T(T(T%`([%hA-`p0@00|P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0O(T(T%l(TG-2M7r0@TS@P 0.S00.S000/SS?X20PpTePZ( ,`V 7@PP ` W/` E0E"mkm@0-S0Sp1@T@dSPj/|Pw 0S z!/pP  `P p 0: S W b /pPXP pW 0S E.pPЍ%l(]"I(T/;^e@-$0Q @ Q @(Tzp@-L@Q60P000S LTPP 0Ses@@ N 101uN00CS00 N 0 M0p,o<(](T%|G-@P@\R` V101 <EP (?P  `I\TQp @p0T \0DsQjSh0 @0 p0BP!0 BS@p@00CS00 M 0@0 @T0S 00CS00 M 0 0SZ00CS00 M 0 bM 1 0h1@ @ @ @ @ @pp\@@%| A-@ ` PR 0R 0S S0Mp0S0 R M0S  MU  MTMn xM( Td@00CS00 M 0 AL%d(T(U% %x 0@-Pw% 0˒(T@-@(0Q AN(T@-x0@T   @@@@ @jy@00S 4060S Ѝ(T([%l-$0@- R    (U -@-   0p@-(U -@-0@0 H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4L,P / $(T0/(Tp@-@yPPPP xp` x`P xp` x`p7@-P-40@T p06 N N1d0@T PMP0 0@ 0O@&C Ѝ0(]%l(T(b B@-p`P@U'}<0PI%{Fkk&Zg{[`[x M06S 00S T8 Ѝ @0t0S0T.S @N(T 0    /(Ts@-@ P`TЍp0P0CS0  I000 P ?0 (5@ 00 0@-PM @T @@ 0Olp +P   P@@ 0@lp 80 @ 0 0Ѝ0@ j @(T%%@-@P 0S0S 4P 00 0 Ѝ(bG-`0S q0P00#@dT0SP'@D1$@00CS0$10S /Ѝ00S p Uw*l:  R )P00CS00S UCB0Sw;BUwPw@C#(T(T(TG-0@P`^PM U+릐 s)2Q0 U2$PP20S nI0S 2$PPPU 3J ^0S|2 0S@w+T ^0S<"$0 0 +^0S2 R$0S0S F@ P0S F0S F^0Sd1 R$ R @T$@0S F 0S F 0S F 0S F  0$ V $0?o2$0Mx0$ R  0S fF 8J4I Ѝ%l(^8(T(`@%dO-@MPp*0 `㠀堠堰&@P@ *Vx0$`W T ^0S W P  0`S*Ѝ(`%P%l(TP8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/%`%h([(TA-Pp`@000^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S S(T%lG-P䑟 M^`AV $`)pWT0尡p0p00WZ 0S- |1|a3pIlnI lI00CS00 I 0= PJ00CS00 H 0 H  L^ $`R 0S S00CS0 p { 0S pS00CS0 0$`0C0 ) Ѝ%l(T(`(a%xC-@$M p䀟) 0 0`R@T+ 0S0 PU@ 000P 0t 0 SP0 0U$0 @ R^PU $0)$ЍP0(`(T%lG-P,Eo@p0媢S' 0S$ 1a12HHY.HUH00CS00 DH 0 &H|aU000 %'PD U 0S @T H1l B@G8G1uG0S  1$ Iߍ0A 0 000 0AP00CS0 0@ 0 00x0 >00CS0 0S GlGD0?GX00S h@00S b(T%l(a%x(`:(TA(T(TK(T0 @-`o$M 0 00^0SP4P @'000p[ p &P 00S (sf>9s0 p000CS0(00S  '$Ѝ%l(TS(TC-@?mM000@H0?_00?0,@0P@ '@P0o0`p00dp@Td0hP@0po 0lP@T 00>0P0l $00`0S$9'`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0C7S 'x0R8 P>0S900SD 4.0000,0(00 0p(0&p  =&0S(7S%00S 0 0S= 8  x=, sp@ P 0 t= L8 `= <=, R , ,( (%P000==0S ?U0 0P@I/P  @J$ 0 $ R 0T@ =l$0SP007GQhI 0'000 000 7 0'0'00$(0x7  10103/$0 7 FD7D' 7<' RDL0S qJ8 6 6 @ R[ 4 0  V $ D&@00CS0 fl60S JP 60S&,0rS5d6$6T h0 )K5,,0( k0000+,0( #0xE$0(0S,' $ h5 p50S W45,0S ppt; %0(50S E0 @0 @P@ET=0 000$0 0C0 000D0004 8\XO00CS0P40S ĉP( p40S)T0SXOI8 3 3 3 \ $4 03娉)ğ00:3 0 0S '|0R0#C,#0 0 3 ChxJ00S0pN0"0C0000OlI8 2  2  2 \ 2 )Ÿ00 0t2 T0ST"00CS0 (2 R   02D0Sr$mߍ:10S z0D!SS}1 08 L0H@Is10@0@0S h1 @0S1 L1$ @0S  01@0s`1 R#0SH1   B  @0S @0S7S@<d 0 00S )6:p@,0S0  <,0Sh@ D<0,0 0H 0F@T(b(`(T(a(`%l(^8(TS(a(T(T(a%x0dL%(](]-&zx%|%d%j(T(U !(](T | B(0Sp0 t0o,0 0v,,s)DPFG0/(T0 /(T0 /(T0/(T 0  /(TP@-@]'P@<0 QP cR   (T0 S0/(T0@-0M0/0@0P spP 0: Sl  S` PЍ0^pP0 : S # PP(bp@-Px@x`M$PL*00S #0`00``00!`<*#$Ѝp(T(]@-h@P$0&0 RP   BQ   (T//C-LM *88 p@<(P@0` D40 `G 0IBLЍ%|A-@P`npWU L`=" 00'p(](UO-pWA R``%` P0S:S S~E@ @0S(W@  @0T/S/00_0p0 R00P R:R:RPPPT@DO!"%`%h(U@-@MP/p P㨐K  0 }@ T9Xop0 @~0!0P 0pWZ0S 0 bTZ0S V0S R0 S-op @! h`P T T T09@@T >0DS(U(A- 1@PM`Rk0 1000  ;p!XZU pbA>A Q X9AT7AQ@SA 08AS 00CS00 @ 0* 00CS00 @ 0 ЍQ A&AU P000K <00CS0T00S D@@80(b/GPY%|\(T(Tflpp@-P@@Pp 0S%SpP @p@-P8@Pp 0RPp@- @0@ R0S P P\ 0%(U$G-`P@唀0吐00|Up00CS0h00SGB0S0 S 0S00w_PPp(T(U$%(TA-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @$P`0W:SP0R@(b'%A-`P倀000|Vp00CS0T00SA0Sp00K_@T`(T(U$(T0A-pPS R+ᬒ`a@T"W p000o0 @0 0 ]00CS0H00S `P `@(U(T(Tp@-P$@Pp0P0@@-L@000@00 ^00CS000S@_(T(U(TO-PM/`@ 0P @@@k (;mP00š0 T0S P0S L000V#   P@ o0P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @t 0|>?00Ѝ H" R," R8pP B0000S R  pbbQ  0X/R0XZp O#P pP tE#P R  R (lP0 * R; R 6I0@@D P R  P@0000S R    BR 9D R5 O3 P(b%(U%x(T%h(TO-`Pp$M `x,&@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQ=01 L>@$Ѝb@DT@ P  p R   U 01W VYXU' [1 00al 0aS v00@0S v P >W 00SY0 0 S0 P 0< S0 X(](U$%|(b% p@-`P0000S S@bI000 00 00000CS0p00Spp@h(T(T0@-x@M0 0000\0P>00I 00CS0$00S Ѝ0@GЍ0(T%l(T@-yP 0SIO-`pP@Md%%P0cS @@ <EpPp vPP VP@ 8 RNcS @ :,0S2UA ̲P0QPF UB6= JP9 /=@M=T( 00S$ dB00CS00 < 0 U= 0R PU E=0@ T  Ѝ<@W P` 1000  `@`P1V>0 /PW1  )[ZU<iPU<U~z]<U Ut Uh UX< (]Tk%|o(b$O- M$B$Rp0@0`V% VV:V  V /V   BR <` F R   Ѝx! R  \a[  j0000S(@@PilRP@ @T ~p [ /R0/SH0)RW 0 BR r R  BR    BR  $  %h(U([%lV]A-(A0S 0PS0 0aqP0S00 P000Z00CS00S P 0SRh`hp0P RP000Z000CS00S \(U(T(T(Us@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@? `N@80S00S=STL00 <0 R0AD1U0 S 0S%\(](]A-hp@R0@S`P  R RN00PH @(UO-s@0MR02$` 00 042嘀0C> w40`SX00 @ 000CS0E0S00CS0 20S H7gP*0X00*PJgP Y P [10S10 DC|0@0CS0d10S |Ѝ0SHH Z- Z`* V + 0S@0  NP B?`F@ 0S 0 0 0CS0s0 S00C0~0000C0 0`F0CS0V0Sʨ@@(U(T%h(T(T([]2O-0pS`p0 Ѝ@1Ա 100   Z :[X0S h@ xqQQP  PQ XI=PD $8 DoQP @800?@P  QE Q@PQ@  T* R RPP P Y <P@P@ P(U(b,(U%[A-XPX@X`P0p00X0p0CS00S ~(U(T(Tp@-P=@W0@ p(U@-QpP0` 0S*00E@P`PP `R@ Ѝ `0P@@0`SP0S0O-0R0@ @D%05 @AQ+TK[X H0h0` Y84 0 @0B L    R1 @@9!@@5m\4T\$  0 Y00@@S@$D0[0<00 S 0[0 0 @R# R@@ @ #$Q  3 @P @P$8#~@P#K P @P"~00@P"|b'TB P%U 000S  0HŸ$pAQm Ux RA00CS0,0 a0 H000P  00B 0C 000PT1 L10A,Y00000U> 0z1 GR?00#S00 B004S0p0 G0 B0i T,Ѝp U   p  R00SPhTs Y(a(U%h%lf([(]8]G(`~O-0M Pp0 t5 h500`E` 00B 00~S ~P0 0`Z Z$:Z =Z Z6 Z     BR &  P 0 AA Px4 J R  Y 0S`Ѝ0S 0S0@S0=S (  #00CS00 w 00w00  #00CS0 0 u l#00000u00D#00CS00 00 00(0S 0  CR  SR0C 0 Y "00CS00 v v00v000PbS00s0 S 00CS00 ~  BR  Z `TO00~00I !00010S00 S0 0S0S04 R @R*R R; `#  000  BR !  P  AA   ~R=Z0S 00A  `(b,%(U%h(`([L(]G-Pp`l1lAf0hS 0`00P0P1 00@1 (ppptV0 S000`0`0CS0#0 p0pĐpG  G 0   ' 0  R 000p_~ 0 %l(U%h([%`(`(U @-0@h%hO-TAT`0$M`F8q00CS0@0 PP55 0@E0 P0 0C0S0=P -0P0 R"Y 0C0PEPE0000C0$Ѝ0000(U%h([(`O-R`p@P[ 0 0000PPX P X 3 0 E0CP00S H D/(04 @D,0 0D (U([%h%IO-Pr0BS,`@( ؂  R f[ 0 0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y0@FT: 0PD BU# 2Q0 TQPR D2@Y@FT: P7 DU0#0 2S 0TS0Q00R D2@ PY 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C00000000(U([%hC-PpM@`᠐? 0嘀00000p000CS00 p0@ 9@UЍ00p(U%h([%`A-Pp@.A00CS00 1. 0 ` V.00CS00 . 0 ` V`a.00CS00 - 0` %| @--@-)00S/ R% T0QH0 0Scq o/P0//(U% 0    B /(UA-P夀0@000p `R$  0 `0T @ `  0 0C  S000SA(T% (U(T0A-P` @0p0W0 aP 0X S S0 000 00 0h0 $P   00T L00CS0 00SAs% (T%P(U(TA-bB0 pWcr 0S 0-.-0S@0PP0/YP2b000r0S\00CS00  H0S 0X@0#S Y P  YPc- 0 0p0P0 R R A   BR 0E0CS0000`0\00S 9-H0,`8 Q% (U%d%3%l%xP@-L@00CS00  bp00CS0@Y(U@-T T@08      00000 0$00(U% A-P`@000^$ EYV |`0P_$p0PS  D0  0000CS0 00SA~(T'% (U(T@-4aM0p0P0Y@P yZP(0: S$0 ;  XP  UPXo0 00" Xd#TXL[00CS0,00S +Ѝ(Tjx}(TA-h@Q0P0`0 PHpP<0`00CS000SA(T(U% (Tp@-`P@00P0#P 3K 0S00,K0X 0000CS0p$00Spp@+% (T(U(T0/% p@-@(`(P0SSSp% (Up@-P@0Sp% (Up@-@Pp P0Ppo#0@p% 0 R/% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 (ZOr5%A-R0S20SP`AT p #Wpp ""[HP + 1N PpW(Xp X 0P '''X qP LXp yL   Hp,mL #W P 1Xp^L  GpSL "00X'U'R'`(Z([%1%l([?c0S/p@-@PP1PL1DP0a 0(00R 0S"00D05#0s  0C?o2^0SP`pP KP p0S *00CS0p\00Spp@{ Ao PQP(ZOr5(T(Tp@-@\P0P00 I@00CS0p00Spp@L(T(TO-@pTM R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S{22 G!0R+  p  !R-    x"^*   0P"S* 0sT ,H  ) 00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Za)000v ) #40  ) )P S#4sJ 0 / l@ h  X)Ѐ 00Cs 00`Fj&(Z%Or5,@- 0 S  .^\Q   p@ S0C $00P0R0S pO-PPp10 0%SX P 0@S!!Q@ C$0S 0S  R-S %S +S @D1@YZT$W@1 r9 002#00S 0S 0Ѐ?S  P T"@` Y P P \ \0@00SJ R Q !" R @%2Q(Z@aG- a 0S Qq0l0@S @ (А0Sʬ00CS00 G( 0 )0 R  0 S0!((Zo(]Or5p%|,A-pP`/P00Stp10P 0S TIjPp pPP gP`W@ P1 1@o(`V Q U` 00S`AJ 0 S(P00CS0 '0S 0 0 00S0 S 0 0(](ZOr5%|800S /@-P `(Z8 P  /Q 0SZ//(Z`060S/P00S/D0Q<0  40 A!0 S00'%l([%x(ZOr5G-Q`0SR@00SiZqP000L:@ 0@C  @ R0000CS0H10S Y0q000 100S01000000V00CS000S 50S @pWZ00萠{@ 10 ZZFꙂ! P00 R @(Z(T(T%lA-`!@S1p@!P JK%Tp1@WV2 `1N0SN U 0S0PUPTV 1CpCH K#H#060S$ A#>#;#V>%;%U 0S fPP^S\CSP L WT 0 V([(T(Z(Z%l%c08 N R S  0S  P E%lO-`R0pMxB0 pP P Ѝ{0S0S "0@0000 0#P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 嚲"S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S \  @Vz   B/oZ"  "0(`@(T(Z([%l%x(T G-pPK@P EP1N0St `B@ST @SBpG `㜠@0S0S 0S0S0`@Y 0 X 000 :%l%jc(ZA-@t PPT0P 0S mlP@ pP@ ZP@mt06 R0S@@PX` p: 0 P m (]$%l%|O-`s$M/ PPY30oV &P *P x?nU pUV \7`H3 R ZP$Ѝ3P\ ZpP&0?oQ20S P VP  Q6ZP@@=Y pW  pP 02 QY QwVP  H(160SJ\  \@ /o"/ S [ #(\@ Q 0p0\#Pv@T R *  W R $0PS  R 0 S0C 0 X 0 R00YXcX `Z^ R[00V(]D(]H^'(Z%ljp@-PQ@\a000 R 0S 81)Ap 2E!A0S 0 00E1  S k00P0  Dt@ RQ Dt@@@Q00R00S 0S00CS0000S p(T%c(ZOr5(T<1p@-Q00@S%$P`0SP00CS00 # 0 $0@p  E.!#PlP000V0@0CS0800S p(Zp$%|%c,(T(T@-n @ 00o(]@-@ c @op@-`@0 0 p 0Qp\ PU#00p(ZmO-:DRDb@U 0S 4@p@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 p(Z%lA-0P@`Tp R@ 0N@T P 0S@@uNW\0HU 000000V0@ ([%l%A-P`pᜮp P@ 0 A yB00 OG-PP- 0M00S _ow1q R100 0000 S @PЍ0SF  0 Q S/R 0CNP" 0Q 000S* RA ``0S:SV@!00S"@6? @00CS00 ~ 0 ( p0ST0 @00 (Z@(ap(ZH(aI(U`%`([n%x%hC-@M$Tpp``P A0S 60SP 0N" 0^0v P1U00S^0SP60S .0S | PhP PrЍP ^Y8 0 P0C?o205(`@%l%x%%P(Z00S/p@-P000L@PX00CS000S TpP@T` `@V0`0T0@0PvL0S V00T00p@(T(T%lp@-l@0P00eLP 00CS0 Sp@00S (T(Tp@-P@KPU[#p@-<P@->Pp@-P]@=pA-@P0PS`~Up~0000 p 000CS0h00S p0p000000C000CS000S ]%`(T(TP @-(K 00C00/%`00  0 00   /%`([p@-@tPt`0000S0 000D0 00CS0p,00Spp@00W>(T%`([(T@-D@ 00040 00CS000S@(T([(TG-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SG E  P0)` 0`00(T([%`(TT 000@0A00CS0/00S/(T%`(Tp@-$@P0 0C0C0p%`([p@-(P(`@0@D00C0p%`([( A00C 00 0C0/%`([-A-@P(MHp@`DpPVP u {T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@w<0 P p  O-D40!Qp R00C0@R 1 00C0v000`@F0"0 !0`0C0w001 0`0C0v0(P@(P0@0C0y00 0"!0C"  0 0H$2  `!!J00pS 21 냐`00C0@50y0C0  00S 00C002  B )Pp' "1@0Cs0S10`0C0x0000C0p0 f00S210"QQ 21Sy0pW 0 l0 n00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP3>P0 |P!000P$@C 0Ѝ@PE0 ,  s0P+ 0&P00 0<P_ >P &P 00p0pr0((0 @ -P 0(0  p 00@ 0F%P%_%h([%` [(U(U,9T(Z(Z Y(]`%ha] 0{P B@ 80 } pL0 {[0D 00 B #PA}P@ 0000@ P5 }P' @ 0 {AQ'=0AQ@=0@Y0%[y :[4 #[5pt|0@ 0 p0K P{AQOY 0@ Qp 0Ap;8Dr ᘦPp@<YA+ Q:p%pp02Q1S 0GS2@0  W { 30W2 ` !o!z@Q{r@p[p Io}[Q 0#p0CS0p pT@'P023Qw0  00"0 `!6$0  0G-`Ȁ0@T@@0PU @ 0S 0 0  B/o"\`0p 0S 0 { 0 0 0%P_@-2P0@-2aM0$ 0 10< 010@0>1|0000'RPI@1| 1Q @@00= dx 0S $Q. 4QG Q ,4  8000<  ,000 0 0 g0 0 0 S00aߍ0  p0 `0 NH0 D0 H00SQS,0 0(T%l(T%P_%h(Tf G-Up0 00 P0    x5P $00pO@.)vP 0 R 03`      0@0S 0 00@ P0, RP  000@ 00 00 R, RP3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 b00a`0 SljP X0 R   L000`0S0 R Ӻ020P 0 R000@ 0  P 0@S P 000~ F`@`%0P00`i P0.    00PU# T 0S #0@P0@00S0P0S0S 000@Ѝ$00pt%P`~%T%lA-Q@`pQ` @ 0p P0 0W@ 0q R$@@`JR ( X% R"p0 `4 P +/壣`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0%P% A-P@0 P. 000 `P tpn@`i`@@P 0`0 U000 VPPe``0SU TP%P%lp@-@|PP 0 @kP P 00000Sp ڼpp%P !P/0S/80 P/0S Q/0(^(A-@Pp`00p` P@-` 7P壼0@ pT@= PP ! 6 Ѝ D@P6   n7%\ 0P/(^(RQA-pP`%6VU``P``V@ 5`0 R@6P P3* 0A50 %\/A-`P@xpT@Q00C0U U @(@P0 P5(^(p@-X@X`0P0000"(00CS0p00Spp@ֻ(T(^((Tp@-`H0@TpV@PU Pm5P(^(|0p@- PR QP@ \50 bP `Q5 * p%\Kp@-@pP0 S00C T  D05P 0S35,03O@dA T @0@p@%\fffg(^(p@-`P0 Sڜ S  5@P t0 R@U  5pi0S 0 S 4@[0S (^((Z%\p@-P @0Pp @  0p(^(@0@-@ P  R l'@40(^( 0 P/ R/(^(C-(P0 U0M0000p#0C@S0 ` 4@P @2@倻  V 4 42 R@Ud2T /o"Rm {4h`0"0f4@P2V0S' `[4p@! 5pʰPf4ưP 1 9 0: SS4볰00``!l`P!` `V'oPP ( 0嫺 V U0S00! 0 "1P @僰( 0400CS000S bЍ@rT  0Pa( 8X(T(U d%\%l  w(TRp@-@`PP Vp ( xK3pPV -3pV #|( 0P0 ppG-` PppW@䀟  OPA p0S T Y  <G8  t20@ ,V  H&T 0S @V@ P%|p@-P  @Y3p R  P3p d0 Rp  E3p >3p 83p峹(^(%\p@-@PpD0 0RPPp03/&3Pp(^(O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P ' V2Ps;PP jT 20SX iPS2P0000 Sl\1 0R  2pP0C S Z'  P 2PP 0S( 2PP0 RPU u20 500CS0p00S T0 00`YŮ0S(^((Z%%|%x(Z(T%\(TO-P0@l#lcMhsP P00P#+p,`U4@D\T(Sh 0Ta000pW` ,@p00S0S7P0SV0SSp0sS vS 僸UPp0+S -S Tu  <Q, R: tP  1  #PT 0 @0SA0MЍUF p p0      "TR  00a& r   %5S 1pK& 0}1p0Y0 M I 0H -&zx-((Z(Z`-R%|A-PQT 00CSPDq12SK R@ 0r`0CS00 `0120<S R 0q0S 0CS>S RSxh R 00CS0N0 - p@-@b0TP R R R& 1S# 0 MPpR!Q QT " "D0600S0T0S 00S0(^8(T(T%l@-@P @$PuKPk@-@P KP0  V8 u(`DpQp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `x{A-@|P|p0`00 T 0000CS0H00SA諶0S 00S "@(T(^8(TL P0  /Q Q0 S//(^8@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: ;p3 0S$ UEo۫p' W`RU,K0@D>T000 0 500 /TPx0N R T  DR 60SЍQ Q2 1 @$ (^8([%l(]HPO-@`P3P p-P (P0@DpSppTPA TP@DP:P5@<P, (4  @P@sSa0S 000!T $00CS030S @@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 A`1 R !T` F00CS0400S ô}p%|(^8(T(T{%x>XG-PPE o@0p` TUG0S 00S 0@0@000CS0 00S @(^8(^<(T(Tp@-H@P02`S@20CSpV02p(^840T0P?o20S 0S//(^8C-p@`1010r!Q0@S10C1 ЍqXPU X2qP!q dP 0S g(^8(U ?0!!R/P/(^8p@-8P\2Sp@\Bp(^80-MM01`"R !R X"R   1 1d"1!d2S ,FPl1, ,FP L!0,00F@P$1, l@T0d.`0P, U @T 0S P奶00CS0 ! -I00 0$0(00D>S 00 -.1-"!031(^8(U (T(T 0@-`"dy(^8p@-L@'PЙ0PPp0C/U00p\p@-T@TP0 0P0 0 0000CS0p00Spp@Q(T%d(TA-@R`P`p ,0PPEUp WDB0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000V0 000CS0h00S sDP`000C0 0C0(`(T(Tp@-@P@0SH00Spp@00CS00  %d0%d0%d@-@{PѲЍ-@-   Ѝ Ѝ/-@- 0  ЍЍ/%d -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`˜P$ 0S! l妞0S00CS0?0 "  v00CS000 " 0S BpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' \%d0Q%d@-@0%d@-0rSձ0G-p0 P0R(0帐@0=00=``F@VPpPER000 S=S B`` R`ĥ`PGa@%h([%`0@- 4@ 00C00 0 02Ѝ(`0P P PR00/0@-LP@^ ^  R0L00 YA-鸀(  R (p`@pW p0S 0QPU  0S 0S   3/P@P00(`0Sfp@-@CP Uh 0Sp'SPTP@'CPP(p@H ED!$<?BGA-P0`Sp@    3/@PP@X %W  p0@=S0U0 0 00CS00  0 00CS00 z 0 T N%|RO-@00Sp 00P㼀✠`V  X 0@PU* ЍY   [ QʁaP`0p(`(`@0 S =SR/=S/A-`P0S=SPERPU@'n\0\p!0qV@pT 0S PVpp@(`(`@-1`0@S @  PPT 0 `3 X `  `P Ѝ@%P jvHt1`M@P q=@PPU0Ss@=pWpGg0 0   X` R Q!q *[ R d0[C ]If"pXv0 &Zs W"o &t (  +   %| & 0@-DM(0   0@@DPU$ "@0 )  ' # #PP@E J,  WDЍ0=юP (U(V.P% p@-閩00S 0| 0x 0p0p p@0   PU P@P0P H0H P p PpT(T(U(U(]%P(^(%%|%d%x%p@-@㚟0@Dt 0 0@0PU@HO000oA d0 R 00CS0H00S p@@C0PC(U %\(Z$%l(T(`P(TP/p@-@PTp000@A-@P`pT0   S*0 @A 嘗0000   凗0000@ \00C \ /p@-@P P0`@  0!S0 0 0 000@0pO0 0  0 000 00 3  0 000 x0@-@PM  0  U  0P 000 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /QP/N 000/(b@ 0P00/(b@A-@pP 0` V  V t@00CS00  0@ 000CS00  0`(b@%|A-`@pxT [TP'T TG "T R3 x1 p\0DS0 @@7T/T@ 0`00CsQPRA`ET@@0P0  aCQBW0CACQ70C00CP@V `R| ``0 \@RT 80 @ @ @ @ @ @(b@&tOj@-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0(b@&t0 0U(U%xp@-0S @0AAi00p0@S tPP0 0CC``W00p"Pp0`0PPE:EQ0 E00p(b@@@-P0`V) 00ț  0 0@00p 0 AdA 0@0T0 A$A00 Ѝ(b@&tO@- P@p#}G `}0P h@ 0\AAץ00 ЍV@@T @ 0AAڥ(b@@-`0@T/ 0'R"R0PP Ѝ@V Pd p+0BP d0000 0 A@A᪥00 Ѝ,pP(b@&tG-`@V@TP L卥0@`0pF ,e0p@P0(b@(bX0O-lh,M0X0`8P P1@01%CPp PE@ LP Xp(Ep70PEAU,Ѝ0  000P@`V7 0S 0S\V $d7P00CS00 47 0$ %V0%S@600CS00 z6 0P`却0p*S`p0.S0@*S@pZ`Tr`p<lp@0xZ0WZ%Zp A0Js R %X0J S00 %S00 ;댅\P ~ )P \R \0p\ s00vG t 0 D\ \LQ  b '\ \\ "\  \M \^0? \^0@-000fnrtvaet ?P0030  C 1 01뜓`P d` P  db  Pd  xqs0 v0 t 0 4~p B `0 0@ 0 lt0  c#l cZv t0 O @"0P 00t V 0{j  0v t  i 0dt 0]h0P $0'S"S{XX0S$ L v t  0 # x7"0$C0$ X t 0 c"v t   0 Tt 0 NVBT0 HD(b@%|&zx ;,:&tQl(b8] 0C- 0`qMP` Pp q"@P 0 0pi"@PC 0p W ) PuY <YP0P( 0ES hP  00S00H l^YPH0?S0 -S00H0,Ѝ plP7@-0@0 0 X$TPQ  P  , Ѝ0@$00 $ PlA-p:㑈P008[Sx@P3 0S0 =PP KS00 ``cVtYP 00 `8iVPNP 00 8GP( i` 0$00SЍlV5P 0 0oV+P 00 $P F` 0(0 Q 0SP00CSD 0`0 0 0Sl%,06<0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+@$Ò0@-0$ 0d8 Ѝ@-@4000@-@4ٸ000@-@(0(S00 0l0,0Ѝt` p@-@PPˎ뤏8墏<堏@垏GPD[`⚏U\唏`, 8`V0,0pD@-@4喸8 0,0@-@4匸8 0,0&"Q@-8 @"X( R n8 ", 8 <  < D ,-D  , /(0S \@-@8 @0<<@00,0@-$ P  R Ѝt\@-PR tne@-PQ toop@-0MP`0@-S00(00P0 0  Pd P 0( RT  0 0 S40(03/Ѝp%xA-@`PpQP-U@QῑP00  PᰑP0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp8,p@-$@P0S !00Pp(bQ+  0 BR@- }! M| 0- BSs^0@Q ^ 40 ? 0 C  / /!N(b(b!Fp@-hP@`V P!p貏`HV4!,!!0(b!Q!X![!^O-M`pA P} U d !TP L }!XP 8 w!PW $ q!PU *! P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WUP8:TU P  bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU P0U(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?P,s0SSUA ѮtϮ<ST[ TZ TY TX TW TUx tThh BPUbЍ0i0d," @T   Q ! 0P녡t0 ! P Uf dP p""###!#(#/"d"m"!c!k!b!j!q!p!y!x!~!!!!!!!!!!!!!!!!!!!!!!!!!!!!""" " """"" ""(")"1"0"8"9"?"@"G"H"N"O"W"V"]"^"e"l"t#6#A#="r"z"{#I"l#E""""""""""""""#M#T#]@- gh#i&h@-000 SA 0VW(b$3&hs@-@`000 #S@P0S  0N00S 0 MЍp$$0S/#Sp@-@,P$p0P 00p(b$3@-PRP@ p`p 0R" Ѝ訒0"S0SO 00SS  00@O&t@-TPL0 p@0"SMЍ%(b%@-TЊPL0 rp@g0"SMЍ%(b%p@-d@P0S 0S 0SS 88@ U   SPp(b&p@-Px@Q dLMdP L0    P    pp@ @& ) (b0@-@PPM 0SLvD00Ѝ000 0AP0 0 )9(b)Q@-0S S S8 4 ЍS$ ЍI**p))g*)0/O- pPMHa  R 40$,] P R Tߍꃿ0 R R @sQ Q@ Q@ ZT WpY: R < 03/PUP(b*s*U**7@-lP$ R\L@4 H$0S p (|L pL Ѝ0(b*(h++>p@-@P 0Sp@y0PS 0P0000Sp+r@-P@@ D`DHp0S00 x +&hC-P`PM 0S|00(p/p0 HP" /Q0`@ p0@8P T0p .PH$0@@ 00Ѝ )9(b(b+O-Ppr0en `( TRP2!&828B( $, 0 8  4  #4尀DR D " 4S  4S  4S h 4S hL P0S P0 T0S 8,@8Y s ЍOb0S0 a`v`l 0 0 0TS !S1d7  `0TS:3 0 Th2 (  0@%&,,,,,,,,BB,--(G-Qt ,@Q`P0QH 4QP4PQ z80S,00 80<0S#<0P:iPP:bP1 QB"7X`8X0apSwp R lH <0RTAP)0< S48P0S9`(Q +(Q $@P0S0 BS `a 0ph0S  0 S* 0Q*da 8Z-----..](b.//G/m.0.q./O-4+M p*bP 0$S  ߍS P@T[D@P 뉔 40ਛR YS? "$0f0Qjf/ 9,2S/!R" !PP0ȡ,21S M1P! 1P,E1@oP  0 tpz hT1P8 H1P, @ P0 08?s0 R* 0S 0p[ P 0S 0 pM1Sw   P@1S  f/ ɍ01P P%D (h(b//먺}}/VEWWEV0+0M0|0(d&A-P@`+Pp %R 0R00000"5S P vL $0f0Q ,I(\  (b(h0(bp@-0@P  P$p@JL0@-0S ,(b@-P  (bO-@:`MЪM 00@ PG  zP00 +0S`p :u~PP(T @00400SPP(PKP+U0P Oy(P X p9 0,0BP,0S  c,02P P pGGqrlPd,- XPPyR H, 4VP0R,0S  S;ʑ 70;v(pZP,00 SP ,00,0PU 0S,00eBP,00   @ 00,0P, 1\  88 @<P(U@ 0SX;U0PW(P (2-⥈P ( ✈ P0(P0,0P,0S ++RP0 0 D-⁈ P0(0,0P,0T0 0 ;k P 0(0,0pP,0`0 LZ P 0(0,0_P,0X0 \I P 0(0,0NP,0\0 f8P t3P 0 (P0,07P,0d0 !P  (Pd50,0$P,07  P (P 50,0P,07 v, P(P40,0P,07u 0 w@y4  P (P40,0P,07^ 4ԇ P 0(P0,0P,0x0L H4"‡ P 0(P0,0P,0|0: PaEy0S0S  L0Y:3 QYڤ0 q&0H 0@2|sT(0S1  7(PG 2X( H3@00(00SH # 3  0 R L0( 2000"0,0 0 0,0jP H@, !Xx Ȁ˕O 10 ,00 (0 RS P  (0,S 塆d@pݍЍ[ $0埅0 $0 QP hP$01 0CH 2xȀ凅00S (0X Hx0S~81X{ 尥0S0 (0 RS Pf  (0,S H (0SUt R(b0+r)Q01, 1 111@1c(b11171A1`1(b(c12@2v(b+p-&t2)9-%8@-`0pCPU V  P3@P h Ѝ`P!Z 00y0@3V|-308$00S D@->00%p@-@5S4 0PSP p@TPp0S 5S 1S 2F|BPp5S T \Pp< HPpZ(( PpF(b(bJt3ZAdeAdr3x7@-1AP(000(;_5 S* 5S( P؊0S Ԋ0S005S | Pl/h0hPH5S Ѝ0< <mP0VEW(bȁdf3dm3%Y(bdg3@-@P f/㞉@(b 0 L%(hdm0S/!  -3@-P T P 0S S@@ ឌP@Ѝ0@ Ѝ/&@-0@Q4@`  @%<<@-t@t0MQ C  P0cS CS SS ,sS00ۍ0(P>a>>>>x>??[??@ @)@L@l@@@@A A+AHO-MM@B䣟 p PS `V9!0S 0`S1 P`P8aErX```0E8ġ0 0SH_00 "S0#1l%Bp P' BUP0 "  ̀ :P0S  3/ PB 0  P'p0Rx%:`.Bnp P !4SE 4`SBY1 4`P=2a0C" 20< S :B0"SB~x5p|% .B?pd P* <x5 0ABpqpB Y0x5< 0R@BU0 BP<0QBx| cP 0 000S' P0`p(V R s S 0 0l)0`P T ލЍAfAxAy%<>aB'BfBBCBBCB(h&(C - BR0 R p@-P@a R! hr 00 (X0 x"X0 dX0 P ( <c, 0,a^0 $Z8 V4 R< N$#J$,F$<B$K>P ]:T }6߱0p 2Q0S*X`?\PQ P$V@˱p@wEF\FhFuF|FFFFFFFGGO-pᔀ 2MSR R@`aJ 8QG ,[D 0ۀ0 Հ  :0@X"  8 ƀ,   %`@0"   0 !R!!' 0S 0Cs R]!SZ0     0A2 8QI P <0P+8zQ* 8 0A0 @2<0P+8`Q *ЍO0 0 02  02 lc `^8 7 ЍOЍGGEHXEGHpHHHHqHHA-@T`Pp(>`8SAv 0 `H0/p/p@-0  R( R((,,004488<<DDPPT@TXPl XRl@PUl @ 0T0p  Q CQCQ}C(b@-@t40Pt08f/>VEW0H @-P \PY Q@VEW(b80@-0@S K08f/(d 0PQ0//@-D0 <T440@ RN  0GJl&hJ%dJP7@-@ PTP0 08P8 0p0 > Ѝ0J(ȀdvJ0@?o2P0S@- p`P~@P ~P ~P ~P@V@l~PH@T@T p0 4>@@ ЍJJJJJ(ȀduJ0@-PM zdP@` |p D> 0 400+ +Ѝ0(@dzJJKs@-Q \p s>0  0 @0`D   _0   0  0  0   Ѝp(@dtK)K6KMKeK$( p@-@PM`PÁ  p  ( ශV V dPЍp (2nH( p ,> 0(@(d}LSLe(d~LmL0@-PM @ nP 8=4P 0p0 =Ѝ0L(Ȁd{JA-`0@Pp!匁0M00x!p0SP@XBT p  8=eP qP p`(,0Q 0$0S* @P =QV"W  V 0p0( e_PR0ct00(0S0Ѝ00* *  `@-&zxL(d|LLMsK#@-P$M 9@P ;p pS=NoNNNNN&A-PM @@lP X 8lP 8 <  ?0P0`S 0"S U1r0%*VԀ  p0p0S ƀxw00 "R00S p;PdPd `尀pp0 8;0U ЍNNO-OEO_OyO(dyJOC-p`@P Q |;{Pd@ R; /0p 0;03/ ЍC %dO(O 0@- ;(JP7@- YP@X{P H0{P400 Np Ѝ0O(ȀdwP7@- 74P@, 9p  Ѝ0(@dO@-(0   u v P&hO-` ,M@PpP~0T 0$0X,Ѝ Ck p;$ P  p $0 S T@0,0 0$0S xt YV  ~  చW 0  @DQQQQp@-@P0P& 0P+ 8>0P  :0P 0P3P0@p@w`p@ 0t: @`4 p@U@<`PpdictarayR nmbrstngQQRR 213/P/(A-PT0p`z@z,0T@@DA?@?@@(?0@-0@ 202 0x0Q!Q3(> 0R//G-`pB 0PxE Vz@PP W 20CS20CS G 0(SS@-@p 2SM"^#n  2"  F 2" HЍ@  ™"2pPh ⴙF"2u X"\mЍ@o (%4SSTTBTPTZTTzs@-P`~  r0SЍp00S@~0"S1Ds@-$Mt~@Jx80́k $0 0 S&hA-`P 0p @Tʬ9 /, q0d / 05tpq  RЍAL`0S`@D@,R} Ѝ%4XX3(A-@0@ @`pPpd1ČL0\ D0d^\^ 0XLXaU(Xp@-4@PL2S0E( #|0B1p(0/p@-LQ ATp'A  …A?@@   \ @D@043c0PpA  RA?@@   ` Ƞ̌ Č @(X0P@-<8B 0"@@$18<4@(O-PTM0x$00(03p  @8 到A ⌠e040< ,000S8 323C( `0$ 0v 0/v0  0v0  0p v$4d"P 2_84<p ",. ` RL` $R0 S 2000#1-R0% TLvL`P@HPs00P00S $2 sP! 2 sP 1  sP' ,0L00 SD av0g2,08 jU$[E\10C?S%<1$\2 avP@1\"BP x PXBx  X20@Px0 0X20T@Px0 0X20T@P`L`(0T$0000Z 00S $0,0(0 00 /JP @TЍ P @X(%4X(8&Y &tY-7@-@.00CS0 8P Pp pp70 P00CS0880 Y@o Ѝ0@Ѝ/&YkYO-a@ pc7Pp?C$0e@O 0rpq Ѝ  R ЍOt`0S 0 qpq `BE,{ u0S %4Yq(Є0p@-"@R  lP"n/{0!!UU08 T0p@@PB @z@Tp((H(G-HbpH@,#g$PPH 6 P UW0剔LI J$ b0,wzU 02U!U !" +I s?@sό0QlX2 G    <1 81 41#(,$#(,sO$@tr ,! (! $!0000 0 8< 4^0 p 0 8< 4P0 @H20H2(Y(p@-d@0P01ps/Ġ2P@ `^`H"̌ B B$ aH20CH2p(O-Q04 ЍQ\` \X0/q84"RMAXQHT-X )02Q Q7P $42S !1?  !< $0 !1?  !< #0 1SQ"R?ʉߍ@P xQS,82SbV<# pp !00" 0p `,V!002Rژ"o 9p"p2R Ci0.I]w 0U0b1 RS  0Q1R 0.J> 6;2S0[ 0"P/ 1R Ci0.J!?Xq02S2S0  Q20S*F0)S  b0)S  0#R00S ꠠ0 ]0--C B  cP2S;&! P@G2(\V\`a\-%4bCXbLc\I\5Uc^ZC-M RUP@P@fЍP0RB1P@P@a@aTS (ЍCq  G 0   1(1!1<0;  1Lz1 ?0^t1!1<0o k 1f 1?0ЍC^(cXcdO--  2Sa1!8p hdP2  (1D0(11  J   < (0B0 D0P 0D S1<0S  ZI@(1 0A<  0I0@; c -P(10(1 0SX0@0A ?o, 2r0S"0P `, $0c0,00 0[@" 0K@0@:1# P0P 0 PP :P R: U 0`$00`P1Sq | U? `k ,@ PR U`V 00$00 P`$0PT0K/c0 p!Q0hq P  QQ0S*0`Q`  0  U `$ t0P0000 ( P$@  Q . A0  L L  @G?LL0Cs \Q*V !L0/r st!0<80t10V3?x1 ,8mO0((00,00UTX0% V 00T L0 0 0L00$00 0(@pV 0 S71S IpQx1PPt!zR Th`P PPL0sPPt!?0It1@tQUP0U*0" 00 0p  x1S TVP@ 0I 0000@x1`_PP 1t!R d6TPP 1b t10t1#40L0s]?00t10I@P30 s0Qs ,0RD U 0`$00`PK/`D08QP0Q:" 0PS00  Q pxPh`P 80"8 R 00 05 !$w(nEp@-@5%SQ%5 %SPQ %UUQQp  0 0Q0 Q 0(A-lP`5p@ @ 0% Ņ{@ŕ\(O-POMpiP b5S5圢@TEOߍt \P@ ET PT 5d 50 1 S$52S$5P R4dP  RR @` d0C## 0 V0 PQ d d0P Eh0K/0h0 _0 4!P,q(r0d  01_  j _  _,10,1#40L0sK?00,1001001#40>00010 00 000T0 CV(5,%PQ Dd &d0Pa((0-0@-@ P 0 5(0/(00/(00/(0-@-  1 售&hG-P`p`@0S 2 0S X|) U TY0S 0SC`@ (0IN\b-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @P|Pݍ Ѝ`!rp@P=0D@rOP 0: S0 RP00 0rPP P81: S P% S  R  rPPlPPPU r PP$0@P(0(@@-+&0P  0 00$Ѝ   (@0@-4S 3/ (0@-_0 @( 0$__@ (0@-_@>G_ _w_@O-`M$MpP`WP"NX1 b: S/a0P  rR Y_00pPP W +UP 0C P"VR V  VkZPN P P W`1\ 0`PIX1: S<V2"b/rPpU PV9 PW002`` 0!$E ${PPt P5^0S3]`P S R S`pP`-XpP ``1\! S R U8Pk`|5x1 "<PaY $PppU`( FPP XND% ܍$Ѝ6JQYgF  F@F0/p/p@-P@@ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P @@@DD@@@@HH@LLPPTTXX\~`\`0p Qp` ]P0@ S p@-0@"!Rc0p@-@Pn@k@h@e@pA-0@PJ04S->CV@->C?XE@9>:>C@@?n:>CF;@ 0? AC>2@}C>G-@mF)@EnF%@E~G!@X J.X V  $$((,S>,@}S>G?mF?HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqx?1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,C2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+[000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  U PP1+\#Z0A0 0 00L B 00 00 00000u0#$ 0 ',"'("&8'$"2&,&42r"bJ 40Ѝx@-@0S6(00S/0/(ƌp@-@PD @ 8P ,00S 60 0pp(Ȁ 00S/I>(ƌ00S/p/(ƌO-M 00@2Pp[@$20S 0`0 `"X   # 3W RL!0 0 u 0 BW@>[! R   X %|10SI p10SET@Z000@S0@0@ a``0@S.T0  0'W ,(PSQ RЍT /T AAV@Td00S X00S0S@ FP( 0 (Ȁ(ƌ(@(X((l(t2O-0@4p 0 P0PQ8, (0R000U00S-  8`P&0SP Ѝ5 p X001P``` 0 00(000,00S/", (R00Z P000 `0` R0(0, 0 Q 0R000V00S  P0P`~"`F0S/"0PS0P Xh5 P PpX00 0((X(ƔG-@PD'T@ppT@@@@   0@S*t@p g뀐` X o5pD @T 8 0 0 00Sp(Ȁ(Ȅ(ƌA-P` p@L5p0S F50S"0 SRp:5p0S 450S 0 SRP@P@A-P`p@ `$P`P00@AO-HMQ M %#0@20 C_ `P/RS0VP(P,0Hr 04P`P "0S/" ۍ Ѝ20S'  qV 03?00?s0S0?0P 0 0, (0 R?(0, R0`00lHHQ(0,   P`k ?0S0S0?00@3/+ 0 00S0?0 _00@ 0? 0|` *?h050S ]&0 0(X((`(Ȁ(ƌ(Ȅ(`(ƈ@-P@p`AMM(x% 0 P@ U4T0:x 0 R0*d U%@d1P 940  PC C%AލЍ(@7@-0 Ѝ0@-\M`PpX @ W0H0T0 `'!D0DP RpRLtP \Ѝ@(|O-QM0M:&p0 `QP#P3ZP3Z0P#U ލЍL0@X VW0x06408Dt068pP<`UpU|tU5ȯ 0N=0 H?U0 0 P 0 ==U @  0`0p 3P5uY``  P0 c1C CN0L03 T(00Y 0000 0 850 0 00T400pSǯǔ !{0$ 1{ 0M$ IFC@ 0<(0P 0 B(02 b>"9<Q0,00(!( {(hrp h(l,0$ 0O  = 0 z/P000 R0T 1Ak QheQb8 1 t0 {1( @( R QOh)@'h(@(|(X(%`( (ƔO-M@ `) PQ0G:0  0@40$?00  52䢟2Q{ p q Br sQ0< ,42# 0JR lTp R 04  0R  P@Ѝ( 0<1 r0 4 Y: 10S<000D0`10`  0<1 010S 10S 0J` $`|1x100s10S pj1pf1000 tpqpT(%`(ƌ%(X(Ȁ(|O-P`FM M X T@U: 0 d5 RC@Th"0pSf 450S! 000S Fލ Ѝp00 1000D0y4 H0T00X0404QpQ\t`  5P!"0S, 4 L000 0  HP" #0000S p0 0 3Y&.P 3 .P0!0J 0 0 @pp  0 0S   P1 쒟!!-P Рᬒ L000T0 H l r 0S0X0l2  0Gi0  b000B[00S2jp0!0G 0Gh [ Y0# 00C 4 S 0040TpPA^!)ol1p 0 p9 0 9000k"000C0 0 S (q   0sx00 p ! pp00/000 0 #!0sx  p0s00S +((|1(%`JJ(Ȩi(ƔbtD(@.C-@PK`pXpaY x10S l10S 00 0\ P4 ЍC'`@DT<  1 QP0H  0A P PC H0S"00S T  0S 5o0S Gpp ЍCeT,P D0 ЍT((($A(%`GUl(Ɣ0/p@-TP@081 00 @ 00 .0@0 Rp(00S/p/(ƌ 00S/(ƌ 00S/6(ƌQ000R0SO-@@"P0 pRMiD R0R0bď080S  C/ S ! R 0C00 0@uἰ? 0 0EM\5t!`S 0 000 ?@U (  R9 R  00C\0 P3 `0/0/  0.Ѝ  [ X R  00L0 0<00/(H((TQ0O-`@:!0 R0* 0L댱匑p SxP P* 0 T C:\5 008P/<# P 1R 0 0/."<0 P 07`0 C c 10P0S   0 -0xP 070T 0 74 , R Ѝ(@>((T(ȼ(|O- 3MPQ P*0HPX k:0 ` \5 0 07@/<#| @2R 0 0/."<0p @x0 i7`0 C c10d0@Lr CC c@3 1B$ 0fQ,040(0PßP 0 8+10S 1 PBU809 ̱P XEʼ 08(,80<01t!0<S0<0<0Ѝ U7 p P\E4EE4`f4U  4 R T` R< ܰ(/? 0XTFVp P Q RF 0Y:P`0 FR Q(^(T(p(h(|(l(ƨ(ȄG-1 `pP060  00@ 0S !0 80`S P`P  n ^'0x K d3R0Z SZ P3 R #R 4(3 R ' 3  R0\0 ᵯ w1 030 00C 04$0S4L3 2$ 吂 B *2|2(\20S 0 0 0: S S-  S3000000sS 1 00108e'1 1p Z5 )L0040X0 ;0T A 0a; ,' 0 C00S 0C600)P( d ⺵$0ˏT0 C c;  뫴 h(ȴ(@((ƘT((h(ƌ U!(`(ƈ(|(0(ȀO-肟2 @lM0p`0 P2\"Q  0 吒0/ 4&0 Jh"h2 0R S P0 S 3 S 4@X dJ20p`M2 RpR\tR`Xd   X 1 R, J&00X0S 0 0 %M*D! 0ST 6 0 S0\0ᵯ 00 030 00 04$04L3 2$ @  *10'h00S ZP8 P>& PlЍSt  o((ȴT((h(ƌ UDD(|(((0(`(ƈO-@|2t2`Vp 0V0  ZPP00 Ѝ k0Ϡ/S e4E U@WLQWU TV A0 %00100 @ |E @TPTpTP Q @A Q@ P  T : 00V02 0 I%` 0 2D 0)D[P@ 0 000d000 )%0`0S000000xs ((|fO-P04MXj4Xp0 ba Pp0 g3G0 GA3B3w T 6(*P  4ЍhC+a 3 0p R =A 40 0/ <3@830000*T  $E @ @TpT0&0TpS @t 0S@ p & T 0 k! 0`00XCb 1 Pf (P  20020SU 뉑  40 0/ ܱ 0 `C 0UCY@"J  10N(Pl 00 p400@1 0/S 7 A0 0000 0 p0S$@0Yg0000o X $ x0r m00000 $_h?(|(@-?I 4&hs@-@P `0S 0S 0 `ЍpO-hEM` MP30S 0S 8,p P 0Sލ Ѝn000S  oP jh20S 0S T0S OX0S|R5 0ShLG 0STF0S@@0S 0S 7M 0 dsS80!"70  " "# 0@D? ? 00? 0DB 0 ABd! 0:B0 X[0SP "0 0S  0 "=  0,0S),04(0AŸ8 ?S%'<08P P0S 0[ " t!0S dPUs @0S @@PUn $ 0SP@PPDPWH0S  `Cn* l.xl$|0S l]l0p00S0P0$ 0,0UA:_000S 0S Hz @1 H0S 0S$o0S jP  !P   00(0AP 0SPT P PP P( 1Or4V(GnO-aH0PSM W0R0: P `("@ "  S 10SR bЍ@ 0̡̱ 0 000CSY?00 1> R. `@p! P! 0 S D  qP      . #0 @#`8P0P 0 #0 S00` @ R Q\Q\(h((\(T(8(Ɣ( 00S/p/(ƌ00S/0/(ƌ 00S/)(ƌO-M,M#@!"[:[$0: S`?[ ` p#P! l#P `!00 0؍,Ѝ0 ,(#P  X#P `h0S !  DP b0S, E : : z  [ 0%4500! ?0S S :00/0S 0 S :V00#03*  R00S :0S7 0 -2:* 0S R P0@4`PƟ [9U)Q900~00C/'+PpP P90S 0P !H 0 0P080S, 7ESZ  Z6Pp∸ U0 00(p UxPQ0X ZwP x( 0 0pPP84L0Pk"S$0 S7 R670S2 V0;Q0-*h0S* 7(d0(3  9P T70S !| `xo @ (,60S0 h0!6&0(Q//V +:'<V  3 #\  R QtP   nPpQ^q U p# # PE"c:U Pp^h R[Pp%Q_'qP tPE! p 10S0Acp0 P ZA 0S 10000S p50S 0S 0<  pPt0/>% 0S 10000S 40S 0S   10S0ꊡ  0000 04 $0 S0 0  `00 0!o$000$0 #600S,40S D4 PP @ p tx3 0R00 0pRLtRPXd00H00lSS/ 0S X30S> \P !,P 2 F0 \00&&t2 0@S0:000S0<`40T/806#e PR8P<`?he0?\ `P 0H0Z0`0A ?Pp`1PU 0\I<5 D5@0LT 0 b32 RH0SC 0 # $":Phh(|(@(Ǡ(((;(((Ɣ(h((A(P(ƌ_(00(Ȅ(p(Ȍw(ƨ(P(T(x(ƴJiO-@5ş|MP,0S%40A HdLDP T0AX  vB5 $00P|h t 0@, R< X5@|Ѝ0/1r'\% R  `  0p`oQP0  0_ S /  p!.p{0pP?00 1> p'@ `008ğ05!"\ Q 0 D0/0 RB#3 0R< S< `3ȓ0S0xpp0@S 7d0, = 0 pp`h30S9 \30S5 P0 S 3 S?pW q~p0 % s\@T`S  N0 S\00 0T @T`VT0? `@p1 0t20兑A0pY 1WS  0@% Ḷ0P0  ) A000Q 0;*0 0pVTQ`p@ `V\@R!3YT @1:@T(a p@ 忸 00  P z0YT  \P  0 ŷ`P 0  R * A A`(ȴ(T(\d(8(0(d((h(ƌ(|(P&h(($ U(Ƙ3I(hmO-` @ 0MpАа 0 0  BRЍ 1PPU  RQ p@l p @ R RP Q @p(ɀ(T0/O-@dMX @0pP0D1D 0@1@ <1 0,0SdЍ0S Pd0,`<0 `/00 P԰ 0E RpU0!:n`P 0A 0RpS RTtS X0S P@z(( (P(ɀ&h(ƌ(| 0440@/00S/p/(ƌ00S/0/(ƌ 00S/$(ƌO-\:M`PV`@@ M<:0S P *0 Q0*`00#0/[ y <P X P )\ P9 `0S 0S l)I\ P00 D9 < 80R0p00S0100,0Z,0S80S0?00000#0%o 0P @pez ` 0#b0 @0C0Q ?000S0z <P0tG0 S$ 0S '00LP7~`| 000S0100,D0+0S@70S0?0,'p 0pp00ppP*0S  P\ 0 0&`T PP @p ` yp& &#0 #0@0C0( .0 00 0Q,*0SJ  JP 0 "pWQލ Ѝ0S #0 #x50S l[0 00$000 r&aJP 0S #0 #50S 4Z`0 $00 `S  Br p P&y ᴠJ&Q@5#0 #00C008S< .PRS4$ 0.S $$PP\P3P` < 8<#0 R0*ă 000AP/ 0 0u@Z P0Sdp0AS0 S(s0p i2G0S40000P 2 D< 80R0؀R0   IE< 80R0yQ' t20Sh20S\" 0 .8P    P000! &!0 < 80R0! R m 0|tcR> +t 810S' 5Y< 80R0 š!ȡ0S  0R ؀yP 0   0p0P``0P00C0Z8#IuP1[ (|(Ȅ(@(Ȁ13L(ƔP(ƌgs(/?(($(KO-WM M'0ASy0 G 7P h7 TG )P 07 00A  6$P 60S 60ԆF6 -X 0=0p`06夶0qY0:6 R W9`PaVuPV{(Wލ Ѝ!  R1W 10SF0T!  0 S01`00/ 4  030!ܰ 0S H0S 0 04040c/ $ 80QT $00$0 40 4L3 2   ^[0{ {<0 PpC((ȴT((h(ƌ U(`(ƈ(\( (800S/0/(ƌO-plMX 9t2tt00,0SlЍ0S @d0,P_50  P 000P㸀@1 0 0D RpT05:D`1 PRp@R\tR`Xd00X0T0@SF0 `V S%P 10S  0@P!P 00S  0 0S  Q\ {{00x |z0R! 0 T  L 0<5D((P&h(Ƙ(|z((P#/7O-MЏM@P90!n0 80t0?0SX0S $5Sp0SVdPWX0S $Yk S Y R(d ?pW\ 0P%T਀X僀 H\800!` 1B`01$dQd0ڜP0C00h01`l0R!B1d0`.0CW P0=SLq QT00H $ 0S 0 x$5> *`>T>0S  0 0ꨭS0 $5B111`R B- 100 S H $~0S% ( 0帐- 00$%BR0ө`S<B11D%L0 ᛮPP  G PP 0S  <PЌ *堐}<u<0S D0 02d0pA?P0;3A?`0 =<0T0.L07 ;0WHQ RX0>F@ @078 <48ϠQ bd{ S X$,0 Sa?^ @PC h;0S @ A>+@B@  CuP;"  @0尠 \ 0 000:J*::0S 20 0؍ߍ0<00

*?H "D H D 08\<TR\\0D7T `V=S(  H"T VpB$r,00C S=S|q~S  m0:!"\Q 0 h0/#00S 60S tnP%5[0Lfh d60S 0&\Q\u0D05P5D 0SP5550:."\^ `0 0/dh pN.' `n3&>,@1p !>! "$5S81(0W8,(2W42,2<0002SV0@ x S0!!~ 4x050 $ST0< T5$2!S\0P 5V=SL5s35 `!~ ?X00S-Z"!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0 3!΍0h0DH0lE ,#0AS0 000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX ুX姁0 8PPK,2!~00<0S. d&10! ST0T00! !0P SX00ԀYd1p10 0 10000$5S `0|63! 03080H D DH `VQ 42!.0$00` S`0?00S00\04 N((ȴ(Ƹ(h[(|(ƨ Ub(Ȅ(\(P&hT(h?(ư(ƴ(l(_(ȸ 8(xU((`((ƈ(ƌ(Ȉ)(Ɣ($(Aa$5S|2! `0h ppWS $%S0! !42 D0D ,|  | x0  ("xH Ht L3p !n r! T0P3 L!T0 R H  2 00000 D0NFxP1  q1*110S 0 020S QL hP 0< ST0T STTZP hF=Pt2 L 0< ST0T STTT0" 020Sy0 S\0P S\,P BFP 0P S\0 S\0rT,0`# 03 ppS $S00S0`" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8*!H &H Xp?!D0Y8 0 S\0D000S8*!H H XA-P`@P000T:Ѝ4NppHX @A-A0 5 P0#R%(r`!00" q0SR 1&0a0  a*t1h10S 0 00SP03Q0S4 3O@ 5*< 5000S Z0 0b@_TPUAt0UC P`0 0S H P80 0S ((%(`(ƈ(ƌ7(ƔU0/(Ʉ0/(Ʉ0/(Ʉ-@-   I&hG-P`p3@0S 卿 0S X|儿 U (TyY0S 00S3@ i(Ʉ|-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @`P|Pݍ Ѝ`!rp@P=0D@rOHP 0: S0 RP00 0PP +P81: S P% S  R  rPPlPPPU rxPP$0@P(Ʉ(ɔ;@-0P  0 00T$Ѝ  K>(͔M0@-4S 3/ (Ʉ@-20 @(L 0$v22@S(Ʉ@-2@i2f22@P/00@-0@S s@ (1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT 8(Ƥ(ƌ(`(d(hT8 t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/(x(ưT 8T8 (ƴp@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0oH3H3L3u/L3P3P3T3T3c _h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\05H3H3L3u/L3P3P3T3T3) %EEP  4K44K44h 4 5- 5d0Bd00000P5P5H5H5=CS>S>h p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(|O-p4M X \D\\t\Apv@H:4D40_ 0 P\ep MЍ0/*0 Po P\JP0S 30S|30S ph3h#0S` \#STq P H0S <:0bS s*$0S @"\5S 2 2\5" 0C?o"20Sh [ŚT"40Q%㓈Pd0$"0/0*:010S?,0A1(Ÿ "\ P 0 B0/ 0Sg0S 0Qh 0S |!\5St1\5P l10S(` XA L!0 0@! 0 * 0S g0 0 00 QK0Ph PE @X* 0R Aֻ(Ƭ(Ȑ(`(p(h((Ƽ(Ƥ7P(ƌ( 8(xT(|((ȸ((ƈ(ư(ƴ(tf O-8MM 0)08PpԴP/I 噻80S i9P/6 d0: S PHSPލЍ$8H0hSO 0)00S e00 7Ĉ 7 8   倨` {8 ul8 o[V``Z`P`<7V4 *P 6Q P 7P0 07|6 R>0 0p 0<|&0t&0P,7p0p60pw>h0 P0p2S# *c*P *^*P *.oVXZ hY 4[ 0SX?관Xx V. 0.  ) <0\:P$V Q3C/n(iPPe 2S|3%8 S20#"20$#20PB 2SAt000000' 0@ak`02P$V20A\2@02 I)2C`) `Fb=) 0| (H 0/`0P|(Tp#0`P\`Q=S/z0P 5` ( 2RV0 SS|c 5*< 5d3 X30S k0 0`20S 0`3 0 S` V 10S0@S< 0$|2= C ,0" 00t rAo6#06# r00S10Sʸ10S0=S0S PF܁q0000 ` 0L%000P%X30,,da * D10S Y0 0(t(ƜB(Ơ{T(Ƽ(ɐ(X((ȸ(Ȍ(Ȑ$OrT8T"J(z8Xx/VH(ƨ(R(Ƹu(Ȉ8 ?(Ȁ9(Ȅ(|(Ƭ(`(ƈ(ƌ(lY(((H(\(Ƙ((Ȩ(@(Ȥ(Ȝ(Ƞ(Ȭ(ȰO(Ɣ(p(h=S$0S,  0`<<00P%X30*0 00S b0 00S? 0 >0S a&PDa 5*N> 0:#: 5qh1i t10S 80 000S$b Z1P0a0*P1H 10S 0 00<cQ:drP 0\b<0*0l2( x20S j0 0r0S0L%r0L%r0H00q" T 000cH00ST>P$c*43@30S 80X# 0 00L40q#  c400cL00S Pc*330S 0# 0 0x4 R.0E q\ `PVR d0SPt4d*440S i0$ 0 0$d0Q,%R0%45 R S! t0040SPTu*rd5jp50S 90% 0 00u(0S xQ$ a0S< x 0(%0Sv8Pv*E6=$60S  0<& 0 08%<5HRS$ 3 H00<508SNWPv*660S Q0& 0 0v@%D5LRS$  L00D50@S%(P|w*770S "0' 0 0 7 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!DH0 000L 00*880S W0) 0 0h P`x P8[Qڨ0QTڠ v 0 0S Pi*]9U90S $0) 0 00S/ 2( E0S0QQ&d D0 0S kPpj*+:#:0S e0* 0 0 E0S E0S EFE0S-(Q\KQK RP+00S  E~0 ppV aF!` . R  ` {E0S72 uE0Sb]<Q| mE0S gE0S aE0SH  <%L 8 @D%X<0,5S0SO | ,x000p<0,5<0(5H000/<5L08%0/@%D5*4<<0S \0, 0 0(=0S 4=0S(@M*wP=o\=0S >0lmh f=} PC P>= 0S= @PL Y p (@TW> @0 @?00@1>0A@O@@ᾢ\.Ph6  (,@Ξ>P) ^ P;00> 0 S 1 >5> > 实>p娞WP?ppY (? 00@DT@8L4H$0/dLc A! a,3 |@`1P Y) ?0S  y8L4H$0/d@ A! a,3 11t60S  ^X6p00^D@P46奲@ &6P  H0%#500050S 1S c$P 5 5 @ Q kU0@ v`P @@0 8< 4 0@%S $50S (J$P 0  0  ``8 400 0 0 8< 4Q  10SX[PY 04 S hp"0S^`LP_ 04 0@0Sd>Pe0 $V:PP/PQ ̓0Sd%Pe000 400Ry hc0ScX Pd0 0 0iHaC0S 00 0 0 00 40 LC0S 0 0 00 400 08C0S 0  0 000 400 0DC0S 0`v``&$` 00w 400 0`qC0S 0@00d 400 0 `1 X1Q1Q,+ 0S |峳tA 5<00.\!00T!0P!0#00#p RW !0Bs00P 吳P0S؜0@ҜPT0 pSW0(l(ƌ(r(Ɣ(ȴr($(Ơ(ƨ(Ȑ((pLABLR(#9V,((X(Ȗ(Ș(((Ȕ00S q: S *C   S D00S @-46 * R  S//(ƌ(1x1p@-0`S d`"@ زT D10S810S(  1p10ST00S p@700CS0pP U 00CS0 PPYU NU 㘲YU0 P0  0 0 S(Dc(Ƽ(ll((ƽu&&p@-PD0@0`S p 0JPpS(cO-01 (1$100 ɟP 1 廟P 0P  PPPpp(㫚 @ 㥟PT`00 XT V p WP @@ 00p((ȼ((((@O-@1$M`Hp /2#$`  ` ,P 0 <v  8%(-P U  0 BP$Ѝ? 00 0/  0P0 000? 00QS / Ϡ/0  80P (Ȑ(ȌO-`M0P8 0Đp@/2#@ 輘Z 0 Ѝ 0|x忱PZ ЍOv 0/  塘P I0/ 娱0Pp(Ȑ(XC-P`U@ (12 U+P0 PP0 0T2`p؀*0 L@D0T@S   8L4H$0/d@ A! a,3 h1 ~0S   0P00`0@T Ѝ(Ȑ1?(`((ƌ(l 0S/A-@p da Al a3`Q0 000SR P00@00 0` PЍ(((l(p@-0P@T@T^d pA `anj3ƌ` VW @ 0 0 0P0@0@00 Ѝ(@(ep@-`P@XMX  # `P @>XЍp 0@-Q0 H0@S $\00S P?008^0P00-(|p@-<`# $  $0 \# 4$$ 0<$( 8D$ @HL$C0 5L5s0P500ߍT((h(ƌ0 \P/Q/ 4    Lq,PŒPŃ , TPH40S/<$0G-4DP,4$ 40S2 40S. T0SD #3 `3R0B-R? S* 3`30S l0P 0U`dSTSpPsjPUU00Q A1P 0S ?/@KIP`"hR0"00S8 pr003Pb0S* xX0S* 0R0E>0*X4>  2p510S w0 00S=\P10S = 1TQ d1* X1`H10S J0 0H10S <= (1P 0*0`00S (0t 000S d0P` 0.? 0G(Ȅ(Ɣ(l(p(`(t(Ƭ(:(|((Ȑ(ƈ(ƌ(((@sX((ȼ(ư(x(ƴ((O-@PMDp8 R03B@^? 03 ?P00PUaVa` 0 SQɑY\ m"0\P  0X" L0/ w0  !$"$2 0Rg Sg r0S 3S @0? 00S  00S`0 S  0`Th!Ϡ 0 8 L3R 25  B # R#  B ` 0Q" @*0`00S `6 ` `Ѝ 0aS  0$  B$ $ R $  B ((H(\T(ȴ((h(ƌ U5(8(`(ƈA-Pph0``ATR I@P<h0S @  1p0A(ȔX<0 0 1S01/ 0S00/(Ȕd0 5 /L0P 3 SP 3:.  SR///(F^QO-0(p,P0`4@8 P P0P \ 0 S   0 0 0P0  0S <0 v 0 0 ((((ȘQ/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐp 0` R P/! 0p P  C1p  1p @- t0` xR o/ 10#/C!000P/ @-Ax0` |R  /  /C! C!/! !/ @-,A|0` |R  /  /C! C!/! !/ @-9AG-@$Q uql'`h$RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP pP`` `iP P:  8兤p ~0S ߍ<0`0(00,0 00004008004004 04$0D0(0P W\  ZpV tTp* hld ` 8  @i 4+j ('j #j j 0,0j0 j ` p 4`?`a8SPb 0  00*0 0P& ? 0 *0 D@dAde[@dzs|A-@Mp`;@@ p@ݍ P@0-@kT 02 " O-`M$MpP`夣P"NX1 b: S/ 0P  rR 00pPP ДW xUP 0C P"V۩AR V  VPN ^P P W`1\ 0O`PIX1: S<V2"審7rPpUYPV9 PW002`` 0!$⒩ $ȡPPt @P590Sӡ3]`P S R S孡pP`-奡pP ``1\! S R UPk`|5x1 "PaY $PppU`( FPP XND% ܍$ЍსJ7?MF  F@F00S/p/(ƌ00S/0/(ƌG-pP1P00@ʟ 0 X 3#!5` 5  121 S `0~Qpp0a0!R00S 8% 0 %# 0! RXh000R T00!ǁ8P,0((Ȗ(0_((Ȕu(Ɣ 00S/(ƌO-,Mp0`@Pအ0V000,Ѝ000/U $p$00 0$000P$ R / 0 00P00T0SpP8P֢p(F^(#8R/G-P $` 0p0V@`0 )@`` V`@&!D( `G-@P 4pS Y00000`auP0Y0\ \! ##P0p/Ѝ_uP: F^^F :p@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@40P/ Q\/O-@Pp02#U 1A Qw `R$` J U c9# S!V Q  V30  P$ I` P0 c9# S V!Q V30  P 0$ P ` U 00 ЍN J0A-1àQ`P |0|o Q%0Sp P$@@` pFQL @ @Q ࠱00N }p@-@P40S:a80Sh0h 1C0C800S   0P00PP80Sp0 C[C , 2,0S/`0@-0@  L2,10,0080S 0 0 [C0@!(4 ,0@-S ,0, C@TP @ = O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00P` U0#03?Z[[UV㈋@D @0P$045Q ,EO0$0 čD 0XR @"!H08pp(0

 T 0S 0  PQ0 S RPQ4(&zxH@dzf‹{®0G]zO-P-@p`,M$P "p($0S0$020S'$p P V 00 0P0Ne0  fP AP PP `pP$kp,Ѝ`P0 `P , ?o  00 00 `6 p 0P5 pq p Up` &zx !U3G-@pPT!Vp`:D10S:, ( p$ o09 6X $$ Rp+ P%W00S $$ Bp YPPU `fV rV GToP$$ j &p$x&zx{ĘĴdp/0/ @- oA-@P`pP 4i\ XޜT  @@؜ 0U  A͜ Ap^&h ,P/00#s01 0"$#O-`p  FW Q @ WP00 Ѝpꁀ > 6 P p7 P P*"? !  RP*  @ R*P*? ,#? O-@P0p@`P T \0᳐ 0S@P 0S@P 0S@ 0PP 0T) ?@TSUヰრ:X *%@@6 p1 7 ,0DPu% R0V@\(`@G-(`$p@ᏃPP 0㘤I$0 0qP Q ЅPЍ P-@-0  Ѝ Ѝ/4A-  |`$(蕁S% p @ 0APQ Ѝ ̒P404 0R0/C-M`@ \pQ0P0 0S 0SS 0S$$U7#0P BS  R$00 pP ؀$T 0 0  Ѝ-;-@-00@j 0u Ѝ@ Ѝ/-@-P 4(嬚  dЍ Ѝ/O-MP`p3@PЍ 0P<0 8eP 4S  0P%T"$ Q; 0P 0S 4S ,0 20XS$ R 0  „RGڰ!0`  }000 0 0  @ 0zP 0  iP} : zT되'P+``4`VS0 %0 ` 50  p`4PH 00PX:o{Ʉɨ`O-,MX`\X@P$_ 3R 4S 0+,Ѝ0 P P0   RSRQ" "S 0 dC000 00 @0 P4S0 S: 0"0 000 @0 0P$0 oO0@ 00SS P%XPp'xp   0( 0@S4S 0q$R  pPe0 RS  $ 0   p_PN P0P 00000 0 P(p6oU3OmʀʯʝO-P$M`|pHL+@PXv@P0C$4d%t(, 0840; üpd` 0 S; `峼p h4044s p +1|p pL H4* R9 : S0$4SB. ԑp  $4S3(d,T0 B. p (d,T0 $4 07pQ 0%0 x$tW|(d,T04$t0dT 00(d,T  0 p$R 0 0pp 0p4 $   J~p JhAk0 P P3p 0 PUp P yP* 0 0 SpP5:$Ѝ00S 8p 000$0+ ! 0S'+\i/`坏"AMY@dtˋ@dˢ˸"KX}̢ @-@P 4B BRP p 84  Ѝ@Ѝ@d̷@-@Pp P P64PS 4 InA- P@PpT 0`80X0 /4  p( pq͈͞$$@-Ͷ$ @-@@T@RT ńCs #00<0$0@000< 0 0 @-T0    G-`P@Pp 1 PoP` A0 `A00 00ₗPU:Ѝ 1 00L0@0`qP1 00 hPU&hC$4 A@-Q@- `S@lЍpP P < 0R00  -5EO-Pp_o 0R0`@tMR(0S00S $ 0R0 U tЍP PU 0SHQE (0QSA 0RS R8$ 0R S R.A 70[ P#  7/p ' 7/p 40 Pa m0 $8  P P  KP UA-@pP`qP 5/p 4 5/p 4 .eC-(00PS4p Ѝ$d@ 0 0 0d` 00  0 `WP o΃μO- 0 0pP@ጐT`  P `V HH<  0 l@-ψp@-P@`0 n@TpϤO-P`,M p@FE0     R  0  0 pl PU0 (P pٔ0 SE ,ЍψO-PQ@04 p 00` ЍP PU0 E `P0    0 4   04 p #00 #p  "ϼ0s@-S`@ P U0 KRP: pyЍp%   iQ000 BR00P0S -&5s@-`V@P`l` T0 ?o2R0S 0S00 Ѝp-5@- iR sR aR p` R9p@-P@ P (`Pp  p-bp@-@T 40`P_Pspp-}iR@-- 0 aR bR LR( _sR% tR@P 0P0S`I00Yp`(a0 С-Џp@-@ M\P`P0 0͵0,0S ܓ 㘓ЍpкG-Q@`M QP  ЍAP $ }pP hB0 00 ` 0P $~O-$M@pP tM p $ЍPP0  0  0` H0$0V!<#P0*Q P`0 0?V `S0S PV0P `E0t PU0 qp $|P< 000 00 `P } 4! `k40o404 40W0000S08Cpu $$5 3 0H R*0P01 T0PZ-:L0SX 0 pO L004 0 00P0!)P= 4$$   4 P44- p〰% /_zјѲ10S 0@-@C^M E$囒E$4 p0 !P!Ѝ0 @1q !ဒR0 pL0 \|X 80  DlP<1h&zx0DO`rӇӞӼ0$ 8O-`LMPp4 S1D0J00 p  0S& ! R"|!LЍLRR a0BSS0 D1 0S  0P ْ@P   M |@ =zPట < | T \0 0@ ) T J@ 0  @ P@ p4 &zxi4-BDFԐ&VhA-p`(P@{P0 p!`P @00 0$0@-@P$0S 0|@-|O-p 0T 00S!Q` $NP$ a@ P P T%mpT bT  k0$ЍP`&zxO-@$4TM⓴(0Pxp  <"`B P@儈0P|`TЍ X 0 Ո`ꀠ @000 0 01R0 0|áPP @0| 0C`l1  00B0P @0@0$ 00S; #; ? YQ Y 0  0$ +0P|  V# `F0,0( r,0 Z 0( 00S$EK%U ? P@0@YT Y hzdC-\M0P  Rpx|` 9X% DP00͵@ @    0 08@P 0 ,-0S ' \ЍzP `00CS`0p S00 P0S X0X /X3&3S @-xMm0 $8@s@ T sxЍ/C-2MPaqP0 tЍC܇0 \ׇTԇ` b` 000 010 0"ppP彇K 80 0 嬇婇 q@0 ?/8r 0 # 30 VWF \\9X匇 3S   xPPr8m0 $i Pt 0p UU Ѝ00  ppP\1S1SSxЍCMd 1$ AS lC@2!&p@-@`MMP' $ !4S x0S h  # 00CS 0,!804 ܍Ѝp A!0(0  0 DkP 0  ^P tӆ# BcPʆ@P 8ÆDqIT`kyC-MMPp>@T hcݍЍ0S@ `  f咆 Pp  $4/ Pp $4'0o HO/H0 B P @,h.D0 B D_m0 $8KKDWU#  O-YMp MP @  : B6j=H0Cr?H@0 00 0剐0 `0T     Q 裟   0 J3f/J0 BF-FP NJl#0y0TStk/JD3 BF.JF? Bޅ.JF? Bׅ ҅0$$ 0 0 2" ƞP" ⾅ $ĕ n?P0S1># s  SP P `@(VM?X?#P?U`1?`#X3V`3QA ,  (\ZPWU (00  P p00  P D Q: $   P  P X1  P UP1`P00 ҃   PUM@ă(мI &@th( &zx4;K?Op@-PM@P`4 <1 0S1L0$00 @up T  P 00S  0iR TR LR a0BST 9plRs0BHzPЍpTp&zxL0 Q /0@-$M` 0 0@P!!8q0!tp#0S00 P 0S80S5 P\^1 0T 00S! 0 a@ P Tx\pT QT  Z$$Ѝ B&zx,@/p/0 1@-  RO-PDM@4O0@( 89 `: 0p30sS 0lS#  0P1< 8#Q  3p%0 0,0P,0"0 )#Q?0$0>0 0=00<0p 0;0p0:00(000DЍ pY0X$C-`P ?@P X`P FP [@X XAP `U 8wAP PTW@ @PT a}"80x2x @P P P0* @ ?P  _P\ $WP  P $ 02#U: H4AP  8W@PWa [2 KC ?P 0!xx c@P !0xx X@P X0 )@P O0 h @P F0 H@P m0$ 8W0S e`P P '@P@0T ᪯i00Ѝ,-D&zx0G$ 04>GDLJ&p/0/O--@`p[Mx+pp h;0S XЍO0FS iS4;PpC>؀C$dsP W ЍeP`P W00 SzPOX0P 0S tVPp $4LPs a` VPP VP 8 /LP_M`8 =P $8  pQ< pH?P <X P < |<Ph0 PQ000 00[008000 0S$000,0{VP wV0P00 ^PP a`P a$gPP0< ?P <hP hP xH C=Pt dP ==Pn L0 SH00T0$ RP0, 0`0 8pq 0S$$03"(pq$0`:u$4P `$$u$4P` V\ V`P' LUP# PY<'3,UP Q^0P(0 (``P(`&? `0 pqx <P`x6o  <P |6  <P \6 <P <6  #<P 6  C<P 5  2<P 5q ;<P 5  F<P q/  <P q?Rr?h 40<P rF1S 0Rr/0s/0{{7r?+3s?rr?  <P &s/ u<Pz s[$$t$4Pe0]Pf p480C(0_`P _$4` 06pqe( x8D =P3CDxP |3D 5Cx(D =P DP83 /<P 3  %<P  4<P 2 D S=P $ D@ ;P @ Y* 0t7$ Bx $ ]tP$$03`"pqP$ HtX$ 0!]  T$p  M,$I8X0$08$U1T0P GN\XBI` $4xpq@P$$t$4Pp`\%,$$;`"Ypq1$$s$4P` &zx -$:~ D#)-pUF+8_o0@-@M P    0 0S$p@ V 05up N0Ѝ00i'J@-SM@P, 0 % %$ &&4 '@p H0P0|00t0`*h 6XB00DL`|`p D Sߍ@i0ii!@-@   Ѝ10S/p@-!MPM@P% PA. (01P A!Atg{P 0`0?oS c` 06P ``$R{0 0A. 00P0P A A:{v3{0 0A. 00Ph0P AT TAX{ 0 < 哞4{ލЍp(O(֐~s@-1PP  n P g `@T ЍpkP  00SVV  z@0 R ! O-M@ Ptpp" `P")  E  ARP? VRPLRpP VplRP V PD9P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, # 9P_ 0S\hQY @ spNl lUZ L帩X (t0㯩W 0k0S, @ hsP@ `spd HQ L 40R !yt01Sp0S 3/p\ |] 8 Xgsp \ [ 6@ `Zsp Ѝ 6>KSBHlA-pQ@P@QPPQ\`P SR P IRP[@\T @- :P ЍA-MP p9@P00p`ЍpP  ј0 rp 1  0E:i@-@p @A-P`QpP00TP@?0T  FzA-P`QpP00TP@:?0T  F\@-( Y8P00 Ѝp@-8M@ PH8P1 VIQP T  Q0s0S00&TPP  Q@ZDh ?  T4 PmQ`ZV8Ѝp2i@-@BMM  p 0S 7  /  (V(@0S700$0/ (` I(@0S BލЍ<x@ x@i<r0@-MPP@P TP p0V" C T 0 0S $pЍ02i@-@M   pЍi@-M @z7P0C p p 1Q0r R0s0, 1p`Ѝ  iis@-`Pp@ @@F7P0\ T+@P`垧4S PL ! @PP, C㎧bЍp )  B 3 n7@- P@DpX xHP P<0<( CC,0 dP@ Ѝ0    n7@- P@ pl #BT0PGHO P808 30C) BB@;P@ Ѝ0   @-`MpOP 0P0ЍSP@U _@P0 H4p7 0 P@ PPNb  i@-$MpOP00$ЍR`_@Px0 0 `pP0ܦP< P`@ p06զa Oi@-,C Pw Ѝ  @-000 0  Ppp `n_@P㩦| ` @ppl P0 R00bS vatU vwP ix    s@-@`<PP  ?p sy0t p@-` MP@OP [R Ѝp P    Q  PCO@}XD iv0@-,M@ P5P0 -  p,Ѝ0 R0 s0S 0  "QPP    O@FXD  f p@-P>p@d@@NPL0L. CQQv P`p #  B7@-X@ Pu5P00 Ѝ0  p ;DHT 4@- L@-M X@U5PH0H+. b00 0o p(TЍ  i @-M X@55PH0H-. B00 0O pTЍ  i 0-M $00; P  uЍ䀐i B@-@4N P(0(, C_N@   n00@ P/a CRWC/A CR=C/@-*00@- M@ 0( 0 p6 Ѝi 0@-PM @P@\P@@ⳎBh {G 4  uЍ0@D?   @-@LPP m'`PR?0L`0P.C B00 0#vt0@`Vm` l0PR/C B0\ L@ @@@@vW s03/` %x   &h  ////0 L0L0/%x0 T0T0/%x0 \0\0/%x0 D0D0/%x0 d00d0/%xp@-@pP g00p00D S 0A0CS[0$P >PS 0@p%x@-p0( 0`P/ R/%x0 O- 4M@@!2T0(  DmpďG$P(0 `!pSđp D@T PoS@ڔAP`@ ?pxp`P[T000 [  Nr R  P Q R/ 0S $P\(P  1/P Wl@0S  mp 0$ SR(0 SLգ\ 2/P W0(*;e68CO-M Mp@p T pP8 㱣( I`P  0Y  r⪗r/'t M tm[>Jp0 R > emp Q h t s@ p 0 Q (s%_X[ `00@0 09mPs; 0I 0 48<"mp 8[0Pt0r 0` <04mpLh <Ds9^8H0S +P01tsH0S>I0S;X`PU 0 3/P:㸢 "r 0r00S:0 0rr0S Xws } os u03/q ⊒I0.lpNI0SâQP E"%J` 1 `E PIEP @0 l1 LAp 1 LJA@!1 ,'s `` #%J`!1 IA @@ |1 A!1 MA@ rPPU_ 03/P 03/ݍ Ѝ`ii~5*%xii6(MP@KiPizpO-@PpP  p ;T 'J@%JPT! 'MJ<`P X$PLU @1O0S drQTOTJpW P.Z  P' [3P! K0S 0 L0S 0M0S 0 N0SO0`S PPV r 8(&@-,MP@pP cJP`( O vp0S h㬡 H0P00@ ⠡0  咡,Ѝ(֔(i81@-P@ᨍ0 PCG-@#JPP0 &`@ Y㌀iMp[MPP  pp @ H@@@g\@[e2(֔s@-@~I@P!00Ѝp7MP)MἏ@P <` P<\u (֔s@-@TI@P0{ MPMᓏ@P L` P\u kЍpe(֔A-@'IPP0 |`@LLdPPp ᮍp4 BFJN@e(֔@-@ \W0PP0P CeD 0 S8800 >00Ѝ  (֔&h 0@-M@;IP6IP 1IPp,IP d0P P P P 4P7p qЍ0[(֔i7 f7@-@囌dp ÌP HpDPь P! (p Ѝ0p @E u x   A-M`@PK upp"P  (     jp' (( pt"<@T d8Pp\2PLp RU TЍ0 PA2Y@P $@ip Qmp t 0R dp k)p pPp L`Wp X`Q$R@Mp pmLP:ЍAZP\ 0P R   1 /p 0 RS᱋pp $ o0` R P U 0pD` PH!l(i8i! !!!!!!   !!!Pp@-P`@QGP V  WH`P Q`Q0 00p>GTpQA-@T 00`Pp}L0 p `@@-MPP00Ѝ`0 00p0@ 0 P J0P 0 p 0 `P0G-@(P00!`( p Q1r0P*0X 0U0$ 0R0 "00"SЍ:0P 0 , Yp 0 @0@-@P P@ FO-`@pP,(0V0S 8^WP$P$P 40S 04S 0S(0p(`8P0S$0(PYO-M00q W$0J00Ѝ`QB QE 00 -PP4P XU =0P t,,`.,d4@[T /M@P00 D0800P cX3X5T (M( R R["00XP 000 Ps 2BQn0CQj Qf%^0XppVPP[ Ჰ  $P RIpXWI 0  EpB 0STt .PPX!0 ➝8!100#R0S s0p8_@  0YPpG@T 0CS0 0r xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@Dt@S 0q@0@Dt@ T030ZH@UXTp +  :FPtOU@ E40 0 0`0#####A-X Pp@`P00 50P 0 p 0 `P0O-P`$M@ HpX) P W0  }Pp` 0p0  0p- 9pDP08pN/Snp `|0 h sP,00P0lP,00U0,`(0DN/j%ݍЍ(֐iK%G%C%I @-p ;耐iI%cp@-d`dP0S s@ Ppb cp@@pP@@% (O-+pPW` 00S`1 000xSP p<14! @T Z  P 1! P `IR  B`W    &,P Y:WWP P0@DBt@UWAq0@D@W@Dt@@t@@&p&t%&&+Qp@-@P&00S#0 000xS*j`Vpp$j`   ,?QQ0S p@$$j 00&p&H&K&<&C&tp@-P M@ U U( H0P0 Ѝp 0TPTT@ !!0P!!` RPP  @$ 0A-p`Pp@ @P(-  Ac&P&Xp@-@P`M   `ЍpG-SMMPP|! p\!#`FpJG@*0#30 Sd0 00#00pH0pM/P41S (0Y CM/Z:i&pi(֐&kp@-`M@ip |0+SЍp啘P  &  C R #g <dbp ]01S Y0/S F&i & 00S/@-@h(O&A-P@`TplP @ 0SP * &h&A-P@p `PW\. T9PH0 000  (p`'!'&ti:@- M @ph  T'P00 Ѝ0( 1p 'D'Xi9'`@-(M @p   -)P00(Ѝ 00S D g'P 02 ( p'l''Xi9'`@- pp 0QSЍS   4h''/0d 3?S $S HH @S/8 S $, @$/ //P(PPP(((0x 3?S $S $S PP @S/@ S ,4 @,/(/$/ /(((((G-X`@p1!0R f P A^QT TXPD@YZX40PE200G D?GJP(((@- M @pld R&PT0T 0@ 0p@@$|E Ѝi())i)g@-@(M!  0P p@  ۖ0 pؖ(Ѝ)w)|i)@- M t@d&Pd0q rT pD 08 0xp$㲖 Ѝ))i(i)gA-M< Pp! ╖0@P "` # 0(0pp0@`@$`<0SPL100 0(00080, ?p&x $!P@0 @ p  :R@00C00 @P500ݍ@ T0S hB@0 @)P0  S 0)))8i*!)&t)*00@-@4M PCp  p@d-d,(p@-P M@` QP0 aPp@@B Ѝpi,@-< @r#P(0/ Ѝ,#)@-@ @^#P,03.  Ѝ,8)0@-MP "M]@PۍЍ0@|B P P+R\P@mBۍЍ0@g\0S0S1iS,M,g@-X @f#PD0D/ I zpȓЍ,v)A,@-X @I#PD0M/ b  ]p嫓Ѝ,),O-`MM@ 420P4 lPgE7ETP凓7U'S$0`0@ 0 0 @`F( 0Rt'P} 0S0'V 0d).0030070 0;00@00E000 c(@!!0 P Sd0 /C BRX      -B8$ B2"!0``F ^v E0|800IcCP S@BA`p 8 0P0a c!0@"0(0(0SF Rc0$ P0B'S$0؍Ѝ 0 0'S   BS>C\'0C`'S Q:<ǟ"!! CR   ##9C0C<"!% 'S&2"!2.B&>C2"" &2"!/B Q 0v*Sz S &S   2S% S`r 0S R )SfX&0C'S00 0S 0 tC t0!c0( 0 B( @ R `uSGc X>b 0R 0c`0S b0S p`e0  b@5I3&⩐`YP0  @bp b0S V?0$3?S8H@b0S  qbbpwp HcHAHY$1᳀w渏qxp`Fv`Z! i av`Vqb~V(0Sc  ^ ,L, ybIx#0P# $Px# t#tß P Tdb`3JP#S0S S<00!031 0@-Mt 0K@P \G HLPP @ (@@ 0KP 020Ѝ0%@6M(,6Z@-@4P ,\`$PA T`U]6M&h+P@-d0 !T| T@0!6q0\ (0000/8|88P@-`0` X| TD0!6q0\ ,00 00/8|88P-4s00#p^0<\ 0000/8|88P 4ps00#\,s0P00/008|88PH- 0:# ^4 0P$0000/8|88PH- 09# ^4 0P$0000/8|88P 4 <# \,4P00/008|88P- 0:# ^ 0P0P@d|0:0# PDD#^<s0\ ,00$008|8888@- 0 00\P Ѝ3%HA-P♅p`@WЍ  P 3MP@ p7@-P@U0  (c~H Ѝ0}9dA-0@nS0oSp@ p}P`\CHPH0nS0oS1JPP,JPP'9j@-k0 ^[9l&hO-M M0 0D@00 h0JRp0S SD XF0 $ 0KWFdFFkF5Fp@-@PP (0/SpHp@DGG0GI@- &Z'WG`&hO-p0000@P`ᜐ (,唰00 Kp0@DTq oP0 P~vP<Ĉov8 O3&zx--IsGIh@-M@A>0 0D@00 h0Qp0S SD xE0 $勈 0VIIvIIIp@-@PkP (|0/Spp@JJJ@-  MV&hJG-`0@P $p堐0 Jp00@DT oP0 dvPPFu  xVA+ZG-L;&zxK L0@@-M0A~H` 0P0 @?Qp QVLPSPl@-屆Q@-r8 l0 0}0000000RWTQ&h7@-P @@6P00S\ 0 分 Ѝ0Rp@-@ PX0 0(p)uPP(xPTp@A( R3O-@H `p0H P>LLD%Hp850`FVQ8 52@FP 50S  4 40S 4 0<0074a08:$0000000d4Dt0@90;84giP04P 04I_0(80@008 0sPP0       +  @   ' B D# R4#  $# R # , @ ( "  )            s20  r0$000 pr0 000 Lr0$800 (r0<:00 r08:00 r0@900 pr0,000 r000000r0909 1R@11r0$0000 00t0,00w0 00x~00007000+ 24 ~ Ѝ%U % U.&zxP(L(D-(PR<TT(HTTTUU U%$A-RMMIN@XPpD`p`00EL y넁H00p$tL0Mp0KS 04  R< pL04@0 DŽp> 04n/`  xHP 0 ,PEP.0D P! D43U 4$04 0404040 40$4 0(40,4`044<$@URݍЍD$R(DUVUZUcV)VXVHp@-@PaP (r0/Spp@WWW R R @-U/X 0@-@MP`p 0L000 MPPЍ0P0 0 0M0 L0P ss@-0`08/00@P ~LP0 JЍps@-`P@00!  PT0 0R0S PU @@0 |TЍp(ؠX)(002P0/0S" -CM001010 000000 0 0P A, QTH00Cߍo/XQO-MpP8@@`p+ p D;0 $00 00<0040D0(P080,0|0PF0<0lP<0< Dp PcH00Ѝ0S R@  T(ؠ`_XdO-$MP0 1p@0` PS .V08<00$Ѝ 03/ X0p 1QQ P0 `r0P": P0 ` @00P LH0P3/pP1p 0@ Q0  S P0  0 SX}A-PMM`p/ P@1L# N4AD0@@ 0@00 0p@.pߍPHڀ@T ,(ؤC-P[ 4M@@0P` :0P`PtQ E 00H 0 P ` (0 0``00S0 V0S`0000 pp  pPP0Qq D0D00V 0 0000P0P4Ѝ 000<0(XXX(ؤ--0M 00H0 @ P (C zg ˆЍYY@- hSiPY.&hO-P@M$  00p 0@"@0"@0 "HDp20a0CS t2g@pbP 0p00@0⥄p ! 0 oPށo P f0S R 㿁  t㸁Oz g!!H1 _P B0S R  d  .z ' Hp0 r+奱>Kp h 0[4S08pS @p @Ѝ?B-&zx[X-YYZZ[/[[0@-M MCN@80P0 0E@%(00 0lJp G 0 @Q Q Q(3 P(00Q,1 P ,0HQ0@Qލ Ѝ0@QQ[\\ \Z\x\j7@-@P 00Lo SϜ 0  Ѝ0]@-@10P@]@-@30P@] @-@ 00S 00S0?  ЀЍ]%p@-@PṕP (ʀ0/Spp@ ];]P]i0/p/p@-P@ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P ħᾧDDḧ@@ᲧHHᬧLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@PzwtqpA-0@PJ04S->Cb->C?XQ9>:>CL?n:>CFG 0? AC>>}C>G9mF5EnF1E~G-X J.X V  $$((,S>, }S>GmFHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqx፦1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  , PP1+\#0A0 0 00L B 00 00 00000u0#$ 0 7',"'("&8'$"2&,&42r"bJ 40Ѝ]0S/!  O-,Mp0`PTXP $ ?$ 0P# @T 0 }bP BPG@U   P @ @ @ @g@p \0XU @ T0 0D dS1R "P  T8 DR0UQUDTP 0 @@@0X R    0Z0 t00 S   X,Ѝ0 00 (}0 ^]^#^F(X^g^@-C@ PU xxNpp]0h@S``^P0SK@00 N  N@(X_&h`^_00S/@-K(X0/s@-P0@0S 00S Ѝp@0001!Ѝp@el0`1#ā0P04V a: 0$M"ZKЍp(\(h(p(ݴ(ݼkxR/ws@-@00S#000S 0 Ѝp@.?.ă\0P`t4V +: 0$zM$$KЍp(h(p(\(ݴ(ݼkA-Po10MSP8MU`aO0@OS@ 0 402#0, p!?P0< ??. U00S1UN@ȼ@Dԇ 0ݍ8ЍAɇ0*Gx0 R `\ : V 001將0*jݍ8Ѝ(h(ݼ(p(ݠkO-C ` d 0A apS0 <0S  0#‚ 0Px0 㥥`0 C c à01d0 P CSQ c ( (ݼ(d Ullo%(l&hlktp@-P   @ ܽ@00Sp0?0 00Sp0?0p(d%(d0p@-0@SklP r00000B0F0p(ݬO-MM`,U 51N_R0uPSiap51C7C ?D 0SDD ?2?D44Q/nDp؍ߍ 0DŒ@ 0L 04;20d04 0e0  00@4T@:T @:T @9T @ 9T @8T @8T@@04s00?C`p40S7x 3 0 000p0  $ `  Y 0 XY0 ``a 1n,F⪼Ϡ ß\/F ^~222102?"""2Qc 0D@ő"L00 /4;2BtB 0d0 0o 0 a2r 0aW= \Bp`{Sia11BOB/0`22220&OD0?0 0 4C0 0D@E0L0 4;Ġd00 0L l104  22221(0$ , 4 0 2? 0  D@őL0 0/4;$!PBA 0dhl 0A a 0<t%((\(ݼA%x%o(ݜ(dTO--)MM,0=0?0(8$0AD0D`0S> 80pW:,0 0  0 bF(\(p(h(ݠ(ݴP@P`P @4> P@  44pA 3E'p@ d3T@  5SP@ *・ 5P (zd0S0,5 Sx0<0(5002 0,%S0022Q04RHg 0QJH_xrx" 0 04 0A XC0P4p3x000<4%$0<0D0t@0|00匐XL5P5G 0/)8`F 0/"  ? pue pG8#PE0 0" 0 p p45p<4``0%8$Sp`G411 <4800x 0 08PpS¿PL @`@0? 0 0`@QQ*0 /˴@Q`(6#R0:޵`@0$- 00[00 1p&"0 ?001>0[`0 c2# S,Z!Q Z300 !1 00^00CC şQp0?#"4 0/ᲟWp1Wp#T0p10G 0\E 0/VPPB@TP` 0P咟둈! 00B1  B[1 ` U"B !!0 R0CQE0E/0P+ 0pm둈!0 1 B[0`0US  B 110S 4FIe @P`x1  G0<48ĔCPp0S8Ą<4-0$5BPS,pQɑRBDL0 0 0000`60S|0p ?H4L04P@0 @6p9''?R@00 Q 7u,7\5?>C0P奁%4tx0dP7 8!"T a31< A202!0 0`@ 04 p ᪸ 0L$4  E$ ( B, D%LV.  R*h (r < ( X ( \ (( ?.@Xt@+@B@A.@B -< Hu p @40K p0 ,p B A YZQ !0 XZ R  Ŷ{A/ 8pW $?. t{ 0Ąß Rï<0\@D$44 0L4( 0ĀpL2 R 5#< 5023|r0S-x됺 z'z'{z {' 00葟0d0 CSQ c6Rc(;R`D @<0 z犸 z'(Ȋ00 (08;R,D 00 SP0\h!P !0@ 1@^p0 Q0&㽷0Sa@ SD PQ0 뀠@t7 *j0JF 0bK0`0S >(ݜF^o@o(ݠoo(ݨ&@th&p1(ݬppp,T UlTp(`(h(\p(ݼ%(p(d(l 8(p `00S; 0 #$Z ~$0+V. 執00S  0=S,D0S10$0$1H@ pp8=PP04SP0 0R0 S00C0? S= 0,0 0P0lA 0,0S9O p开<嘥ȿ+" 8 Q \%`R 0  ᐡ! #0@(0 0 @DU@4A~820 @R40 `0```0T0 (pb 0 նp2 I `0 P$5"S`0 9pR80<0匀 t x00Sx0x 0\0  1`0  B1$%R\# R0C00h0$l`0 R#00B1d0 R*%댃U` p 0 0 0 (0 0C 0(0(0 S 3`R` Y $%R0 l ! `,4 p  R2dL 4RT T  4P%QXԐ R0 d0 0Ʋ ò  ི0 !  8 ` Ua@Q }+H05H (P+H }H0:0S , 0 B2\,^   00/d A! a,3 1 X&~B$01=S,00CU a010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0 80 C  0C1448000C ST00C@ pl`p48 0 RT*0C14  4  0T: $5Sl0 @0h pp^:S $%S0! !H`$p$p(0W4x0S ,4  d,04  0,4 $N 00`  Vj0S   0帀0 X#` x04y 0X\%Ϡ P R     d 0L  l!1f 9\%R 90SP Q``ƌ` $$T0 *`S` 0$5S l01` p0000S2dİ0*ST0T00! ! P5RXԐ S(0d0 0> ;   5(000080@ 0pS`0?0`@$00$0ppS $S00S0@Rl倐HGP00@|8p`0x1V<pYU0IX!@@݊l00@0T: 0 @%A$\Q  @08( 0- 0( Od@ 0LLC l 01p0SD=0S0 000S.@08C0S= 0Ϡ5,"\Ő\   0 d0/ @ `.N3,0 $ @0000P4>0S4> 0,00C0S0 \>0S @0S @>0S 0b{ @00@P|:x*,E`P>0S`EN C>`??.0S003040 4004 pCVW*LpV.PdoV.GV△0S  ?0 PS?\5=S,₳??^0E/L0 0S 04  dHLĒ 0A a04 <,$0S0S 04 d ,04 0x9 04s9)ݍЍSleG-`RM@Xr oPP poP`` `P P:  8l9p e0S ߍ<0`0(00,0 00004008004004 04$0D0(0P !W\  A9pV t;9p* hSod` 8  @ 4 (    0,00  `⽲ 8p 4`?`a8SdPb 0  00*0 0P ` &0 *0 p@dAdep@dzqq qq%q1qCqWqjqA-@Mp`;@@ tcp@ݍ P@0-@R7T 02 " p@-@PᰃP (n0/Spp@qqqR/G-P $` 0pRV@`0 K@`` V`@&!D( `G-@P 4pS Y00000`auP0Y0\ \! ##P0p/Ѝ_uP: F^^F :p@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@O-4MX0p0\00``Pٲ0 0,(, 0Q P 0 mmQ2aQMQ AQBA0XbAP Q SQU @  DT dR$0 9Q売"P T U8$0UQUDT P 0 sQ@ @ @U   @@@ X 00 d m0S000 00  0(04Ѝrxrrrrs @-;,@ $>XAU;rx&h0/p/p@-P@    ApG-@0Pv t``PE0 00000BoH0UB?E ᴀ( (lP0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p( 0P  C @-l co`/ys@-@PH` 008`$V P@lЍp(( y!s@-@X00SPH0`ă5#40<@$V $ P@lЍp((( yEh10 PS/C-TQ@@MPM`6`@f$q !`0 P08 0 T:@6S/O@ ᡬ DD6ۍЍC 0+0 R  Q\ Q 0`;Pd 0+ۍЍ(( (((ylO-BM p` %PPp"=l 0F0< (0 06# R 0 ")'l0 60 0 !Rl00060 &:06 0@p00C0(0&V :D!p`p`Vp ᠕03 {(x$6/呕 6   C c1 0 &$6/| `V&L0S% 0: S$0$ ` хK0d  &ЍO&?X( y%A-a00S FT:p\$PP ( 0 0A1S0S& P @D A01 S hk0S @21060&i&06@p  06p 00C 00( zTO-@PCM0H4쿟? S`$j g37 W0R1Q( 0t0C@0FB@> 0(b S 03S0! ,05pᐩ 1 U0B 40sP40  0AS (00 0  ,pF 0$MX-000 6 0 6,= 0$1200U(  ,000$P`%($0L $(p|<d0c0@LP<43 0T0l<0<X5!<0Slh X!`<PU ϨPH < S L0 VS $ ' \p$  0A! \ 11 C œf0F0&aPeeC0CP!Pp\p ;0 0"PX0e ` ㈭0Z0C$00SFk 0S 0 2#*&(:C1:0 0 00:Ѐ70^:P* 0 ( "*T: 6 !0H 0 0l:Pp`D" H&TJG0Sa9Q0N 0 iLp 0W㓆( d0 fP 6W0 \0<06s060060$00S`0Cp06 0V( @p06`0!oD 0(Q0 x0Sx 0Sw008@ pp"3PPXP 0R SHr SpᱨP@p0S g4L0S d0 P& 0D4#?o2%T ED&0#0H& B 0哔)6 7} 0  公6吗0CT 00C0CS: Bp`<7  S}0S0  C02#& 8xP0 `0V 0:aVK:e3006l2  0(01 0* 0 J$T4  060 5&ĥ(6YD:L0TSL0S d0 7P U950SpW.@11 21`0!!!0 Sh$ ᓢ""] $0d0$&S: 060Ɩ  0&_0.y8xGTW0A 0@4#  8pX0SVPEPU 30S~ 8W V83PU$CL0S \0u3`0_ s PP1 P# jⅫl3616l0L0p0t0x0n1086301P? `XrU&?` 36"0U? 0 hl hRL0S `0  2#'$/%x261hPL0lp0t0x0/1080&2l0P"( frP 7p* j16m1L0p0t0x01f&! 02/!"6 QP*dd >P 0 l0PPP r*0vw `P  P  6< ( (zu(z(zz{{I%%{({(%QNS{((|(|(|@|}|(||&@th&|}'zt},}5AA%}0}:%~%(l( (!PU: &< " & U:0 UU:"0 !0 hpL0S U: 0 000d0R: S(:Y0  6Psd $0 "P S:x!  90q !01P 1 !  7fP <` $,4 H2``Ɣl2& 0h0D?o2e#D&0#96P S2Hvӥ pG0 sHD0CߍW20/p/p@-@P+  $$((,,00@@DDHHLLTT\\``dd W_ WOpp@-@P`ᥩ}zur o lif c $`$d]dhZhlWlVSPMJVpE0AVp0Sp7Sp2Sp-Sp(Sp#SpSppG-`RM@Xr ePP pAeP`` `LP P:  8/p 0S ߍ<0`0(00,0 00004008004004 04$0D0(0P MW\  .pV t.p* hed ` 8 Ꮸ @ 4 (   0,00  `k .p 4`?`a8S|ZPb 0  00*0 0PU Ԕ0 *0 5@dAdeL@dzdm~A-@Mp`;@@ "Yp@ݍ P@0-@-T 02 " @-`pS  @PK00S0?0\ 0S 0 UdS\F\GL0 \ gL|0 SDKT ЍE%KUJ%FZO%A_0 (@-H Db5<< P4@0 ,PW5U@U2&h A-Pp@`Q0V 0 cG-`RM@Xr >dPP pcP`` `P P:  8-p 0S Sߍ<0`0(00,0 00004008004004 04$0D0(0P W\  -pV t-p* hcdH ` 8 5 @4 4f (b ^ Z 0,0T0 P ` 7-p 4`?`a8S"YPb 0  00*0 0PaT z0 *0 @dAde@dzs (<OdA-@Mp`;@@ Wp@ݍ P@0-@+T 02 " 0-<\   RS  0 S&l 0 /)lQ@-$ Q:GO--@MMh Vͦ0d00h00\00p00|000 0L0$0l0(0t02000040<080H030<00404p 040F00G00H0040P0050<00S00|0000000S00?00H R00S t0S 0Ptp|0p 0l0, SP&0D?i/0*pD$ @|0p 0S @% D*P k0 D@/aY@P#*pD 9,P Ol0S 1 : S  R 5 L DHPPP0j VPrPE_oRb p4PU p  8P 3P@D d3m`Tb&0 0D0h0嶜&PQ T O@ F┥0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100| S0T00RS00 R0 R0S0T0y /Ҩ0P00Q4,%RP `R  V 000PV 0`S`SU [ T @0S X0S2|0p 0/>0 D0p{ 耝p`STD+vpv @@0S ?W01?0#+@0hph X0S*_p_ X`[ 0ßZK Y  Y* >05ZR[:L0Sd P!0SV\ hPXP UU L0 0P U$ PDJJ=P04!,A$ 8!00 h? 85)lD&hhfffgURRaArrAaXQ0L Ry 0  .`0ST0S00`0 Yx00x0T0 0S03%05# Y Y0<0 0S<00<0 0 <00 00Q.00 0$0.,0S 2.[ x.|Q`. 0S  .T0X @.0S . 0SQx <..q4nEQ `F..Q. @.l0S ݍЍ0/^ &>l02)`PP ]l'&>Cb) 0< S0|0| 0$02#l05 Y0000 0l 0H0 20R08 0R000L0L0S0 Y@ $ p000h3Q t R t L0 p 0H0( S 0S d(0H H00 (0.00\0S" Y0( R030"S R&.80S  %p% P  P>( (0S Y0( R00S $4 0$0 Y?000 @0,0 0#40+40`00 0?1@0?1X0?1T03?003? 0 <03?$00(0x03?,040?30?3)000@00 0$2?@1c4 04v 08#$0 #(#< 0 0  - =Q p0Q\0S000t0o0 00 R  PT p嬠&?  D%pi P` ( 64 R ( 4R  R 0( S 70$71011l0( $R030#R03S 0$ |CజQ`000S  0! YQ0R0( lR00S LT(0 00 25 0?10 0P B24 0?1(00(0S  0   k B*{@-S-`@ 8 / Ae@00@- 44@4P\P 0B"" )p@-'B=)@-۠ P-Q*&hG-`@ P p塟00?P U0 0  0P@ G?0P`03" 0P[ R 4[ U   )p-Uns@-pP@ 0  //X 0TT+LЍp P `/0 +)p)@-0S 0  0, ЍA-@p M0 0S P `M1 00` 0! 0 ,)),1 (,.:+.A+a@FPVX`F: Ѝ+0@-4M@ 0P0S  Q 0   R 0  4   0 "0!4Ѝ0@+R  $   0 "0!R 0S 0S  0!( 4Ѝ0@+4Ѝ0)p'Hi~ @-?#pZ)H@- 0 R* 4s# p@0)P `00CS`0p S00 P0S X0X /Xy,&p@-`᝟@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hodm`0vPp <10C <1$0 810S81)p%&&h)0@--@4MT +AQ`*d*hQ 1*`"R d2RK* *d2SA x= hk0:{PPS['ΞkHk?[E{741 = > * + (;R  PPP* 0 @@@ ! zj{ k{[;R[*4Ѝ00B:k{{'*k{`;R* ?@@?6C-@Y))p%<))t)p@-`j0d2S ()p@0@-0S0@d2SJ`2"R2%)p@-@ 081 P 0/'t@ t0 t 0#-S88<8xS`S)?S DS .  <(8(*Hy*@0C %K+ C 0BK+ ޅ00CS00H@*a0CS00  ?  ⬕PK @0P< 0A0 9 90S9 00K +K  dI  ⅕PK 0  PK.  K     kPK P 0K. &80    O@Pjql 80S D8  ʓ ` 7PR _?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?0-I?V3& ⎓ t `PK PP D70S@'0 0C!0R3 70S0Sy K  @PPOh Wap^t0@Pp s pTt@@hP0X#T0 0T\  TpW pDS  0QSL0Q0P@_0X\0D`X0D S@0S) @DU2 PP 9 PP<VK 0P@0 K. %K>< 0/ $@@mpP @x XI -^0S$0 0C!0R3 40S0S 0P`0EP `0z?P c=0,C0 0 S;.000 P%+ 0  d0d0@ 3iG Sp 01 1 Q 1 \R \??p@1cE0D H`R(D# R  D%  Z   Y   \0T0S lD00D0, L0 SH00H0H P0S  ?A  ⪓P0S>$ > (  ╓PcݍЍ   Ta ? –PP|A80S  0 OP   ` jP  0 ]Px ` B  OPPj@t0SC 000+ RLDD*0* * *&hZb*%%~'D*t**fffg)Fbsx@-<00iS03S !48P1!*x* @-l@h 0\ 0 LI  @4D  0 ?   : -+82:BK+9@-@`| |0 P0D!0PUR3P T0p0S 0@ SB8 0( p# Ѝ*%*Y&^C-P`@!@1 0E!YR!tM@p  10S # tЍ000iS00S 00S d `P "W @ 0 l P wP000 p 0p9 W@000*%*th&*x*%}` @-@X 0C @T!0R3@ 0P   0S %*G-pQ0S dd# @P 0S 8<8a8qP0 0@0C!R! 1S1 _ T`Pp̀Ԑ 0U0(@P 0E!0R30S z | X#0S7 @TP`00 @$ *&****t+8O-$ 0CQ0USp0 `PP PP" @P0 D  0S= 0S: 0P5"  UE  ,; V S 0S000C?oV20SP@Y\ P`P30S  "|#0ES0 000H30S ЍY3 0! X@00020S >P0 a"lX0000  000S 0DDA" 0 0@0010S P0 YQF 00 0X@C0000S X0000000S~ @0 0 n RT 0@s0S  @ 0 @$ 0 w@WL00S 0 X0} L(!3**t&&&h-?\+8~d1A-0S TTM`@H!0 T0 :414a PU @T*$PXP@`0S 0D !0R3 Pp U 0S 0S  |l!P0S0S \0S < T!v@*&*+8*t*0A-0S |P `p @T V @TL$@ 0S$p$00H`@*&&+8GG-!1 RR0堑S @Pxqx! 0P0:ЍS @L`P 0'F  000a @QP:RS  0 r Q `u`P0p\0 j000e000*x**&`**&h(2O-0S A0b0 <`1Q#pP@p0Q00^: 0Q0/:| 0R04:60 R S 0T,:SR00X 030"S P 0000 S( @@   0X0:0 SPhb \ X 000P@ Ѝ*&***&hC-MM@P$Q0S 奿p@ 0T0:ۍЍ0S 唿0 A>000@T`PP@p0 + Y #  000PU *&6*'0p@-0S U`Px 0 U0p(j@TP` 0Q0F00S .@*&A*ZA-p`P@P zp@pDorP 0L0 0C?oR20S  P p&hp@-? @Pw$ Pp0 SRp+\@-80S$$ B0A A45*`&hA-`0p0O0000 SPڤ/0>+b P0 P<0P@O 0 y0O0?+\+ T%0@-@0 0q0AЍs@-@P`P @TZ TT ?0 0/V+"+R  + ЍpH&h$0L<S/ @-P+ T&@-<p @,FP0@0% O-1@`pVCMv Pap@0DWCߍ貀TX B/0S x V@0PS 0 ?2/ 00S 0S 0S0000崐(h X:0000Y&*Đ0S 0 0S 0 000R*Q l\B0S D`W0S  `*l+(*&l+'O-h3p0]MS TTȽPcPC H0@#@00RS $#05 Bbp2"!CLLRPP "2W 0"00RSZ 0|"tlXbp`"d HLPH"L  Hp<+b  P<十P P {Z0?0H @P MPPD ^  WL P MP;Qt]ߍ*&**`*x%#+ TC&Qf *h+\Y9:|+&h&@- @ 00: S*G-@q `0S+ >P 00S 巼P0 S00P R HRڀ00S |p  Y\ȋP Y00:$00S $**t&hfG-AM`P@tpP00 040AލG/0 008/P1 00C0 0 S0+h X t0 *{ 0  D p6+ T:d<&hgA-MMp200 0/R @`㜀G,PP 0S P@ۍЍ D @ᓉ`D @P 0S P`+ Tfp@- 0@ @P SP @p@-@U@O-3tM0 S 孻눣00RSx3 l3l#0hdC4#SXC)PtЍO蓻@c 4PL  +)F0@`00zAoԲ`L<` >L\0@ dXK= hpWW#X2@P L<0@(f0PxSiSeP 0)0@& 000 L<0@ Q&#O A``TDL KtЍ0 0C0D10S 0pS%0` S\Xh0SS   +8+0d0S X00%B0P!xgap 08$*&*x**`C&%&h+ T*|;Us**A-MpM`@PP 0pp7d!d%@P TTL刀땎< 0ۍЍ aD D< lpPU U`k p0P g x0S p T0TP 8 N8 [EF&hK+ T*|*c@-:P@-L@4#S 0   0#S0 @%0A-@P` 0 Q0: 0plp0/r @$aD00S$`V0 SR*+*t 0S 0 0/ R  /0S0 h p@-0 @Q0P*H`0/r Pp0 TUp$/p*+0p@-P@ 0 Q0: 0|Ax`0/vr!1S 0p@D1 $P\P@@p$ 0*+ @-MPM@T 0``p/VVP   妈P @T@ۍЍVP @p@-/Pᐏ@P@p00/00@P 0S $A-P/p\0@oC 0T@@DsWU pDP@D+;G-pPۆ`04PSp@P`0PP0C0 T`4 $;D@R+*\G-頡FpTP A`Pt&0@(0C0V$Q@$0( 6啋00v`PPEPP a~ @$@@(`/k 0`0 @ `P`;0p P0@0 P $+ +*w@-@@00$D +0@-S@ t0S 0S k 0S e0 P\Y T` R 3aD0&F$ ЀP 0S00*;+p@-@`PP|*0S < 0P0 @/VPӅ_L0P 0 00pJO-2p0SlM  20SJtlPP T\ XMP0`000@4 Q 1*`  0R 0@*@a0Sg@01 $10 %1 08`008<8|0@ ‹A p MGlЍ 0`0V@ 0 0/| 0` @T`$ q000 0 0($00S0,00S0(0 0S000$0S0400{@0 1S0 00{@*&[*|vx&h*+***hC-30MS QY肟r0 p>P0 008000Ѝ PP *h d| \8P t8 (m (@0@D `P P![ T 1RQ rQT 0 $SP P0h<0 ^P X1 D1H1D10S0x"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t/ R" *&*+!&h+MWy*x****d/+& z\>?$0@-P *<&h0@-Q 0@T0 R ||[0AS@ ЍH0 DJPC( %*+ &hc&mp/0/@-x 0 RS T0R H0P88pЍ S + I*&hA-D@p 0 0SP( ` `Dp `+ L0@-  Q0 0P ,0=> Ѝa+ *&h@-0xP 00S@%*S` P@` 40P , 0 Ѝp+ *&h 0@-0@S 0$P B5/x0 RP`P0kpqH0P@`ᖉ0 ((@ Ѝ*p+ *|*T&hp@-hPh@4S 0SPP *%D0D P0000$R0p40&+ **+0s@-0@SP  40B3/p00S\0  pH0P`@C0 ((`Ѝp*p+ *|*&hp@-P,@P@pP @p@-X0XP0SpH`@P EP  d@p*h&+ &hHA-P1a051q0S :p9y@P 00P4P)@P!KPو2 0B@ (;PɈ" 0 000@A *h+ **d&oqs+G-`a! OP L F 0,P: %+ k909909 Ѝ0 +"+R ! R  xEUY0+5p`PlP d<sX (n`e ǃ0S H P_ X000/zpq V00S |0S 906;#;S T%nT+X k+ *h&*t&3&hu***P*+#0O-t'BM @R MT'T7PP zP P Bލ Ѝ$W0S70S  坰00eP 60Sf [XU R OLIF@hfhf090464838<0<H-HL*Lfffxx| ]|f9^EfEf:^EfE@%0A(US0 (12222( , 0 4 8 @ D P T | Z40(01@ 0D0(02,020028 0T0Pp00|`P$ 0PD \4$ R> P<(4 R $ R ޯ3   p`|P y +^0/ဳ#0/00#00 20 0 0/0?(00#H0?X0?`0 0,0匓唃,p\`dP⁂20R000%60, (0\20=S" " X" R.x30=00 2R 00#| # #/%80/&0 %0L0<040h0 aR!S  ||#3 h`~ T"1 !! 0AQ  a9-0CS Y  R0 R R 0N\ \0`|0=0- 90 t*llT+ *&&(k*tA&a&h.C-$2$BMMP0000 00 Qa0S q=쁟0=P 0RP!0AS\0 =0p㌁0Wd1pqXP 0RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$ 0 @-Rڔ0=ۍЍ|0 p0P0h0d0S Pp 0)>**T+ *H*3*k&h*;O`lO-MM M <$H08B@@4hS< 4 4R 4S #404H <Q}<,` B < 圃夠PM@☓{D0S[k 048h#4 "SQ A 0H3/04$!0H;s0 83 @A 6/080 GS00 G0Q0+ G!0 S004SQ 0H3/048H0 C 6/080 4S9 4,`$0? 0;DC0 4P "t <Pz ׍ݍ Ѝ(`4SQ 0H3/G;q A G6/04G;q ; G$04  BRMP@0SP 80S1P@0S( 0$00S  B 0SP D$S 0S2 00S \0l 9P tlx x3  PHhP0ST*T+ *k&*R*t& 0 *Y@-@0SS*0O-M< 00 0 80 4 @b Pb 0 @00L0@0HP0DpPP:P S  S  S;  S 0 PP p SK  S"  S,60S   60S 6f0S-&P 050S   Ѝ50S P 0 p<50S  ,,  0 00 %`90S40S   40S / P 0 8YV   Z0 0 0T40S 0 <30S  q 30S30S 0j/MP_ 0? Z 0 8H30S_ H V0A 0 $#0 0 020S  " 20S8x20S P 0 Z 0 820S 0 o "`g0 0 0C|10S 403/ ZZ !LEZ00 0P10S00S 0 83000S 0 4\  03/Z 4   00 *u&h*&**|+ k%Z[\+<*pY9Jf*p+@] ^\A-1, 0  S !@ 1 1R 4S8 !4q04@0n`P1 PP0S  R-* SR/ AP/ $!0 010  QP 0PV 0$O iP Ѝ0PC0P;C0d0P80S050 000 @ 0@0 0**T+ <*@-cM0S ttpCpS0S YMPm~8#044  R0 3s 0500L Pr5"0C590C990C9000zPpp 60S d2l"h2Q090 9} 0<< p000SP  *|&h*&p@-P@T` 0T0:p9P 0S 0@P*p@-P@T0*p!P 0S 0@TP@-@"0 00 g0  xla0 dT[0 P<U0 <$O0@ ( I +'+'p@-P@P @0 4 0D !0R3 p*&hp@-P` n00CS08p@ T 00CS08 P yTnTyDop0 @00  p0 0 S*&h-@- T L00S @P@0PЍ@Ѝ/&h*'-Rs@-`P@00S#P =|0 ЍpR00SP (|0 `TL00S8T A0 `| f*|E&hv*@&p@-@Q V P JP * B P  :P  p2$P d P*0T S0BP ,! %p@T&h-A0@-@MPPPP8 ,0P Ѝ0P++@-0@ M \0 00C Y:u6 ۍp@-0@S m't0P0SdQP 0@00d{ p@044000Sp p@*|&h*&A-/`k@Pp/@DЍ/SpPP 2 0  3P0000S@-0@S  0S 0 000h0@0S IP {d @044[000S @R*|&h*2&@-0@S 0 000d0@0S Pz5 @000,,00S @#B*|&h*Y&@-0@S 0 000md0@0S bPz @000,00S @i*|&h*©&C-0M.SPp4`8A0/SS  刦0  0PV ! ,w  4q          l  X E00@ 0a5Ѝ*¼'@-I5CA-@P`App` P L850 S000ЍU00+/CcÌp@-BMP` 0 @E CR V  tyPP0FS \0 BލpAS sP0P S00@ Y44á+/èCA-P@`~s<0 %pvsW 4A+/C@-#AP4 ;y 0SP   P40a#PP `@iPL 00p1 F0S6 0 00@1@00H`V105 S:; S0*PP 00P  0 0 P 0 Ѝp_S-S p`0T 0D0P0;C+/ &t,+/*h0@-CM@P0, f 0  DCߍ05+/@- @ R800+/=@-$M0h ` F P'@PPDp$ЍPU Dh0P 3FK+/C@-d`$MC/0P@   r8p / +$ЍC+/@-0@XM0F/P XЍCQ@-8@BM0   Bߍ/gA-pP0`V  @  0!S d \3 :w 0T`0 D 00o d2 0+/ƞxp@-P@U U c 0< $ p@Jj Ƭ&ƺP 7P P / //-M M? 0c'6ۍ Ѝ&4`00CS`0 XX0 X /&C-pQDMDЍCj@p`dP !W200 u00@020PS00C00@ Rp@T3 W+X( U U    v  v`0. !   v  v.0T ;HHrp8(jp W&+/I+/L0@-P83TM<0S @Q TЍ0@P0!QyGD0"0CS0 "P7ETЍ0@a +!0S SL02  `X"d0AS!0 @ 0S(TЍ0@>   00P1P2P3P4P5P Ѝ@-0  6 ЍO-@p P7 aT00SP Ѝ -QP  P P ADPP@D`FRPPJ@-@0 0 0 Ѝ@?@-Ur Ҁ&h@-ؿҾ@-QAMp M0W`@0lyq`Q`\0j p80P 0,r\0 rAލ Ѝq0R S 0P01 ?t08 !R  0Gb@Pq0 0q<T0 <^8<@D@ D Z0R0b`G +68Ҁ+;TX@-+;T0@-6S H+68Ӿp@-Pwqtqqqxnqm/l^@Pp" 5PF8 /2 +,}k$ %p@^Ӽ+7H+7T@-q  &h0@-h@  0@ 0\Q0CS @C&tp@-@Pp00SpG-XM`!gP@Q% 0rS P @0  0k(000 00ld0P    RQ  XЍS @0  0P@+>A-8Q夁X@`!1  0 0AR!pRS4V0 1SV nAVS A 0e]VpTPDP@XU DA L0V+=&&؊ױ0@-P@0$M00PP0 sp$Ѝ0 R  h'd0 0 1S0T0 000 0K&+=؊@O-\q 0M08@ D @CT Ѝ0ZЍOR`" 1!0  @@0"p Y LPP  @@ 0 p R Z ``0T 0CS0 8,$+=+=|\ݣ!0@-P@0,M 08PP 0 p,Ѝ0 P  6'!! 0Q P0P}2 08Q( &+=&ELRp@-`@0M 0(`` 0 p>Ѝp R  &|P10 01SL0 Dt1S*DP !g&+=&_G-@M`Yp2 0S 0 000 ([P (P(0U%`(` Pw@P@Ѝ`(P$PPv (  PP$0 1p@ЍG(` 0v ( 0C$ S  &v%Pp㜡v00Y0S Y 0I00h!,,pD1! ; 0(  (`(Pv ( i (V( $( 0 0  0 00 00 0 00$0 0 $0 1SD"!!!! +=g&&(o؊vC-M⬀p`` (iW0P0 0000 ZPPQ ЍP@P3 PP  PP 0|p%ЍC 0R  %0W400(00 P( 0SQP y0 Pp0!00(pP0Slp1SX5`D0S U 0* $&Pg&+=o&(؊޶0@-P@0,M08PP0 p,Ѝ0 R  n%0 0!1SL zZ{e[jKZfke[KK{K;R&+=؊O-xrMM00`S@ pTPO P, H5%J@ h Y:0@@ 0Ep.oTٍЍi  p  Y  $ i "QPR !,%*1 21 k0T 1S1!T0 0*T 1!0 0*P`c0 D  @Pc 0 D o+=O-{JM M`P@6c03~<00c0`400pc?c8000S0P0S@pThK+!W 0 0P+4@pW4pr4S U08pA/0 :<0 Ur> r.0 014@:@#TRT 1S-  IR:1t| Y00 ! \ XzD0(3p0wG, AT,T|pG y, T, T뀀pG  y, T , SpG  y, S,t SpG  \y,P S ,@ SpG  ,y, S, SpG  x,S,SpG  x,S,SpG  x,S,pSpG  dx,LS,<SpG 0x,S,SpGX 0 ',S,S 'LwQ (  YX'0Q00S? 0YS; \Q;X PD0g4EH01HpL001`00pD0 pMpL01\0@sd\p&4 0#Q0\00Cs 1SL`\0@sYG4 0BsYPE pW.-a ,?[/4 pS u,S,갠Z 0 R(0 R pP f 0 0 0P3A7/%00D0 Jލ ЍYD 䄟 RH 1 H0ipH0S# 0 0 @3SUH  7O "0S qߍUme 8۱80U  0Se0Spl`PY yP- `P.U `P `P040 `P040  `P `P040 <`P}  ` PU  ze 8 |804U ,< 0She0S ` P!U~  [e 8 ᫲8 Up ; RIe R1!S00:qxo`P#UW 0L 80 Rk aBQ @IKKLGJ 2  p  Q)PHFDBpe 8 T8 0W d  R0d R0!1S00: <04140K0S0<L  X41S 4PU 0H?oU20S0H?oU20S0H?oU20X0S d d 8 8 0W 0 R0d R0Q0* 0%0%04140K0S0404q@^4PU4KU* 1^wd 8 G8 W D Rfd R `0 41 40KS0 {wS41uXs40Sm  Kt 0H0jXx7' VX\ 0sXp0;p00,7O0P.v900@D @8ADQOfP 8BXO08 4@V80 R@00Y@0-1 `0, 400@pcS  @c40$0 6@ @N8 80p @B1!0 p' 04 @1@S pco0 ybdDp5pH NpHP0 SX Zbb-0E1 nd! `0 D000``Ipc 1!0`100CS$$1t' = S@P qߍOtor4S 04p4 (04c0(00p`000 d4, *Np8Xs,s RT=00D3`  p^@P0=S 8 R`  c^P 0=Se 8 R @b  V^P 0=S 8 R  \qߍO\( T W0@400, 0@WD@'0S S1S `Y pP PU-N , 0 0(0 0,003A05/00P9T"Y\(pD,PW\0,S(P T'&b XpqF b0"S b 0 SX0T R d00SW S SX0 $0Cs" 0P T0Lp0 pT00pGX@ F000&00' T0&p+=t&~pZ_l,Lz 'if ;׬q &0i+@H.ؽE+=0.T0hp09b0SR@@T T TJ0P 00p0@L <@' 0@0& 000.000h 00P> \0p XR qߍO"a0S \0pP0 0 0000( 0, 0I0s@-a@ 0 P= ^p }` P  @ 0  C &ht0p@-@PT`\ P  p@0*p@da 0+A @-M @ P   Pۍ?p@-IMM @` PIލЍp 2P0 嶮0 l尮hP 0S 0S0 0S  DP?Bg+A@-M @ q PDۍ00 R   $P?+AH- p3MMjPPYWS@D)\P 03#\P@ 9 P 04\P00 S 5P P00 S ) P2  x `Pa `2P X[P ,PPP0 0x U,00P`0S X QJ0 P J P 1J@ Pp10S d 0[ 0d[PPPUX$ PC`U 0  V, )6PmP`ZZE_oR 0PP`U  4S J P p圭p* 0XHP?+A 9&h^~O-pM M`;pj/ p P@@p p p0Wp10Z?:0S ލ Ѝ00W1@P @Pxq(0IT*20Sa00 0Z0@17 0V98 Z RP _1Z. _@ZPZ 0p V㧉 0Z 3P v_Z. ApZeP h_Z. _KZZP ]_ 0Z. _Cd|Ade+A0p@-M`0 0LOPPE0@P\ ?OP Ѝp@8P  0 0P : Ѝp0 S C/p@-@PXP`XV pp@bZpO--M` \PX07`@V8yЍJN`0PH0  H0P@0$ @0S  4@HMU U U;ㄴx0@X|6hx01\x00Sx|=U@40X 0S0R0SP T08 ` PH0@pXp*0SPx0/ DX3S00 P 3S00 P3S0P P|0S|Pt  0000000 0% @@|0P P@D㽋 @H0D`04,P@00Cs@09X0S 00T0[S40DჄ,0t  b 0`p ,0+@0p  HB0Xx0@e X 0Z1PoJ~`0S 0\ S^ 0<04L0<0?d0?h0L0?l0T0S8 竸z<0相 0SFx0/W |0p xp?/0 t W {{'0p0<0t C0 {WL08 0t PW0p P0, 0P0<040d ,0 h04 0 @000D L00l D0 JnX0 p0x0 0p0p@@Y\w~ #K:T ; C4?$00 p+4cp 8L X< pUp < 0B/$+p4Ep 0 0|0: {{'000000{0P ~x`,Ɵ 0 Vp 0V 0 ` 0SS40d,0kე0S00t(  Q 0Ppw  +4po ,004 0S $+ 4pa I0 xP ŏ 0V p0 V,0`S# 0 V0 P0S40啛t,0{ჴ0S80 R 0 ,b0 0`p 0 p$@ +4p 80D/D0@ 蓂"80吀1 p ,004 0S $ᘰ+ @4~p 0I@4,E@{ {'n F`{ 00|0P PaR0/@4,+@{ {',0x`S#Ɵ 0 {"V80D ?ᒃ 80 0PV00 0  P V 0 PV |0 % @Y4@-P\ &hA-@p4S`  PT0DPEE$UX  WPV00vWP V0-04 P $S3MDPE@D+B( 3p@-P@Q0 t 0 pKWP@ R 0S LZ#Pp 8FG00 0, 0p$L#&+qhl,,t,p,l@-2400S (0 0 ppF +q+qh+FG-XM0MS0 DpW,Q`@`$$Q0 M+0A@<P 0 0 ۍЍ0 000nS ?S aS ppS qS x0  0 d00L0厇0 8+q+q+qh&+&p A-X`0S L00S 08P8@p0Pp00++q+q+q@-@L0@-2@00SS&,0, 0S00K&+q+ql+q,+GC-RP`tM  44E  P RQ ğE R`S T0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ LY 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+E`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 (00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&t&p,,,,+qhPA-@@P@T - @P`p0Sd˅ \0 @ FP ,04 0 0@A&+qh,,tA-@P@p0S0P0`x0 R ` R0T @ 0S 4 P@` ,l+v +q&,P@-, 0 G,8P@-, 0 ;,?P@-, 0 /,EP@- , 0 0 ,+qh,KP@- n, 0 0 ,+qh,(lP@- \, 0 0 |,+qh,Lp@-PAM C0@ 000 0S0! 9P7 0S40V=PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0 Q000S0}& AލpP, H0 P @0  9P,,,,O-1M MP+ p4 1ݍ ЍPX$o9P @@4@@/ ,DP_ 40S d_P 4pPV r/ 3Ps垏0S30S 3Y30S7 0a@P0 |30 0l3 0# T30S0%Q03@OoB0B%Q 30S  2` 0dP0002`P0 0R " R `2 T" R E@P L2\"00<2 0H (20S%W 2@OoB0A% Qo10Sk 1pP0001p^, V 0 PA0S0JU,`V 咟Q 10S 00S2 0@P- 0! 0 000| 00S% Q0@OoB0`@N%Qx00S  `0 0P00080`,+ +F+qll+q+q,,,+q+q,G-JMMPp 70@ 000 0S! 88P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1dIPp* H1 @JލЍP @ ! 7PJ W#P0ʡ #W0S @$00 R000S00 &l0P0'4pq T0SP00@&,,,,+qh,,3C0 0 0 0Z,H0 0 0 0Q,HMC-KM MP) 2 Kލ ЍP|"7P @\2\R@X2000/QP 42 0S@$2⨂- EP0 Qo` 0S 10S 1 1 2@P h-l1@`10S t4PP1 0pP 414!00(1 00S 8P, 00 0.>?0T por 5&t0h@Q00S x0p0RP0 00P0pHſ,O+l,,+qh +F+q+ql,,,,+q+q3A-PAM <) 0 #Ps`P0 0Uꈀp @G 7At0@ 0\0@@H;@C0+k6PAލ0S 0 pT,+qh,P0@/P@-(0$ 00 0,+qhPp@-o@P P `hHP XCP (pU ,0Q0  C0 p+qh0@- 0+q,P@-( $0 00S/0{,+q+qh0@- 0+v0,Pp@-0o @PP0B 0S 0 Q0S P s(0 0pP@tP<P 14P(00 ,,+qh+q`v+q,)0@- [ 0y+q,0@- Q 0+vD,@-(@(0 F 00S 0 +q,,0@- 6 0+q,P00P0SA- (0 !0ЍPAaq0S000+0S 0S1΀000PPYP00QP ,?'7`0H 0QD084 ,+q+v+qh+H+q0@- 0+q,0@- 0$+q,P00P0Sp@- '0 0pP`P@P# 0P ]30P xl00?o2`SP@8 8 <00S000,+qh@+v +vZP00P0@-S Y' 0 ЍP  4P 0iPd00}S`00S T0T0HWP 40 0, 0( 0,t+q+qh,, , 0p@-PP000088@PpRp dp@P p@'1@0@ 0S 0'00,+vL+qh,P00P0@-S & L0 ЍP 4 s4P 0 P 0, ,0@-M P& D1 Ѝ0P0! R4P @1@k*'P0  /@PY*0@0 S 0 00S P |P `@l0 Q\00S  L0P 0kP000$0P,O+ +F ,+q+q@-Pa& 0 ЍP 0S t 3P 0S0TkP0@eP ,0 $ 3P,'/,G-pQ@p`Hoobp+NP>10S|1ЍG~T`pE8& P1 Ѝ@X5V@ 0 001"T9pX (`P 0S zLP5|0@0 = `T AMPppTT TV@T 6@P <P 0 ЍG<,+qh,|MA- MP% 2 ЍPR0S"=3P 0 1CAMP 00|S 6P |P 0|M@p1l@5) XP#@HQo`010S 00CS 10S ) 0 0 S \ 2P0 T.>00R   ]tp!"Ql00S  \0 0#0P0040@,|+ +Fl+qO+q+q@-PPM M%@p1@ۍ Ѝ(`K6@PC@@tT( ,Ja@P@F/SP+=00S p}00CS0 U0000 ) E l0 0 )Pv(t@(,+v +qh+q|00@-MP 0$ `1 Ѝ0P H!4200CS0,P@/0S0PPP P@ K PT0S0 @ʴ0@P @PJ OU x0x6}T0S 0H @wJ O (0 ,, +qh&+q0p@-p@P0 p@:$\0\`0XPS 0S.0S0p@| $N00p,, , +qh5[0p@-`@P0 p@$L`LP0S.0Sp@(| ,00p,,+qhqP00P0@-S # 0 ЍP | ~1P 0hPL00}SH00S <0<|00P 0,+q+qh,P00P0@-S # 0 ЍP  C1P 0l@PL00}SH00S <0 j|0,P 0,+q+qh,p@-MP`+ ;@T \P!+ R;0ES+ K;@ 0 ۍp,@-PW# <0 ЍP $ 0P  , @-P<# <0 ЍP $ 0P  , :@-P!# p0 ЍP 0S L 0P 0S0,+  0P,E@Pp@-" <0 p00@PP0 Pp ,+qVa0@Sp@-" @0 p04@PP,0Pp ,+qlPp@-" @0 p04@PP,0 Pp,+q|oQP@- " $0 00S@*,+qoQP@- " D0 <@0S [0S ,+q@-0@-P000P0S i" L0 ЍP@ 4@P@${H M,p@- M PI" 1 ЍpP! /P 0"p`1`{0S@1D0 0S 1(P%P0 0S 0@T 0z%`E@P H d@ 50@ :0 @ 0@3/H0T 00S00%,+qh+G x+q+̨,0@- 0,,0@- 0 +v@,PA-PPPPU㈀ !00P@lph0hP|z00`0 @009T,0P A9,,+qh$,,7@-PA 0P00Tz00 Ѝ0Px!0P%0S0P 00>0@0S 0 S  @w>@00+Ti90 S +<b9 0 .P,,1+qh+q|+ql,,<P@-00?o2 P 2!0 0@0P 0P pP 0H@XR0 L< B S00Y50 +q,C+q+qh000 0@-S0 00 +qx+q,+q000 0@-S0 00 +q+q,+rp@-@Pp@0@- 0,,0@- 0,,PG-uR@`p]P\T- ,PPgT`( {,@P`_]$Y$V; W P10S- D1D!@1B0S 0(`PKV1P1@W 00S 0 0B0S  $ $t0Pp0@PPlP XP HP E Ѝ+q+qh+q+q+q+q @-s0,P@-+ x0 pFP \00}ST00S H0Hx@6P 00 0( 0$ 0,8+q+qh=h,, , P00P0Ss@-  0 Ѝp0` 0S P@P  P00S  L 0Ѝp@x$Ѝp@,,+qh,mPp@- $0 p0@P0Pp,+qA-P0 "0Ѝr0S2sxP70S10S 1ex@a0 ` 70封S Cb"c! !    c#A P0U0C00CS0<\ P?00CS0@8 P7 (!,PS0p00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S,+wX+qh+q+d+d+{d& QsP00P00@-SM  0| 0Ѝ0Ph  ,P 0(@tqP @0( $0U@00,+qhP00P00@-SM 0 0Ѝ0P | c,P 0(pq L0@0P=?) 0, 0S0000,+qhP@- $0 P,@- (0@P0 @M+qhP00P0A-S쀟 z00ЍP   ,P 0/`P PPP 0S0PD@D@@-p f6 D36 /600HF,FP00P0O-SM  1 0 ЍP  +P G @P@ 0S0@D`G-|0P 0#60hph`h@Р0000 0@0C ,F,,+qHPp@- 0 0p`@PJP |@DP ?P@)p @ @000 (0@,+v4+v8+qhA-p`P@Pd0 A\P 00,4 0 RU A+qh-+qC@- PP   R Ѝ@P  HR  @0S00 Ѝ@`p,Z&+qh0A-p`P0 A_P~@PLp @A}P S00 s00,+qh-cPp@-? H0 p@00Sp@000v0$@$P0MPp,,+qht+q0@Sp@- d0 p\00Sp@L0Lu0@@PP80*Pp %,,+qh+q @Rp@- l0 pd Rp@T0Tu H@P0P8 Pp ,,+qh+q O-MMPPQ  3 ٍЍPʴ#EEV*P c@3pY 3  DP`@)L40p㓄( @0S (30@ @c0S000p`J2Qu2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )bb40 B`0S@iR0@S 0 F)bN40B`P1u d1 0S x10SL1h`10S ,0t00CS0.  E 40 03/00S 0S 000CS0 S0  )t3j00000h0 Y 0pS7 ,+d+wX+qh+̨&t+q +q1+q+q+q@-@P 00P 00P00 -d0lM RT00S RHD 0d P,00pp+q+qA+qh+I-lM3P00S 3H@ 0d P(00pp +q[+qh+IA-@P p0 0Cs0S13A `>P@ 0 B RQ@  0 0Cs0S13p@-`@P:N8P x, 0S!PR xo,p@lk,l*`n(P %28P00 0[,S!0Ru~p@-@P 00PU ~A {FPp00p@-`Pp@0P< 0-0Sp h0 S  Ѝ00S 0C @pP2+v(P/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&tG-pP(P SR@` >PP0    >PN0 0010S / t7Pe )`@k7P 0PS $2` P):`\7P P)P :N7PP000S`UK 0S 00S1 @RđR0 dU T=P0 0 U V)S)P) 0 011 60Ѝ @P) `1 0S000/) 0S S St0 0S 0`S@)H0PU ),P+v+q+q - BR0 R  P R IO-@M M tPE$@9=P0DHLP0(,$04D (0p0,0DHL` 0 0S 0S X 0S宓@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;YH@P d彽P T帽P D峽P8傓 (}000S V PU@ /2HV@0S  81P @0U0C?o20S b4pWp 00C00p0Tp pW H1pPpUP 0S 10P00 $ 0R 0<00EE+ 0Z0<03 0 048b)3 x30S7tZ  (@50P0 $3@@(:50P@ 0 @'0`0 @h0 `0PPx P00@sPS 'P Y0@ 0'T00SPeU 0S} W +X0+XV0+XR0XP+ |00!0 4Pp80L YA+ P0j0E>0000MP1@@DcT@@/]50P  00+L 0J0 08 04@ 0R 0S00}Sp0S @0S 0S@0P/GP0Y8<00 @.6>Fs+q+q+v+q,+q+q,&h+qO-jM MxHt\|S΍D@<XTP1 !/0PX0C6lO0 <(p8 Ⱑ0E?oT20SX\Q 0S PVV 0S#UU?0Sl嬑t0sx0s|0s0s0S0s &L?0S0 /OFP&&?0S 00SU 0 n 0 /l=0S P' Ut,M8-6>O00(0SN O(P$/> N 0 (00 9P 4l=0S2@x=P R( (@@-0 Rc8l>P8<0Z 00|SV x>T00S;0FT03RK\ < < 偑:xk,.h;`0S00P  UD  k;/ 0S 00S 0P 0S| % =o`Ȱ↎pPp 0S :uE0PT<Y :I :pPX dp0SU 0S^ X; 0, P#P %e3P  0ip!C]/0l1h1d10C?Y/ p p10d1S 0S lAT# 0S i)>P ` \YX K d0d00S 00S P pP%lO M1pPP`@(PPg 幫0< R 1000@ c#@pP`萟(@b>0@`0|! D0P ?@ pP `(@@0S Pp@(PP+ؠZ  0`0uPc h1P00S +IA>d+q,&+J,#D+r+q+wX+d+̨+q+q bh+v(+v8+v$ 5O&&tZr@1"+qva a+v8j,+qB@+I(A+q+qt+qhw,,+q+qc P= PG 0*S0 ␍0P0;0-S7 働PP/0Q0+0 /R' *R0 o@P(000S1 02y7gP 0, w\0>\wP 010SwP e"` P \P p2Gm Pn<000P P P  5"qsP<0S S WN @<0K/CR032 V 0Sx2 0 W5V6ZI Z8 ,h#2Sn#<3Q0SO?0@0 !3 SOQ3 LXIᇵᄵ0SH40@ u{00 PP00S0sxh4r|00 P 00S& 40S004(k(0ts4( @ 0QP Xw`0S(50s|5t2S % R 5 P "5P P P ED! 55`|0Əs |0|0@T@ 8V  $Pt3>0 0 僩 2 @R >0"0C?o2? >"0 "0AIh0 S ;S0 VL9P 0 R RT D0S@0S40?\'"4 00 R / T$@/͡"͡ᬗ/S l0"R0 ̡ 0#PPN#Pp0S0S080S?#@P X F8(X 0 /S0LH0$/0 pww0PppP0 Phph l'>lP #P U  pW$90S 90S  9y P #/0S @DTʀ90S YJ 00S PZ0S= S E#X9 9`00S0T0SF wpv0J  #PL PZ L8P  We gx:0Sgl*0Q a* Q0: V:#/ :R0 sr ^e/b 0A3/@^pH;@35X \+0 R0|;Q;A ; 0 S tEx A|=9{"0S, < 0R.O jCh0S j000S c000S \000S U00jލ Ѝ0S 03/0S C00@-P @3P  3P0P F Ѝp &`P G A3P 0 FUh6P  Ѝ@j 0S S0S   30PP00@-Mh 00eP P10S 0S00 0 Ѝ0*  @T0 S 00S 0s 0 :,P 0B0P R  0 o@ T d7P 0|S ᢲ00 0S00 0000+vT+q 8+I+v+q_A-` M@p '000@00P50P/S:S X5@nP w' <D'p$ (m'/@Y>@P/:T>pP 劉@LP H Ѝ@/000p0 @@PW@p00l0@@DcT@@o010@0CcS1S@,PP00/@-; (0@  000;@+q+K(@-; p0@ `00S T0 0Lpp<0000S S;@+q+q+qh+K(@-;@t\00S P0 0Hpp8 10 10S 0;@+q+qh+K( d0@- QT00S H0 0@ppξ00 101000 +q+q+qh+K(+ -X0lM@ -d @&80 00ss +q+qh+L<@-0lM@0 0 00 0rS sS lBd de&d X2&P0 00ssy,d $+q++K(,  '+qh+L<@-PP`@ @0@ss00V 0ss0000@? bP UV 0A0T0Ѝp00CS0 Sp0 S 0 /O-TMxp|W00˯? p0p0 0⊿:0P`0V0W B@{4 D000S@ H 8PZ0S= S D0 S00  @P):0S :0#S :|0pS X!0 R R 00 PPP0p`5(p 5 P<$ P@+40S5V $ 0D  +0XD S00H00S+(% 0S 0 S     R  T!$PP$p 0 +@P$p 0tp9# apz0tSS 00  ~ {00Bލ Ѝ@H3@] 30S VW@@cA g+2 0Y VW T 20S 5V  R x" R " R W WSh2h <202hW @2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F3+K( `,+v(+w`+q+v,+qh+wd+w\ V+v<,, &t+r-A-` @T  0 ЍAЍ/0p0$ P +xd* h0h 3oa0@S P 5/`+w\ ,+K(  +v< O-@FMs M` ( @7 7 70$0h30(0$ 0H,@PG0P SI8墰0  寅 3 Fލ ЍG0 @,Q(r#2@@в@aGT  呅 2 G 0 PD0P2d b<P h"hdO# TK#0S 00S 4 00d T μPP d⒡@0S00?o2 Pၻ 60@6F6 D01@唼p  lj 81 dD0(66S0d00 0d0nA0aPS 0P P 00S x0 0|0lP@0H x@0=0,X@70=+Q8+r ,,+q  +qh  +QH . b+w` d+w\0O-FJMMsn0pȖVXv600S00p  9 PpX X6  P60 9P(ӠJލЍ60 0 00ݻ97S 50SZ5c5̥0S# 0S5 Q U 5R "P 0S l500CS85Xb00H=0S P97S( 4 4%40SX0$000(00000 &PF 4`0000Zt40܀C XSX ,4l`0(  $   @0 CP 3( 4\ 0k0$<` ((0d $r 0+ <7$ &S t3d0 R0S R3(0008'qP30SH97S00000 "0S   0p008'PL2 0 00 00I 0 4 p` 087P@廟 97R] Sȁ 0S [Q0sN0010S ;70:70?70>7='<HL0S ,0< x1, 3:P!1 R  @ 0 &0ZP 0S 0097S|0 0S [[X  S\00000IR+K(+q+q+vD+QH +v+q+qh +q+q+q+v +q ,   +wd  +M@  - T f +Q@    L l @- 2 Bp`WLM LЍ@  pP>  p8 0001:1 0S<0 ?|q0 (,,00 Q 00SZ=9Q ='/?@#b!"/>p C50S ?50#S ڞP墂Ҹ00+0(60 8ʸpp $50S 50#S 常 p媸p 90S0 00 0 0⾹%LЍ+q+q+v(bM  +K( 0A-H`D0 82Vp  R`RBR RB`2b  Q  , 00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPx40S4Om_m 3 3K ^_ Ѝp30SCP RPHd( \3 4LS P@04000 3 )bQ qP@$R000 0R0 0^|SP  KP L@P  0 2$@.2P0 S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S 0 0S PU P 0S 0S T01SPl $0 ,,p,,,l+q+qh,+K( ,  +L< p +ql+v<+w` A-M  P@0 8 4 p(p@P@d(d@`( $ P( RS @8Q  Ѝ 00-S0S 8 {7 u770SN0<00@0D07 0PPGEG@Wn 2-PZt7,087P3@PPH7`@0 ,wK-P [-P6Qx AQ ,0 p,0000'Pq h 0S 6 @0syD0sztFPQ00<0St40Sx5$ , 0  n 00|S  0fpDy,,0S+|5P5<0f ,,0S    5P<0,0p,0rPX0: S 5 H徽4 i0 0,0.D4Q PU>0 00S,  P 4 440S!@@!X4@@0Sd4@s \TP˴@40S 44040 4 $k41S $ R 3P ?3P P P CaD0s D30SP 30S 30S2P 30S&Br,0p` VvU㤂d 48 peUz,00@ 000 0e400@ 080040CS,0"p,040q402P001!P TC<0S <0,3/0,0@44@p!0 R0P00 S@L1#l"0 ? 0!$$P400@ 0 48 p 400@ 0 q$P0 lx0#g@&D ",0S <0,3/4=+q+q,,+q+q+ql+qh0,p,l d+L<+v< &,},+qta ,+k +v4,+q@-GM , 0 0PO$(000EP@˟_. +,0@P@40L0;K@;0 0;00+oDD0S>;0SV 080< @ t+ RD00S0X H0sPLKNH<41<S$$*P $00|S $"P/$1@/0SR /0 SN $ @): 01RS 41S $00-S0S |: xd:$ dܻD0S $ GߍU0S : <0s^@0s_JP0080SY00S]9 9 h9T00$0S  T$ 㹳T/00Ph90S >/0 S$P$4/0 S$!P$ 90SD8Q0SP`P?D0S!0S' ^+80S [(P  8d(880sSH<8  0<Pw00S  1PlGfS000S|}P 7 H'0 R0VAS41SW^$)P_t74!(06 6 (0p(0p 0: S 0&0&071S ' R 6P ɤ6P P P F60S` 60S 60S5`H60S 0CSWD0S8 06 4 (p(1$P*$$00|S ?@$g8((0S$ <54! 45 580$ 孺((0S5$ח^00X%p00(0q(0L5`001!XPM!.0 SF|480S 80(3/0(000L0S,$0 SDQ  40S 8 |4R pq| `⿲%'0$`x0pp3X@$P吴  00duP$oD0S s 0 P0 (P唈P@\ 0T0(0 00ㆈPOsW,pI P @P@#0 ? 0!% 0R0 0 04  P@H0S> (, pV>000@ w-400t-0 SD1(00@N h-,00(00@T! 0 t 04Mp@ TL0HQ0L0 TV A @(, cp%P1 U1#PXʖ@PbL zf"Y00S 0=<@ (0S 80(3/0 +q,+q,+q+q+ql+v@+L<+v< < +q+qh0%,+q  ,,l,p,  &+k +v8,}tQ+qU p/0X+qhoQP@-X@ L0  P R@ 0 +w`,@-@,0 ЍQ p@-P,@P@p(P @&p@-T@P HPP  0R  p+i`lh+idp@-T@P HPP y 0R  p+i`+mh0P @- Pp@T Wp`W VL\ P  R/&@G-@p`xMY'T oTP ЍGFT8,},a,1  CQ@ a QPj ЍG]v 8S 0S sfP pP  0 ?@DTЍP 0 hX0    03/ (  +i`&@58 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/+i`&p@-H0H@8D0 (8080$8P  Up$80+̨+i`+@-A(8S 3W0 S 0) P p p $8S 80pP\ UP 0S ,8S0W (8S 00CS0 ȷ0 0` 08$ 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝp㒷+i`>+̨&Bbw , 8P/@-@P$P  o@-<@0sk(00pp0Co&+qhO--0 0 KM00. J Q 0 0SZQ=9 =:k{@08`V0' @P @{P@P0F 0,0 0A.+q+q,,Q+q,,(0:F+qh@P<00X (p  `t 0r{` Y  h  0Z C00 0f Z` U Z f 0 J`< E< f0 L!:0` U  S  RS0!1D0f 0;#;Z0S;#;0d ƒ>#/+"+ 0"%+?;#;0@#5;DE @0"0@S(PY (2`V0SPH2PLT2 Q EQ@ @k{H{7{jr"dմZ` f 0"ʹ`< < ]Lfp 0#ὴ 00S @ P0S S dl#婴@t#dऴ0 S30ppᮬKߍ%U[0DEW@-A)X @0 R0 @00S 40 0,pp+)@+q+q+qhF-$M?0 0 G$Ѝ0-4M 00 000(P4ЍO--pMMElUͭ " `ĭ4  P!PU0( RPU4$ 0 R 0t*|\P $0S  0sH0S &P $040S` $1`#W 06 {@0("@{{zdWdp0f0#3`t3Q-AP ?"AQڗP3P#sA0 f2 ³`  0ß R#3SPS0r1D000fm/⩳ $` Q(0 0SZQ=9 =:k{<2@Q08P@{P!5 Q; %#3[PO qD d!0@! f!j1`Q0Ft1p Sf Q 1*|!3\6?\05'0T!P0HH1 000ssU0S""%+0!kU6 `0Sf `|0 0pp#Mߍ@YA.,+q+v(+q, L~,,,QH+qh+vTF,~@! Q0 @@k{H{7{d0X}0P  ̲P``<<pXe0  帲`  岲@-b'@Y^'@p@-Bd00` pd00CS00p ,P P00 @R0S"P7d`Qd00CS0*p "P \Pd00CS0p000S8A PA p0 0 `V|tp0 c`Pd00CS0Vp 0@S P,P \Pd00CS0Ep `V0 0 "Pp@, &,!A-pp@`eP@ .PP [@P PE P@OoB@, O- U0mMS pDPd &0S 9mߍ0P.0͵14PPd(0P/S SUpE P\4PPP P,$0CS0 p, P P P0 PsdJ!P P z!P d0pp>P 0? hsdsd@p P 0Sd0ppP0? sp P 0S0S di0 P P d00CS0Mp`2`Q P Q82<0 0 dAQ 0.p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 p P`, ^0#S^0C0 hrP\\ +r , +d,Ew+qh&t+{d+dB&+ql+wX@-0 @0SޜP  P  0 00@ x0 lƜP T0 L彜P 00 ,崜P 0 &t,00CS0 Sp0 Sڱ0 p/1A-0aS0P0BP3U  P 00.S Pl`1h5 \HT1P@  D(P00T,!,!,0 $1$ U 0!0@p000 00000P0 0p0S000P0T h0h0 @U t0P$0`P+v +q+wh+wd+qh+ql,,,p,t,+r u'p@-@P |0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p+w\+q,,, +v+q+q+r+ql+wX H0@- 800S ,0 0$pp+q+q+qhz+vTA-@&$Qp0S `0S ppͧ"00`Pç婧0000 0S p`0S pp000080xT  #p+q+w\+q,|O-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ B>4P/S + +  vP :7pVp刑0儁00g00000000 0S P1o@19 k70@ R 100CcSppW00 0S 0og000 000Ư 3$RVp@pPPRT{ P00++q,+q+v +q,+q+ql,+wdA-Q0qS0`00@S Q`Ѝ0O]P QP Wp0 R 0000@ Pl00}S0s00T 0S$@,N +v +q,+qh+wd&t,O-a0AS04M00qSP Q 1N4ЍPH P0.0tP00`_P$ PHP@1(,!2 (A 1 0  ? @, C!@P 0 ڮ@ RP 0$0傪pq00P0}S0s00U 0S(@<_N I+v +q,,+qh'P+whXY+wd@-,@02$ ⤗PY,"A-`P㸙dp㳙 @P  @P 9@㟙@-@P, 0A- 0p0@S0`P0PP㬀" CP 0S 0"S x0S R00`P"S0"S0 00, +v +q,d, +wd0@-M M P  B@Pۍ Ѝ0PhS4/Sc @ P;0@TP/PhjO-@pP`V1@@P`3:-`E(0P԰0Y/  0,T@1PSZ 0 10S 0eM0 R K 0S*00 0>0 Ѝ,+qh@-E!L0@0 <pp@pP0 0SP0 03!@Ѝ+qh@th,P  R @-D Rx000 0R/`0000/0S < S0C00S/ S/0C+q+q+q+q@-0 000 ⸋0S R 0Sd0000S b0Cs R@ S0 Ѝ &t&p7@-@P0S 0t 0p0yp\\X@0S 00@ 0,ip( Ѝ0@J Ѝ0+v4+v8C-@\ᄐpA`\P ^T1:00"\ \ L|9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!+q,, , , /A-p`P @lP0  T  `00T  0@ R   `FVp`00CS0 X PpTD000`000 T00&G-̀P`@0崠T+Kp y 00@)ax0@P 0hD00< P 0 Ѝ+̨?+qh.I&+q+qO-M M@ P" 0<`0  83P`\ 5#P #\"   30S) P Q PUP 倣p0@00002F. #P x"xF F@hRލ Ѝ @pp04\ B 3p \7020(PS @^,0( 0/" pQ~0$S,F␡0I00S B0h$Q000SZ=9Q =*/?@#b!"/E ݡp5V0S R0#S [K0AS  \0 0 PE0 P0p 0S 20/ 0 ῡptP0\ {A}P<00k+vHm+v(bMp@-@P=p@趢ꊡp@-@`00CS0TpP0 @ 0S0`000#S V 00p0 PA-p@`pP0 @ 0S0`000#S V 00A-@XP`pP  P0S C@-@~P 0@-gPW@-@gp P@-JP0A-PhMQ@00 00 T  40S P 00 P 0 0 0 PtCcXY 3c0S @@@p p = 9P TpmP@ 0S @P@   W P@ T0S @P@p 0SIHTj0 S9 ,70P 00ZP12 qCA( 1 PP 00 @T x u P 0 0@T i fP ܒhЍT[8P@P MT 11@T 0P 0`VPP)'000W0 0 0P@T{Q DP+v+vP+qh+q ! : B L & ,  Y, +ql+q+d+wX a f+̨+q+q, , 7@-Pk 1 Ѝ0Q0S 1 1全P !0 CRxA R Sh10R P1P 0S4'S,1 0P 0S 10S 0 0N@@P 10 @0@)0 @#0 $@0 )@ 0 00S 0S,+q, l+qh +q+q+v +q+q  ,t,p,l,(,$,,,L,H,,+q00S%@-@0M, Z 0P0S8i @0Ѝ0@+q -A-kh$!P1 M;@P/`0<1s0S j~0Q 0  1B?Bߍp R~P`⮱TPp0)&J<=",.`",.4,.p,.#&#,.h,+$,,#p@-BM5,h<PP3X1 Pԗ0!(1 $@PB/`1<1s0S ~0Q B0 寗 Bߍp }P`DTP|P團噘W<Пz",.`",.4,.p,.#&#,.h,+$,,#0@-@hP4MhT=P 0P,,<<0  y u4Ѝ0,,#,+$0@-@DP4MG0 0P88 0]4Ѝ0,,#@-M, ,PF A P 0 001 (1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍#&,.`###,.|@-(@ $倘: @y,, t{ tz@-@.Tu@!p@-@PPptP p0@-AAM M^PAލ Ѝ0PE⽗Pa|b/0 ⋞뷗PPh1LA`1T@Ӗі͖˖00$!0V4u |弖庖嶖+唖@寖 U0S S 000 ?T|   T xdKl  10D0 S B/o" R  0C"A&#"#,$&h####,#@-MP Ppmp pMl@PL\܍@l, H}P 哗܍,0 < ,.$,/$-#,&p@-P McP'@e?o2P0S ۍp@s-P55-` ` PPPۍp@.D` 5Ɲ  ۍp,.$C,#$K$-$ap@-pP!P h(@PpT[̞P]8p@0P L}l1s0Sp0p@唆$,/)&,,p@-P MP+P/o"P R0 ۍp@-Sp`ᗞ@P\ۍp@ѝP l! r R< < 5e ,=ۍp,.$,#$$t$v&$$$@-  >]&h&HO-P4M$`4~`=@PȔtȴ`0 `4$$坌p0Z$ dQ Y  Q|x$0l  P0\$\40X4LW@T4Q(N 0$!PS pP U Ut @DOo0B#10<13 B0lS010S P   Rpp= ښtS`S FS4 9S/S0Su(#a0CS00 yES2 PvPS2P Pu  PZ x PP[ W|2 @|g P[  da PW h @PD D(2!00=2 1 0 060S1/ cP* T+%,00 1 0 㐡,0P  D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/iPk0SPP54Ѝ,.,.,-$,(&<)&zx,.0**&,.,.(,, I**,)*/*>&)6)L)Q&,.|*H&h&& -) )U),)1);)h)))*^@-],) @-@M h \0P0 0D0@10S  10S0S@Ѝ#P  00S0@Py 0 00S0S 00P0P@0 S090 ,; A|,) ,.0,,,,* t A-U`V7P@@Pt8py0Ph% /Q4 w LpypP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,2P004@Ѝ0400/S@FP w w w &P5]H2]@ 0SyQt0S zp=0#zp;#s00S: Zw`P`|` R  V \3Q 30S t: h?wPX3c0S 2Q P o2: @$wP 2 : wP 2l!: wP 2 : wP 2 : wP t2!: vP T2h,!: vP 42L<r> 04Ѝ0,*&@-`0S@ P2 0S 0000q20\ @v,*,N,\s@-0Pl00@0p`h R R  l R  T8寘03/@ЍpQ P&&d,*,&A-$q`AQT 0SP ᯶@P00000P P0 P0 tP  dd\0H@H  "  \ &,*,b,g,k,p,t,y&h&,,,0@-1s0S 0P &,/(0@- @0 ,.p,.,.hp@-`BM P@0 S0`01s0ST01y0 Ϙ0Pn00x0 ⹏BߍpB/ BR 0̏00P Sy0001,.h&-n,/,.p 0?o2 0/&H-AM M  ,r,  00000P0000@0 ᖏPڶ0 đ 剏P0SS WS BS 0 +yP  Vdq 0S 10 S0Y` 61s0S ؠ0S Q  5   |P Y 0@^S00CS00 S00 P0Sv,.` Qt,,,.,*&,/p@-PH@P@pP P P @& 0/@-~o/A-@PP p 00CS0 `V PPᆁ P0 P00XA.& 0S P0000 !0S0R 00 --p-A-A`P0E!S qp0!0P0CPSJ0 `00CS`0p S X0 X 0P"SP, ߗ0SP`0P0CS`0p SX0 X ! 埖X!ė嗖0 0P0 P000P lP僖0"S0T0A%8x0 0P0 p,/&-x&----@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 -A-x@P0 =`P`PP2 00pPF 0P +V @P  @0S@0Sؼ/%00@wPP?P PPP P 0!SP͕-,/-&--p@-@MPP\1 X v@P`u00u0ۍp0 ZP 0@ 0000S T圕   P00 f (YWP&--,- -p@-`@;PP 0 -+Up$Pc@p-7@-@P p 導 R 婎 奎@T|L Ѝ0(R( d0PP O<P K(P ,,/o@f tx ty/s,/0@-@M@ 0(@,0 0 @P Ѝ00,x0 ތPPP P0S p00@SP ^,/&,,@- (,/,/@-@ 5 /M}mP E} 0P3P xĔt”h  Xl)} 坌Ѝ,, tx ty////@f0p@-0M`5PPS 1<1s0S |啔xAx= 0 9 0X| <54S,Q( -,0F Rz " <P 81P` |0(0S r=RS 00FS0 xJhHP0Ѝp\XTP D8&0,,&0 0&0(0-,/03/i06090>0I0X0e@-0 ԋ@7,,0&-@-tt-@-lt0 R   ЍЍ/,0-@-3V0 R   ЍЍ/,0A-ARp`P@1T ᙋpP7`@DO-dM@P |0P 0d|0P0 0 8p80 0(P400P`,@@pp0p,@ T R3 U&T  (E0 (d(0sp  Z0 000_o 0,@@,@ 0RT ZPPU w 4 JR  (0 R 0S0c} } 0S p dЍT 3  0@D(0,@pF00(0 RR 8:0@D(0,@(0 R 0@D(0,@w(0@D`(0,@oVl( `F  (0@D`(0,@_(0@D d(0,@WVS P ( Q @D( ,@H E ( Q  ` =V 980!(*PO (^+ R  8 %Q  R P(1bxtph8@Ht  E  $P ,0 000S(1( 08 40TU (0 2/Q@D0T,@(0UT(0 2/Qt0(00@DS,@T000001,01161Q1W01m11111122+2QO-lM($zpzPW``48@ 0T0Roυ p  0<0`2 @@000` 00C@P r+@P` MEP`@0S($(P @P ||[@lЍX@D?@h@ 00 S @.  C8 ЍC70&@223 3&A-Mp{P`ЍA{0@: SPPT@Iy`P00S 0 00hQTP1 шp P PU0DsLS<(    3.34,03;3C3TO-0]M-SP MPL50S ]ލ ЍOv/e]ލ Ѝ@pP$ 00S0W0S 0S뼔` xpP  @pp0* RX @ RP aPP(ou pωP ia0v: S+  r3 P@`P|3y  K)P pd ` 0 0LC0 00` 0S0S`- P`m`v `0S 0 =P |V P `{z R 28MRK ҇pP [ EP w!1[Z  0Ӈ . Zᲇp`l; 0S'HQv00 0l!g P: b  0S- 呇pP  W ]ލ ЍO-zP-Bᓇ 0SᎇpP P : R S00 R0S `PPdTT},0&@343t333303 33444C4h44&440 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@ _P 2FP00S D00S  40 -F!IMyX͌,0,m(,>\&*D@-{H6#@-bxPp@-P@xp 000/,10p@-@P0-S@@p vGP0Tpp0p@-0@S`@MP0@ z \P@ЍpPU P Jn0P0&p,106P6K@-@P @b$00S@ ,10p@-@PPp00Spp@k ,10A- `pP@P000 PP0 06`6c@-@P P0P00S@} ,10p@-``MPU< 0S9 JP0 @@?T-   `00@ C @ F  0*R /D/XP10EE>P `Ѝp6d 0@-7A,> 7D7K7a7c67k,I0  ,100  ,10@-@(=St00S h00S\00S L00S  400S  0(=,10,m,1,m\,m,m0P/0( P/,0,100 g,100 $ b,100 ],100 X,10p@-B0@0S 00S 00S  E<0S <0S 8S0,=t00S  0\00S PH0(]0Sp@ YBP 0Sp,m,10,1,m,m,m\,m/@-0  @ ,10$00S/0 R/ ,m,1000S.B,m0  ,100,10@-@P1 P. +P@@0P-0Cs0LS 0ppӑ`AP0-0Cs0LS 0 0 rw %pp  rw00VpU  Ѝ0  0.S 7s@-@P P  P P ЍQQd0dQQD0D Ѝ@Q$Q777777/p@-P:3@P 0+SSbTp0+Sp@p@@-@@@    0 0,107 00@`/&p@-@lP     <00S   2z @p  ,10,mDD0@-0S 00 @T@ok@,mp,10@-@0 0 0@,10@- Bo 00S VA0 &p7,10G-o`p`Cpq C@P VGBp PPVYpGWVpphp7/pXUt @X@TZV G '78 8#8: p8T$0 0) 0 00S/,>`pp@-@ P 0s  IB@p&|8hG-`0S P p09 00 ?990 FI†U00SZ L B  RP gP&X,>`8}P 0S  R 9  (0///,>`FO-4M@T YR(0, Q P0Q 05r:t$ ("` "RgpT  rq$ ($Q  Q Q 0q#P 0 {   {  P  0000 ``0 PPI(,p0劦᧩vp|pqW [! RSA 0? 0/pq0 lAЍQ P"0 0PR*x2@0S 0 0 P P 0 2  PP900 S`05:`k109p1 رqC   0@! R!T / R   0m 0 )ϬTS? 0A0SuE0DA002:?00S3 10S/P,  0 09@@ 0 00*b>p098`,n,m&| 8,0&X8,mt,IF8,{800S 900 //,>`@-\@0Sp 0890 R , ( , (0 ,>`p@-@0Sp Q 00h@q00p098@00ps000@(Pp 0 &X,>`,18,{G-$q`V> PP@>pq00Q00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00S II(, 0@,>`,{@-P X00S S 9(,0 @T  ,>`p0@-@TI0 pq0@ @}01p,>`,{l0@-^ 9 @!@&)60 Q@ ^@U,>`0 R$ 0@-00S0C0@ S 0S!‚"\0PQU 0000@/,>`P0001S0 0/&|7@-P R I00 #0 Ѝ00R0 @!"0@@ pq Ѝ0@H?,>`80@- 00pq Ѝ80098<@ q|/ 00\ /,>`A-p`{ PP"@9  @0@  P09   V 09 r`A,1$,>`@@A-p`VY@  @ @ 0 pP0 0z0 b}T 0 0o0@A ,>`,1$0P /,>`\ -P0S0@  / P2:1S0BS /C-@(QM@`@|0S 1U>:ЍbS6 .S5 00C S 0/OP u>cS@U:j>0@0CS000 00 B/NP @@@,>l,?l88p@-@P 0S`PpPQ ]P@dPQVL->LP0S  p P&&9A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o2,>l@-XMDpL@DM@M<M8MTr,3,!4!!!8!!l9*9~99&,?99,?969^999&t9999 0p/,>l @-p 01SP0l  Q``lXR @ !P04 (0T! W,>l99,?9 0S 0S 0S 0S P//////@-@0S PPPT0`1s0T 0 QS0@T0 R /!0 R0S //@- 1@P 0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*08<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@,>l0p@-P@P QT4@pTT@DQ0`VD@S@ T0CQ @7@,>l@-\@PHP8P,00S@,?,?&,m&@-\@PHP8P,00S@,?,?&,m& Q p0/,>lP7@-ek Ѝ0P@VP @ $QP r0ll j0`T! _PP <0X!$0T(0 0P9,?9,>l@-@NP@H,?&00PbAA0CPQ//DA-RPp `@W@X@Ѝ`NP@h@P, PP@@,@A-P` @Pt0 pP \ L@P  A8 $@kT >>>>>p@-Pl@P TPpDPpp@U p@Pp>>>O-MMp 0@P! I9zP0: SPὁ`~kV   BP  h@PP1 GލЍ R R R00 _P P @I XP @P QPP 0"SU T 0S0C0 7/  }BP 0mS >>&&>?&&?P ,Hs@-P@` 90 00 BЍpp@-@P` R p0S  $`@?@-P`( @p0` G Ѝ,@@-`@ (8R808Ѝ 8 0 CS  8 0C 8,@,Hp@-PQ@`1 0S S 0U P 0U ؀VpP0S d ΀$0Sp@ Āp@ p@軀Rp&&>?? $0 (((( 80( /,@&& 0( (( 0( /,@&&C-@㼀`p0S Ѝ @P0S 0S 0 ( ((087P 0 "PP 0,?l,@7@-D@P@@00S Ѝ0 NP,@@-PP@X9I`8 R8 R8S Ѝ 0p 8 0S087 80 8 00S087,@,10@-@M0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS 0`,@,1@-P@`8000 00C?UR 0 R00C8HiЍp l 0P 0e0S 00,@,1s@-@8 R 0S0` (0 RP 08 80 8680S Ѝp0CR80S 20S608,@,1p@-p@XU P8PE`V` D0(  p8Soppp,@&&080S/@-@,@p@-D@0S PX. 8P 0( pp,@&&p@-|P`@l0 R(0p0CR0R: $0( mp00,@&&7@-@g@P@P Ѝ0 AP 0P$ /,@0S/0G-0PS`p@U @0 pP0@@@ X P00hh @ P00,m`P R/0,@-4@$P(0,0P  $8 ,@&&O-6F0p`SMPp(h- (R008(h8! 0S0S Ѝ0S08R00(h0P]08X0x88S08"OPWP $(ĕ?o02Q0 P`Pڈ%0@S0 eP 048PЍO0480480488080 Szx0488S0S S 8S0S S 048804880S W048|048ЍO048ЍO048n0488S 0S S8Sb0S S_ig8SY0S SU048~Q04880 S80 SGrp80?08<0$48X5(pPWxpG(p V(PX  sPP vfH80S 48PS8P dg088 0Xl28Q V 0\48 #Df  00 Q XPP@~,H??0 pC-@P M!00 0 B R   0.S 1 `! P`EP Pl5 Ѝp0 P`000C/ !EP00,@?'08(S/,@0$P00 /,@00S/ ,0 hO-鬡MX[$ 00! 0S `PO PIe@0HQSQ0Z00w|@P7 ppuP0: SppsT P)dp0 R'0 Y& .=|@Y  K0Ht  t?800S ,00S 00Co//,1\,1X,1`p@-|PPD@T p@``eT0S S VS 7Sg@ @,HPA-@0S00S 00SS6P A0pq  d00S R HPH@p S` sp`&x,m,1,1,I,m,>d@-0;u@2G-@ e=`T00P  00pတ倀 00ST  0W0 l000S T28 E,JP,>d,{A-P} @`000{  x P0;0 At t4   ^ Pp Z?0PP  W Ay ] ,HP@Np@-@PpQ0%SS0C Sp! Sm0 !0C Sf0 7S ESM /Sp0  [/0 0pp@!p@=0P S+S@ $AP d0S0p*p 0p@ 000SpY p@@0!S $P d$|00Sp$lPp@%T00SpN6H80`Vp(W&p@ c3p,HP?J?U,1,,0@`@g@mp@-`@P 0rp@,HPA-`P0 E@@P@p/00_,0S W DT T A(0|,HP@u@w,I@{@}0@-AM0 7000020  0  0  0 0  0  P0 S2 0h %yPU0 D<< 40 Ѝ0,HP@@@@@@@@@@,I@-@0&'0PiP/,HP< S /@-0 02 Ѝ&;@@-@/0@ ,HP@-|0DM@T 0S P p0`P VDЍ`F0PS ,>@-@0$ 00@S 0,HP@-@@P@-@G-0-e`C@M03s0܃0?000S0S  ?30S `0S 0S43.P @P f3P| 0S MP V3Pl࢟0S,80S- 08I0SeVYP0SeVi0SM /Sr *S1 S S(P%UKU!("0ES00 /6;P z0Z 0S :;0 r!K07S iS U U\00E.U S``dP eP PT0S`?0S P0 IP {P >P 00`P iV]0iS 0 %+ 0S[P0@U_U0 ,0S U U =U Y] P ,HP,1P,1,{,0,m,I@?`@,HBc@A,0A-,mH&&&x>?AA,m,mX,mAC,m$ AF,m,m&'A]Ag@uA}A,0AAA@@fAB,mBB,1$@{@B,B7BD,0BP&' @}BX,I,m,1,JX,m+U@  U !UQ0-UQ00  [@0#0P2 PQ 0 a0CS00 0-P  00P< 0Sa0@S @P000S- +YP% 0e`0,0^0@0S 0! b,P 0Sq-P +a0ES000 +P +0 /D: 0*U @U !U<30S 97R0 <430S07S ;07S 00#p#v.10@S0 @007S9  P 0S S30S PP d0S7 40Sg3#0CSPvd ;P $0FcS00 0 e` !S $0 0R0)?040S  '/!S 0%0 0R0)?0 g 0R00 !ı50S 0R0  0R0 0!ıv s 5m 6 0R00 !ı`860S  0R0 0R0 0!ıL  0R0~)?0?60S 60S 5`8!S 0'70S s!S 0 ~ 6  0@gR00 !00I!R0 eSd0C0<0S d0 !0<0<kQ0mdQ0]![P0 !<8 NZKm3D]Bp80S0Sd8D @ p8 D 9 H 9 tP( P@900 00R00 !ıp900|90{ 0 00R00 !ı ~ 0< `0 0000R00 !ıh ` `<0P4 0P00 !ıP *P n P  0R0;; 0y>P t0P00 !ıPj  0R0;; 0_0P00 !ı=`P4 R OPNO=pqJ \< XF0P00 !ı=`P 70P00 !ıP + )6'<`P-P 0`0,`APJ(P  00,00  d3X=0S8x V_@p- '0 fPP U U ?Vc!K0> S PP U U u!;0 ,CPP U U ;!`>0S %t/PP U U.P*!0P.% (P0 0S .00S>0գ?00 ϠR0  B  0? !S D/00ST?0գ?0/!h 00 ? ??0S080c@00S/,?l@-@0 S!0O-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0<80  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 r  80 M^P _ [0J0C,?lO-pZX& RP a`P|` P :[ ``F 0R@ 0R U *0@S0S  PpBep@-`R P@ Z\0P @@@ 0ppM-@Pp M@p00`Cv RT0Ѝ0 p/<P0/D p/<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 ,m\,1P,Ip@-P\dpHPV@^8^LP gP @P%; @@98@T AT T ep00SCBp00SBCp0!@00CQ#k 0 DPp@{T ^gP 0S0^  PA0dP fP pip,m\,1P,I@- @ @,H @-p@y+,HBg @-p@l+,HB2G-pWi`P| Q0PipЍ=[@P 0 ppqf\ ii?SZ X\0E0` 0S0MS0+S0GS 0VS 0VS0VES0VnS0VdS@0vS cS eS0@VxS 0@Vq0 #@V00Yrp*p,0,HBp@-p@`PP;N,;0WV@` ` ;D Op *p,HB 0 ,H 0 ,H7@-dP@ PP 0S  P Ѝ0,HPo/@- * ЍBA-`QpP P P@P%U0P 0 P l @~[T @P 6/Pm[BBC@-~|0p pl 0hP X 0D H 08 P0 0@&'$&)C xC C<CXCkC-P1M0SL @10SH 410SF Pp` Ji0@?oPU20S@ VPRe@POЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P aPEU@@,1\,1X,1`G-@`M0PSS00/ @ R S"\R" :R R DZ @Pp P 0H3/0S@00ЍC|P/@-kp U' t)ZЍ00S @  dc)\0PT T Q' 8Hpq CC,mCCCO-@`rPPPPpᔠ唰0SWpV  S =P0Fp@ U0 PPUP@ RpP SpP&'&' p@-@QP 0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`= PPp@pWp@0 0@-M *0 x@sr  , PP  000Ѝ0,1$,H400S/@-$@P P@,m,1$@-@P  ,1$P/ @-p@&&0@-M@%fPg00S@(aP DP OP AP dP oPi|0t00SЍ0 f0LP 00 pqf00@A(,1DDM&XDO-8M0S 0S h0@S S z P 4X ЍQ @o Pp 00s pPPP`d%P\$ P  pPPP(d0S P``40SWPTPQ ((@'#PP3`00FP0`0 P0`0 *P X ' X0 d!fP% 20SP `DP  @' YP fY |2 p` P2 G@2p<20WF,b(2P 0S P ((gP11P %0S (. 1X aP \P Ph1 MXP10S FX 410 (0 yq 000Sp 0 +*P 8 0 R  [ R 0 0P: p X +,1$,1 DDD,mE,HC,1,1(,o,m,0,1D,1,,JXD&',m@,{&)E(P@- 0@,1$00@-P &@,HE-DA-P`XpVVPU@JTWgP0,{ 0 ,1$@-yP@ @0 ,1$ 0 ,1$ 0 ,1$p@-P@@P Pp@2pp@-@`P%PpVU p@ Pp PpA-@Q`Pp [^WZWUG-@@` PР @PUЍppP/W7BP $W8p0ShЍG,1$@-T0@0S @y,1$0 R/%R %R0 sR0/p@-(PPp@P@p,IEwG-`dEd@p00CS0Pu U   0DIS  ,UVDp@P0 P00@-@,P*EwA-@, 0 0pR`@0S00 R0R@@0 `P0S U  sP@00&'&' O-MpG`@ P!Q[ Z@P[@P) 00p00 0gkЍPP P K TPT VPAJP 1UP00pWp&'&' EA-@LpgPPPЍAǂ@@@n`H0 HPkU Hᰂ@UЍEEEA-PPЍ0S `pj@g@@TPP D 0 ` BjW $cPU6cE@-@@ EA-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0}T@,1 ,1$C-EMPPEߍ@0 @pq `,bPڬ嬐P ` P:T0S EP @  b0pS`P  EP@,?l,mC-MjX1@0SGp0@QSP? GbP ppp``n0000 0p0 0jT+0`@0yPU I`TV Pᯂ0STЍ IT@,0E&' &'F0A-0S@`I@&P0L i@ p`PT@TT,0F@-@@P ,P oEFF/@-M@P aPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` `bP TP <4#@ ЍP PP  0 Zi =T P 8TU @T ` vv`|aP @T@P@T 000d0@P<`.@ށ0S T,m|,0FGEFPF/0A-`V8@P&pP0 PЍA"wPt`l@if@@@A0 `hSS@ST ЍA蔁Ѝ,0FF-M lbP  @oЍ0@-@P0MSP - @RR JbPS @Ѝ0@T@0: S *@R,m&*&*@-M@HbP͡0 00 Ѝ0@-M0@P bPl0 0S\P0 S\ tu t0Sp00Ѝ0,1$,H,H/E@-@P P0@/R@-@ (0@0TV#@,m8@-00R\00S@,@,I,mh00S /pp@-pq /#@tqP PQpp,>d@-P#Q3#0 R/  ,IO-q$M0S@P`0S\0SO@sP`@@100CS tDP`@ 0S"P`uv00 @0 00R  0嘠嘐00 000^ 0 0000000P0 000`0IP$Ѝ,m8,m4,1,1P,9,JXO-M<`pP@8@V |30Sp30`So`V L3``F`V`utV-,0S 300CS PQ ""]h"PQ "|"0S6 O`+20"`Px0X 0SJY/Y P @^"VD"0 <0 ut (20S2"0 000 `0 0 10S*P10S p&*Puq@Z w"Pr"P<1Ak"P  !pq 410S A"P ЍO0G0 0 ЍO'V utS 00St0 1" 0 Q*)P@7ut`b,1P,m,m,m&*D,0,I,l,m&xF,m8,>d,m,IH00S <0P/000S $0@///,I,m,m,1P'G-(p@P,`oP"V 410S(1`V``ut 10S1T0T0 00-*`*00oᨂY Jy)Puq00S@ W ЍGk!Vn V %,1P,m8,m,I,mO-M`dP P @/P! ЍO!@tqPV00SЍO0Al!P0 00@WЍs!pP@PT p 0Z pq0 @P,>d,1P,{A-p` Puq@VЍAv   0@2Ѝp@-@4P0SPpSpq @,1P0P  P/&*H0P  P/&*H@-P@p@-@PptP0S 0 0HS @ 00C0FPDPp@AP  B 0,1$&*H,I 0/,I G-`@ qPU  ,P9 Y* PPU&8y@{{0 "0XPP00040000 (@0@000S < 0P00LP   0&*H,I P/P // / /00//000////0/0/p@-@4PPP O4Pp4/O-M cDX r{PX  0 (EP 0 (XQXQ> 00 0 'P*Ѝ=ЍO <O-@P4M(0X0 ,0utP: @4Ѝ40SU4  0/QK('P@Pp8d00 0mp P7uY   `賟V0,9 ep` P PP@ᨣv V~& `AVP@,0S1 h3Z1 P@'L30pW07 0$ `P" R $0 S S`# P P  `VʏZ: P `@T_P@[ |20S 0Q R (0 S $PO 20S 0  P @1 R00 SA= P Pd p 4ЍO V 0Q  0PA R TA0 Pp``P@41`!Z 0 0@Q_ V VP@ P P P PP@ut 0 0@Q_|l00S V V0 0 0S lP@y`0 ,m,I,>d,{,JX,m,m,m,m,m7@-P@P ,0 R  000 Ѝ0,JXO-p`4MV0  4Ѝ p`30S3V0V0 00&&t30VnPT30S @ T T,CF $C0 PG0000QP00 E0 P @,0p 200(00P P@0% 0P,0R\" ,00H" RF0x 0Rï[0 P P p| p0Q  0PO,0(P!,0 R 1 P 0$00(0 ( #P\L10ST 0  $P @H X X P P@P P P@P@P P T0' r0z{0 00S X X0,0,0S0S0b0 P$0 P$@,m,I,m,m,{,JX,m,mpqp@-P@ Pp>p P P+L0L`P@&0S63@TP@P0P@p&`H&hO-PM@`XP!@@T 0000 00W `F@P0 @_20S4 ЍO="7pP ЍOxy00 T 0SqI zqWT0x!pF0p!0`!0 0@0Ѝ[000S 1 0000@0@ 0TPuq@ p5Puq@ $P Q0@` 000CS d00Sf`H0`0 0`0@,m,1P,I,I,m@-p`< Puq @P 00S h0 Ѝ@1V0 @P:80 ', Ѝ@ p` Ѝ,m,m@- epq   Ѝp@-P p@`@P@ PQp@Epq  Bp@@PQpp@,1Pp@-P@`?P P pP@000S  p@,m@-P @,vQ00Q  B@,1PA-pPXpq\sP`vq@A4T0 Q0T0A .I,m0 R R /@-h@M0 M0P`p0@ l` P*`0 e`000ۍ Ѝ,I$0n*p@-P@@Ppp@-@P \R ^R3 R   0 tS jSbS4 0CP@S 0 S" 0 Q ŸkC P eS  00C00C\T PQ  p2 p@@p 1@@ @@p@@p@@pQ 0xS QSDSK #1SJ BS0 C^Rp!X_dR C&R  0 !@@ 0000 0000 0LS 0 00 060S@@@p0 000 0000 0 00000 R      R Z,I$c&*,I0mO-PPAM@MPp㨕ep!PK)(pG)0,p<00B)pQp L5@3P8u 0f`pP!0 0 0P0  P  P ,00 O!PAލЍ Pg `P\0=Z* !Z' <Z 0J^S0͕ 0͕ 0$^v>Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = Z* P+R( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP P P 0Su p0P &*,I$&;&$0 RP  /,I@0 14/,I@0 Q/P/&-@@-04 ,    00,9,9,9,9G-P㌐剀^G@ZGPT`ppP HT H M ! H uH sH @`匀,I@A-8p@0PS` 0P0aP ,I@@-@$ 0 @z,I@P 0 R   /,mDp00S/p@-`@mDPPPpP 0S8@pPp  ,m,I@ @->@XP006QPl0 0g  c;D0&<&8&4&0&00,I@%'8,I,I,I,J,J P/0/,I@0p@-@00P0 0R0 .PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00,I@,I,I,I,J,J C-餁@0PSpM`&p`xx!0 0 0Sb0@ 0 6 @P(a00CS9 `PU: 0 Ѝ 0P  Uqr    Q   R l@S `P 0R } yP,tP,m,m,m<,mP,I@&h&`,mL,0P$0 00S000/,m,mL,m,mPp@-H@P0S0000p01S 0?&P,I@,IPp@-`0 p@X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP ,?l,I@,9,9,9,9O-M@pD`dC00wvP1S<& 1S8 ;z 0A# RhY) Q   0  P20S P wv  P0S  ps000q`1U 0S j 0 S1C10410S,X7 1R 0 sr0`pS`0 P`0F[0 1R1Ѝ  p` 0nP  00KU1 0[+0 `0S% Uz% 0R 0Q0tP 0C001萄 S rI  0,I@,m<,JP,m,1,I,mdA-p00PS` HP `P +80@0@D@ 0@0TЍ,m,I@,1p@-P@ 0p@2A-`p@@PGE$1S 0P $@@,J\7@-8PPU p Ѝ0@@ @ Ѝ0,m0 (! ,!/,I@0(! ,! /,I@P 0@-dP/,I@P @-@P$0SP/,I@P @-0000/0@-S@ Q+ 0S \Q@AOoB@0Sp IQ S Q0 0I0S0000Pp@-`@P  0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010vS00#pP0Dv0q# 0dc F$ F#Ix 1R P@#1 PR0(d0 d0 0  0U*P0C0#0rD001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0UP 0S0C 0K` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh \Pd  0 ЍG(_V` P V10S t! RS 0  m_PP P P0 BPPP0  B01S0R4AB^w@D pP@DT0CR0S*A8A@DvP  0 )0S pA,m,I@,I,I,I,I,IX,m,m,?l,m&-@V,JtrCA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S S00S$1R0$aʈ\Pt` F F)00x$<0s0$10P0 0S $,I@,m ,m,L,?l,J\@-(@0S =Z00,I@G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Մ0 0C0S U10S0 0S H G1 AdY 0 0R  1x00S U d00SX00S D00SX    ,I@,1,mh,md,m<,9,9,m<-0 R!  ^ !0,I@04/,I@0 R 00S P@0~0/0P 0/\!4 0 / B  0/,I@,m 0 /,I@pq/G-p`@PQpP 儐u U 0 4 0W 00V@00CS]P #Q 0P.@P,I@,{QG-P0Q`ePpЀ@ 0@D P V 000U00C0C0y Tʌ!P 0 BJ 0 Q@ @D 0@DSB,I@,{G-p`P@0@@0W  S #R0C00C0Ѝ PP   ~A 0 lpGA-0PP@q1`EP q0 P 10,I@G-1@l`Pp0XXpq00 R00STDP0pT@,1,1P,I@p@-@ppP P0S0%@p HP&-@@-p 0&-@0 P/0S/  0S !/,L00 0S/$0$ R ,L,mX,IA-X@ 0S0dS 0p,0(`P` p U` 0,LpX0QH0H 0.4 00/ 0 0,L,L,\A-P@T ^#0pP4 044 R@0pW T 4` 0 P^@ P0࠱`@ 0,LpqO-PP10SPU P@Q0ȡp`@` V0  RXWP@  0 V 0 PW@SU*PP@`$ Y0  0u W`@TP0 00 0` vq '@PPP@p `W 0 0H0  0`yq @TP,m,L,{Q0G-`p|PU! SXW@ U W0S P)SP @P P`@V0 0 0 @0P00tq0S`)Ph`@W 00 @0P00tq0S`V@,L,{G-`@POpတtu00V00S 0S@P`@Ptu TUQ,1PG-@Pg0pP`tt80p @ 00 0P`uq080,L,{800S/,00/QQ//,m0,m800CS0 Sp0 SU0 p/O-0P-SP   ~ ;k! eLpVLPL@P0S,F@ 0S 0S%=@T ?>6LL2L:gX C A  v 0 # ЍO5`P ,@)@ @Z 0A $ S>,IG-@P $ `P( 2kpPW `r   @yz  0Z Pp@ ;p Tt p@l  40 z p,IC-`Ixq pT@tq@PPL.Y U0 0 Ѝpq0  p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   ,e,lh,lH.Pp@-: $P# 'P> P 0 srp p^P 0 &- &P =06 pPtd0`P@\0 L0Af&P,@mZ006p0,1$,e,1P,lhG-@p`dP4T#0 5T Ta0'0s000Pp0 =@6T` P'0,e@-o0@-MPg@P   rs}Ѝ08!P W=0 00&,1$,e@-GP0 sr@^0 ! 0&,e@-T rs @@@60P&6 &=0606Ѝ,e,1$G-4@PP`j>T6k.sq 00P6 =06PU p<P0PPЁ GP ,e,1$,m@-P ,0 0R  ,1$=l0@-0`  ^ @^TSa04S '0s05S #,1$,e0@- P@0 QA6R 00,eG-pP@P P`P<`<p6W @,eȬ00S/A- M`pR@pqp6W @ Ѝ 0 PUP4fP P0 R,mTV,eZ\@-  0mS Ѝ 0 Q0 >@P 0 S# < PPP0`0 S  P0 R pV`PPp <p00,1P17@-PU0P( P@ Pj0 Ѝ000S@PP ;P:;: Ѝ0@vH00S< Ѝ0@ 0 0$0 ,0,1&X! 0 ,1<00S/7@-@( (P/@0 Ѝ0&:,1PB@,m@-P M# @0.S 00S Ѝ 0S 00 00S000W @ ` PP0@ 0R 00@0@$/&:1G,m[}<00S/7@-@( (P/@.0 Ѝ0&:,1B@,m@-P M# @0.S x00S Ѝ 0S 00 00S000 @ ` %P፾P0@ 0R 00@0@$&:,m}@-@P^P  @ Ѝ@-@PP  @ Ѝ70Sp@- Sp00S p@t -l0p`mP p@'Puq@ 0p@ ,0[,l,mP07@- S Sl0 Ѝ0XP@T0PP :]@ Ѝ0@:0 00\ &;&;yP/L0@-0@S 00 $0$ @,m,1,,mP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P:: Ѝ04@P,0  0 10 &;&:,{8&;,m0/0|,mP/QP @P/:p@-@PO4  !ᅽP0UxSJ~|0@0yw6uksp@"&;h@--0@dS!@S1 CR&0C  R  0Q0 . Ѝ@A C#R  k Cr Q 0Ѝ        @`P @k,mD[v>O--PN<M`00P@*0 S 0/   00 Bp/pT*000C SY E0!R1PT*0@ S 0,S UL0D P0EPE1!0C0 0UЍ ,Jt&.p&.t@-PMP M 0@ᮼݍ Ѝ@` @!80Sp᝼0 . x@ݍ ЍU XX8ኼ H .P0Sြ(7&.p,Jt&.tP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000&' &'@-PM 0  0 |0 q @p᫽h P 0S>000H ;0Ѝ004@P n,mh,mdP @P/` 0 /,0P/00S,m\0/@-@0S>,mX0/@-,@0S0 0:00Ѝ,mP$0/@-,@0S0 0(00Ѝ,mLQ0/400S/(00S/@- pq@,m@,1$P@- 00@ ^S00S00 Ѝ0 &:@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S\ 4Ѝ80D@0P0 00 LP,m8,m40@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R  E C R    C R  S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  ,m$800S ,00S 0P//,m,m4,m8$0P/0 0 0C/,m,1P,m8A-PU  @Ѝ`p@ᦺP|`V 00S0\V0S 0S`@W P `@$V004,ml@-0S0*00 0 L( Ѝ *  LO,lT@-Q00P 0R C Ѝx@- +,lP/0S/P 0  //oP@-/ 0LP/,l 0@-L  } Ѝ,l4A-`@Pᨼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @Pp88 0 R @@-PJ &$PP 0@s093@!+P0P0h0 P @0+S9P *6⓼%69P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PeQ   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0fP.00S ,l,m,1,$@-@PM @PU`p0@ uLЍU  j  B U Rz  0H"00CS0 U0S U3/U@`x 0 FV00SXS^U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 P W 0  0S00S000ESU U U J 0S0nPS000 00SD000V T@Ok,,Ip@-P`@Ⱥ000C S0 ` 0 Br ^ ST00p pS 00 000S/P/,m,m@-XP H0H@ 0S0S  0  03/$@,m&.x 80S/S/ 0CS/$&.xO-@pM0Q 0S [; 0S0 0 Ѝ`V$P  O0P  AAQ-P $YQY0 墷0@@Oop B0 0S `0 0S Wp0p&.x@-'P'P0&:/@-0M D20S8WP 2     A2 0S@ 10@@0Ѝ001 0R= 08"$01S 10S 10S|1 \11S(  @2 P!2 R@ q$10P@ 000 0 R  R@0 @000S T0 0S T \0!PL 1 10S 1㛹/0Sr +0#Sn @,m,m,{,{,L,mt&:,>d&:,m @-͇,m@- & Ѝ@-Pg5`@ὶ@@ᙹp0 `HH Ѝ@-@Z5P  )(,oG- p$@P`0 Ს )  0ৡ@@ό@ p\p3#@- d0  Ѝ(7@-P@2#@/ Ѝ0B@@-803?B3c/  0 -@ЍbMB@40@-0@@T ?P  0 &:,o,I@-@0@&:0$R/ $宾,op@-,{,o,I@-@@PC-!`?Q@ 0pMP0PƟ 0ᶵ00eT-00EPNV1ЍA-P0`p H@ 0 @e P0 dU-  D@C:1ЍO-0` pM! 00@Ct QaCQW@CACQ@7@CtT?H! |?P! ,PX ZЍO-PpMP 00@Ct QaCQW@CACQ@7@CtT0/ /G0/` /`PZ UЍO-P`MP 00@Ct QaCQW@CACQ@7@CtT? H0?p 0pPY UЍA-0P@MPЍ%P p@0pnP$ cP& dP %PsP xP   @`0P`D@0 0 T`0P 0A-`pP@A<e 0$,o@- R0 0S20 P00S@Ro p@- 4@0P 4幻P}p@ `00S&ȼhd0`l`P뼼H0@밻 80@0@S p@ 0 ,o,mp,9&:,9,1,I@- 00 Ѝ7@-@PP Ѝ0@(0 0  B~ Ѝ0&:p@-@PbP %@YP k800S ,0 QTp ,1,I@-@1P0pSQ ?000@ HU'Q0 0 R0 ?o2 `;P r0W Ѝ<IP c0`_0,m,{H,0@-@P փR000o/O-|MpP @`< ų1 Y0 \0ACX 0s0^YP P0@ 0   W" !Q0S|Ѝ@00S0/0 0 0J P00CQS 0 XH R 1 ^ AA0 ,m/p p p D00/40@$0@0@,s,,1P800@-00 0^ʎ1C0@ @,1P,s,@0@ 0 C\1/0@-ACL\@c0,1P,s,0@- P@ 0000CQ0@ ,1P,s,\0  Q0H0@-0^@Q C0/,s,,1P@001P/  R02:/,s, 0A,1P0Q@-@ q1!0rs T0L1!0rs $0A Q ,s,,1PA-pP 0RX@` P/r00ytv 02C!A`Ѝ,1P,s, 0P0PP@/,1P0 :Q Q .Q 0?Q  \QQR/ R//A-Hp`T0P; R@10C @C" O-0000,s4p@-@XPpq00T00S 00CSp@y@pqp,1P@- 0 I Ѝ@- B Ѝp@-0@PS b0Cs0Spt 23p0PjS BS bSp0mS tSpp0000kD,mp@-h̴d0dP0`@S;Eô ⽴4@N⸴bⴴp2,m,s4&:C-U0`S$M@p`h$Ѝ:S/ %S .S 0 pU@0S0S?S \S0S 00@ 0X 00~xX@KXBX^ DX/ @4LH,X؀ QQ6pqD40SP(4 P40S S30S pqt P q Pj P3 pq Q, Q04}wN P3%Xp 003BH@6Xf Q0R 0 Xpq 0 N|2LQ0t2 p20\ Q0C0C/Ự72pq10 QQ01!0 Q11`1\1We7- P \1O0  0R0:Q0Q PZyx0 SQ  } 0 ι 0R0: Q0lSA Pb ] PPP$0gP,s4,s8 ,JX,1$,m,1(:,m8,1P,00&:H0@-@@00SOoBۼ(0(01w 0 ,m,m,s4&:,1(0k&: p@-PPp$P S@ @Tp `$@S`p\ @S @T @S \ p$@ S \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P G,00@p@-@PT `0S`0 # p`㔲0@ᐲ0000 S`@@0@A-@QP` @$ @噯p0W0 S 0 R 0 0 \PЍ h,P 0`0T X0 @P +0T0 fD*`,m,{HA-`pV@  ` S Q ( ^QPS(<P# ^U!S ( ^ 0Q0 0 Q $P^U $BP 0S` 0 00`Q"P $QP "Q  P\U!0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-oP/,{HA-`M8@0C0ppG4 PϠ AXЍ H/o0"^ R  ? 0Q00 0  XϦ@,{`O-pP@$M0P`@0L00SF RC L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 00L0`00 0C7P$Ѝ@,{H 0   /,{H0A-0@S tPT(`V0(0l00S@`p e(`pq ,X{@00CSp,I,{H,>,1P$1O-`vwB 1!0РS ЍO:00S 5P@̐00CSJ& ЍOشP rq  G0 [pqW Q P(e@ Ѝ&h,>&`,I,1Pp@-P@T 40@@@ @p `))@,{H,{`p@-PH@U p@\Qp@(0?o2(0,{H,{p@-@Pع p 0$P  0U@p,{O-M"`7@040ppH780<0<7@ "$70S 70/S 0Ï0@{t "rs007S0 0(0,00,00 `$00P0060"rs  T0000S ,0S0 00000S0S@$Ѝ0 0C000L0H # 00 000zy,  0Szqzq0S`P000 00S0 @ y40S PIUPe U 0? 2Pn40S 4L HE04P|4U 'VPR d400PT40S @400S0R0S P$4L0SPq`)qP L0Hv3PPU8 <8T  qp R#T '`L0 `    h  D0HPD0 T 0PT@X\P( ( ` P @PU^P  0 `hPp`PL0 P  000 0`0 L0$00CS$0T20S r000 0`0 L0q408 CPPJ h0S8 Z5 ` p J!` 0C Q00_0p 0S0( 0P a 00o0 0S0YPPYP,1Up 1( (0S@0$0`P0S 0S < @B X0C  BS p aoZ0Yp0pP0,1,1P,m,m,,m8,{,m,m4,{H,m,m,m ,m,{,m,JX,Ip@-P@Է  08P  0T0p P$@,{p@-P@ỷ  0HP !Tp @S PP@,{p@-`PV000@0S0r| @^0tu00 U 0S" 0P tu  0R0(PpVp00@00S 0Sp(0(0Sp p,m&h&`,{`,m,{Hp@-P`uU 0S0P@T 0P@|0 pP''@㈭0 00000@pp@'0P00,{H,I@-%0PP,{HO-@3Pأ0 404Mp` 0P 0 pX0`S$$P4Ѝ0  $$X0X8 <rq ut00T00S40P0`ut 200@_ut$0  ys00 $0S0 P$@ut00V 0S 0$0(00X0 0$000 P004 srH RC R 0B 0Q00=QP8 0 APuq@L p `%ut P0P@100@_V p`000/V0V`p p ` P @0X0<8 [000rq0S [0 [P 0  ,pwq`000 040,,{H,I0@-MP @ut .0 Ѝ0@- 0( 00S@,{H,mh0p@-@mP HP0 pp000S(0Spp&',{H,m@-$@$0S000p @,{H,{L,mO-0 ,M"0Qp 0SGPy pC 00#  \PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(0-P2 X`@PEG@tqP[c@@PtuTXPJ1\R0 0#>p HBHb0 0 0(0o0S 0S >20SX` 1``FlZ@P 0 @PX SiX1&`O@Ptu0`V@P004S S S Ꮹ0PS  0 QP03 |0S  HH0Q/ 0 ^R0 Q\ S$R 0C 0N0`0000 \Q0C R 0 C&;,{O-pQpPpMW M ۍ Ѝ@`S`FTpL3LC  DsD4c OPU Y< 3T P'BPA |Pppr@ ol @@H 0 p$W "l O@ "T<"0S000JP ;04P S@ y- Pp 0S 1T zPP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P 0/ V0`00002,{&;&,{&t0@-@7P0P |+P l&P \!P n/P/&;"(@-@PEP P@*7O-x1M0S" @`0 ЍOipP000 0 Ppyx@`Ѝ00S 000S  0P @`RW 0 00X0 ! ! 0S,{,{P,m,m0@- LLPR^0S @T 0 B,{&;0@- LLPR^0S @T 0L B,{&;0/,{0/,{00S R/,{@-HP .P.Pc@-0,{//@-L@U 2p0 PSS0PЍ,{\ QS *0/QR QQ*/0000/@-@P 000000/0S0C 0//0@- 0 #A3@0@0@- R@PS/ P `Q  ~ ` PЍpA-`pP@T@  G-P`"F$@p(, "PQ 0$ GgFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0  PЍp  000@@0 0 0 0 0 0lA-^\^ ^Q}[\9[^V ^\00]QQ$ ]Q0\[Q`.FqQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00p@- Pd00@S S R 4@D@T p@蝏0 @ &t 1C-p`QpnT@P0\`0Y 0 *PA \Y R T R 0 0P@0   [R .0Bs0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@ 0 R Ѝ,,@00@-M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00@L,O-@T0tS bS rS aS @{S000pW` Gp 0S0QU 0V娣P 0 0 PUP(b`P,{,xeO-pM>4Mn0  PIW ܍4Ѝ000Q 00  R Q  R  R   R @ !   0S 00@0p00pS 0S @P#S ;S #S0@0 P00 50P SP  0S @,SP0S 00@RP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q R ,MP  <,0 \\^ ^00\ APP00R0I S RP0S 00@:0S00)*p Xb 0S 00@0S 00@00P0S 00@T0S P @0S( X )R 1@( RP0U0  P  P\XX $R I0Px $^P I0~0 , 8 SR0 (  Q 7哎00H00 PP R00C0 0C S000QW,X, `P0pL\RC [D Qx␸0S <,00S ,, E 7P00A Q 0(0 [^ 0  0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00ARs0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y Eߥ0"S YK  0S 00@<,0 [  RR , S 8x O3 0S #5)p p  U@P IW[ 0SD @;S> BP0110P\SSpE ND  PP< , @P 0S 00@00 H:p`0H ,p Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 0ݣ ٣p000 XH 0S  p U`   pYP 9)0     呻!SP1 ! 00 $(9 09909 00,}&t,z&;  7], ,{),,}$IcI&A-D@`@PU@Tp00S OX0T0OD0 0pS0(DP,{,x,,,@,<)p@-P @O000P @p&<|@-@O 0  @0&<|0p@-PPUph0@P 00CS0`p ᚄK`p0 B`,PA-p`dB R3 RQ R P$0SV0(  R R j0$0P ,,_P0 P0!N/PQ0$00P0PT0, iPP (00S(0 #R nR0V ,0 0200#0$0,0$0_( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0,P>A,F@-|@X0  0S 0S00CS0_p Xσ0  ,G-D`X0pSM00S 0S r^#3X 00X 90C\ `00d0崃XP 00CS0 _p X嚃X "pP0 W0 XPލP3 5_p0S (0&P 0&P  p4S 'j,0p0p4S \2PP _P  00\0&Ptp0`0d0S00d0000S 08S0i 'P0  ]0  0@ @]00S + +ٍ P0 ]+0+0J3`P'J`0d!H- P8Q*'\ PP ^0 /P\a ( p$pu&\0pp!p& 0`PS(00.PX30 00,0\`0P l000S SP@  0  lC(00(03,L&p, ,(v,(&>P7--AMM@A> 0$ 0-0 @0 V],,--M MA>$00i-( (  0ۍ ЍЍ/,,@-T`@PP H 0#p;M0 # Ѝ,(@-`MQqM0S000@03 0@0S H 0] 0 0S S ` 0JlB.@P *0 - P] 0600ڍЍ,,,,lj@-@P  Pt\ p`\0 P ` P 20P S x \ Ѝ,,sG-pA嘁!0`PU , R:(,L0(0 &U# \U   0 R`Z &R\RP` , R:(,L0(0P     pr  Ppu PE ,  R:(,L0(0   t 0 ,,&tA-@P p0R`*rLW00 T 0P P 0O-l/MhO00\PЍ080@?PU 0PH0 \ 1SyPy P\^ R2 0S >00C S0 0S4 0  P0 R d>0R*SH>0@o P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S4=0@oP 0-=0C>S00 L0 R: L K `0p00c0S|<=p<8 00 X\04 0堐<0S '!,H0SP80S4PU 0`  E0P0800A E4 V0T P "0 x 004 0t 0 `` 0D; 40,{ 0 0;0R( <0p 80P 0S 6P 0( $P2S 0` Hx:0C0 0S0`V: $ 00@ T:@妟0S  0(Z  H0$IP y0 H$0C$ [0`V: $| y` 0 0C 0 P 0`V:L j `  0ҏ[ !p  埏0P `V:`:0N0(CE +0 aV := ` 0 |0+0 S@88 00 (h04 0唏<0S Po(0801 0 P&80S"g04 0n<0S  80S04p  G`P <0 00Fpp40<  0N<0S V 0400<068 00 V04 06<0S L0 R: L J `0p^00p[  R  Q 50 I4000  P 04`Z Z  Z000 G 0X0 0 0 V| Z0 QP  0T ?0 0  0RQB p0V`XNdH0p0<Hp<(0000S Tt04 0城<0S &p PZ 80SW0sE<$<!p?0  4YQ 0 0 0 p0V`0  `?0P   0 PS0 0p0VX`0 0 !PQ04 05!4 0P -!P"0 000S 00P80S0s"9!p 4 0 !40P $!P P R0@v0`pL<0p<80S4X ! 0`Rl0#0V*0000pW(p0 1(W0 \<0H  ! R 0EzP 0 pW*0$ (#1 0X`xpH0`0h<Hh`<x0h0H0| 0z)A,,,,\,},,,|&&<@th,lj,D &,<0 0R0((Q 0{Q  ,},|p@-@P`Tp0wS {S sS 0p ~ P 0 DW0`@p o P `G-`pFPPU00W01@ R  yPVAGWp0!p!Q <0As\S00 0  W0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: ᥌pP 000BS ᵽ,p@-P0`@T P uP, 0S)0 0 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@,-* 0@-MMP@P  P!W _p4W+ t PۍЍ0H0  BR Rp R( p/&&h@00CS0 S0 / (&@-,A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@a,0-01S ^00oS^ P0\ S0S Q0S Rr P0S0S0 s00Q qR  -@,0@-  `Ğ\ @ T\    %R    ,-@p@-TA0 5S <0S -00$!<DPa0U&!0! R8  (P  10  ,P  (0  4PP Čp@㏂00\P ἨP @ 00, P$$Sp-@ 8,, &h.p@-@0` #T  &t卌d lP`PT p ֊P000ST @&&h7,L@-@P ӒP_8@P @0?SP@ p Ѝ/㋜P@ZJP 0S SD4C0S?00\Ud\i@- &#&h@-0@<TQ T0B0 s&0001S R0Sd0d@TPT T@0$ @<,V&T ,  @ M&,&h-@+4GQ@-ʙ ?&@#&h7@-@Pߙ  Ᲊ0S 0@T љ00 Ѝ0˙0"S0 sr@-@uP  p TЍ^<0A-@X``# ^p "RG ^<0d#N R 2&< 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,Ǔ0P01p,,01//00/00/00/00/00/ 0  /,HZ 0  /,H`00/d00/l00/u00/~00/00/@-@ ,t00/@-@, 0  /,td 0  /,tl 0  /,tu/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/'00/+00/`00//sO/gb@-0  0Ѝ@-@ +@-  -r0@-%R  +@-  -k @- 0,, @-,(0@-% R , @-8 @- 0,q,t M@-,s @-  ,r (0@-% R y,t < @-  p,T< @-  g,Q < C@-^,t< @-  V,S @-  M,S  q@-D,| e@-<, e@-4, e@-,, @-  $,T @-  , @-  ,R @- 0,, @-  ,T @-  ,Q C@-,t @-  , 0$S00 @-, @-@D8P d 0  LP 0@-0 |1V, p@-P( dP& <PV 400C`F V$P SuP4P 0CP  @@PLlp4P P0S 400C`\z{k1SR !0C B/!?1B]!NRAPN P  ^Aжq0r0xP00S11A)zP`PxP@a@1S020-(PJ @$3@P, #0@S00 2P0CP?P <P>P P2P 0PVvP tpP1a(B P euz1S'ʰ1 B P VuzP 00P1 RE40S 3/Pe PP e P,ЍPR0y &\ 0SpW 0m 3/pg P 0`A P u je `yee00x00AM%0 b02P 00P000_yEe ,&h}-&t -S&pR.2 001/,P0 R0//,O-p`*@PP [ ! {0P @ Ѝ0ӊ00 1\$<0 P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,P/D0 R/0@-A1 P d@< ㉊,O-dBp0 W`@4mg0p 000 Ѝ0P@P 0S 00@ [& 0 mP ,W0S &W000 00 `[0S mP W000 [0S mP W W0 00U P0IS0SPPm0 00m0S mt0#?C S VPU   j0Y!0Cs0S( 23PP PEV,,&tUUUV@ O-$MH0[S0P 0L`Dp= G0Y0 0S 0g LvfἄP[m\m im@` 0l@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0fAmX 2 f 0  BT P0{ P>  PN P P!VUA`E Dp@DP`0Qf NfKf@`"PD P AP;  KR !   ` D0p0@0!P`1 V0p00@  \i`Yx`F`FV0p00@  DPEp@DU`E¨` Y @ u@T`— R   BU0S 000 0 0iu$ЍOU0Y S ,,ILDG&t&hA-lP`Pp `xl@ql@0T `P@ P ,P,,@-P@p 00T0) i p@Ѝp0 000 h` 0@ pi @t 0P  &SL,,Nh0p@-P@XP0Ps H` R :P 0S@@Q@pu&SL,,@-@>,,0i,,0i,,-@-@00Z  Ѝ@ Ѝ/-@-00 K Ѝ Ѝ/-@-  ЍЍ/@-@@V@-@V@-pP@`M,0 0( 0 00`Ѝ@- ЍYO-M P`@pk@kUiT0 0aP 0ND0PSX 0SU L00SQD异PPL00PT]y@DO@W <p :yPRWpV`KЦo`0 S`K0 p@PD@0 :PT0 0P00L00$T >Z  Mq auaaЍ00D R00S 0S ]L0X3#PpvpP 0 q똰EDcc =~0 EG)pdP`DD`ocrc,,Z-@-,, ($ +ЍY@-P@`$0 0 * 0 00`Ѝp@- ЍY@-pP@`M,0 0z(  0 00`Ѝ@- ЍY-@-00c  DЍ Ѝ/Yp@-Pcj@hjp,,@-\7@- @Yh 8A#yWPU $ EyC00h@PU $T 5yC00000S$$Գ Ѝ0,L (d (i, ({,P&h (O-TCM@/0PD0`@ .&@  ᠡwPP  PCCߍPpW J @ dpPY Z  ` w @ =R@8n@0} p r + + +&h + ( +1@-o0C-MM 0p@w`P0 }PP* P BdP 0S0 0z   IPPjP 0 Q000PauۍЍ0s0P 0 00 00 + ++,00S/ 0P F@-[,,<@-TYP f P <b 2@(!Pq@ (d ++C-@M @哅0S0z$P,  ↅ0S#zP  n0Sl Y0] (PeTA@PaC.'C*MA^&'ЍP@R;/}Pp'Pg'20S P@`P\'.@p 0$!P;} X X$P 0)AT P:P @P pQPP 0+Q !Sp 07'SpT+pAW3pp0W3:X# W@PQ  R@4Q p0Q  R@7@P`=Vp003/P,00  h0S  R l 10!Ip,,, /@-MM+@(!q+(pB+(qB+p(`?PލЍBW?P 0 T @@@@@ @@@@.&B(7> / / /-MM+ p+L p+ p+0p %?P  >ۍЍ / /0@-@M ;1@@"h#P @  qP A0$*!PRU)QX?&Ѝ0RL00S 3/P 0$003/0$*+?P3P/[P+W@P'?P# 0P{ z:{  0S 0_ Zi'P ?P4o0m%~()00,,b / 0 --@-@M ⹃0@@<>"P* =@ qP 00*!R00$Q )J@P  0S 0` 'PM%7()Ѝ,,O-`M!  0X#*0S ` 0 SS 0c~p0 S00C `@T~0 S:PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ A T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 %o&t7@-@ PU   u?00 Ѝ0l6P T H u긃$ 0 [), 0 0, 0> 0I 0bp@-@Q`T8080P00S0S   0p@4,,L 0s7@-@ 7PU  su?00 Ѝ0PP s x ]u`00S eH 0EB[\( $ ,L 0z 0 0, 0 0&hs@-8Q`@8iVy _ic^c{ _^cF4yc^4y{e 0 Aj@Pxxn 3fP ?8? ^ ^ ӃTyЍp- 0 0&h 0O--}Mp@` Hw 0p 6V 0S  P R' 0S  렵P t됅P tgpPU PgEC T'R90B? 0 I)P >PP >00}P}P: @  |: _:0S [:JP W:D4 d 3 x 4$"0}ߍ4iZ3 340"!03140`040&2ыҋ 0T40   T(0P500  @>"!!0#  PW  XT 2t 0S l2P t;t<ށ0S$@0 ;U0 <"QS ig1P s 1 S0W$2jT1@T  @>0XC0@0S@ @  0R0SQ Ⴍns0S  )P 0 ]wk0  PS $2 ,&]$tptb 12@f,L, 15 1? 1N 1R 1U,R 1 1! 1j,< 1 1t 1 1 10@-0,MP0 00 0\PPP@P DD%@0Q ,t ,Ѝ0@, u4&](&h 1,L -O-iMs?!0? ZP 00iߍOЍ/\A|^ `PD1P 0 > A#`P z[p P@' [PpT00Z&<U0P 0 " 0GSW 010#S 00PpP@ P$ 1,L-O-p0MT@X   p$pF `V  @Q'U` pPP1zP@P ;븤H E09PU m0'SP0U*S / ᇂP0 0pX/0 0P y0@ 0 0H0 uPX1Z l sn+p`PUQ2R( .2S022SP0220C2  S xS`` gv$00 00( 0`,VPMUSR /PP)V  M  0%S @S B* B~ 0.S 0 0{P1Zp(@P] 0A0 0@ R 5 f-SNv00 (i@0 0 (aPbbq0S  t[V0A 0E?oX20S `0[_$-[_IbvV @ x 60S. a@$[v00CS0000;Q0S JX$0S  `4ReuWU _Z_X LZugwG0ЍO Ѝ/ 2 2* 2= 2N@th-& 2G 2P0@-CMlP)PP 0S .Qro@P 4ejCߍ0 P^j ,T,SG-p@ 圀PB`AT:00Y W ,/Y 000 ?oP EQ 0 7 @&t 2TA-`Pp p@ } ,pj Pj@,RA-Pzx@wxopl i0S DQ0Q.SHP @$ $i i,T 2[,Sp@-M 48PLP    i 8PLP  i Qp@ ( ,} i pPU |@ %tP i 00 ` %@PЍp di `iPi!,Ri%,p,R(i8, 2]O-NMX6Q >M1xx.`ێ,Pz0尪S w W:-8 4e0 w=C$ C/Bt DE009t=0ؽpQ>e0 7iP400w0 yP40  U Ur0YR? ;/ 0mp <*@: R0 :P'P P 0X60,0:P<H0.̟   0/P `d< B 0 0u`````YPp(00ۮtl= +D02lq0,ݍ<Ѝ>0a Xh x`P  xP `;{ 1sS1lS8;"00P%QPH BWP8;x`Pp},h*0x*0wnhxP\8 0\8VW*0yU *0z*0}\8p*0|xX:U :H*P0Q4 4* Q9ʟP \ʟW^ x9   +9 @H- A)+0p 0HAlp p=Sr 98)a0dd DP 0H0 H0Alp ( A&Y`P( 0Vi nPSUp`jvD T{! JP{H p00n`<T(0~D`<wP P(wP <wP wP }JAwP wP wPg0:4LP '0\6S '0'`P F4x lh`~{$'w[7S0  'pli28dp& PX6 AcAy0\8CP P & 6 jP `(@:4S $ 5YP 0: APڴ  VF\80%8\8nPय़` g  lP0%08P  g   lP0040X%S\880\8P f 0S %8P tf  `kP000S\80\8%P0S\80\8`: 4S3P h 0@?S X@P D3f 0{C:$P0R#R#p$|ßRl#hW%RL# 2M  "0S2 P 2@T {5wL lHH'* 0Gc0S t"d\0S h"URl73S5 U\ "R?0ⴂ0N?C0C `.,`0  0F0`[_Px9A?Feێ80I,07>E`I00x P"H pR0S tWW5S (!$jorXvlX60S`0 <IW4 3@,S,R,,, 2r,,p 3 34- 39 7ai 2y 4g 3D,, 3] 3x 3 3 3 4 3 5" 5, 5 6 6 7 7' 72 7~ 7 7 4,P 7, 8 8 8 8J 8oP 01/ 2T 8C-pP@,MpuP3S0 ` 0`:00 0`@0`00n/00 Pp 0P/S/00 0 /S 0/0 0%R  @ 0 `@ Bߍ 8 8 8 8A-`BM|@uPlP3Sp (pE < X800`0 0  3PBߍ 8 9,P,T ,@-@ @,@-0  0_ P @0@ 18 0/P $  Ѝ,P ,R, 9'@-0@XPL0  0@8 P | |0|` x0Et@|1P0/Q   P p1 0/R@0@ Ѝp,T ,P 9$,,R,P,@-M@DKSPtP  d d0 D00Sލ\0\ \P L0 (0< {0, v,t 3@,P,Q,,T, 9-,x 9`C-bCMX6S P \8BPCUt2tB0S 1\6S T}1L2L"D 1PP4 0,B 0 -*:4S / ""\@gU 00 :4!SU *00 0 B qgGA1@P@+ 0 aGAcGaGA0S  !(!0S   4 P\6S @#U 4kjCߍ 0p Bd@ ,T 9d, 7t 3_,R 9,P 9 4 9,d 9 9,S,R :, :- :T 9 :4@-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%phЍ0L0 3/@P 0 @P  Q 1/P @ @t@0ᄠ80:/P 0 083/P@@ 0PQ0//!01000/ 00#0//O-`$MPA@T _q prP00 0S 0S0S$ЍP P00 S rS, R ,0S R : 8 80R:P3#///A-@M`Mp# : P *p Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTT ;\ ;pA-`QM p@ P PP TPЍPrPTP0 puP@$U@@:T @ @<G0 @<P ;~ ; ; ;G-Pp0@0Mw'PP ,`0 R PЍ 0L03/P  0Op놁 0 IpD @$0S P @a @a`, ;p@-P`o0@0S 0p@' ;A-0Mq!P0`L0 3/P< 0t@T 4/@0 @P0p 0o 0$0S |a$0 waT \qa map0S0C, z'Ѝ, ; ; ; ; ;0S/p@-P@K 0000p@JO-p@P|M Y'0P,0+`V,TP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00pP ,0<<0@D@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 x @-Z P 0P 0Pp PQ` QTPQH "P <0P/(/$/ / ;\ ; ; ;p@-8@Q0@P@DPp -Pp&]pp@-P@P  ` S`00pp 1S n|P >$0`>@LpԐ+ pd H D + D$0CZ 4p <F0S 3SL |c Gs Cs0000? n0Pw 0St'S  76`. `N0B(Qn 0C QX > 0 0B,41s10吀P "0` |I P\P fP ,4101k`~ "``m@2P  @000@A0 "pdq0N?P0 S J` rKR r000`81t1!$10 100-~!(, D@a C 0 1/@P00pЍpP@00003/003/$Am =qO-`UM MM.x0Pep.{p Qi\,)EJhLD!T@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯N⌗ 54, Q~W <S X7h4F>D0C287\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @*t00, nRE "G\5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$#@p00,0mS` Eh40S N?,$$l4PU`4 0}10@T  A [ "[ [,10!,1 101$14141(8H!L1 1$1H!L1,匣6$1(1!R)!,0, 1401$141(>8 $ $!R   0XzYx <H."0$1P0!$+4 x2P >{\{ $10p0$10jP00: 0 \0H55S Pe $003/$p6kPM pQC!> ,! 5$H0@9S 1 HPfP= );;S9 $10A>@C418!<100S- @_ 0bWQ!!10b/vn0P@,1014181>@C0(1}1S0}1$1S p E@,-& TZ ;&],,@,p, <,L =_PP$030/0@o//BO-P@ MMAT0*!Rp0)A`T0 $0   5P T Pp , *'0t$0 `$](pP H4\,$ ܍Ѝp 4]0Spp0 P 04p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0 S "S S/ Pp  R  ;f > =? > ;@ ?O, > > > > > = = > > ? ? >L ?( ?< > >xO-uM0M*QU$e UB&&@&d Q Z &0 0 6\T Q ލЍ4 )qW nP7 FP' P  @bP' @ pH0X l40iP40 ] P U Z@D`@ 2 p PU   c0SHS   : 0S #S 0P000P Fr]P14s10`#5:\#\S /%5%;%0@`S D% % })__spp` 00 ,0S T0 S00 P0p0SS 04  0xP;8.5/P>0400S8RT0RP S@" SA0 0 80[hP80P QL ,0@8aa<th<0X !L! 080$ 0 40d( `6 S/  S" 8Q0PEv $PF_ hP005S0+4^X04  v 0R0s  k$똰0, ?,L ? @ @R @i @n, A A < ? A A ?T ;O >L =? ?Z ?e ?j ?r ?y ? ? ? ? @ ?\ >@ ; ?] @ @ @ @ >ZO-@BMTM) Pp ` @PpTp$;PpppmPP@BލЍ D 1M0j@0@ &M>0 $04@(8 M>0@00P@<DT@0 {P ps\0A00@3 0 !d, A0 $03(408@00S0ؒ; M~P DZ =N BY BL m B|,( ?, ; > ; <b ?0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  =PB,, $0@-@"!Q(@,@-$@2S "02,O- @P@J`P@   PP@ d@p0Ec#రPU* ЍI GP  GP @JI    R0S p&t =N@-@00 <P Q P 0.YЍ O-p`JMMԢPppp HLiP)NU\b`H7PfPX` EpGGYK eP 0 000!00P T"XT1P T2X"TPZNT"R0 0X pPX 0H,0_1A 0101P0000PPP lP,Pk0S9 0S)XcJݍЍQU$P 0Xp$1Q QP SU T"P 0 003/PT2X"S0 S(0S 0SX)(0S003/PT2X"SP,@ , &_ 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-Pp@`4M0S4Ѝ0 0L03/P 0 0@P`180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o B 0@o/b0 !!/,10/dp@-@4P0 `T1111p,O-P@p`ԐԠ԰0/ C !  !0  Pg00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ, (  0@-P@M/.g1, 00 0d0@00 0T0@@@@1 0 000@P,ߍ0 ,O-Pp@`4M 0SpP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   0Q R  S0 0P  P  H   4@R,  8pT  TX $ `\ ( ` , d pA- 0R 0  DQHa@1QRpB   !LAPAP0 \A0Q     TTAU @@, D( D0O-PBpXQMU<26PX\1S2\U \QUЍ0C`1V`1SX`a001PS \1 XXX1! 0`1Vle.0X`0 T1VX " f\IP6 \ ! f000: S.X1 2 \1`00X1`]P 0 S 0.S  Shp ` XXPU SX1, 2 $ eR,&_P ( d p p D9p@-MM`_P oۍЍpbP@P+R P*+hR P*+R P*P ⫲P D; D9 D@p@-&M @(DI`P5 !h*<0 0` P (E5(E h] <@P ލp DBa DEb, D} DO-p@MP! c0  J 0F`尢Y p` 0 0P0SߍP X%]P0bP0 a0CS0S  PsU`08Sڠ0SP` R SZ0  0 a00 =p 0X1勅00 0s [+4Bp;Y 0 @00t00 00S 0 vCP0h!R@O 3O0㏐ 0S* ?0!CUa0 , D D @dAde, D D D,@- D@01SP@ 0S 0   , @- @-G- T1  D1D1P3ݍ Ѝ D900@-M  0 0S@Ѝ0d0d d;@P T0TP P00H0P @<00(0P ( ,,| E,x,S,t E(,P,Q,@-0  0\ P <08 0440000 0 Ѝ,t E,P,S,Q,0 0!S//, 00/ P /, 0( 0S0 10 1/,,11<0@ Q !@-0 " !/,0 10 1/,@-M9/.b, 0l0d 060 P000@ 0@,Bߍ&_T ,0D D /Q/QQ Q/,&_T@-@0@ 0 0SPЍ E@- @0S[00,x E0@-pAMhPN @'O  _P<04Px9 /T0Aߍ0 E, E F -@-P@ _0P  XЍ,-@-   Ѝ Ѝ/-@-\00l@P @  Ѝ@Ѝ/ F F$ F@-7@-`P010M@P B  , Ѝ0@Ѝ/ F{ D(@-,P P @ F F F@-@]P@ I@o F@-4@^P 0 P  F,t,Q,@-4@l^P 0 P  F,P,,QA-@@1@#PP1P#Ttpt` p_P t ua@=>>v6t6XYAUY-,@-@p)P `bO @0 EDЍЀ F&h0@-EMP@ N SP00940U0 ((0x:@Eߍ0- G,@-dM\A Ml\<1G)01M<0P@T 5X Ѝ, Gh&_P@-@< 0@- 0 Ѝ0@- 0 Ѝ@-0@MK0G0  0Ѝp@-P<@0/SpQ ]Pp@&_T@-0P  ,P,TC-$M@`pPl 0M nP) 0 PP0P00P l @`0PP0L`ySa00ͅ0݅000͕0ͅ$Ѝ Gw Gu E G%,H,,x,R G GrO--,M`7[$Q@qr[ VpPe $QP@deT10S@ [PPEUN XX0 (%_$0P0   @t$0VSS00Y00S Z P E H $Q0 0$0  0 T$ VRR   Q # 2R @D `0@QJZ `P$ WQ@,Ѝ  G G-p`@PPU : gPP 7/G11PpO-@ M$'Q`P Ѝp0P 0`VPPTP$Q-@- 00Ѝ Ѝ/ ^p-@- 00Ѝ Ѝ/ ^C-@`PM MP`' @@EpD F83V44C/V]DAD Vc& * 0So 0CS+PCS0)  0 0S8 0S r0S 0S QN@xP$ 0 X0 H@o@2P 0,b0C?o270 姟0(H0Sލ Ѝ !7qS R[P5S/G B !F? u@F@o@1P0  0L '  0S 0S| q0Sx 0Su QN@TP  00 @<P_F? 5Q. 0QFNn Hoq Hx H Hh-,,| H E. H,&_Pm DB H E,,T H H H-MM P  P  ۍЍ I-MM P  P  ۍЍ I%@-pP( `lP! %  `" 0 S0  @XP00QP G@TTЍp D$ I8 I?|0|+R/ @-h@|+\0 P0D080",0& 0, IX-- ----P@-@ @0lU,p@-@PM H(@]000H ,0@@04P,P4hPp0: S HZP 0J ,J܍p,] 8]Q @P_@Pڤa <VPT8|1| B\p82<DQia H1 0880c8PP  QP00S nz < R t00 00000 00l0Jp@ m(&t(0S!,t I,P,Q,,8 I' h,,x,H TO- 0CMSP3q `@q0!`3/0`SPW!000 @b`@3/@P CߍW! 000SZ 0S|X 0 u@z<T W  00 0 w ]0S l00S \ Q P0W0 ! !  000,P,R I- I I J' J,8 J*,7@-PQ@0 SS <4 000] Ѝ0 2S<0  J0 D9O-,UMP$!4Q 寉 _\#ß0/SbP3s0ԃC0`/Vd3P Q.HEU@c A@ lPKZP D@C;@1 U `>P}8P$ 0RP 2P 2`.$o^ 0 10S 0S5 0 1S10S MPpG #1dC0hS!0a !  R R` 10 1000p\R `01S RB  0 P a0S  /SPR  Uߍ` 1 083UW U@P@T T` E(, J?-&_T, Jg J J K D9 K8 K\-- JS,P JZ I?p@-Ph`@TUgpUP`P  p&g J'G-pMMdpp@ P D;wD2PPC P1P  2PڍЍs DwPk DwP-P `P  -P>`MPP003 0 ,vU ;WP 0=Sp  K |P W  P P P\hP  PP F J'3 K K K20p@-4 P@Z0 Pp@@-G-P@p4 lZ0pS R p2"4p0QSP pP`p 0S!40Sp  Z`/0 R/@-p`0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PYP  p@b@-@ j(h@eA-P@p`p0S 0pp RUAR05#h30P200#X0S/0Q #"h0Php P#"4`V000S 3/0Q #"40P4C- 4op Ѝ`P Ap 0  #' /! 0pZW@|녱 d@ T  LUPMjP `fP @ K KD} E Lfp@-PMM`; = p  @p ZPZPۍЍpp@-@P 'Y` DP  0QpPpd| @dz@-PM Mp;P ` p  @0PPPU9ZPۍ Ѝ Ade! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPY00/00/4\80S0 S001/\80S  00@-\\@"SR0(SS QU S!0$0S\  0 M1Sp@- l@$\ 0P"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/, H0, 4 T 8 X  M40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 BRp01 408 00803/P,000403/, H0, 4 T 8 X  M000/O-0@p 4MPPp`104ЍO_$0 L03/P# Ѐ0 \ p!ФZ ["H* 0*P T P , [p W8``pp 0S0P 004Ѝ0,DO-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R?!S,0S 0S00 0S p  0!"0 0  SPH P00P00 0 K`03/P L Q Q  Q R S - Y 2<  d . | ` O-0c(0M<00PSp@p`00 # 80s 3 0Qh0@l0 S@3`} 0D@[  "(0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00D0@00p2 p 00QHL 0xQ  (, 00  0lQQ23T 4 0p0P<0SNP0 K T00SG0Sj 00p0q  x0 0 000000  P0 0 00000PX 00808/TQ0 PpQXQ Q(00,0p 0#_p a X0S h^ 0$0p0 0(00,0  0#0p>0,x, N],| N N\ NG-lF`0pSPhM^PQ0S P0 SP0SP0SkxP0SGqP0SHjP0SIcP0SJ\P0SXUP0SaNP0S$GP0S000$ R$000 "0& W40SU4 QQ00Q00Q00S 4 ehЍG( P0SWAD4W>0 P Q Q+=3 0030,P0 hЍ3 0030P03 00$0 l30 P0 0TS(0p`@ 0 SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@0 # }8v P0 QT R>0 FH0L0 ?H0L0 8H0L0 1H0L0 *H0L0 t#H0L0  \H0L0@ DH0L0E ,hЍG !耟SH0000 #0PpG0  d :/ 000(00,x - 2< Y ` N\ M N,, N | d  Fd N F 0 N N N N O O O O O$ O) .C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/0@-EM0@P 03/P 08 00 @@003/Eߍ0@-`,MHP u@@0 0 0PP@00 RS THP pW KPP00H P00P0,Ѝ @T@0/W  /0 0H8@H P00&t O2p@- MP@D0 L 4` 0  040PP`v H0Dd Ѝp NG-%(M@PU T L @P`4 ,VV !R "2 Vr PpP`"pVp$UpWb$U  0 ^R0 00 00 0% 0MppppEPP &(Ѝ  M O4 C-40PS,MJ S S S ,!S SB Q@P? `q``X 0 e~000 00 000 0 00 0 0M`P 3J80S?,Ѝ ND p 0 O-P@0p(AMP U  0b0 p!"`00(1@ "U`P $#P ?00 P P >00P0 Z@! 0 A@BA0  0t!C @0  L!- P0  $!D`pGMP@!@3@@M`0 -P:R @D@0 - U! @ P .㨰嬠P00 @p `D/MAߍ #"3P0RPV N\, O,x,\ O OO--P5M0<p@$P tP 1`P %4R 00@D0 U0 $0p0pC 0D@D0 0[@ 0S0 S,000A R\42PP00$4 04PA00 00PPP0S8@P 0P40 0H03/0S,0P p p0CD 0@P000P`ċ@0SOP pv0,01v0(1PP ! B BP2"Q%008  R B 8";Q 7Q 0 R80pPo 0 R#,500y6000|Ѝ<0X ∑0L0 3/ 00X00p: 0/P P`&0,00叾0P9 @ p0 ZY00SYXP P00S`(0,(00V,000p 0i3/` =,\q C .p 6u , Q l "h 3r,| Qc@-@P0HP/OP0S0 QcO-pMCO TUt{T4 0 rs> 0b0 *  P 1@0 B )R RC*PQ0R r Q0CFS0TR000US0a0Ѝ@0  pp%*PT00U00La@0 \%81R8 ,R4 !R0 R-R H ` ` 0R! 0R` [XoFT00U00V F @)P0 /S`Sp`` [XtT00U0,`0 Qh, Q, Q, N\T 8T,8 T,,( QcO-0MS@pأЍ`  ZW0@ 0 P0S% cS2 %MS) CS, GS R 0&FP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-С POMMP#!P0@0@0<0\0P`(0 0H03/00040 00! 60S 0  0(3/ 0Ps`` r S08 L&a0@&P}Ua`v0$0800s0,00&$0Tngp(`DpWP0`0T0d05R0h0X` `pV SO` |`U TG` tPUA` nVU 00 04PLf4P0XP\040S000O>=C0D0#04 0SE$pUL0 R  Hf0 000D0H0 F0JHL0S pFP 0S80Q00`Q0S 0L0 aA3/P 0Ā`0`0 %003/\PXp E 0 g&` @o/DX` X 0 [0R0 ` @0S<00 00S8P* a`v0"T$0$0,0.T0,0$0'$0划 X~0 D0 ps 00 D0 e0 D0  [p0`00d010` Dl0h+X"6+6: Y`*pV 0 LeU 00 0hLe0 <LeH0*,0$ Q00Q03S (0A( 2bJ7lp0 ` %C00`P3/ ``0X`P2VP0`4L(OލЍ X 0@[0= X 06, Q Q Q, Q Q Q Q Q Q Q Q@-@!"  0 Q0 "ġ0S "O-MpP, @(`|1/0PU0@5@Z0Y@0 0 C 0pP CPUp TYP 0  C X00 @$ $U<0 00$08 C 0 1/@P  0R$ALH R>0 R 0S pP P 0$003/$q,#0pQ@-s㉼㐶 #"T R0//s@-(@T@ЍpH0P0 w003/@P]d/@-tM`P @0P p@?@(P  90@Tp@tЍT0@ #Tx0 Cdd0d p `P D 8 S,P S T , T! T3,( T@ TN/@-@@ S///@-0@Q s@8o?0 \ 0P000@-@4M0  CP0PU?000U00 0  04Ѝ0,//A-pP@`VT0S0S X3@PH0P$1U?0U00 0X0`p@ T-,\R0  /p@-P@d><0Q"4` 6D0# A@$!p,,A-<`P@?Pp( / A,@-7( T@-+p@-M  ]C0 hk0S Y}PL@L`@BU 0 0 ܍pc T,t T1G-1MP`@1P!t1t1t0ppl`PBL@fD忼D0 [׺8ߍ ͑@P F^> q?@P 0=S=?A@0  @CT@  {P 0 l6P P v6@ UA9: T T T U U U U,L U U' U5 UP1A-1@P`p1P!P0P0P`P`P0  @K54 g,L9: U] US Uu Up@-0M002 00`P 0@P @T 1T 1TO/11 ,PO/11 Ѝp U;R 0@- hP ,@-CMp P@UBWP y`0 0p?0SO/11 Cߍ5S| |7p pPd`X 60S  S(A1 1,t U,s- V VM;Jp@-P@`1 1  p-1p@-P`勹@P凹0 p@f Vp@-P@׹P PN/1 1 p VVp@-P@1ȳ1(1 zP1 1 p VV@-㬹@j VC-@aM.pATV PS2:PWPG aߍP P @"080E0$"tP ",2X , |< 0, t< XN?1L0 0!,P Px1x10 pAPphaU U UL10$0PU@4!44F`A,ppP0S S  @6A 0` 0P@hP0@8 ?C8 0 0 0F& 000 p @,id,5 V V W6,L W= WW9:&g,-,s,t--- vK vxA-`$X@P Qq-@T M }GP( 0  :P  0f3 P 0=@6oЍX0bm DO0 0P  W W,L W X X X^ Xh//O-0p4`@T Ѝ@T@T' ^% L U[Z [ԡБ YZ PUPE P$P P@B0"/-O-0P ;pA-@D`DPp0SJT00ԗ@"T 0 Y,, 00S@- /,,pC-麋X@(p,P3`$ 0АYĐY T  T:\0WaU|U VP P 0U Ѝ *V0   Y Y Y Y@-@P$$0 I=婵@覵 Y0@-0@S0d Ts0"S  @0<00R( T40 ,--G-lP0`Sp@;S S 2@1+1:X zp  QBp\T.@T&RQ00 00(Q $9p Q 0S T vB* 0@1 00 0TRT0T"1-{p@-P@u@op1O-0@SpP`0 PQQQS RK0VȰБr0 P$0 0 " 00=0(Q $M9p0, 1X#Q  F vQ 0)0  R [ R pR L0L 8CQ< R# Ѝ  W1Q:`0, ZHp@-P@P0S!U 0E p(0"PE0U055403 0(2#p,--40@-0@SiDP0@0ӕ, XC-AP0`SW!U 0E p0쀟@SV  Ѝ 4 U(@0v`P `4p00 0@0<Pp\0 XH pP `0P N0'p(0,0`,-- Zsp1A-0PSp@` 0 PQQC S;0 < 2  0 !rRv?000 V ! (0$0X3,00S000 1RPp0S0 00 0W1S` ,N@- @▉00S T ]ϳЍ;O-X0MSM0 @D;\0@S0 @@`0Sb0/ @@d0S0G @C@h0S0c @J@H (0S Tx80S 8< SRS80S 7, 0HPASTPPKP1q @]@`P)~G2 @ Z, V\00`0d O.0h HX DŸ;S"@<0!,00@0TP@_oRݍЍ 0:S 000a 1\0  0 0 0 0C0 ;0CSLLP Z Z [ [ [8 [S&t [\ [` \ \ \ \O-0TM$00 (00 40 0800`000@,0 0@<00$$0 !$0 0(000  P 0STpDP@Q0HLpY Y 1!S 5YPYPWp P 80$S40 00 ( 48R0(0 $p 0WW0S$ $ pP;S S2P11: 0S <l 00PAp^U8PU0QP0 Đ(Q $6p,0S  0S E ,v6'<0P1 00 0" S  0 0S "TЍUQU0E"1-{p@-\P@0S? 0R;)r00 S0@0 N Dp-O--BM MX\t0媰@P 0 P(` ; PPp̱Bލ Ѝ80 P +Q 0 0d!MpPr0 00!$0`4X00 0Fv0`F;S P pƺPS +RQ 0P \Q S@0Rpʩ0S R/ S * S, S0S 0 ʱ000`0 0P 0S  c& 0 R$ ?!"S0S "P0n Ade \2O-DMh`lPPDЍ@P >4&"R p 0g4`P0+"R \4p0 d00到`0\ h0X `$P`Pt0 (0KHt000 00 00p; \H@-`X0Sg0'. Co8\0@S0h - C`0S0i/ Cd0Sjp0!. 2Bh0ST0k}/ pP U0 6æ Ѝ Z Z [ [ [9O-MpG001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q r@ 0 @0R0 0p1/P @-$ \HA-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-ɭ@P`p1S 3/`V@Td0@@ᴭT0P0S@000S4000S(0000A ^H- -$ \H n8 |p@-@4`4P0Sp@߯10S 3/@-$- 0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 @00//00/00/00/10/Q@-@@@ 0A0003/P@ j @J ^eC-B`0SPEM;0V20pSN20 SlF 20S ?20S8820S 120Sk*20S00$ R!000hA0 R Z/50 00T h0:/P h00S0U0S Z 1 0U/ 1Bh e&#0P 010@P0 ^,, ^ ^eC-PM0@0` P " `b0  000 ;1p!0 00/1@!0g0p@ @ᄯƭllƬdF1@\ԭ 0 D!@˭ @p0 !!p 0`䀟0 R {" Pw"PЍ 0p!墭0i ` `c"NT 0-0ȗ0@p NR S3#:@`0 ^,, ^ ^, ^ ^, ^ ^ ^A-@0P\03/ `pV@@@P< 0쀟DV  \-V0 W  0  !   0 00$ 1     t   Ch  0SJCT T0T4 N40B@@ tr,q  u ^ys@-P,`@01Ѝp,p@-0(M0P,03/`ᱫ0@ S:0 00 0 0 0 fp` F0A0᭪Ĭ(Ѝp0 O--PM4,@ PЍ ʫpP 0p @r @< 5 PZ0H03/0S`@G`@@00J`P l" 0Q!`2A 2I0C 00000004"  0 0ܦE\0S B("0 L0P 3/P \0T@P`@X0`0 S8 PY 80 S ,1 0, S001{40P ≡0L0 3/00 P00P: 0i%0L0 3/P 0 $ R PR ! ! pUP0 04DЍ00S 3/0@-$MP0E R R\R0@@T T S0T 00 S 0 8  P@@0@S$Ѝ0 _uD C-@MP-30`@`|0k@P\  @0H03/1p0`TPX000 Hx03@00403/0 \@! <1p `0S 0  003/P; #$#%0 006`00p00`0 0ݧp`A@⹤"90S @, 0H03/p,A@'@0 0S00s01Ѝ&h,, t t0@-@80q  003/P 04ЍP1 A-0FM0@00@3/PP#0`SP p0 ``0I0S 00@03/PPPFߍ/A-@xMPD 4J20`l00$pp0`h僨@P3 P p20h$ 0P\S+PŒ 0X*0L08 3/16 010100 0 00p`ႩxЍ00_vp0S 0h 0Q*08 @,04/P,zqP 0]00 0?o201&h 8&id t tO--@0lM0$3/0H03/ 2`0PTPqX0pZuT0 !0 0 `p P0 (3/P`Z L1"##$0 40R ! H 3/0L8 03/p? 0L08 3/PP8 0 R5 `#1//L"P#0X 80T3/L0 083/p 0倰$0Y 00㓩.8$  p` P(;/P PlЍ,O-5P0MS J?0SUU 0SHH0 C@F0`VG ,%@T d?>uF 00$ $ d 00q p`儨@喨0,咨0叨匨 `|t8 p44`@ p1 @ pd40 000 f0,0ddΨ0$10c0\$10]`\0@ pd0000S< p0 |PÁd ,\3 000000 000 0 0(0p⩥p` 3d,0ᅢl0S= S@: SM`p$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS`p 0SV $BP2Q ]Ѝ^Pg00SZ 3/@@OoBS X@0 0610@!Rl!@!x@|@pPpt@t0S|0X*@6P PQ 0!@x 0T:x0S@ Sjt@OoBO@|0xT:^@, _y,, tR ^80  - u Cp ,L _>O-UM8 SP44@`[D 0P(0 pP(* Uߍ0P,0i30 40S 0RC 80S9(1SJ!<J ,LH S!A TH@$+4r 00@PP@T ( (0B"2 ,0!P0S 3/P20 SU@0%0cD0`| p2RѦV1@82PU?000X N 彦 ,!L12H䱟H@P"`P`T@婦P ` *@ *0 *000 00400 @ဥ *   0 u )0 lg)40P1:> -q@0 000000 0000 0(0p` DD0S#, 5Q7ZTX 53(1,/v (- -$ ^ noG-/<@JMM`0iPP+P& 0S" 0`"`!p/1P T` H 0@T* /R  $P/@Nm+ P:/?0 `H⏴P+0: S pW/>00ꨠ t!PJ>0@0/S0@!κ+  SP`+ P*WP 0/S`0oo`bS )p)0&000 SV+tb P*+\ P*PB/@޲>/@`ٲJލЍ ` `  ` `@-M @ P(0  㫲@P ᠲ P Ѝ趲P0p@o G-`PPp X`p$@P7Ѝ0S @ p*P0 \ IpL冘 P Xp0 @>  ` ` ` `(@-&*A-tM `PXP HP4+⛳@P@0  @ ⃳y@P+JJ.0+JxJ.0LޭL|P ׭PP|<s, έPPs+Jd0J.ᾭPPcx+JT J;`L ᧭PPLa+J{l=pd0\!0J>zP 0.⊭P UT ލP@[+JNJPP p0J.e@ +: ZP h J>SPT `7 `@ `K `Q `[ `g ` ` ` ` ` ` ` ` a&i ` + `q `v ` `/00/00/00/00/0@-@0!$Q4M0 ;'P\ P0T0670 P @P ͣ4Ѝ0, a,,O-AAd2M,0!0PB,0 00000 80s0`0R, p  $ ?(0$0L 0s "h5 d%T` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ `0d P[ T0Y2@t&L"@(@@,0S:((0"PP@0@00 +0@080s=0 0@( Y ߡW|Ѝ#!@&(00T1 0 %X!00  b@, b bX,A-@  "(0M)( 0PdQ1\2 5  D! C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1X!S<1@1\1(H!L1X!\1Pp ,L3"0@  78 7 0 W %&, 080000, 0 0080000  0'cY00HLH0P (P0R W0 000p8500 %  % %P,  (P 0 %<  |5| 000000 000 000*pp 45P,0oXpW* 0GS0.(>P C$ 00S H @3/4pGWp @ 0L0 3/P 00S 0Sp003/Y0pH03/0 ! P7/P%$%$)@0 QIYb@J@DpH L0 ZY03/ 0 0]Q  01/ 0S 2 ;C$Є  0 <P{ 0  Hp0  @D@0 ᄀX60X< Pk;,0SpP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,p\ 0,QQTQ D@ pP Q Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 05P 000,, a4p80 ̐ ̬ ̼- ̜u Cp a e a0 @-@P`4M#}p@0S $ 0dL03/P #` 0 #8PUV`4Ѝ 0R00S0 //O-@0SpP 0< #80 s#   ` 002n  Ԡ`0SQ,  R) 0 0#Q! Q0 2N<{# 8 0 r  1# 000 S   @ 1 SR0r01/,!0 /,p@-@$P x1SP 003/p@荕x1犕P$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0 ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0IےpK܍ЍI⷏ +R*<o=(02#8 ;c&@@ Tu-O-`0@PMM,0h1h0p 0S (0 S> 9 H 00 0 <0.%#@~40kP`0V,p0U 0000000 0 00000000p 0偒p`ލЍG]ƒ,0S*< #0+,0B#X0S000C0C0000S0 0,0B$P, Tu@-@-C0 !<$10(10,1P001.@-@/0 0! 0O-4M\T`Xhp(0P  咕"\ @,@;/,P R7P IPpK p WpF2  0" ( 00 0`Ў9P(04ЍO/P4Ѝ[;0p@-@Q* PM 0 PF40 Pp@ <0dp@PT780 P@1,0 P+00 p e' f`) fj*+p@-PBM `@  2 V` P 0P Bߍp`P00S0`40Pp`80PS<80  4X0S0!ۨ@$ӓ 0 P˓\0 `0S Ũ @`库d0Ph0S ⵨@l0S ⫨@p0SH ⡨@T`喓t0P^ e9 ft: f~;= f>? f fA fBCEp@-`M<P@z  p 1U%P 0DPK0 @0S  /  +8PU@Z 0 #PR 02܍p(0S p I@h,0S H ?@D00S , 5@$^ e f/ ft f12 f30p@-M01P@Q#    0`N 0S (0S l   ,`V D܍p4   0`N 0S (0S    ,`VPӒ $0Pʒ 0 PĒ0 Pt徒0 P`帒0 PL岒0 P㬒 0 f f f f f   C-GMN`RP@ |唒0Al ⓧ@Y 0 PkGߍ 8`$+4` 0 f f f<0C-P808ş0C@MS00 1S |1SX0" ߍC6`0xpW)50pL0 3/x1S 1S 0S~5@Z00`S `$@F-00 F/&0 00 00/7/P P     > C"\0S0 `F` t0p⇞ 0S  H`,p WV o$ Ɇ`ґ 0`0"  'ᮑߍ@忑 0  0S  ⣆ `PV 1 `S0N  `墑0   0S @0S @向 ߍCo<0040!00↦@0Fo$ 0DL03/00 O0S !0l{D` 0S ( ($8`Y0,p `xQ0X < 8 RFO  > 0@ /7@/ 0  n 0R0_| 0$   f f f f f f f f f f& f g gw g. g%@-x @l ; @0p0d @ g*@-D @Y000(0,0000d| @ͅ g3@-hQ`0@sKMP!   0B1!S=0 Kߍ0 00@ @@0P(@UTpp (`0 ឥ0  0`0`p;P;( J 0 R #m"B/ 0 R "_"B!x 06#0= 0S"Od"Bx 00 0=$0Sd"> "B0 00=(0S,"/!Bx 06#0=00S!!Bx 00 0=40S!`!B0 00=80Sx!$!Bx 0X6#0;!   B000B/ `VxX 00  @8 PQ+< 0 \x S|0L@T܍ Ѝ--w g g h h h" h) h0 g hF hM hT h[ hb hi hp h| h h h h h 0C-pP@㰐,M0T 0^ ^ 0S 0L @z`]P aV@,Ѝ@,@ hC-@4MT1Pp`!PP 0 L0T3/P R000T0SX0p`S@, XT $0S S T T0S004Ѝ0CS@Df7#(0(p,`-t h30S/O-@SMP 000|# p3(`P:T3T@ D3P  s 3  0B0 ݯXگf00,0 P0S* XZ'0 F⻈PP Tq 0 x0F/0I1P/S P(·0(0 00vZ0SvU (  0S `P0 1㐑  1!5:%  0僑P o Q 0, ($!` $ pP] 00 8a4Q101S- -T,@ g i jF i f i j$0S@0@-S@00 0S/-X j\ O-P2EM 2@T P0 |2P p|1S$ $P| 003/P 02P (  Eߍ$0 R P 01/0P 003/P A10SX PaPE  <0 040000,00800 pP@3@0S. $P+ 0 x0D 0xA׺Pp0@-@\MP, ($1L 00T0@0@00 0000(00 0P$@w\Ѝ0Nd-X O< @-08 S $0 0 0`Ѝ-XONd<  10@-2cA80!0CSM PU 1S I{Y㟮P 01T1PP1P D 8 8 B0R  GЍ0 0  00 0 0  0  00 0 0 0  00 00 000x 00p000d00`0,,,L k fO-t ,3pp-8 8x"T-D- |L@-M@P `00T20S'  DW P!4 00 B\ \"00P0<  4 0 !c %ЍHPH010S/  + PP)a 00 BQ Q"041$0 000xpP0` 87/0P0 00!`0)] U=00S0   P* 00APU PU000 !̓P^ X^, Rh P$0 ".R>- j\- k1- i-T k>- h-C kHA-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0------\0p@-T00P DPPp0AS@  1SA{,p,,@0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^ @^ T 0SR2"-(p0\ Q0/\ P@ ^U Q0000@--(0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@E,p@a< ( (G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C 0 1/P ,0 0L$H R>,80S @- 0 w/ lp mG-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  & T P $Q圿$00S U 0 |1 08ЍpP ʮP P Q v ḻ P ᶮ  zP ,A-Mp}P8 U`ЍGP $A003/0 R   01/`P 003/@P$a0H03/0 `WEL2 p0803/PD@0 !! `b8#H0  3/P"#"#00 03/p p0` L03/[ 8⃮` 0SWp`@`C88 0U 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 0 `04dRP  v00`p 0Sv  0 |1 0> l lp ,G-`RM@Xr PP pmP`` `xSP P:  8Fp ? 0S rߍ<0`0(00,0 00004008004004 04$0D0(0P yvW\  pV tp* h-dl` 8  @S 4S (S S S 0,0S0 S ` Ὅp 4`?`a8SڨPb 0  00*0 0P 0 *0 l@dAde l@dz m m m m m( m: mN ma mvA-@Mp`;@@ Np@ݍ P@0-@,T 02 "  /O-4Mpd@`P(tT,$ `&Xp\>T  0 Y Y 0 0<S, S 0Xppͱ @P S$ P#2Q4ЍR <00 Y)Q X& Q   T0pTp 0pW W0 0Y4<0p8 (,W \ ^Z7 SS Z" 0 Y00 00 TpTp 0IpW W00  S S\p\ ؀0@-4MP!!0  P PP@4Ѝ000P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >t!n000㓛#000X    Q,( [: 7{T  1P ؀!\R 0 0 B@0St 0 0@ H0 0S4 4 0 m q(dyd|&t q5d{ q< qj qr q{0$\ (00t S S  S00/Q 0P/0S 0S P// 0R80@-4 :C[R)r0@/ q 80R*@-@0M$ 0Q0 0 !0 ! P0Ѝ/00S/,ip@-,P@0S0S< 04 p,@-@0S,A-pP@0ST 0S` @ aP<0@P`V@,s@-S@P ' dKP {Ѝp<@P {6`P (EPP )AP` #P P(  `P` D  Pd OPP 0SL` P P @0`0@0 q q q q q q q pPp@-M  ⟂P ڔFy @P"` yЍpN0S 0 (q P*yPy q r r qO-@QMM@P;.,@'pP}0` Ftpw p 00p$@ @Q&D0S8 CR0 n 0 ⺂P[0D04@T.4@0@T50@`T$00 0-G p P P    00wP  p$ pp00#~؀Gy@0V  00# l#l000G `#APQލЍ0 4004RP8 <80<RPx00 S 00#<PD tP #x.P@p Y #YL!P@k ~P # vP0'% D00S00 D mأ0 S 0 0 0 `@0x0#O@#000@10 4ׁ@d r r r5 rN rp r r r r r0@-M 0%t 0@S( xP\xx0P @8╍8 P$0$  B@ Ѝ ss s s#@-t0SЍ@-@M ftT0  CR$00S ЍwA-pP@0ST 0S` @2P0 0=00<0p 0;0p0:00(000DЍ pY0X u xlC-`P |p@-`P Q@8Md@`Q2"€ 0)r000% 0S 0L0 3/P 0  ** +"+s  S   "S2006 g8Ѝp,p@-@^P8Q @ 2"p282x@-0p@-tP@0S0S 0DHSTPSD  p# @0p,-08S^6/-'-0 p@-@ 0(  P0R0PS 00Sk ppM-Pp`NM@< Р/p`0| p ` ⹀000 ;PP <czpxNލx  }dyG-xM` @pᜐ壠TP" !0@P 0S PU 0 R=H!H0 bB00S 00" !P@&P0 0S0L0H 3/P H L0RPP T 0$RP0 0   x@ 04/@xЍY Y ZD   +YZ  - } ~ ~ ~O-p@PBM M`/0;P( w0P@0P0iP) Y  &+4  Pg P!14`#?s0S4 0S=xto@ OU01U01Bލ Ѝ oh0P0  &g?XY$0 0I0,zj?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @K 0 8< 4g <0 8 0 4 0 0 8< @4V < 0 8 0Q 40 0D!1G81Q 0(, 0$ 00 0  P刦ԝ@s@Q Q' Q0PUTO 0"0S0S0@0hP P `@@!02s 2 02@, @*UXR A-00MH`LPp l1lR/ fCPh@P( T00儝0 S` 0!?020 20*02p04 pi0Ѝ 0S"$ 0Q00 L03/P Q 0D Q 0 SD S003/ |>-P/0@-2S@ “B\œDL@A.XuOPvOw,S0A- P^^0`` ^ 8^ @T xi` @ @ @B@ @ ppS@ 2AAA0q1P 9ip@V8hB\P08} ^\ 0Sp`82S04@11111111108 o2aqR 2@S22(040TP 2SXT0S   ~+O-cMM00 Q@ ,00#.;Q0P0PcލЍ0` Fwp \6X&PRS000o?00@ ;2, 0 0S 2S 1SP2P/ >0/p 0Ẑᾠ0 0'000000pW!? 0 t᣻ 0dG T F pdP^RUu b 80 ] 800S $ 0X&  0a\ X !( 0?? @MI X !(??$ epP  d?XT D , dh?X T P@d |GUs@-RU0 B@@q`\0\ CŠ#+ Q @ D`04 oЍp ~| ~@-@ T  ^D@ @Pp` ^PPVPU Sp    L"<0"8 0"4 0$< 0$8 0$400 0<<@0-,DO-@|MHp 4 $\  QD}τ$$\ YY  \^8RP PW# 40 QP}_PbV VZYQ\``\`V W0p|ЍRE  0 Z Z 0 0`ͅ^ V ^Z Y `VRU` P(  USQP8H  @08    0 4  D "< ! ", , "S01@ 5 @ D pF W2z\ P  \Y Ƒ Y( [ PQ$\P Q1/ ZS W] fY D0@ S(0, 02o(0HHTpPC 80 Ă2 R020S PP f 00S0 0!40S`1 0U0 <0 1R o 0$  RQ   0ST0`,2 Q HW(0- ~  |GTlO-@|MH0Z00p000 R08,(,0/C R2  XD00P} 0000"UoQP RP"4!0 0S40 00SR 0XSZ T70XZ@7 00/ 0W00* 00(0000$0(0$ W000 40 080400,0(0, S$008B4Z6u?v/0800S , S 0ZH6BT@q? r?`h"s?` 080S000T0S,0Y0 < KdP< GZ50\6o_P 0"H0S PP fe0 8 @ U 0 o?0 R S RQ & 0^|Ѝw/ (0(00$0?01o?0RR<0# 0{,0Y00AQ0P0T"

x P0dL0@>S@ P0-x P0d;0@SP0 0LH S  0/ N0/K/Z[d0Q @10`d! ἐ 09/0P@\Ѝ ,G-` p0P@LHR0418 S ^ ?Y R  `0 X0?Qࠡ࠱000^ 0 G/,>0@-@0M 410810!b0 P0u0L b0 J0PU ! 5/ᶹЍ0, @- G@q@ o@-@ 0]  xu &h@-<@0so(00pp `0Co&j-[-$M?0 0 1p$Ѝ0-4M 00 000P4ЍO--pMMⰤT p " @pt4` `0 p0R0( 0pR00Sp0$ 0R0*pğ $`pC0S 0s 0SMߍ0S @P 0`3吓0S  1vp#(U 06៪{@0(@{{Z_dUdP0k0 #v32Q-AP "AQڕ2"SA0  k2 Bv0 Ÿ S#3RPeR  !0P  k@" v $ Q(0 0SZQ=9 =:ok{1@Q083@{P!5 Q; %#3TP/TA ! d! J/i Mv 1 @Q00&0P SdQ* 5#5; !@\p/  v@0Sdx v@p0 0 pp%n@YA.-[-[-\-[( x-[-[ }-[Q  w -[-[~@ ! Q!0 @@k{H{7{j`0Vڰ0P  uPi@<̰<`aep0 u@ W/u@-k@xg@SRG-@  ]700pP ąP:`X:00X0 uP @-P@`pP0S -S :S S  000`  0 !0P0 ЍU0S T  TP&tp@-@Pmp  `m@mU700@pp@-P 4`wmp@  MmPm@p@-M@ np$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ p@-P R`@0 @ 8n 00S JUP3PE ЍpA-@Pp Ep` j 0W0 xW0X U` 0X P 0 h0@ tЍU  0 P   @-`0tM0F?oP2p @pm mplm@mp X2Smp L0V"4 - }<tЍnX"lpp@-P@@mpPppp@-@0 o ul0 S ! 0PUPUp@^0S   0 0S ^^0S   0 0S ^^A-p@PMU `0S@PE7  0P00ۍXڊ700#S @ Q@BPE@C0 00 pLsn0S j0#S @UX5 =@-M@ H kp8ToۍP   ~p@-d1`0SM LЍp@C@>  <P  0 !   kp0 S 09S 1Ѝp0 S   000 00P0 PS @ \0 9 p@  Ѝp@ p p@-@$`P[Pp0 @ `P0 001 0pp@-SP@`xM  OAj0 0Zkp@) Hkp$  Bkp @P`Dp @ p0 p`$Aj L01p @ 00 p$AWЍp p@-@PqP  j0}1LpP`qpR j0"18pp@-pM0 p @ jpj@pЍO-QMM700ۍЍ   Z  @`V Qj@pP` @-`R00 ЍPp@0ST[@PT  Q*R@00 S   0 0S0 S * \P `\\  00000`0 @@P0   @-@@c ,G-`P/H@ D$:0  100 D qH $R$  080P040>0S0&0 Pp0 P QW  g0L1p@-S@T1S"d1S,tRU6\RUp`bV7\a\\bp1C\\L10CL1SPU\0P11CO\T10CT1SXH\0X11CB\d10Cd1Sh;\0h1x2,P0Cx2xbVt-\tb`2,P0C`27@-@0 PP$ H1 0D181-@80@ CB Ѝ0@ Ѝ0Q@-@    b6iP p 00\ Ѝ@ Q @ ,0 p-Ѝ@ Ѝ CQ@-@  0A  iP p 00 Ѝ@Q 1Su70|[QYP| 01@ 00 pAЍ@a Ѝ 8@-t0M0@Q0$*pO Ѝ ( 0<1/@-@d6'P0S .P 0800L0S S@B' @-p@\M Q t0  p\Ѝ 0@-800@@@ P@-@p 0/ @ Q7@-@  ,A _ B\hp  Ph Ѝ0@ P 11P,|1@ R  |&AQP x`00CS`0 Xq@ P0p ,A Ѝ0@ X0 X Ѝ0 &&p@-PDhp4p@ v @hpn p@h  &p@-@4P  W 0F8 p@, 0> ,p@-P`8!< 8!<=xPp00@Tp 0S ,0 :*,00@@-@T 0S /@@-@Y~0sЍ@ d  0@ Ѝ 0S %/0p@-8@` Z40 :0GP PpP  Pp%pp@-8Q0 0 UX HP  *< 0S 08   Ѝ `@-| R xDH!0 ЍA-@x0P P ЍAs 0  0 ` c 0  ] 0x1PU 0" 0S7HP ЍADT 0S 800 LP P _ Ѝ A- M@`= pl,0PSL`$& 800 - PJ 0Sz PuPUv 0 `8PUN,P  DB ЍA$081 xQ EA$E;080SK $0P    p0S  U8 A ЍA W0 0S V  P0S t`QP  ,t R P 0S kX; 0S 0  4# ЍA Ѝ  3 T  0@-@x P $ LT@/ L0p@-S@P` 08PU $00P  Z <1 0800S>? $0080S  p,u A> p m p@ i@-@@O--M`@0pRPU@T.Ѝ P X  R$ R#W 080 C 1#0   C0800 ?@ hG@X 0 0'|BWUP0|$ 0|x0 A-<1@ `DPPk q`0 ,Up 0 ߊpЍP. P P0 P6 lP@ PTQ IE@7 p(P 0  :0801 P #P @p )@yD!\10B0H1x,h 9@ixC 2Pʞ 0P - @-@  A@t ,cp `1P81 ^,,c0,1ЍPH0/M81 P5 b \ Q/@-@ w 0S@C-q`@ x @P00@ 0S  0 Sx   0@ Ѝ81  0H pPp @P 0@0PEV ( x PP 0S  $0$0> R>  **X  0S @0 S   000x1  @  0SP Lm0 W0 S   0$ 0A-M P0 0E0@!0E:dp}00`+b`pQ^wb07S ^0 S X \O0E 0\!`1  `Px1 ,Mލ % R Pp P0 S   x0  pP 0PPUSUxex  xk dx1p  P  0S 0 Y 0P  A 4HQ@-@  p A@*p07S@Z0 S 0VS0S@ A-`R@p@M P'P U 700 "@ЍAP"R 0S 0 r>XU%  *➻P 0S <0 *:h p  } <0/ &tV>P  *@ЍA@Ѝ O-P@($M`pP  P 00A# $ЍOPx P000 P PPX/RP    0PEPE 00X J S]T 003#XpPs <11<100x1`V+ paPx1`G <11<1kP NP 6P4PUPpP xP 0: 0 0nP00P 0S 0 0`  P XX sp 000 0S 0 0`V<11<1$Ѝ  P XX  Op0 00V0 0 0 :0G VYx181:81 0#Pa R @ [P V @(0Ȁ0 0 0 Y Y 0HȀ0Y 7 X V x x'0P 0S 9PPVP~FP0 xu / 9 @ P ` i&zx } Ep@-@>Pp 2R0P0F(0000> *> 0Cpǒp@-p1PSM"`! %@P T 0p1!V 'S 0S X.PP <@tAtЍpp>0S 0x1@T l1S   @>0S@ `l1S   0 @ OjP 0  @  B.(0$pl1S  I R u@-MP0@) \.P@ Pp`a 0H # ^  @@@P@@@ A00\  L00`B#_pЍ\ @P^ `@@pP@`A 0p@-@Pp0@0D0X0\0PP `kR0 0P `aR000r0p0P PRR00840P PHR08<0pp@-h@`T@@@0St#dPPT00pQQP dh@pO-@RpD@T@P ЍP@`Vt#``T00@OP 0 @QB<84`(``` 0`S_@Q/qA- 81`0SPp@000S= @T@T2 0 S   00S0@0 @@00000pp10  0PppW 0 S   00000@@0aq0PO@Ppq0@-PM@ a00Ѝ00S @TU00 0  0!0 !  @H0  @ 000`^pR000q0C0p@-T`P\@0^0S\*\@\0 0SZ0 5Qk9 <R0p@-M@`_p p P 0p``F\ Ѝ0S *p0 0 0CR00B *S0C00;G-P`p $0@T 0 S0 R  S 4  0pT@PT 8@T 0 S <  0`0Q 400@4@sN@P0S 0S0 @@@-^0x00 Ѝ ^   ;@-0 Ѝ@-@P`p, 0B0 0p"#} ЍbMB@0@-0\0Q@ PUPUR PU PTP4PP@PPS00@"!030@-@Pi`p N]dO@O@-xN@P  _^pO@0 0  0  004  800< l0J^p`pp8@-00  L0S 0 p    Ѝ0M-@,rMp0p0S r 0PRr00q0U0Sl7J 0R Q00 S 4  003/00<00P;|M@M@-@ p !'\p ! \p`@-q@ Z01p Z01@ 2\p@-PM@`   c0 T \p 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MUV0P0\ЍU700@ p`R0 PU B0>000 <0c  ,>  PP> * @-@Tq=@Q/\@-@T=@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0 01 0   N08S0 \00 Ѝ080 00S # p`P `P'0P 0iS.S  `P04S 040:S&t0@-@PDM QP@T 00p@DЍ0U  8P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-000Q/Px1P/$0/@-@M  m  0 ZpЍi~O-YM `F/@HU9X0{IpPpYߍ0pK 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 ⽍PAT1S@\1S`1 ⯍P5\1 S S R@L1SP1 ➍P&L1PC_oSRPU@gP04S 0s0KP8AB@@$P00SLQU IPPdh1 ^P Pd1UP H@ `  0[$0D  H `0 S 9X001H \0Yp X0 PB000S0 15S4 S  CR.T X L@@7S! y r R02 > 0*<1 000S p S 0 S E@@0?H0p 0P0H0}>H0 @u000L0PPP   % Qi @ A-p X`0P M0 @R  RT T 1 # 80@ @ QPUx!@T$00 Ѝ R @X2X-Ȁ 5S   0s0 50A % 1  0  +0 ":+0  9! R500 @-`p}@P@ Ѝ ╛0PXJJp Q,P }PP @-`RpP$M 0S0U00$Ѝ/@P 0 0 0 0  0S dU 6PP, T/00DU 6 O-`@(0p"S0W"SpG` Y  PP u\700 ЍTU YP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R  T0 `T 00T 0T 0000 0    00 PP 0S& T  =0 `P0A\0SP0S  =T PT0P &tP /0 S S /S/P0/S S S/0/O-M q|PPЍO=`P ЍOH@Y@S B  pWHO|PP  8P 0QA00Ѝ=0@S. P( 0S -|@P_H@ `@G0P 0 @ C0 0 @ @ p@-@P cH` 0SP\H$` PP(0S $TH0(0$0p,e P,e PO-@/4M10C`pXPS00 pHU- :`Pp $<P@ ⯙P7 7  '$ !0P`0@T\0@T U0 @6 0H050U, H0|x>0P G0 F@PA t014ЍEP 0 2pA 0S PG01@U  CUH070 0  p$ P! .RH _ 0R77@0U  0pP  H RU H0@1S&{@H000|U P0H0r ,0 00 0 cJ,0S@ ` B{U ,0 01 0 ,0 S J Ux 81D80w40xbt000 0 P$PP00 0 P  p@0  @P 4 UJ 8180w40xbt0p00 0 PP00 0 P  0@H0:0H P0<0UH# 0S /`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 I,0HST  ?h 0A  ap  P 4p@AK0  U RU ,`P 0SU0 pH0 50e x050,0 % 00 0 ,00,Y `$ UtPPeU700 5$'0 5'@p 0 +  0 ~p P H0@40U 0S 4S 04S0:006S 06S090PU. ,0 00 0 H,0HS U H0P SPH0;00H090U ` j`,pPN vC`P 0%Z CEH0Q7;0UlQ P0l1 tP0l1 \P0l1 #P pD0Pkp1tH000}U10H 2w}P0H 2o uP 0H 2g mP hPH| Y H000SH020NU @ 0pP$^ H0 S;70;H0206H0601H0;0,H080'UV 81"8xb0w4t00 0 P000 0 P0P0P@U2 818x04gtr000 0 P00 0 PP00 0 Pp@0  @U =PD 8p PWH0p000 SP0<00 P WH p P  PWHp   XP  DP  0{P  uPyWH^  BkxP ~ ($tp> 00u &j _ v   < V ]   $ 1 D L [ t   R H o  ,/p 00vpP- $ ( H,8   P B% P*WH B $p GpP ((Y (V H$8R  P  B P  PW ,0 00 D0 F,0HS H P$@ /o"B ($P/ᮽP0H (0P 7$ ! (0'0| ($P/ᐽP0H  (0P 7$ ! (0 '0^U H0XX U=XRH020MH0 000G(aH000?H000:H0 005H0 000(07600R 2  *(450S00T0<45@450H0U@ 81 0(@0P@47x0'tP 0SU' H$BvP$U <1 800 ,0 00 0 E,0S 0 'P P0 0 P 0 0H080YH010H010H000H050H050H000H,7+,UH090AK3O0\ U0` 0 Y{AKοOAK OAKҿO,U \0@T$(@# w`P  ,00TE,0S0lPP@ Y`P0:0apP { {{,0{04E,XCPsFP7`Pp =<Ppp"CPp.P`Px (wCP!P`Pz iCPP`Pv [CPFP`P| MCPpQ FCPyJ @CP9|   D2<|?o2= $VX 20Sm YP0, <PPACPP`PqOCPr BP p0S TQ00BPs (BP .BPp 3BPp :BPp BP p 0BP@p 0 BPx 0BP)tw   8 A Z ` v | @ } @@ R ` , <   6 L l ~ @0BPuH \0BPu |A |0#{BPu9 0)tBP|3 nBPwr 06gBPwk 0 `BP| YBP| SBPvU ~PP0P0CB`Pr rt`P  R"  R 0,PS0P , S%00 0$0(00 `0X`0 5P@q@ v d'Y`0P ʎIY\0PY YUAHP70P7H0"800|H080wH07 00qH070lU 5P0X2dX2S$|H000YH070TU _`P 00f`sNHPР EP @PV  / s4P /P$10̀ H040H030H,0$,H020 U: x0 ^pH H000H000H0@00U ,0 00 0 B,0HS$ wU ,0 00 0 B,0HSx aU ,0 00 0 B,0HS K AO-pУ@`Pr8P P `nV81P ЍOjR('RZ0 078 ЍO7 Ѝ O-S@M4 P 0Q  8ltj⬰81 0  0@0Cp0@   p   P@ X 8 $  Ѝ&zx A -G-@`pPU T <PPP@@P  *T?0S DD0 !@D@DYT 0: @/@ A-PQH 1pS`01S`5x1hS`8  >>$>0g47S90>8g<7S:8>@gD7S;@>HgL7S<H>(>A>> 1`P>>1`P>X  &P T0 ST447,`0C47-<7,`0C<7&D7,`0CD7L7,`0CL7O-MLM`$ 0D=PpGgx0 3&70 0 + 0+0 0P70P7 0 0E00 0P:0030 0 5 p K ;(0 0 0 p00 + ;0 P#Z 1H@[0X,<P0047("P @5: ؍LЍD P PA0 D  D 0 0F<DP078t2470x24,0<'哸 R38=@,0D'哸 R-@=0H'87\"L'<7@7D7`"H7L708 p0  +=@0S R R P\R @?<0@ R 0#P0 00 [?op2 000S002p0p@p(0 DDwP 0 0# }D00|DyP P0( & Le P=P7 Z&d hpP% 22C#*, ,0@0S 0 S S0P\S  @0:0p0 jPphqdpPd p(0 !P$0S P $1 P 0S P Ppp{ 0 0# 0 Pn Xl0D00D00 0  0=` 0 S E4* E000X `-\ @ $  .0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HG!U( IGeA-TpW0 %$T`@V0? C.CL0LS @sP khX X| |00 S HH0P 0RS  p@-P @PpE<@-p@-@Pp PPpT Pp@1@-0@ T 0@0T0S0@- eB@ lT0A-p `R0080<10@: ዿPP?W0A U t0  t0 p@0S dp0S <~p? @U4 CJ.P P @$T T0Rt0t 0SoPt0 t0 88dPT0$0x x0R Pg@PP40S 3@ A-`P Pc_п@T ɿT0pS@p@-Q Mz 0 zBT0S0e PUx x0 BPc_`վ@P ὿0 8 1O   Ѝp  l  G-81/00 pP@-L0o 0S S$0@o%/00 p hp@-@Q0 eCRP0_ C|C0`S0 SQ 0X KMp@p0 p@`0 p@` {  0P@-|0| C⯿Qh0i CC P R !P BR #@๞@  (p@-@P M0 ⇿0S R 0b0?oScP 05R 0P0 Ѝp/0P``Q L0000P 0 CC p-\( @'A-0S00@Pd` pW j/0000Pp 0 C*-\( XnP@-<0<.Q(0v CB0000 p @-@QL C-`TM@ P `Zcp) 0 c ````c1pWp0`V& }c @ 0 E@ =cT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0  -3@- P jbp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  pp A-0Pp`@S:0SS 0? C/C  RS* R0 $b`V1S* BP a 0@DpR: Q  ) O-A 0MTP` 0 vu9?@PAHc@|0<1 0S  wp 00~PЀ xP sP nP iP dP _P ZpPp 0S h Cp X61T!R D9p 0<1#3K00&&*pа L0S% %S  p H p P p $  p " pw P0S t0$0Q0p P pe 0Sz0|p \DF upp%` lp~ 0S P qQ ߺZ T  Kp  r"BvKp4MP{ $HPv CPq x>Pl 9Pg 4P /P X00S 0Sa Ta FQp\%P `V%RY pTr0S]   ,pg 08!lpM^pJ0SL   < pQ 08!p<HpPB 1 R6 0S  P4 Ѝ 0Sp pl   [ ` k f ! . : H S \  q v = f p@-P@pp p@sRRA-P`@@pL0s  S$0 U@ p@@@dW0S R H R U p Q p@-P0U@S 00p @>P@Ʒ@T:p/ &@-P`1pSMAT  p@xЍ `PЍ@!R 00 0 0 p@ @aV 0 !p@{`P fp 0S |00#40  L< SP 5,0 %   , /A-PP 0S @0p 0S @@s00 S U   ^ @ .S0.S[0_S-S```&00  @RG"0T0 0D0&t @- @0P P)T00Q    PDP `00CS`0p S00 P0S X0X /XI&p@-h1@SPgPPE @p (0.SSPP XP H P 4P 0  .PP p@-@P'Uh 0 gH0 bH0 x]H0  hXH0\/T,L)D& <#@4 , $      #H0  H0  H0 H0 H0 H Ip@xH DP    % , 3 9 A H P W b n t ~ & 0(HLǒ -\ \` Q^ ,\ ,@-QMM@pP.Yp  0B BVGQލЍA> 0!>0 0B IGp`0SPE@Ep 0S:0@0D O--,Md`pP. e|`  @P2 0S  P@ eP@,P$ X]P$0X21믻00,Ѝ P,P, R ӶP,PE0S h R* 01돻0 4$ R, R 屶P 4$ R R ,Ph!@P !!!  P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  Pغ70 ֹ.0 I@0 0IU:D Xƺ0 0 `TT  DSPO-Pp0` 2" Y*Q@ U V700 Ѝ$@@P`Fp  00U V 00  P     @3 \Do   ' T/T$T\T0 U V@@U V\$0@00@@`FPpU V @`Fp~&t C-RM MPLp`Hp< @:pF gFpx V=p \:4 UFpTN    0 Ip PB IaP I/    Rލ Ѝ   20ιV00t2 0@I p D @`p1P $Fp @T*pP0P 0S4 `@T*T  Ep @ p{ P @Epo @     @  G EpW @ %   FR S.0I/PC I/Ep= 0S @00SP%<Ep-200) !    ( * - 0A- @pTPM ^ЍR` R 00P0S 0 -0 0t0#0Q0 J$ V0B  00 0DD OO-4MX@p 0S\`d` (0S<0 `p40 4ЍO 0  ,   xp0,0 ,0SPFP ,@up 000 ),.4ЍP V0 00 0U0  ó 0,p_p0X0 0 `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  08,P h j p@-P@`P 0S P$`(0Sp,e P,e P  0 <0@-MMP+ p P0@ۍЍ0;0 C@P +P @- PΠ Rط00\L  ^@-Q00P`PV0 V=`V xЍp@@T   ᫶0x@ `DPЍp`Vx1@P 0>0S *ₔP PU@CP PRP{`x/0P@-404 >Q 0 9 C/C @g  =A-` (MY00>0@SP  0'0x B0epp 0t0 0 01 0 0S0S|0@0|0 0  X40Qx0 xDPT (Ѝ0 8 0>0S 0xPT IA-`lVPPFPPp2X@p`Eh8,P hpl"h20 ۵V0  l20l2@-`@MpP! w (s (X( 8p;PU@ T700@Ѝ ⣵i///p@-$aMY@U 0]  n*PPЍp 3"Qgp 000)00/;p^pv0000@ 0!;pl h 00 " 0;p<] :p 3Q Vp@-QUp@p 9p,0h1p@k,@->`GMV 30P0Gߍ@PF/ ߴ9  0cl0 p 1`0 DF?;P> *0 F?; ii@-@MoP4@ $)P P@Ѝ Q@0@-< Cⲳ0SSP`/// $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  o   P:p 0 00S p,Ѝ0(i8p@-@MP K ` F ̠  (P:PЍpi:O-PQMM@3@ CET0S(3 CCpW 3  CC@H`"0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0| 0h00x0P00`T0 0FT0T(@)@@F³@  徱 T0R  B  @ Y? H1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP ͳUPPEPP@ D$r !8p`ݍЍ  =  ⲳYI @   C-`p"0M` 0$`  0=,pP @T*Ѝ`)PPA   0%,pq0 S *@ ``T*x0V*a00*T00V:0 (P|P@K (F }Y 0@P @-@P`DM p@    j T0 U134  R2$ (@0 DЍU@ii@-l@QM  ⺲00p l2 0"h28Ѝ@-]MM`@FP#i7p PP VR ܳ000S0S S SS wR0S H`pVPS CQRS 0  Vxp@P V$0 Bp 0S$H` M Ӟ h8p 5 $ L 880Su S S00,0S  R000@0S  R00@ H @ 0 H⢞150H \0\8p\U0S Q01S lOQc0 0 000 0 0pURZ1S SN F F]ލЍRIxN@P= d@2 3P0 0- H)@8TY$0S! HM PPN0 $0~Qi@i $@-40 000 0*Ѝ <2S/2S00/@-@@ϲV002@-S0@0 @@V0002S 婏/ lA-PM`p (P_P'@P. 0LL`0"6p0 ,!=6pP0Sp 7p PU0S p 6(@! (⮝( l7p | Pe7p 7/PP Z7p 3&P Ѝ@ r {@Bq BlBp@BfO-@p`0$M00PU  50S;P  0P0S P弱 00SU 1 !  N0P00 0P0 PPP0PU:000y $Ѝ@-  6 ЍBgp@-0M2S`P@x (ذVP@0 \(600ލp@  B-$M^ * ! 4$Ѝ@-@+5 '@'@-@pp {6p` B~R0@-00@ ^ 4s# R0p0P0p@-A^ TP00p``0@D^@"000txœ\p@Tp0,QRO-M@@0%0`1Q V00ЍP0p Q :8Q@SH  넂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C *&P 0 B0 ͯ 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S00 Ѝ@-@\0S \0\0@-@`q0`40`0@-@08$2@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@< p@-`PK@"%Pp00,000SA/00/0KpcScO-@GM`АLp Gߍ0RS*R?  0 000KC$PP d0S  FRV ( Q  R T(Qh 0 00> 0200BS *Ȯ0 360 RS90 T00K4 pB' `$pQ@ DPV VdP h00Q 20000$0@00$Q DQV0S <0S 0GS60000<0@0V0GS 800006 S0@0 0Fq2!31 0 a %R  GR0+  %A CL %0 @V{ 8    GRm2   0@08 R  GR_3   000GSU 700 0 0t2@,0 x" R 07 ,04'R SM3 F0Q4%0@0iSV (1S 0 G0S=00(  (100@0S W0 2S 0 GS<0 0 " έ 20@V0<1 0 Z00 GR P0@  2S P Q0 GSQ0Y0 0 2 0000Y00 @  9@V 00  ^00GSt0`0`@h 6S 0pGS^00 &A o 60@uV1=(, "r  P V: ART~ ,00)S P R:(, "r   PV: ARTZ  ,0  00D0C0W0 0GSJ900000@0C0D 4S Y 0 GS8M00 $A  40@B?S6A B?S6u 00PD0 KS:KUKe 0 S0P0"1R 0G R 0   լ @B 04 #S ] cSc5 7@-P\ R&@P\0S x0x08  Ѝ0P @ 00p&n(  @-PR1 R`0@ 0p\ 0C R1 00 R0  06 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000000 00p0 00vp0 00 ?C-@PTM "P@, 000`0001iH00 P00 x0`  (#0(10: P  P( # 8@  ' 0ta P( ``(1 (1  0(t!p«0 +"70 (P 0K z>``v` P( `"(1* (> >Qߍ 0*+    0@-p M$M0i0PS` H1!pp/p@p0S i mp ۍ$Ѝi@ ,0 IPp  a<1Q50 00pP$ P(A < &$ $ @- 0080@P PU@ 0S@  `P@Ѝp 00O-IMPpAPHLL `PR @P0IߍO#"0,06"600 0=400` 0 "p00,0 PS2 V30$a2@0 0 !,0TJ:0 ` PP =:U@PIߍO@3:0 P '8V`` 0\`0T:0 8`%:0 P   @  J 'G-@pPQP,tb,`x2S#PU`,@ ,x7P`7, Q 0S ,9$7 P,`0 X x pRG-F00!`p@0PT:7p T  X ⢑00U *("0 "pЍ0R0   @90 4f7p 9  ]7p p@-RMM000PS`B S@ 00 0pۍЍpd p p `F0DU9, "7p V @- 81SsQ S0 00 0}PЍ 0SDPD3O-04MS@ h@@ `_0P o0 00 0 VpP |3 00 y0 KpPX3 0 0S0@0go00T0w @P0p 00 0 0`Pg 0 $ ( aX_pPx 0$,0(,8 P@p W0!Q*5"0 0P 0$00S0  $ %0 pg7 ps(00 , $t0(,8 EP@0Sh0` 0h0 d 0304Ѝ 00 !0 P~ @z Xy0$00S,0 pP@,0$S S S0t0Q4 1S 2S0000s(0 $X(U,8R P@ 0 O-P0M040@`0 `2''`pp'`W9 pW6l0S,0S`,0tr0v x2S`,080w0v 847S`,0\r0v `"Rtr0,p80x2 Sp0刳0g47S 7 0\ npߍ0(000 `2(p(`  `(7 0 Sp (` 0 Ip 00 `2,rp 7 0 6p,7 0\ *p'0z0,404l0? 40pl'0k@0!04,0- 40p]`]`d`k,0 !P !304ǜ R00 `"`P& 00 100,0G0 ` 0 X00, }R0SmP 0H ` `  00,p7S  ,0 !P !0 `"QP 00@ 0  0p,`x  @ 'p@-PUp@0L0pp@- P# M;p 0` 0 ` 0@-p+@ Ѝp ` 0,p )X` 0,p  00D0 U100,p@-p@`P<1/(080000'0S  0R  dp`L Ѝ@6@ 001pA@ Ѝ@ Ѝ 9 O-`@p 0SP$H` 000 0 0 `00`0! Р;0 `  $F6 00003H0<1y H ЍO~<0 $(6뜳 000H@0Sp3H000s$80406 HkS 0z0008 R#:kg{{'{z40S' zkg{{'{ z0زS+d0S( $0P$h0!5 00&R::kg{{'{*zdE8 S zkg{{'{* z07$5 00H0S0ST h Q 0R<0S 0S11H000s8040 P14 P18 Pp10 #\00@0S0i ,0.0 0p 0h` . P0 /0S00H Y P 0dh0 ЍO Ѝ ?? D c n h Ž – ± P  s y8 Í û À Çp@-@P9T  (00@x1S0pS|q |%*0|2p *02022p R Rp0A-p@`0P S pH pph0 00 00`ppd0h0  I}00 0$0 F3   AA p@-P@UM R 0 Ѝp@0H8003  l0 R,  0i0 P% 0S" <0S 0 $ ``4  | 0 @<0 mЍp0 Ѝp@p O-R@`pP\M$P X0 #3P 0 RT0h00 p` hPP. aL0S0 0@S@0#/L0} ]{?I00P X0 "2P 0 Rzgjzzz{T0Td0S  $ P $[ <Y y$ 420,2 0010,00000<00@0,0D00<$P(P Q48`LPPPTPH0(pW TpP 0 0DPPF  D0 0`1v`00s0 10 E00(z@0` 0`P00 0\ 0o`Jv 04S 1S0<10 p  +X @0 \Ѝ7S Dz p v ēCDC  `@-`@pP`w0 h0X $7S R @`0U0 , ` =3 0 Ѝ@4   H  p /p@-P@ $ 0 00L0p@ I p@-PUp00CSp@0@ 4$3  (F000L0p@ i (A-`P@ p_ Y800 a B&000@ 0<0L00A8 #  ^A-P`@ i0h 0R0P5  0<1HAp` P!0<1( AP     Pl l 0 ]B@š 0d 0 P $ZA ſ  h00h0 C-p@ PR0  R $ RP508̀ `G2  i@0S ;PP % P0 Y lH<18!4?788'00i Ѝ@ 0 8 Lp0@-@4M<14(0,P 0S 0 0P00  000 0 08 4Ѝ00 000 x1  +4Ѝ0@_ S0p@-8 `R@   P  8P 9Hp@#Ppp@ Ÿp@-@P (h00h00L0p@3 m +G-px0Ѐ5 @Pm F8 8C0|2sp|ЍG@ |4*pdgA @0 2s 3p p ЍG`@F'L`  ``H  ЍGwl  ЍGu80  $ 0S 0 00 0\ P  S$`00@00S( `P  fP1  ၡ00h0d`0h0 0 S000s  i_`P pq 00 Q R @ # 0 00$0zQC40 040800 080m0 Sl0&h@Ti 0Sf 0p0x0Ѐ60L  !Px ЍG`0^l0 $0  <[0S> 0S; 0 S<$0  0 <`0  @ R 0P ЍG 0PS 0 PD0A  0 00 0SЍGЍ Ʀ ƲcSc `0p@-800@P  Hh00h00L0p@$` Fmi + H\/ R/ . d0S  0R/S>0/ LO-0M0 0PS000p ,8 0`ST 0@R 0 ЍO> R*Q~P7S Ǚ ǙY  S/  @ !  Q 0 S:500 0zp00 00  ЍO Y 0 0Cs0&0S0 S0L0 \p    0P 0 0 E0SY0@60@ 600 09p0 0  `P | 0 S 0<1Hi@06P JP0S0 0<S<0P0Ѝ0    0nP 0Y6S700S0 l00 0P R`532Y@0KSK?34%05+0 WY0S0 L + P   Q [ iH0 l4 @0S Y0 % 2)  Br  Br0  3 $ 0P 0   0 Y 5 0  p3@S R@00Y$00D0<0<0<1(?0< P0 P5 0000  000 0P00S* P *   pʞ @ 0uЍO8600 0<P0 (0S * P  p回`<1 000H 0 000 `0`0W\0S   0X!)YP 0 8 R @1ЍOPY 0 cY 0 40Sg0 00 P0PY0 )- x ЍO. j ǔ ǫ  p  > L Q h ȃ ȋ n`T ț ȭ Ⱦ p@-@l PT- 0 Lp@`D N\P d  p@s`$ 'O-,M@PpP Q0 ,ЍOPE -UM0@SI 0SF UC:aV?0U<:0 "R3 U0:!DR-   FPp%  R P  0  Q!   p*  &P -  ,,Ѝ J 0  Bm H Ɂp@-` MQP\@M  0000x )p 0S T A @f ۍЍp 0``V \@T ɘ$ ɞG-`Pp 0x1@TT 0S R T0 S> R*&{P  0 @ A- p`@PpAPU, 0 HA0S 0A\0S 0A G-0 ;M0MNp`p Dd`8奜0 P480EL80H8$0ED80@X@8<8 ` m@W0|` 0E 0G!p$ݍ0Ѝ`    7@-PX0A @P 0S)0>8 Q0'Q'+ " B r R "'   00 Ѝ0@z}:s zgjzzP;R, F@ 0 Ѝ0Dz 'p@-@P0( Uph0Spp@O-P`@T Q Pd0S r 0 *0d0G3P0BQ 0S 0P +  0800 |# 08!=0 80 $ 0R0hd`h08 R0 , 00C0 0800<0  P`00 0 00S $0 pWp1s00 2   0P C @Rœ 00pwpWH0H0Ht0p H l c0P s/0 @Rp@-00p0`PQPE@ `B @d@$,b pP/1S P///P/P/Q 0\R/ 0\/P/ P/00S/x1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScG-` x1PM@T+ 0S pW$ P ❖ iPP@h0 d0S4 xt↖d0 0S hPPPЍ|0d 0|0 009d0 003090 1P p8PP m  | PP$0 00 PP 00d8dXxz PPq |0x 0|0h0d|00|0X]U ;0S P 8 P  NU` P < 0$Q S "  Q  ᢖPp h  5< 0   `pP< t0<0t0}0 0x0 80sdxQY Xi nP ጖  U ]pP {АY $0% h  5< 0 r  0<0|  * _ 7p@-PP1 yCL D=p`p01S l0S h0S d0S  (`0 @T 0Q0 PSP 0vU d0S0h0d0p@ ˃ ˝ ːp@-@T PP@0*p ˿G-Pp`P@Ѝ0E @P00 4 @P 0P000000 000|(J0  9%$0 P pEpk(0 pؙ0S <0 EP  0@R 0 0000@@ @-@T PQ08 :* SP h0S dP H` Ѝ$`  Pdp (0Q,0Q  G `P 800000( ,0CPd0S  0h dW $0Q 0h0d`u0SHB| ' H0S/0S/   O-MPH0<`R8 0@xP'00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs @UЍO4 @PЍO p    @@0 0S'!0 $ S c 0S/G-P@M T 0p `x00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p,T Pn 00p0000 S0 @00:S 0S @\S000@:S @-\0&t0@-P:P@A0 P\:R \:\P@\\ @R0/&n0 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO0E`VK `0P0E@ PP 00pCލ Ѝ@@ ;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S C p PP ;000P p 0S#0 0 0Tp8`@Z + 80P R 00SF n@ j@ 0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D h 0SQ Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0> P0@DJ`F  0S { ٖ 002  @ ` P D,0}  },0@PE P0S X$ D0A00T* PP 0P:SVr-\0&n0 ̞@-0  0 Ѝ@-(@ P R0 0-\00C-BMM00pS 0S`! \0S)  R&    RA^0C R[ Sw0Pv Ps @ iR Q0"P ލЍ 8w0P P 0@PNR0 PP U L"P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  -\0&t ̡p@-@PDp@NG-`= @P@ d Pi˕ 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY~0TS @ ASBC\ 00bC|^\ 00:0 0 0Pd 0:SS0AR0@A P Pd p ̋ xA-p= `P@ d4 PPd0`FL 00@0S @Ad Pn Pd0 :RRAS@A ~ P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P ^!P-\H ̤G-A0SRPp`ʏ PPU00Ѝ P00CS0Q Pp0 Y( P , P P00SW  R00S 047σ,P R   S@T PR   R -\H-_p ̱-\P@0@-0S |P dP-\H-cp@-@[P08G-\Hp@-P@PPpXPPp-\H@-@FP Q 0@87ST -\H-cpp@-@ PS P@p p@-@P * 0@87ST -\H-cpO-pWP`@P @ ЍZ K P  PT  RT@ Z //////O-8r@00SRP`  45PU00 Ѝ  P00CS0P Pp0 0 S hZ ȎPD 8 P P00SX00 S P xP00S  P P xP \P DP ,P$ :匃P-c ̴ ̷0@-4@0P UP-c ̹X0@-0S ;@@0@00DJP0DЍP-c-c@-@`0P0`Sp 0`/P PP Ѝ-c@-@P08D-cp@-P@PPpNPp-cA- P@`pPЍ0 `(0P84SUP @-c@-$ 000B;P Ѝ-cA- P@`pmPЍ0 `(0P84SUP @-c@-$ 000B;P Ѝ-c@    /0A-P<<`0@ X<0p0D0& SQ 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z# 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `p-gA-@`Ppˋ sŋ mΉ gṋA `0@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-p`TM00`< @P xp TT0 p@ F<0@发40 4/(00S 0TЍ&n4 -gA-`@ 0s P00p0pGWp0PP @P @pT 0@@PP @-gp@-@P?@0 ?@0R:@@pP p-g@-aM$0Sj Q1@ 4/1@A C"+4/%0AS&0  S00PpDU7/'0pS(0  S)0S*0  S007/ ,p0# Dn7/ p0# Du7/ 0p0# D7/ 4p0# D7/ p0 7/ `w0 6/0 P5/Ѝ-g&n4 X :O-Q<08@0(00iPR @pⲋ`,@48pT:(㙄)<0( T:(㙄)p@0(pT : Ѝ  唋030IP@`(4冋8p00 D3#00@ `@4v<08p4  b "0 0, `0@80@`00 4/0SD0 ̿-g  $&n4 Xp@-@0`,0DPSp1S@-g0D0P/-gG-0DAMHPMUR`000PP, p0,0t0@00`o`SLXp Xx +po A>004@ptpG0SkX$0`S D0ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00\\弊e`D| <峊0,`\PPDpAލЍ pP P 00PpWA C9RQ  0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0<h0 :/1, ! mP 0H0-g&n4 Y >p β μ-h0-hH j y0H0S/-g0P /-g@-DAP|0`SDM)0S&0S S f0P 0P@ DЍ pW*P 0 000<0pp@ 充`0pΎX0 7/0S <0SP 0 P0DЍ@-g-hH&n4 G-\qPL @0P12C001b5R 0 0&0S  fh0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rj00Ή0S0PS [&0S,P P,@GJ-g-!\  0L0#0-g@-p0M  L0@31 ^AP 0C! 0Ѝl0-gĄ @-L 0 0@11D ^Q       -gA-@b@0Mu L0 @2# p PW%cP_  Bc p\  ZἌ$0 HD@,X#1010 2R01   000 S" V00 S ⲉ ЍA X 1(410~X0威42 kSV Q`ЍQ0S ЍA`\c  Z_ l⇈@lp%0S Z Md0@0-g A-Q`0MS 00S` @P9 0s$@Ѝ "pW   @90p0|0S0S @Ppp00FV@@P 00T l@=p`W 0S:S* 0 0p0pp-g-hHO-`HqL1P0SU#,@T,P@P5 &0B1 `P 1<h L0C R P!050%Pd @T: ᾈ #0 p[L0CY1T*Q@@-gG-qT0So:\0`S&; 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  V0B408@S 1:X 0@D8C 003 c0?o< @@D@  /PP  MPOPP 0 @ S :    b01"!00000P00-0P-g&n4A-p0@@ `P PP0`0P P@ls%Q *0S  -g$00S:@-@@R-g@-PP` U(0SP@P )@T \0@T0 4/W 00'0S 0 $( @Ѝp-g&n4 X βO-$MPpPeE00U0SXc )Z@ D3@嵋<3 4/%W(0Sp0eWD@XU0XZ5 0PPW00 # 30+*[@C@dQS: BL{P5 KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@W1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   d%Q   ؉0@P0'0S 0 H0p$Ѝ*0S  -g&n4 X-h0 β@-M@pP0aE(0SWTP )@T; 0@ʊ0 4/:0#880 ႅP0Uu@P  ㈉'0S 0 x( @qЍr@P %Q|0S0S P걊 00-g&n4 X βO-@QpL$M(0S@ P zP'0S A p>$ЍW %0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*lD4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp <`0<0 0  pP LPP% 0   D່  :%T#2QZ J*0T00S  DࣈULP )PU @0@徉<0 ;4//PPՉ 005-g β&n4-h0 X@-L0@'0S 0 00 0j T Ѝ@Ѝ-g βM////&nD/&nD0p00/&t0p00/&t0p00 /&t0p00/&t0p00/&t0p00/&t0p00/&t0p00 /&t0p00 /&t0p00@/&t0p00/&t0p00 /&tQ P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/& p0 0CSp0 S P0 /p@-P@,`Pp@ Tp <0A S010// <0P/!R/P/P/Qa/P/0p000 /&tP/ 0S S//0R/00p00/&p0p00/&l7@-@P@@P 04PSPE0  Ѝ0 &hPQ 0S///&n|03P 0 / 0 ACP 0ABs0P r CoSPS//O-MX@ @ЍO@ SQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!`PE`0r>T 04SJ:`\H㌱  ᾆT  Q\ ( Q   8s ⫁ Z P   T0`[?oT20S@ ه@ @0R @T`0-@0S S @0V D X 1D@V X* 00`00P 4  00S00/"H0&h 00S00/!d&{ ///@-@H)@P (  v@fy&h -@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P @p@-0P `| @P  \*. Q  Rp R  (  p 0 B &t-h\qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00cu Ѝ0S/1>3 !/0S 000/-h\0S*p@- @P+N P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!Ll0`A-PRp `@{P 0!000A-@P`p쁟0 SV1 V00W W0Sc0 P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (L0PA , (0 ,P&&p&lA-`P P0PS\ ]\ xp@BX T 0| P~Pp&n0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00-h\ 8 0 s000/`Q'Q!//&t0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0n0 "0 00 0W-h\p@-P@,`P@tp Tp Q 010// ,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`&&p&lO-P 0R@pM @~ P&  $~ P 000Ѝ 0@  KPP ЍO 0 PS@  0 00<00S*^Q0R08 ]R00-R ((g Q* ]R -RS\T0]Sh-R0 S^:0S006000S80S 00000`d0xS ,ZGV ,0Sl40Si$0Sf<0Sc(0pw_  0(`c0 @`F p@ ዁Uj 00C0e-R [RS :R =R| 0S: R 2S0S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``G0 s0I~P   0y S0<R$ JP    wP  $0  0$ 峠S0hS0`0`0-S]S0`S0`0= 0 S:0`S0`00S0 -R[ QX]QU -Z00  YJ 0S- Y0`S 0`00S0<Y00 Z0S  Z4 0IP / {y400!0ⱐᲠ40  =P0S 00100  0P  +P{ U [ 0]SS0<Z*0 P80 P <0 S P p`v`00勰P00 0  EB#ЍORZ =RW ]RTR :R ]R007 P W&-h\&t&p&lp@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&t&p&lA-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xIPu 844U\ 0CUUt0SU 0`B t  | 0D OU &83U N 0  , 0000h30>@0S* *Q2  0  B  BI   B0  B=Ѝ 8 0S 0S 00t200}PT\QR {RO00r0PS;* ,R8 Q 6 2000/ ]U0 R  !   p0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \h V 1L  0 S *R \R )R003 0S00000+-h\)>{^ ]&t@-0@``P?Q $0As R % S 0 ^Q [Q \Q 0S Ѝ{Q |Q?20V:0S00500 @0` V1@`(P G0 S*0)S  ) V 1L  40 Sf:0S00p4000 S**@?PQ{PR ,$  "!,Q 0S 00300\0 0S 00300?P  *P 0 B5  B   B0)  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0@20z`o ksi0V:0aS0`000<Q >Q q`x+P {N &   B 0  B  Ba  B5 "X A, k0 `S0* ,R-  0000< V0 R   0 S*}Q00@ R 0}Q 5000S 00 -h\&t^ ]0S G- `M pQpG xpL:@P 6W: ЍPEPP P $PPxP @|P 0uPP6    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0EP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 f  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S* P8P@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U! R0>P P PS 00 00H0@0 @000 0 R00d000oF 80S@ 0Q10CRZ/UUT(kDj-h\Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0|P`&&p&l0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@&&p&lO--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0 >c0D0H0 00 P0 0 B>c pr9 pRd[3 A T0-  WP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(&t O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0_0, 0(0 000@$002   0 X @ Q  0 R  R  PZ$P  (    R    ``S  R  Ug h V pt p r _U RQ v   _V R up  r   _U R w v  _V RQ ppX u0] v  r    _U_V QO  X 0FP|u  p $ V    upv  w( ppu  v X pX wX0wq uc v _VX 3"  Q$,ZS (  `X S 0P&v u _PU PRPU00000S 0R0 4Ѝw`Vw_SwPu4&tO-pP`M80U:Ѝ0!>3S S8 S6>S1 0800@ 0 YS  D>31># R 0800@ 0 Y_  DS S- S* S( @` PS 0e800@ 0 \Y  DSU S S 0>#0FϠ0@P0  @P0  0P P 0/VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0 >c0D0H0 00 P0 0 B>c pr9 pRd[3 A T0-  *SP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(&t O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  OP ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E0  ?oR20SpG pGP x0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ0@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ0@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0/PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0 >c0D0H0 00 P0 0 B>c pr9 pRd[3 A T0-  ALP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(&t O--lM%PQ0p @%Qk pph        Q 0!RS. 0 YK,Q 4^ 8[ <``F0 0`Z01S` 0s vQBo \R 0C1!S` `0Ch0 0Q[0 000,@4H80<@ Y PP  0 TX\ L0` m Vd 00 S`FY1`0 0 0`,UP XD0S 0 0D0,E`PD00D0 0R < 0JS : 'KP Z Z `p2`XD0SZ 4P ,0@P4 pi,0@ 0S%00D ;0$0 0D0,PP5DQ/*0 F00,`PD% 0 00,P0HP 0000 0D0,H0SPHDhX 8 D0`F0C X?4@0 ` ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y&,Q~ 4^e 8[b <``F0 0`Z"01S` 0s vQBo \R 0C1!S` `0g0eE& 0Q10 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S7 0 0D0,`PD00D0 [ ` 0R< 0JS:  JP Z`XD0Se 4P,0@P4  p4P *HP &lЍ,0@ 0S%00D ;0$0 0D0,hP5DQ/*0 F00,'`PD% 0 00,$P0HP 0000 0D0,H0SPHD_X 8 D0`F0C X?4@0 ` ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^r 80S 0n <``F0$0`Z!01S`$0s vQBo \R 0C1!S` `0f0 $0Q0 000,@4H80<@PP 0T X \ L0`jV 00S`FY1*`0 0 0`,;P XD0Sf 0 0D0,+`PD00D0 0 S` 0P< JP:$0 HP $0Z`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$0 0D0,8P5DV/0 F00,`PD% 0 00,P0HP 0000 0D0,H0StPHxDjX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPpps pqpo-Ѝ///@- // //0p@-8P00@S PpRaP p-hh7@-4P@0S TP Ѝ0P -hh@-@P 0S d@P/m[P0 0 0/ /0 0 0 0 0/////0P P@- B / -ih P P/ /0 S/ 2#0/pO-,MPpT`@`pS0PX$*$0S$00f 0Z0000\0 0 0 R0030#$όZQ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR#  0 B 00Y00S  00C 0S000f 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SC0 S H$0 0CR0%2 L 1P1000 S 0!03 BS t0 S 0 0N $ @ P $0S$0C[ 0SV 0 0,Ѝ 0R3Z0A[\00S SB @PTP=: 0: ( $ 00d$Q0@-M@(,4`0  P"U `0`?#`o0S/" .o^,AU-00ĵЍpFW`&-M{ { xЍLQ0@-M@(,0  P"U` `0`?#`o0S/" .o^,ASU-00ĵЍpFW`&0O-M@0p`W PV P'Z P2Y PyX PV P:$  TW Pr  T  TV1  S SZ  S SY;X% h ST 4SЍZY!X3  S ,S  S <SgЍ S $SXVZ  PЍOG     t \ ,     t L 4O-@Q0M0R0`0P|$0x 0 pᐳP R nRk a BR  $  , ucP Q DocPL Ѝ3 00dcP~Y U000T0003 0$0QcPNY U070T070H ?cPY} U000T000 P-cPY U000T000YW U080T080 oR 0cPT000U000v ~0 XbP 0 4bP 0 `bPjYL U080T080U0 tbPz 0 bP 0 |bPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t bPYv Y0 hbP 0 xbP  p H x,P0 A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 fp@ fp@  op@@@df0 PffPf0 P[fP`Ѝf00@O-1M M(@PDpPp"$ `"4\"(0 Up (-pp^c @D;@h@ 0 0Sr pءp 100 0`00p@, ` )@-0)p t0)0 PP .0S Rf001ݍ Ѝf0S 0F\ R0 Pp @0`!@DD4 [@ 0 0 0V   0, 0p,R 4M1ݍ ЍMpHtF\Ltg0@-P@M 0  PHp Jp@ P E Ѝ00 0Ѝ0@A-@@0s/ PP0P0 !p` ``0`0eppX`p e``0`0e 004~p@-@PCM1 /VP3 $SpPA ` F@e000]t1 @ 2{P@0F0 {@FZ0S VS00 SCލpx@@0S{e@`00P0@  P@1:e?00@e00@|\\p@-QMP4@SMZ TF /UPC QP0s, `P!mQaP0 ` pO @0 @[pqF @ Yp> ۍЍp+0si/0p0 +qP e@0P0@ q P@1: e?00@p 04e0#S5p@ e00e@e@{{|h{H(@%z@-sP`O-$(pX,.R`P@+Wu00Sb [0 0IQ:K%" 2Z$> * 4"0x"3S20*sW00Sa [0 0yI Q :;! "B@T#.PQ$_At00{ Qp w{_ \I Q :;%" Z# * [0 0DIQ:u' 00{S' w{P c 0/IQ: :%" B@T#PQ$_A[0 0I Q :Ky'Pw{ 0IQy: )JP 0R0o2 T$> * Xw{U H Q ]:5# JP X0R0S2" R$>01"_Aj0S20YD""""""""""""""p@-@M@ P, ` 0 ueQS    00R  V!#ό00NY [ȏJ0 y YX$Ѝ 0s <$Ѝ `p P040  .S R 0S  00000S3Q, 3 R. 3QY 3R? \P08 P00 `sSp PQ1  ^P 0S00S Q ]P0.S0000S0rpf~Q ]P l0S08]P r p*}Q ]PRq䁟pp!Q ]Pp1\@0sS: qp }]P pQ 0S 0P0 DQP]]P. PQ0.R  RQ PPf^x]P PQAppp!~i]P pQs00     ama.m.pmp.m.< T ld(A-P@U 0U0PUP!A`FQPFq ``HP 0!Eq1pP 02P''O-0PMhP X8 @4PP0XPhPTP\PlPpPtPxP|Pt x`pl, (` <0+{  +夛 P pPS![Q00<0S 0 S 0$>S 0 S1h! R 0SL[B 0407*Q !POT d!$ *0C 3S00 F< {{P 01C /AFPV$ 0P  [ `0% [ P$0SP (~Ѝ00Z`F* 0C!< R Q!h! R@, Qp0(0<lx0t|`t0p,0x0lp| (0G H9`00W1<PSQ_ }Q( ^, S*P008$ 0P 1<`@(Q( !hQ0Wp0(0<lt x0|@t p, x lp0|@( P 8$  L A!h! R"0, ST:p0(0<lt x0|`t0p,0x0lp| (0 00W\P<Q`6 LS ,0\0F <Q0A 0 =S@00;@0\00@DX h0(00(0000,00,0  F 04P S F"x  SQF#0 SF Q\0s F&F 0 R0* ^*{q0s {#0 @0D 00 h$% 0S 000000(00(0,00,0(00(0$ R0\SQ : P# 01 ?"x2{$00$0w 00 0s000o0S <\ H NR LX \ @D0hX0 So{{AP{$hI` &0P 0 v> 0d0?`000T0?P00<0?800D0?@00L0?H0?X00\ 0 00# L0P dS 0 {{ {{{{{{&{0{00(0S  R $ R "R !:6Ÿ$4&60 $ 0Ϡ! >0T"!!!0C 82 Q02@.3H0/#0Ϡ R  " RD#L .@0L  ?< H D800 0#!/":N6@ 4$&60.$ 0x.>Â!!!0C@ \0RDL,"΃0,ώ #1 HL  LH @00SD  %0 000yX00|$0S"xr$0S"xi0$0f lL\q  h4@""""l'%.Q\(\)0 4080DP @[:$(\0V<Q0HP0 =SK%0h00H @D0c0XD0@#:6D 0 0@ . 0Ϡ.>! 0!!!0C 0" !.\ !!DDQL @T?#"  ?00 #1?B! H  HD0 0S@L 0Q #0 10DP :Q00 <S$0h00 0Dc0@WD0@#:|6D 0 0@". 0Ϡ.>! 0!!!0C 0" !.\ !!DQL @?#"  ?00 #1?B! H  HD0 @S0L  R0004 o0  0C0  CQ} $0 h00$%Y 0d^   Q k   @D Q D  D D  RZ`0@0dPT07  P0N  R000 00SBPT8< !F !0 F!0 !0S(0S& 85<0P : c0 @DV00D0@|#:6 D0% 00@. 0Ϡ.>! 0!!!0C 2^!>0D0.LS@/2"́ ?0 0 #1?B! H " H D0 @0SL 0^ #0F000$02t rt p p 0  SQ  0 & F% F SQ#|!F SQF# &m$0SD0(0@000<P } =RxH0L^LX\ q@0h@0D0D0N 000$0H0$0E Q\#SV ^ S  Q    RGP0 T&%0dQ(00 3(!:60 0 $Ϡ0! >(0!!!0C Q?$ $. ?@ /" R  " R D!D0 @ 0#1@0L h0 0%H0 0D0@ C00 00S \ 00 $0h0 C0000S ^  0@D h0 CQ0 $0h0 y|s0; Q  O-M@`$\0D|0[0Tp0 V( 0 2c1 0嘐00  <PP/ 0v> 0d0?`000T0?P0 00 <0?80 04$$%"X˟$` 0000  000V ;0h0PM 0TP dP> P? $`Pk0Sh Reʰ R aʸ R ] 0 0a 0`pSd@ ?O$@T'pET0}Np0`pd@0w[0D@ 000000 0H0L0PQ0l0\0v^D 0h0<0P0 PEt PQT0 J40px|PWxR[S S  hp@| Ux Zt 0Sp0Xl0 Rh0 Rwt [[8 P0:=CȈ 0t00@p0p` VPw x0S [0p0t00p 0804@0 h 0P  0| 8ȟx0\ Sv. !0#/!! !./ŠϠ B ǟ0S ,?.Q!Q00#1 ?`v.C BL\S|  Qxt PtŮZ 0 zq  A 0pq `p V@P0 ?oR20SZ00ߍ 0Z0h00pwq@0 V   Q+! !pS@-NRp* h0 P0,Pa000 p0  ZR 0pS 00@ BZ0h` 8Z0S 0W0ZS `h d0hT0? P00h<0? 800hD0? @00hL0? H0\$pXTZP MpYT00Y0S@Tp1ß"bZ2*:##c2S$Y0S- \TP)h<PP  pß嘐dT0CT30@p>Y0h00` 0p4@P8P ?(/( R ß&0Q 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. X0pX!10(/ "#Ό Rà3\"= #30, SDA^ E0  EUpq? @p(@LCY#00@Y0S p㼰@ h p@1Y00p@ߍ輰p[@) [[ʒ 0Y0Q  sPYT00 Y0S!10(/` "#Ό R0"c01 2c1@TcXT00à\l䪪着\)P\( ɚv $I%@-@ Lp;85Tc taX00 R 0 R 0Q/  /  Pᜤ  DQ 0@-0P S@@H  ^0 S  Q 0#0S0(0/PH  Q j.0 0#  Q/OԈ00Ɠ\ 0@-pPo> 0@" \ 0 /O|A-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPN|A-\@`@DP pH@P0& P @PPNO-@ M `P< p p$0n@0uPP P p $ dP pP0S  Ѝz T0 0V hQ  =0`0SMpA-pPQ `@Q -P 0@DDB(000S  H @- M`qPPp* uW 0 40@0S iW0"S# 0p000S0 07/ ЍTW0"S1Ds`0pX000S @ Ѝ1Ds( SGlG|@-@_ ]@ZO-PMU@`  PP2SPS PW  Pp B `Xa `L`@ P) 0nS: P= >GP0 0Q Q P P 0 IB"S0 000qP Ѝt0 00 S Ѝ0oSP  ETO-BMM@pV0d0`  0pMP:FPP  8cMPn00BPkP PC @P`J# 0 PP)p V0P0 0 PPp t@P" 0 t0dSPkPU0 Pp` Rpw  0|QP~ @PP0 PpM cP aP[ Y&V 00BލЍP/U ` P p:V0SL  KAP EA0H0PP0 p=  AU00 X 0-APT! 0  /0 0U00 X 0AtU  0x fW00,U00  0@PU0p0 @ 0 P@vU00 @ 0@Pll0d@dzx-{M 0 { 0PЍ -{M 0 { PЍ >-{M 0 { PЍ ?0-,M 0 !EPЍߌ--0$ S   0/ 00JJp@-Pe@U@pU? $0$`0 6/pJ@p@-P@U@pU? ((0`0 46/pޠI@-@P 000l3/PI@-@P 000l3/ IHp@-P?oU20S@p 0 0 P5/ݰHp@-P`UV00P00S@p$$ 0P5/@H|p@-P?oU20S@p 0 0 P5/Hp@-`P@PpT(0(@0 p@/G܈p@-P@P p$$00 0B3/p8Gt-@- M  op@,,000G3/ Ѝ@ Ѝ/G@-np@  000G3/یFG-- M` P @I0Sp ЍT4400 MP@:/F(G-- M` P @ 0Sp ЍS4400 aP@:/<Ex@20!P (///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ /////۰۠ېۀp`P@0 ڰڠڐڀp`P@0 @-@$ MP#055050%A0!0%_P$00$0Ѝ R/,0p@-S@pP($ARp$0S*> $0( 0C\ 0 CR$ *#0$00S3 5$07$050(0$0,0!PpO-@XPDM@p, fzQ@ [a P @: [ [|7$0P$ 0 @X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S>3 57,05  50Q,0R 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0DR#00C R700C 1L5$0qS<3 57,058`0,0 ?R0@SKR,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQ `0p@ FQ)Q* AR  bQY fQ ?R0@SP  b;@S B88 C c3<2080 S ,0 S,3 5407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS=3 57,05 0 ,0 0bw@0fp`F2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P X P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`W  R `S` 0P0`S<3 57,05 50,0080:Q,3 547,5 5,@p`0%#jo%#jx%ju-M{0{0Ѝp@-`PM0@ 0 4/ЍpO-PRM^  `WpP+/a@@P L0  D pp Ѝ@0S 0  D ppP0S Ѝ贠 yP0S(0D @p0D @ pp^P0SYP00UP00\ϼ@-$$@M ЍЅO-EM MaX@P+p `Eq; R0P@(T 0 R0P@T 0 b0EAP !; ;UEލ ЍP00Eލ ЍO00@-@`  pMPKP, /R 0R rR  P    P@0C ЍP  rR 0rSX 0 @, 0 Ѝ@vO 0 `A-`@ $p 0P/S /QP @0 Sp 0 S 5 Np@-IMM@`PP Wp 0: S \0 040pp IލЍpbOO00@IލЍpZO00˰p@-IMM@`PP +p 0: S \0 080Dp IލЍp6OO00@IލЍp.O00-{M 0 { PЍ P 80Q 0 08080//p@-@P PP`  PP u @P  p@/+PPp--00 M (0  ЍЍ/0,P --M  Ѝ Ѝ// -@-MjO<@P@ 00  0Ѝ@Ѝ/,0-@- M@zOP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$ PY P@ 0 @TYP :O@!,Ѝ000:Q!0P00,Ѝ80p@-@P(M ' (Ѝp0 00 ,p@-`@POpp p@p@-P000 0 (M` & (Ѝp`,p@-@@ @  `  @PNpp p@k,p@-(M@PNp & 8 [(Ѝp@-@PP P  ,M` @Np & A,Ѝp,C-PP,M/  @` p`FV`R V @`0 @T N ,Ѝ00 0:2 0,Ѝ 80p@-@P(M Q& (Ѝp0 00 ,p@-`@PRNpp p@p@-P000 0 (M` *& (Ѝp,p@-@@ @  `  @P*Npp p@w8,p@-(M@PNp & 8 g(Ѝp@-@PP P  ,M` @Np % M,Ѝ, P $ Q80 @-8M80@08 Ѝ880/LL0000 0<IR 80880Ѝ/8hP/0@-@0@0 M0S 0000 X0R |0PP h00(CP0T00 Ѝ0D&EP0-d,\DO-3M0PP 0 @z0 `0Dp@ P P00U tpp0 0C Z 2ATT00  RF LD@D T]:[ 2 0000~`K DM0 V0 W8 \2ATT 0`Fs 0Ry +M 0  0 B0SH M0Ѝ0 V  0  M ` 0 0pHX;0S2 0 Lv 0 B@ 0 B  BL`FtY  0 B  BL 0 wz L 0 j0S 0 Ba00Ѝ 0 W] 00 ,p@-@PLppp@ 0RS00 /p@-@<0<00P  @tLppp@ \,808 00 Q0R00 /,p@-@`PTLpT T   p@pp@-@P\ \  ` @7LpTT  p@ph,O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` kBp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ0000 00w~,@-@0@ 000 @T AP80@080~@-@P AP80@0800-M  uЍ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U P`? K͌T P? F͌(Z P> F͌(1S vP1> C͌ X dP@> JB͌8W RP= ̌V @P= ^B͌`=@ 0S078d H0P< `P P  P P P P p PL Pp(, qP P`P (aP Px PP'( Q780D0x100C40S000C,0h0Hp0L`P$$0PQw ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @gT, V   @@dqXhP 0Z Piߍ P 1 S  ,00 0! 1S 0D 0| 0R@p002P,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@PーP`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0徿0P@@X1(@P0嶿0P0$001T0寿0PPP1 PX0姿0P0000堿0P0, 0pBPBHPP@ 0T8`<@OH Us,` p@PW 0g1pV@10P00 00Z00 ^Z,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UfT0@0p8`<T4 ! , <B B P $@0p8`0[/To0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ ㄻPP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR 0`0 0 0[0ꈰ  0PU 0P  0@TP0 @  0Z 0^ύ @  0`V 0 Jύ @  0X 0Q̍ @  0PU 0P΍ @  0PU 0,0$ 1@,  BU00p@8`< ,   , 0 H T0封.1D|Q >p@T[ 0p8`< T P H00 0R_ (0Sk ,0P0 P }8XC h!(0ST L0!11 @ T p @娼T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@.!(0R1P@PB0P@ T  0PP0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @2T,000 @,0,0Q@ 0@1>PpP`ǹ Pp W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `V,0 0@ 0 `Tq$0W1`V W  0 |0P`}0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a P唻U,000 P,0|!0RP0P1`@,0P`. V  0 @ P50 0R80000S  0p8`4{!*prQ>{ R 81 R 0SЍQ L0 0 0OEl0T0Ѝ!fVLd<0l 0̃ S/O-C@p`ᜣM[ +(p( $W㰷0CS0SLষ3㲷8⶷P 3 0/# {% 08:x{rHȲ pŸ堒圂8ırtrhÃqlr(rdrq\r`PrTr弁qLrxrDrÃq۵pp<ֵ^ӵvе8#͵:ʵ0'ǵ#ĵ0z# 0念H#㼵p-㹵-㶵`_㳵|㰵o㭵p㪵r㧵y㤵z㡵{㞵@|㛵h}㘵6A-\`'^`@ p 0\@(`V(PO-8g887M`  `P `0ǟJҭp 7 000 S00 U0S}^p  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0⿴ $Q B q/ 0 ;0 尴p4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3 `f pS 83003 `W p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#\ p SW p  0 s 00bR40 ; 0p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 p E  `Q q 4 00 0q0cR  0 ` Ѝ 100#?c p; 000#?c pv/` 0 `00! 0f-M 4 00 40 s 00bR 44 `NppA<QT@0(  0 + 0040 0/$O-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 80+P0@P@P@p@-tQ@P6P 6P  5P10S. (P:  p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@Sp0@S mS 0C;S P   0@S;Co |{O-0lvSp@`MTf` `ZP HT0 ʍr `r 0H"R (0$00 03S53PK ᖥT$*3P ጥ 0XSڈ%$ |%T 0p5"00`4S03`00S5 p0S2 4S, 4S 0t25W】匡Tp2 1Pm 4p2[& LAT# `P P 崂@ᱰ᮰oH5S4S 4S0?o2ᛰ44Ztx2 PtY  5P3[x2  5Px2?;~0x2W  |5Px278x23Y|2 PV x3|2hЍ0 D p$l h $ <%$(JYi V5P Z O5P [# H5Pp2?;~0p2|20P?0 rr 0H"Rp2[6odcτ00 0#d#lm0 p,_F?2? 0p2ͭY?w 0`w b2 P`0  0 0#`p@-D@D0@Ppp (0l0m 00 p!`p@-@0@P:#Rt t# R- # 0ppP`p8:p!8$dp@-@0@P :Qld^p- pp#P`p  : $dp@-@0@P:#Rt Ó \ "R-- , pp#nP`p:p$p@-0@DPSP @p (0008 <@%8 pp0,@-H0H 0@0:#R#R"#0:@-`0` 0@ :Q Q-  :|@-0 0@ :QQ σ #ppPo :@-0 0@ :QQ σ #ppPG :hp@-0 0P@ :QQ tà Ãpp#Pp :hp@-0 0@ :QQ σ #pp}P` :Qp@-@0@P:#R  #Rp @8 %8 "R--  pp#IP`p:pp8 :l$,@-<@<0@00:3S 00  @-8@80@00:3S000 @-0 0@ :Q&Q)   ,0,0͂ $  $ "p"p#P`S :Qp@-@0@P0ʃ#R(#R+ P-, 0,, -00$0 0$0X0 R0pp#P`p0ʃ#Rpdp@-PPP. 0@` :QQ! “Tƒld l pp#kP`p :Qppd0 0 ,0 0 ,@-@ MZ"qQp* c0 ,0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#chP`< 0 000:P/@-0 000hT0T 00:3S 0@-pp $P`/<X0X 00 :3S 0-pp@- P`/$0$ 000:#Rs/p$0$ 000:#Ru/<000 000:#R s30/(0( 000:#Ru30/0 000:/p@-P0P`M0@0 0ssp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp\@thA-RBP0@SMq QP 0S `[ 1 P00pp1p0 Q41 1`p0V0S  d100V0S  034pp# 03, pp/%ЍP  QÁP 0:|   0000 0#/0 ` 0@.00p@th,`@-,@@0S.00@-$@@0S.00@-X@M@ 0S Ѝ< 0000 0.0 0Ѝd<@-h@M@ 0SЍ . 0R  (00 Ѝ . @-@B@2@P$MQ :cVT0r3ppp#0Saqp 0SO1p0S@ 0  B0*1`00|PM 1@ 300 R 8 C 300 X30r 0  :3,pp4 P`$Ѝ0`00|P @ B. 0R` 00 `-00T @8 300 %.4h0pC- M P  ᒱV L`刱㦱<0`00:3S \ x Ѝp   0 000:3S/I T0T 00:3S 03@-ppG"P`/ @-<0< 00 03, ppSP` 4@-808 00034pp"P` 0@-PPP M* 0Q0@00xP 00 02000*C Ѝ0|P H00 020000*| Ѝ0 h/0@- 0 @P0:R M# P P&tP 000 20S Ѝ0`P D000,PP Ѝ0 h0 000:!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@TpU#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-媢Pp4S-` @PP3@ 0 00p) ,4, [ 0 + $ 0 ^ lЍB0  9lЍOF0O-:$M$pdZ0  r$ $PUv P0p 0 p D Vp(:0PSH7 0  ᪡@P$Ѝ0SH S4 SpV  )p0004S$ЍOAp @0S S SpU  )p`Fp@0SF0Vᨀ *HVp P @FXp  a)p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ $TP/ { @p ` PPE @0S 0  `PЍ` D  P 4A " 2Ѝ @0 <P0  0 /404 000S :P /(<0<0 0 0S :P /404 000S :P /<0<0 0 0S :P /T404 000S :P /-DD 0\ ʌP 0 @-|0| 00@T 0J#4R B0pQ 7@.P e @h808 000S :P h/D0D 000SP:P4@//000 000S :P /@L0L 000S :P @-p @`/A-0 00pW* Z3$SP! #R`@4Sp`3@Tv AkB0tQ 6A'.-0    p000 000S :P [/O-00 0 MX% p `P 0 ởp @ᯜP  0 P察p@ 0 5@  Ѝ@HP  P /p@-JP 3S P`4`Ξ30PVȞ  0s3 S 0兝P 2 $R 0X0S 0D3 20X #$04p03pp8Hp@-jP F3S @P4P犞30@Sp@胞A-`Pf JSU?sW< @P3$S3 SW*0N, SsH0S0 WP3PSSpP4S{pp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  ` P LTL VW PT VW  P000S<080 0 0 xO-($Z Ap`P᳞P@8P ( 6&T2州P* T 孞P 0 & @00 &0WXT P  RX8 @(  !P&@0x @-? p0   0 `T1@A pP`U@  00008A- Q@PP% pW# 0 0S0:,8000 R   R   R  P #!4`T `TX *P Q Sp  QW02p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S ZP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p `pH0H 000S P@ ?# Q@ 080//H,(0( 00Q0/,(0( 00Q0t/,p@-P0P0 0@R` 0 S;,0 0D | 0 00P0q}pI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPYx0 00@,p@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CM0 00Ȱ,\000S  Q R P (!00//uPu( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝt\ǘt sX(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0r(O-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dp `| tp Ѝ@0 S RQ Ѝ,YP d,0R0P 00X p  ``F , B,(`aaA0  T p0D`4(P  Fp`,004@ 0T` p0Du@U   PB  0SQ 0 0PC 0$ 0\R =@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP ,PQ8 0 /$ $\/ P/,PQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ETpL @10 0 QT$ D 0R U EBp: x0 0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q,PQp@-P0P`0*Â$ @P uT00PU pp 0QP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0S0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4zڌ`@Ps |{툰 {Pp,p ,PP0_ Y4% 800S0 X0 08` ``#$T`LH0|0P08 @!\08 `0d0h0p0l0 ЍP4- یP' 0*Q- Q80 SpG V P  PʫR Ѝ @ Ѝ  A-0QM@PP(C p`QAR   B P1 \.X) P$,P?PP H0 DH00R00D p0$`P!b@0SЍPЍ@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @x$0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0,@-44@M00 MЍ0QP-D00M  ( @05ЍP8 /00@-MN  P@N000 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AAO-DM(0X04 ,00S80  S l0( S࠳ࠣS࠳00CS࠳h ^@4 @D,  p04\00\0T00S@u80<80808080ql00s0SL0Cs0p008 P(@T ^800qQ000- ,0 (0q`0s0S$, ,  P(p@@^ @P8@hPuPC ^hP4@N~@t@~PpH~^ ( npH^ , 1 00T=08 <`! 01!a S 1  0Cs020Cs0Sq 80rD 0S 1 @t@PT 0uPs08<` 00 000 h00 h (000 0 000CQ00( @ 0 0AP8 h(A^ (  h   BQ 8000c(0 pRp 00(0 R 00SX 000 0 1$ 0S0 !1!0$1Ḁ{0Cs020Cs0Sq D 0Sp1L0|100 pC 8000` 0D0 !L| p. 00MDЍhCpPp4p 00 (pQS 00ã080@0808@8p@@pDЍ [O [L 80&PU0,`A0s0 ,pNq ,p  B   S ^020S@:A-U5P`0%@00?C5Mp 00TP 50 05 0@0@0@0  00P P50 0@5 0@0@0@0  00P 40 04 0@0@0@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0y @0;@0  00P L30 0h @0:@0  00P 30 0W @0:@0  00 P 20 0F @09@0  00P 20 05 @09@0  00P <20 0$ @0;@0 004P 10 0 @00@0 00P 10 0 @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@000 ~h\|x0@-h@h0@P M006S 0  Ѝ0(0 000  Ѝ0@vhp@-tAPQ@`7 Q`1000S 1Sڸ0  @T @TU p0 0X pp1S1&0C( s00B0Cs0SBB 1Sڸ0l0 00:h2P000S j @T 0 0Tx -M 0ЍC-P@ p$P `?LH\/ ONI ^pGPE ࠡPJ@$ @ 0C@-B2@`P0 M@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0Tx0 @00P@0 Ph0p PX0 0L 0` @08@0  0pPh|~x~\A-@`PpiTV,1 @ 0 @A O-/dM ?, 0L00*#Rt,/@ T8  (   ` (`RU(080@80@ @ ?0Sc,?@8? 0@000D L00  0SF (@@000h0S80@0804 L00S8>, 0(0\,0!0 s0  S^LPIL00"? @ t@T,0Q0@t@T80(00S&L00S= ( R , LP S800,0 1-$00Q$0 0\( 0qQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00ap 0SL01H@804 0,0000[,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YpH @ R T0 00P P 00 SPR P)!R00S 00P ɟ`V0 0CSp SqVp4 0 AS0 S P0P ` P R  0R  `9,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sj9, 0@000h0S(00S8000S3 80 ;8, 0`V 00Pm0 0CS<0 HD D<0NN Œ Č Ȍ N LL\oɟ`VWY8 T0V T@00D R 0 R PPZy ! YR  pY $Re  0E0 p0]   0E  @000$R , 7@  a@000!R~ 8x6 8000Vr00C000C0'P6, 00S?0X *1h"0 @, 860H 0  8 0P4, e `p$t00S000 @0p 1P11qWX5X0  @00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꀄ 10&0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0 P0P0S^L L00S3(080 w 800  L,,20 Xp`dЍWL008 0080@080' R d1SdЍ( 0 0=x \P1, `p0, Q0A0Ո8! ,\PY @@YP 2P0@, QcJ   8@,@ APX@T `P `p4EDx=r<;33,2118hPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0}8 0.00@ 0C(@ 0 0800  } 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pe d1Sb , 4@  TP:X X@ P S@DT H HH E@E0 0: 80R0,`0C 0B0X00@P `0 40 0E00I PU U R0 R  X R RR)0SC 0 R$  9, @` 0  `f@0 0p0 `Y00P d 0@` 00 B0X P0 P<00 p 0 P0+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`rUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` K0  `@0 0p>0 `00P  .0@` 00 B0 "P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 1@000=, ,>@ 0`C000` @000tW $ v 0 U@`= 0 0LfP4Pj @00 pWU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`*UpH50S0X0S* 0 0 0 0, @p@0 0H`U~0 0 0 @000jP$pPd9h'hp@-P@PPM/ 0`0 R    80x t00 0 000P 0 Ѝp80 @000! B/ 0C?0ЍpzP0 00yd,C-鬐M@P 048! \` d0hlp`PpPi80  D000 0 B0C 0/? 0ЍЍy<@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  x\0 00w(, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `~Vp`m|0P 0@PUpT` @~T @pp  ! !@-@P@~T R/A-p0,SP` @T @~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S uP$00C$0I+O-:z0Mx*p$P( ,pP H*00\c S@@s  nRXal HR @@i`40IS0c0@T ^OoB@TP AA  RR0|)\ 0  |  bR\ H)` R&8) R! CP'I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPf S ^\ X( 00Q 880, 0,4(0RJ0H 0@0' $P)0S700S00l0S# 0 S , 40R#0l P, 0S 0P0$@P$@70 RЍ $70( U$(00 SBFf@`< & (00 S4$&P0C (00xP0S  SP$00C$0'@`&  T60,@(@0 R 5060, 40RpfF`@ 0 0, $P,04 CS (@Re 0 KRaڠ5%0 p p @d% 0(`Z cq`nR `F%` V ,00P0S 0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z p<40,04$!,1010y d 4`000P ^$ $@$#@ P(@h0 Ru ,,Zq  P+ p# J d# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R K P $@@ lP "  20,  , o40 S _ ) @20$ ܀(B@0S 0P0$ 0B$0$܀ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0(A@0S 0P0$ 0B$0 @,0*sh* )`d),(H(H(8(( ''8'&&&&,%%%`%\%$####p#""!!(!<! !  O-lsl3phC@00 S M 400040,c`(,P Zm34@3`0T&#0C S402PK袟  ?0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS tP 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 @P,P  n@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004PhPdhP \p`L@- ,(4 00@-  ,(4 00dO-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0c0 00 08QD0S0l%R h%R /!R!RtP/P//bT 0 000 0P/aG-MuPp0 5` 80s3  S̠`D Pr LR!1S85@450 50 `\Pᴖ 40 00P 40 040 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q WS~VZ]9 Q oSf2 Q PSSVi^* Q j^S! Q WSVk^ Q S Q[-S 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  YCPUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf SUcah(4\1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //[b1P0= 00` P7ʀ :l“3\0 /@ P 0000CS0 00000000000000000/Z,xR@-@P@M&\\ Y #3t P P 00 '000 0vЍYh`P -P\P Y͌# /X@@-00  |00S d d0 8=0!D00 R 0W @-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\ h0W(D,0 000:h/Up@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &ЍpUhT02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R R, !p@ '( V@ Ѝ1=00QM0SJ\1p20lP10 0O0剑Q:20h1=00Q!0S0p20 00 0/0剑Q:20t 00 00`0pU0!Q 00pI0!Q  XTh0 000/Rp@-x0x 000@00CS0 S p0 S P00pfPp0RX0p@-0CS@0 S p0 S P00fpHPp0p@-,0, 000P_v@RpQ\p@-PUv@Hp0 000S  @-@J Q P\,Q    @/Q,0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0P`Pp@ W vP 0p#0C S-0 00$Ѝ*T0 S80  *2 0@Ꭸ @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p 0rPP+  U  P `X(0 SCJXC0 0(0C\00C)^$ЍX TP P  D0|0ap H0@D002 T `V `,tV `` P|O0 00Kd,p@-@Pppp@p@-@80800P  @ppp@K,O-`6lM0@P,0 j Q 0pt`Pa Pq0P0[ W   0<0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0? 0005 000p`P0 @R  <0T R8 2 0<00800C?80tP0`FtPY00` t, t480pP p!K 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!p! Bp G" RX :     HU pG< S8 8 (P4`< @p$0,0 1400H0@0 @0 0D.PU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0? s2, 8 P I000 0P8p0i08 k800C?80sP0pGS00C0`FQsP00C00p000P0 0PS08 B! Wf 0 0H000尡pG WD0|0prlЍ80< p` 0<0T pR0`<0 yPo 08hrlЍ`{\rJ^0 00 WD<,p@-`@Ppp p@I G00 ?C,p@-@Pppp@ 2p@-@@ @  `  @Ppp p@C|,p@-@<0<00P  @ppp@ C,p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``BO-ԑMS D@HP 0S p `@ 0Z  @ 4/ 0[ 7 $[0<S<0.0S0!10>P0 0@0 0}00 P00 Gr R0S0 0?P4/ZXЍ G\00r R0S@0p0bpP4/pWAxQ# @-@ RM !R "R pPĜ\  00@bЍ/0Q # @-  MS S PpP$R ,@8Ѝ/?8@-0@,M @ Ѝ@-@044M0 @ Ѝ>0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LN!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   =QO-M  m EPP@ 0 p % p 0 5S p/ Ą`@Ḵp,S 0 0  C@00 S  Qr%S+0@ GS0  %@0iP@0@ `fv` 00#1.Q0*Q 0S @0 SE^0 @00% d dP00 @0@00 S*L0 0 r 0   0 0  < @ 0D@0 @00 S^To! 00PЍ0 S0^ ` 00 @@D"0 C0 0 S^ 00000 h0!@ @0 @0g0 S!00sp pp00p 00p 0@p p0, T \0@410 0rp 0  0@ 0ppTp0 S\R W' I00 S0   [m  00w0`f Sv` 0S0\S 0 Sa0 00 :{d%pz4%c%+%cxx$</>p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp05xl`A-@0MS0D0@!0@P0S?  0 !~|!!`"bNL LL 0 0210B q6P `0 pW$P@WP 0fS"PЍЍ 0Ѝ4tNuTgȧA-@0MS0D0@!0@p0SE  0 ?!^\RN  L !0 120B QP `0 pW$P@TP 0nSPЍ"0ЍЍ2Lks>G-`0MS00! 0p0S[  0 `1` I $L0!b!bIO4ቐ გ1c1cL0 0#3cl 10B AqP P)0< X" pW $@r0sS\P @WXV @T NlPPPЍЍ1L?-r\S*0 O-TMlj`PN ,$  0 : 0} @P 5 U000P 0:m @P 0S  R 0X F #X =X =P 0000pP, p WkZp  e00Y*S k`P V30  Z k0S l0q,0@<  0tß $ 112cA112c B LL00#0#pr!qpC 00P0q0p@B P@=rH`@X 0Sp  vk 0` lk@X0`0TЍp  0 "$ L衟‚  H !1 2ਁሂB;P㈁L 00@>p  0r `1` $L $$H0!b4!b Lƒ1c$1c 0L 0 00 壀((!h!b!CP㈁ 0tS0cS0Spp~G0@00p< Rp0S `x kp, Ngȧ\LkmX>L?-lS*A-P`p0\ %\0@pS sS lS P0\UUW t000@1CP0PCV` 1E!c00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@fjP 400@,%,`+P p` H˟,@ 0:ZAZ JQ  0JPPp0-00 >Z A0Js =R* =S00 C?QRp  Wp1PW -.R0 XZD cJqQ   Rp~ PA0JlRpY PA0Ja0Js Rq11OSt00qߍ|I@[/dhP 00040[hP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, T*R 0 p 40P040 P PPp1  \1SE 0C111SB Z0! Jr 2( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a d7@D!&J0AqVZ ຠ `OT` a 1l!01ATe @DAAAa0Js RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RU 1h BY!r [#P`!`1`Q,*P  0~p^ 40040i10Js Rd1lp1OS!!0l1PUAT @D`1AP %OT0a11@A?0Sl00l0 0St00t030S%   ?R ;R P0S %S0 01S2 0C11AT/ #Q,,*P  4 @ , 40,0PPp1BA0JS30J1OS!l!011@ 00@`ZhPv 400`,Vp p2Nh Pj 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT> `V ᪜```&``VP``P``ý`@oobP``V ``@Q AOQ AAT @D1!ZAo!᪢Vp p2gP 400p,PZ}00!Jxo0 0媢q0`0m001&J0GZ @po_0`0Y00U00-P0 0|@V``pT@`V`pO@`fpK@opG`@pCoo@bp>),~'~Z t8V {bu-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/A-PQp@M 0S XD fP X`V! 5 0v0+ V T 00 .PP0T0j 00ЍT ج 0 0 R T ɬT|\¬P0S T`@ ⱬ $vp 0S R s0r (0 000ST00P 6\ p0 (0P )\ p0 0`uTH,n8isshs,s r@thrHrqqq0R @-M@0@S > ЍA-pP_P U) @`TV 0PS |_@P0DV  P oA-pR `Q 00@ PP{ % P P 8$0 GS  &fP  0 /0r 0 /r 0R0 /r R0 /r R  /rQ  A~pp0 Q?Us0 \PQ  0?s0S $ pP  op   1@⡏pqP V0?s0 q%geP v0?s0S  pP  q0Q ?s0U@pP 0?spWB 0岀ḏxS$pBPB " X8 $ 0?"s0Ž nP5 sPA fP,0p/oS" R0000qQ :!eP#dP%$ pP +f$p'f dP$0V0 p03?/o"/00000@ /r RUp0p?s0(C-pQ@|!P`M0 { P 000S9 @ЍJPP ^p  0p R 0S 0P@ [P@ @Ѝ 01 \P LPP+ P * PP004hlX0O-M Mp:S$0S:S@ 0PS:S``E[ P!* B `0  nP 0P:S ۍ Ѝ@ۍ ЍC-8B82M@M0`PptP9 0/SH ޘ@P Q0@9eT PI +(A@4UP 0 ۍЍCDJ0P  L 3zP"0 @\ۍЍCx60P 0S/S P @dT0 ۍЍC0  PۍЍ p 0dYX H0H 0 (04ۍЍ,0, 0 04iiLhggŰG-p`@P  Y0@dT  OP @\PPP P @T  @0G\-@-@ MP00 Ѝ@ Ѝ/(< Ѝ@ Ѝ/ 0p@-S@ 0  p00s0?0 0?0P &0 p@-@MdKdId@GdEd Cd0Ad@>d 0p@-PS@:pS ScP!pa@- ^ @fR^ qQnR sRq^ 0  Q A- @X `PfS@X pwpP 0@nS sS@Ot@@X@ 0 0S00@PA-P% Ppp R,R    0S,S@BAia`P   {`00ppp@tG-|rp@`PP#6pWX*nU> sU\ fUH0D Y-R0 @bP$ H0D@ / H0@0 H0>H0nUp@0 H PO sU: fU% L00L0 @VP @P ` 0S0000Y 00 H0@ H00 (,00H @,0s0?0H0@0, H0(H0, 0H0 0@SH  $03?0H00H0,0$P0s0?0H00H0LO-@ M yPZ p rpY ` k`(080H0`P3 0 0 u0?0 0Zw 0/    0v Y/ 0   00P= :07@40@ Ѝ0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00dA-p ``V@PR maP A0u0W00 x /    0 0 0P_8  O-`0@ $M 0HP pbPpUP5  8P &a0P  0a pP| @P Ps@@ aPa $Ѝ aa0,P U 0(0$0,0& @ p 0S00qkPn PU Y  2/R@PU  /r R@PU a0LP@U@0H0D0L0; pfS*p @P& PU%  @Ot@0nS sSqpY @p4O 0p6 0 ^a $Ѝ@pOt@(TTHT@b{ { A-` ppW@P R# Z`P 0uϿ   v0?000 0  0 P^0A-` pW@PR (`P 0u 00` 00 0P^0O-LM<  <<+, , 0=pP |@P0|0`P  00SZPT LPH:PP_PP p pP$ V 0"T 0,P`8 ` 0100#$0 :0400S) $ .S  ROSD =pP" 00p`vC <0P;0?s00P4 0?s0V,P `h`LЍ#y@P? pp`v , R 0S00 R 0?s0V0TS 0  0000000 P0(-Z80]80 R(&`PLЍ@0@SK  p@t`00 0 0f0 fPYs (@[ 0 [P p;  )\[  R-Y %\^[\= @[0P0'0GS5v  0P (W0 KrQ40E K/RS  [@ [&,0  @ 00@L&,0  O pc00 D"TD0 0S1P Po 0 k 0Sb v0 l 000  00 n0PB p (^801` Q  Q 0?s0T00  p    \00 ?[{ $v 0 S00P0@ P  0BP,  0  80i Y80! Y0@B PT@@p% 0 000 0s02P (]@p@ti p@t> , Rm 0S00 Rf 0?s0T@4lRPiT` ,P`0 xxD00 F("-P00bPp@t0j <0 QP0?s00Q I 0?s0T0 x S/0 0GP.80 M00 0S00 P  0p\0   < `00 00Pp P*xxsrlqpdpDoto0nnnP/$P00//o80@-MPx0 80^\!1l!1"b2cNL 0@@0#@B!A@C0PЍ0Nngȧ P0`0K?//nPp@-MP=0 0nPel b N00PEK 28@0#AB@C1dPЍpLkm>$0P00?//mdp@-M`0 P0el`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$C!d!b8A@C1OPЍpL?-S*lp@-0P0M`2e@P 0Ѝp[, 0 0S Q20ЍplG- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00pl@-@P \\\ \$\,\\,00!R  ! 001/| 001P/ P/d\@--@Z X@X0@0@0s H [PJI HH @|LA--(M s#p3`0 @[TR  k{XF{{?!00 (ЍPo P 300 00XB0 {kXk&!00 PT ~P 4300 X 30 "P  0cP0{200{kXk 0P PB  0cP0xʠ200[DX{ 0d2|"|""P  0cP0P200X 00 "P  0cP0200X 0 P  0cP0100^[DX!{ 02!"JPz  h0cP0F`100X 0G A Y0cP0e(100X 0U2 "lPR  F0cP0`000X 0P2 "YPO  30cP0ʘ000X 0t2` "FP  ??LX`Gl~~~4}l} |0cP0Y,000X 00 "P:  0cP0t00I?[D{ 00 Ő X"d P  0cP000E?{kXk 0[ P  0cP0 p30A?{kXk 0r P%  0cP0(300X 02#"P  0cP0n20t0X 0^2""P  0cP0ʜ20l0X 02x""P  x0cP0hT2000X 0X2\""Pr  e0cP09 200x{X{ 0 yP)  S0cP010g{X{ 0 hP~  B0cP0@ʈ10W?X 002T!"UP  /0cP01@100xXB 0 CP  0cP000S?X 02 "0P  0cP0Lʴ00\0X 0<2t "PS  0cP0l00P0X 02X " P  |x|,{{{Hzzzpz$yyyDxGx\xw0cP0Z,00@0X 0J2D "P  0cP0p00O? 00X"f P  0cP0ʸ00M? 00X" P  0cP0%10I?{kTF{X{ 0O P  0cP0H30l0X 02d#"P  o0cP030d0X 02#"P  \0cP0ʸ20\0X 02""oP  I0cP0yp20S?X 0i2X""\Pf  60cP0j,20Q? 00X" IP  #0cP010d0 00X" 6P  0cP0ʜ10E?Yk[D{X{ 0 "P  0cP0P10t0X 02$!"P}  0cP 010 00X 0T P  0cP0ʼ00W?X 0s2 "P  0cP0t00P0X 0a P  wpw$vvGv@uuuXuttpss\srr|rlr\r$rqq0cP0PP00\0 00X"% P  }0cP0Wʘ00d0X 0G2 "P6  j0cP000l0 00X" }P  WwP  Q,1000$!0!X""00 Ah100t10K?Q10G?d0!X"l"00 +10|01000!X"yZ"00 100j0"X"L"00 2080{kXk>!00 30Y?3000x#X","00 X30T0L30N??0<#X"h!00 30p0Y0"X" "00 20U?20R?0"X"!00 20`020=0t"X"I!00 h20h0:\200P20C?0"X"!00 20p0200;0!X"s!00 10U?d0!X""00 q10H010K?0T!X"!00 _h10`0\10h0:0 !X""00 M(10Y?z0 X"T!00 ?00|0E00`000G?)00T0s00(0J0\ X"b!00 !00h0000 qlq\q$qpppp\pLppooooto<o,nnnntndnTnDn4mm{kXk0!00 3000#X"""00 300{kXk=!00 P300.D300=0D#"ZH H 0#"XN"00 2009{kXk!00 200y{kXk!00 20p04"00 "00 P200D200A } PH  T@ }"00 x"00 s!00 n!00 ikk!00 b"00 ]"00 X!00 S"00 N"00 I"00 D!00 ?kky!00 8t"00 30Sk l!00 +0SF d!00 #0S \!00 0S T!00 3P  0S F!00  @ !TD-m4llllXl kkk0S .!00 0S &"00 0S !00 0Sm "00 0S5 !00 0S  "00 0S !00 0S9 !00 0S !00 0S !00 0S !00 0SI !00 0S !00 0S !00 0S !00 }0S !00 u0S !00 m0S !00 e0S "00 ]0S "00 U0S !00 M0S !00 E0S ~!00 =0S v"00 50S n!00 -00#[D"P|P !H H 0#"0S#T!00 0S L!00 `300T300$?"00 :"00 5"00 0"00 +"00 &"00 !"00 "00 "00 "00 "00 H H 2X""U2L0 0j2(0 0u`|20 0zV;T20 0kL,20 0uB20 081t0 0. 1P0 0$1,0 0 d10 0?<100 %!00 R10 0U00 0[0h0 0)?eeddXd0dcccchc@cbbbbhaalaDa````X`4` ___p_H_ ^^^0 @@H l 0H00 0p00 000 0[00 0 00 0k}J1 @@ T 0o\H1 @@  0a10 02W\10 0/M1 @@  0?T!00 280 00D2\0 0&l20 0e)2 @@  02 @@  03 0 0!,3,0 0  ;R\0@-L @AQ MOQ,0PP P 0 0 QȠ\ 0;B{ 7G 0 Ѝ03Q Q, ;B Ѝ0A@@1 0^ 46 0b0` #6 !k(7(@{6F{7{   ;B Ѝ0 0al`/ /P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! V @D 8,0400G ,04 00 @(0( 4/P840,0S00 40Q 0 @-P0 R 0 I H SpTPo @$ @ < ?40P R $ R  R S /0?0>$ R'4000  0p@\>0U 0PEt@T$0Sp0  0@p >0U 0PEt@T$0Sw  '$   0   0s 0@$ pR~ph=0Uq 0PEt@T7p0pp@0=00S] <0000CSU0S5 < 007s@ Q<0F(0 S0(0@< 03p|<0U0 0PEt@Tw0Sp D<000<0LQfD0*;<0\0T  0T :L0PEt 0@SBU 0P0,P0` 0U@@ 0070  Q 0SU 0PEt@T 0S 60> 00H70U 0PEt@T:0D10*D0 @D7qdh0l[ X0P#$U 0PEt@ 0S\7s@D0l0[$X6 R] ?0S50>00$60QD[I U10[![h +0 PE C0 ` 00D0 0CD00k`l Pv(T% UI 0PEt@00Rl @Dq0^ T 0 $ R40,0000 400U"  PEt@T   !R 840d0U 0PEt@ T:H00*H0; @D 07|;  0$ R D #  $ R D # $ R$# 0+R D U1![ $Q ^ LQ0Q 0 ! B00  0D PE B `D R000 R=0W U 0PEt@T20G?o20X$0S 0   $L2r '$B0#22cR0S 2000`20D10 PM;7sD@D10 Rp  B0 D  0h10)@pUc 0PEt@T$0DpSp  0 @Dp+kUJ F$0S  $P (D0 S2D57[U0  0 $ $ [PE`'0? 00??ZZ?6?7?8?=?>?N?P?5X?J?MU ?H?A?LRRtQPPO?:?;?<BM?C?9J,?R?DHH`?K?BGGFFTF E?E?I?F?OBB?QBD??A?GU F$0S  P D0 S2D57[U0  0 $ ^$ [PE`0 粰\=* @ 7s@D 810 <*;X0P0T :#0PEt0@SU010\ \ ^vPEt@^pU~@pF$ <Ë 1(00^|(,$ 0PEt< 0@QyU( \ 2q@D0w D0B @'8<#0#w[) 20 < 0"S2 0. x0q@DP0T 2$3 HL04P;7sD@D q 0;=00DSx30z @p P 307s0D@C s PNl0~90r0\lt^PEt@^U(4q0@D>0,( 粰*@D7p$R t!B0$ P0l00X0S>0p0P0?0X00 p0tP 40> K@w 50>050 7?R4@0p 0T 700p0t50800l505l 06^\PEt@TV*U}0 C00SU 0 0006Q0 0S @0p 07s0D@CqO$0(\$ PEt 0@\.U ؂;606L0 0s0P7s@Dm 0@D'qZ0@ph0dlp70p؂7sP0D˂7{D @C 0` 00P00X⽿p0P0tp0 (0$P$(0- 80> 0080 0sQ80>SR: @3 0@|0*$9@0C@ p \ p T d \ h P x90>(v0S90>Ip@-@'PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  f c0S  00?>?RP 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P0,4R0p0 p0 0 0 30 Ѝl0Spp l0@@@ }?S??P 0S $0S 0S P?,A4 BR/ Q /@o/?AA-`Vz@ 0!(3/PPw 8pWG  ( 0(3/pP00 f  @T 0  d!P S>0R`*p  BS>00p0 (08#8pPoRS B P T W B T p 0Bpp00  @T 0  d UP S>0R`:oRpS. 0A pp $0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-PM@ @㬰(0dU 0C00$P $p`0 sRpW(`$0 p p0 Ѝ0` Q`V00p;J\S10b60s0P0U 0 CP0S 0U\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 280%R00S4040020,0@00004@,008@(00<0 00 0 00C$0 0R0pP0 R`0ࠃ,0Nࠑ@00t000( @<90C1@ R@P00F3 0S$ Br R$VE  ` R*$  \ F C 0 Y(  V F( *FW  BR 4 Q  Rc8 %Q  R]<  BB!    S @ 1P <01( 0 ,08 ( 0 04@, 00]@?=O-@X0 34M00C  B U@\ q W3> BJ  p Wۄ2  B37RN q`36 B Lq`36 BC@g  @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  \X8@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\j \b$`\``$(@$$, V,(`@  $$(@$$, VpLF$(0$00W\(0`@]mPU?PU@PUAP0UAPR@oPP 0C  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0V00S8#  #800#"0 u4a,B 0 0 0 0 0 S0 S00ӈ R01q 00  R000 0$0%*W6: &R \ R80l0 C 0 B  0<L0DC0C t0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC f060@D0 0!1 0RppP O 0$0;/\O-Q$M R0ß ! 0 R0#s0!03o0P@pHß  @$ *  #)z0 (ay0qx0t0@Ar01 P!:RuPQ`&9RuPQp'8RuPQP+P5R>"r uP!@$0# "@QP @@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pp5 DMP[Q @!M080I j\PĖ PĆ0\@ CSP$ R(㨆 pPp 0Q= q[P$尐6H0C6RƆp 0€00@ jX0@PQ- 0ඟ0 pJ`{P09 `;ST`+0HAX{T4T+ pQ}Qp0Wq 20|~6{`0,Z`;p HT$@P;0>0 0 0p徼0S01Y0嵏  0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00Q0 0S@\ R @02^02N00 R0@\DЍW@  xP 01LY 1R 6 G2#6pP^p N0j 0=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-M\PPRf!   `0  +M @Nk@^ᶰZ἖p S 1>@0ny SwpFP0N`ppP`p%TPVPeTEtp漖0@P0dy Swp @0`pp0`p#406@D@0cUSupNT~F0PDt@`@`@@0P#4``0F0d^~p@D[pF5 [0@Q p[ ` Q^kp徠἖0pj9Ys0pJ 0 00#4 0编0iQq0 `V0἖pW 0@S p`W0@T P`㶰[ Y0ʀ p ^C @0@Pc UYuP@ 0PpP0CPpP%TPV0PeTEt@ S6`F3@Ps0kp0p0@0P#4pp06[@cVd 0C`6A0@Qe pW `r 0@P9pd Ws0 @p0@D0p0#406@0cUSu0 TFP `FPDt@k>p@p@@P.pp[@nVd N` 0@Q# p[20@S P`㶰gtwp@ p@ 0T0 `W2 @p0@SЍ༖N~C[0k@6 N~4[@k0F| P`㶰00@S P`㶰%0@S P`㶰0T 0 i p@` 0 `aO-ʀ6MS 3003`003k^0 0300300! A@b9 Ts0@p000@p#406 B 0c^&6S0@ 编0$` pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಀAph>Ys0H000#4060cWsw0 p0@sW `D Br @g>Ts0=@000@#406pGp0cR#6 SvekN&0Pn2Rs0 P`0`00 @#4PP0&N0bQq0 k0&Ѝ 0&;p0v7 ļ00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I, ( &&)A-@ k΀`P s0! Qr p p "$  aS2s Ak> u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ MJ, R 0Kp&]EP+(+;0N  q/ ! R7@P j   Q& R \3 "[k. Z0-q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦| qk>0#40缦0j\3s0 J Z㼦yzk>0#40缦0j J\3 Zs0漦@|qk>0#40缦0j\3s JXM⼦k> / ! Zq ! 缦jR!r J^ἦ b _ J  \ P+R +R ,RE R  Q ,Q3 "[Q6k S op3 s0000 #406 cPp 0Ck N.V6 0G. 0S0 0xS0   0LSZ=00IX  && Ѝ R3 "&][Pj 0 ЍO y: Zs0漦)@q:s::s0 r :s0q#r 0{ x @ l:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  L0S A-P p@0 C`40@#<TUT @/%P $/@- MP`pz(@P @ڰ   !<p P J- @P  Ѝ 0@0 Ѝ0@00@0-T  Ѝp@-PI(@P @婰@p 00p@-@8(0P 0嘰000۶ 00ضp@-MP`$(@P @ @僰0 0;p ,@Ѝp轶0@,T @Ѝp0p@-S P@0 C`0@;T 0 p$0P@p#aray0p@-S P@0 C`q0@`;Ty 0 pl$0P@p#dict0S p@-`@0 CPL0@;;T @Spp/0S p@-P@0 C`10@ ;T 2$,0P@3p#p/aray0S p@-P@0 C`0@:T $,0P@ph#p/dict0@- M@ ;p  P Ѝ0 Ѝ00 0 Ѝ00@- M@ :p  < P Ѝ0ݵ Ѝ0ٵ0 0 Ѝ0aray0@- M@ :p  < uP Ѝ0µ Ѝ0辵0 0 Ѝ0dict- M Ѝ- M} Ѝdictp@-@kP#0PPpdictp@-@_P#$0P p+00pboolp@-P`@P  0@"p@-@=@| @-@7@ @-@1@ @-@+@ @-@%@ @-@@ @-@@ @-@@ @-@ @0 @-@@I @-@@Z @-@@g @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ p@-P`U @P  0@N"pp@-P`C @P  0@<"pp@-P`1 @P  0@*"pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-P` @P  0@!pp@-P` @P  0@!pp@-P` @P  0@!pp@-P` @P  0@!pp@-P0`P @P  o0@!pp@-P` @P  ]0@!pp@-P` @P  K0@!pp@-P` @P  90@r!pp@-P` @P  '0@`!pp@-P0`Pk @P  0@L!pp@-P`Y @P  0@:!pp@-P`G @P  0@(!pp@-P`5 @P  0@!pp@-P`# @P  0@!pp@-P0`P @P  0@ pp@-PU@!(0P p0P 0pstngp@-P`@P  0@ pp@-P`@P  0@ pp@-`P @R!<P pmP U [pdatap@-P`@P  Y0@ pp@-P` @P  G0@ pA-P@!X0P p&`P  P `9)stngp@-P@ (0P pz0P 0pstngp@-P`@P  0@? pp@-P`@P  0@. p@-@R 0@$ p@-@P $0P pU00pboolp@-P`@P  0@ pp@-P @P O0@p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@5 @-@@K @-@@d @-@@u @-@@ @-@@ @-@@ @-@@ @-@@ @-@}@ @-@w@ @-@q@ @-@k@ p@-P`p@P  0@ipp@-P`@P 0@Zpp@-P`O@P  a0@Hpp@-P?@P 0@9pp@-P`.@P  @0@'pp@-P@P t0@pp@-P` @P  0@pp@-P@P S0@pp@-P0`P@P  0@pp@-P0P@P -0@pp@-P`@P  0@pp@-P@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@}pp@-Pt@P 0@npp@-P`c@P  u0@\pp@-PS@P 0@Mpp@-P0`P@@P  R0@9pp@-P0P-@P 0@'pp@-P`4@P  .0@pp@-P$@P b0@pp@-P`@P   0@pp@-P@P A0@pp@-P`@P  0@pp@-P@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P0`P@P  0@pp@-P0P@P 0@}pp@-P`@P  0@kpp@-Pz@P 0@\pp@-P`i@P  c0@Jpp@-PY@P 0@;pp@-P`H@P  B0@)pp@-P8@P v0@pp@-P`'@P  !0@pp@-P@P U0@pp@-P0`P@P  0@pp@-P0P@P /0@pp@-P@j(0P p0P 0pstngp@-P`y@P  0@pp@-Pi@P 0@pp@-P`_@P  0@pp@-PO@P 0@pp@-`Pj@<P p2P U  pdatap@-P`@P  p0@Wpp@-P`@P  ^0@Epp@-P@P 0@5pp@-P@P 0@%pA-P@X0P 2p"`P  IP `$stngp@-P@(0P p0P 0pstngp@-P`@P  0@pp@-P@P 10@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P j$h$p@PP 0S  p 0,@-$@@ P 0R @-P Q :o// P &t0, @-H⹫ Ӭ@-P Q @0ft0 H⨫g0 H⡫ d H 0S p@-\@`@@ PPpP p@ ,TA-P`pJ! !@P  `P ppX ϨP` O U @#F ##p@-P @`lPpP p@@- B!@P $ 0 0 0 A-pP /!@P  0 0 0 P!`P  :` P((0 H@ д/@-@P ئ@ k0E/H X}-A-M `V $P0 PB8@P pP  0P68 EЍAЍ/ЍAЍ/>Q/Hⶪ ϜU x@-@P @ $0E/H➪ <}p@-@P x0 0 0R0 P 0P Q ! p@pp Μp@-@P `0 0 0R P} 0P Q ! p@p P/0 0 0R /P/<0 0 0R0/P///d ͨ0P @-od  QP  QQ !/ P/ 0 0 0R/@-@P \0 0 0R   0P Q [!00P lP/00 0 0RP/// ,A-PPM /o00 0"P R Ѝ R0 0 p`P 0 S  R L  Y/(7 P` "  00 l 8 ,A-@PM 0 0 0R ЍQP 0 k 0p`P 0S `  PY/6 pP` !(00 [?-Ha ʐ X H; P -/o<0"0 0^ R  R/P/D0 0 0R /@-P oD xP/D0 0 0R /@-P o P /ol00 0"\ R RP Q f Q^ / Ȩ ȜfP 40 0 0RP LI/ HfA-(0`SM.P@U Ѝ P0 P pP 00  0P+ S(P0S0"Q00+ @P \ 0 0 0 @Ѝ, g P   P 00#  R0SSQ///@-@@ \dVp@-0(MS/"@R{S%   P{ 5` `tP P (Ѝp(ЍpL P {  5,  $0\ x& Ǭ 4  $@-@z @-(@@A-P``@P t(pP  b@P [9 ?W@$$0 xħL$ |M2P S0 P \0/S 0 P */\03#//0P S0 P \0/S 0 P */\03#//0@- P@M @ eЍ00@- P@M @ YЍ00@- P@M  @ KЍ00@- P@M  @ =Ѝ0@-@P ,0 0 0Rt /P/0 0 0R /2S!Q  P*0  S */@/0 SR* R0:/ /(P $0 0 0R //lP $0 0 0R //4P $0 0 0R //P $0 0 0R //P/\0 0 0R /2 S00 P0* /R0:P/\0 0 0R /2 S0 0P0* / R0:P/h0 0 0R /2S! R0// 0R0* /P/h0 0 0R /2S! R0// 0R0* /0P/H0 0 0R /"0R 0 /SP/h0 0 0R /2S! R0// 0R0* /XP/\0 0 0R /2 S00 P0* /R0:P/\0 0 0R /2 S0 0P0* / R0:lP/h0 0 0R /2S! R0// 0R0* /P/H0 0 0R /"0R 0 /SP/80 0 0R / 0 R0* /$P/80 0 0R / 0R0* /P/80 0 0R / 0S00/P/80 0 0R / 0S00/@P/T0 0 0R /2S0 S0 /! /P/80 0 0R / 0S00/ߌP/80 0 0R / 0 R0* /@P/80 0 0R / 0R0* /P/80 0 0R / 0S00/ިP/T0 0 0R /2S0 S0 /! /\ P -/o<0"0 0^ R  Rh/P/P \ /QQP/ZݘP/P \ /QQP/Z4P/P \ /PQRQ\/P/P \ /PQRQ\/l0C-M`000 00Sp pP Ѝ(@YP+ A( 0Q xRI t Qq&*0 00 0S  P ЍP Qq:D0"S?0"S; pq  0 00 S ( #0"S O-MM(@PlD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ ܂P 03/P 00  $ 0:/P 000 WPMߍ 0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-3KM `0 0@R @@@$@@@(@0 0Cs0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RFP0/S7 0(00>S: SA 0S p03  0Bs0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8͡ S =SB0"SQ0SN   0"R "R RAC$ >R<0 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pm \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R4\ BR   ;R<@{  @d0 8 "R /R 0oP 0 +r  R:Y Yy*     SP(0 Rh \Re  uRa AP [ +r PW6I0 r    0 # <  P,!*-"-  ƠP  * --  (  " "0   O-Ÿ M @ 0Ds0S<^QQ@`Q  0>S 0 T @P (0SP  R @v ЍT" T& @+P0 S00sP  @P T gPy0S  0S ( HG--PMp`@PL ,%pC &pF 0F fppSp>0? -P P~%u&  }0 `p r&Ѝ00 \0p``&`Ѝ L%`Ao/A-PP P`p @v@P@@n@P p40,p0P4080<09@-@ . |l@-(@@ >Lǀዜ∜@-@@O-4@T p`, uP @@D¤@`T P礀Qㅑ8080 0PZ PZ P t @-R 0P< P 4Q ,  4)`0 0Ϟ0 0Ȟd p@-@M4 00R1SP,0S@R 1`V, P` 0 03P 40, 0C40P" +`ЍpS" RЍpЍphZ<.0℞PPj?.0}<co?.0v$$N?.0o |y ` DiA-P`,p@P W 0 !፟,@0`,@0`C-`0@SPpMF  P 00Ѝ!0 .P ,0SV |!0 v/P ,0S(0S00  0iP 0S?0S0"S`0:S W0}S "S000"S v]P  WP @X 0 @aP 3$$w?{/0ɝ <  , 0p@-S X  Q P@)0@#p`0!.0⧝ $0S ,0 00V@-?%. 0╝@  4 @-R 0, B4 P @ 00'>/0~o?/0w  dO-80M@ Ѝ@p` CPP @ ` @Ѝ娒  <]PP0 4004QY  4 ,R\ 牱Q1v  ᒚ P 0YIV  B B!ᛅ,0 P 04 `<0 04 <0 P,UM<U7U+Y& xx @y ^P  PP( o 0,S<SS8 FvPh @ <0P0`<04 y< !G,0P 1YP  |,\0\02.0ⴜLW?/0⭜4?/0⦜Tt8l T2 < p@-@PP 0S D  Q <0 0 p@`0/0⁜ p@-@P 0`0VPP d d0 0  0@S0<  pPp `0/0W< O-0@SP MT p}`40SP p `iP@ ЍLP P 00S 0r  A> 00/PY 10Z/ @0R+ P$ [] P 0P 0S P( Hqpc0` ЍO J P 0  03/P  40R1# P P6>/0ěc 00C 0 P l`(@yTT?/0⭛@+? 0⥛ 0 Hx  < \@-@◙0,S<SS?/0⁛ PG-V Pp0`WSW@6 404 S @  S3 E000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<<-B> 0$$-F> 0 ! 7G-PS @- Y`' T 0p 0R ]  004 00R$ vP r 0S 0 G=XXG>I.00Қ,0,S <2.0Ú 1  KJG-PP' 0 0R"#4=pP 40S @,0aᄡ1 !  ,0`儡40@T:8 408 p0P 0  Q@-P80080/p@-@P80080p@p@-@P 80 0R@ pP4@php@-@P \0 0R@ pP`00S@#:p@p@-@P@pA-PP 0 0R4 p`40S @40S ,0P@ `tA-@P 0`0VpPp0S P @T <+? 0@@V 0A-PP /o0`0"Q@@T @0R p= @P @T 2@+? 0ⲙ T0P T@- ^ 400\@,/<2.0◙l  0P o@-p@ T\ @\400\@/<2.0r P @-PP M 81 0R Ѝ`@80  Ѝ@ 8P 4 0R S *,\$0 B!p@弁400C40<00<0``K.'> 0,HHK.M> 0$00N>K.0 0d <u v w P/?o0 2 R0S/0@ S/0P -?o82 ^0S 0 S /P/0 0@0R/`P/0 0@0R/4 P -/o<0"0@0^ R  R] / A-`P @PBpP (0Sp0P  pAT-`<  ` O-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L dIX% XP0@#r 1/t*0,S xBAA-PP 0 0R44pP 40S @,0a, 40a@T:8 408 mp@-P80080p@-@P 80 0R@ pPR0@Op@p@-@P 80 0R@ pP>4@;pp@-@P \0 0R@ pP`)00S@#:#p@p@-@PI@pp@-@P 80080p@p@-@P8@@@pp@-@P x0 0RP`40S ,0AT p@p@n?/ta uaA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@m@44?/t' ?/t  t tp@-@P H0 0R@ pP`F@ypA-PP0 0R@`j4P%80,0!qW# P P ,0P < 0@ 40< GA]AA4?;.tǐn?;.t sP s40P -?o82 ^0S 0 SD/tp@-`P pP@P (0S p@   0 //@-RP0p0 t uO-IMP  @T p `0 R 2/0yRX P Y  9/0  p PP @TL0P C003/Y@ 9/T =RT T @T@" 000Q 1/0;R# P/0S% 03/P& Y 9/R@TL0p d0P Iߍd0p h0p Y 9/Z 0 03/(0p ۏ u t s s s spP0/O-@MM(p NT 000 0\0+`P$  T%0 `jP4 0@ 4/@P`P@003/0 `OPMߍT00 0 P 0 $ \00 Mߍ((0 k R00 q# 0/0/@-@@A-pP`PM1 @T. 40@0W   WT 0 /R C 0CW /RW  W0 0 B/Q d!0C@T@! W0@ 0.< 0  R0* 0 0bp@  U 20P @*Pۍ%?00@ۍ S0p *P(Hp p 0P@ qP p@-R 0@S PR:   Pp?0P  , 0T90( D⫎<:p0( D⤎$;0( D❎p o o op@-@Q PPpQpC-0 MS~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ&㼐Q P&㴐Q xPPU a/U`U"0E'S0 rP\bP ]P PU /U\U fPnPtPbPUt 0  O/ PQQ 8P(0F/D n n n m m\ m 0S p@-P@ P@p 0Sp/p@-@QP Q  PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@>0Q/D⏍ kP#0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@>Q0Y/DV jl0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P p@>90-D icA-PPa Qpp0` XpWW@PS  PL <V`p p0 8/P>P;`<`nQ P P 0S 0P P 0SPT T /P P 0 P hT~ g~xp@-P@PP t 1P᷎0@벎@p yx011/A-\@`pP \1S 0 €  P 1nP1 `p P 0,0A0 4JB`0 4C h hp@-@^ P ^%QRS  T00NQRS"  TŒ 00Z0 4  gG-@R0(M0QP P 0 ` p Pl `0T?o20S00(Ѝp`0 g0 2/ / /    \ /0 2/ / /    \ /0     Q /0     P /p@-@PP`(M/ 0S, R00c$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0U P0V00(Ѝp@ R 0S V00 e0Q000 00/@-@p00T0\0]0^@-@T @-@T000 000S/@-p000 000S/@- p000 000S/@-`p000 000S/@- p000 000S/@-ٌp000 000S/@-Ɍp000 000S/@-㹌`p000 000S/@-㩌 p000 000S/@-㙌p000 000S/@-㉌p @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#CCHC 0 01/B001/B0 01 /B0S@-@1/00/p@-P0P0 0@0PS` Pp>pp/?000 000S-/@--p@-|000 000S/@-4pAo//0@-p@P M , P Ѝ00;0 tv _@-p@M D P pЍ 0;0 މ@tw _0@-pP@ M T T T ͋ 0 Ѝ0, @ Ѝ00:0 ⹉t _8p@-@ @ 080 ⧉ t^ _,p@-@PP (P$Pp070 ▉ _$p@-@PP (Pp070 ⇉ _(p@-@PP $Pp070 x _0@-@P  Y.<+ < 00;0 ^ _ @-@P (070 Q( _@-@P $070 C$ _$R/-ptx` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@ᎉ P//-ptx` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@P/80 0 @  0""048# /UUUU3333  Č=p@-PQ@t : Sj E Sd0 a Sp0  S?0c0 r-w-!- R00K <Rx  -   r-w-L  Q5 $Qx-1r-@w- T" T T-x:0p Ss0  Sw0 S?0l0Q s! R0s  tTSS   S?0b0A0a0-0090 އ YO-0AP@:  pP? P?  7pP% 00` 0@T% ބP0=S AP` AT BX ! Ył<0>0 ┇ ꐉ00{ XC-@X2M0 LD P @0H P@Lh p`XP `@\@h@d@l@XSpk p Lp` n{{n{ P  { p[ p0 0S04@R08@<@@00000v+0++0+g@1@00 0@0 007 te+X  ")0S kp@     Ѝ ~ oЍ @0 0  ߈ ۈ Xy WO-PMp 0GW"S00`0v@ᩁP-TPg +T@`0@ ǯ 0 m 0m P p   @00Ds \a0DSW0DA0DS"70DUr Y :P Q   S  R  "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`d00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 :UW ppsW  S00 0M0Ѝ6tX3O-PMp 0GW"S00`0v@݀P-TPg +T@`0@ ǯ 0 l 0l P p   @00Ds \a0DSW0DA0DS"70DUr Y :P Q   S  R Ƈ "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`ꘇ00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $nUW ppsW  P00 0M0Ѝ6q(3O-MD@؃ [0`P@HpV:V\ U0DPW p T"S 000@0`Ѝ0/00,0 0L0w@"0S 00000S0S Q +:[ -:0SV00ЍW00 Q0:[00:S0S @ X0K0 V<MX0 "00@ "00 OH O(-M{,0,0 0{ {000{0tЍnoO-S$MpPP@HL T P0S X0S d30 000@ 000@0 0P`ᙆ0"SX T 0"bC P 4$;RPF`  P0*S xS S' "0 @ P`$ЍX0 00T0 0P000P00S5#0QPP`V 0`Z0h0P 0$Ѝ5%&;RP<"009!0 |l!0 d u?/&1RP:*&6RP0$SPP  `01!&?RP00 TGH0 P0S@T0 8t 0 `PT /oL 0 `PT $dn N8 M L L L L K K K@- M|d"{@{ @0S H @0 0 |0 30Ѝ  @=/jj J-M{(,{ Ѝ 0 0 9/ ANm00/ G-@SP, pE`J\/Q# W/Q JKXP0 S0C0 PY 000 H J(O-I,MQ@p 0L R^ 0S 0) 09 P0S009`0S p) d)d  X)X    @o}PT0+0CP I @p  q 0| 0  0C 0B0 0 S00Q?0 0X0-SQT0;}P0-S 0 !000 ,Ѝ 8 H 0@00q p 70  ,Ѝ01 0 B0C0@嬧 :Q 3 0+ B RtP 0& WY :R 0S00007@0| | -Q000 6$  0 0R& 0 `=tPr A 0Z @P @` Pp@T wP~ P2M v `  Q Q 0@RTZAgv 0 Z Q! 500S 0:S   0Sl5 00+ C :S:Q ? ,Ѝ0JS0 S P0S,ЍA}TPX `0 W 0S 0 ܁TPX` H0 ҁ 0S dH0 ȁ,400S 0:S (  ' 30 h0X ⭁t;R0S00'X03 00S 0:S W d30 0+ C~0|  0S /0:S  X 010300 0 0S000200S 0:S 20MQ 0O00P200S 0:S hRZ< 01 S0$0002100S 0:S I00C 00!S0 0 00+ C H0  0S lh0 |10 4 h080 88!0 00S 0:S V000+ CR@@q 0 ! 10T th0̀h(( Ix Id   H   | 8 FX| Ed< D_ D\ D, C Ca Cx Bh Bx B A A @hO-pQ ` V 20 R" P@T60崢 R01-[@P-T@PC T"hRPP rPA -@r0P  :R9 20 0S " 000PP@:T0S! 000100S 0:S %1 0d?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S 0 0gP00P0 0 R0 VWST0 OQl0l 0 ^HD @< ?\ ?(H >8 >h >H >$D =@-@P @ 0/0  >@-@P @ 0/0 @ >@-@-\" \ \ R2s 1# 0P01 0 RL^"0 s 1# 00  0^u00<H0 9$00 3bT00 = =G-P @p0#03w0q0W`@DT@!  I 0R ! 0 P   G0@ pQP@-pp M P@P `P% .{0 @p{0 PP  Ѝ00P Ѝ0`)'P`0P`P 0 0 Xr"W0-0   X~"Vp@-@PP` /o"0p@ .I040 ~ :@-@P 0@ I0A0< ~ :\p@-@PP /o"p@; I060 ~ :T@-@PM 0 0rQPЍ000 x~ :00 4p@-@PP U xt00QUPQytp kt00QUPdt00Q0/0 M~ 91R ! /A-pR P@a@T T 1 !03/pWG /p@-@PZT 0p@/pA-`Qp@P R}P0开D00p 00$`,@(P0R 0 A-P`p@PB 0U0" V W- p`Pp`P|P, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`P00x`|Tp@-@PPM% U 0`1S ,0S ~$0S ~ ZpЍp4<80 z}0;0 s} 6 6@-@P 0S# us0 P @0P 0 000 01 1 00gs,0<0 G}F 0  6 p@-@PP$ U 0`1S ,0S 2~$0S +~DHpqp4980 }080 } 5 5|p@-@P s00CS00 PspP;P070 | 5<--M  6GЍ Ѝ/ -- M0 0F ЍЍ/0@-0P$M R0 PS @'  S%xx 0   B040!  $Ѝ00fx L0 000 0 PS@$   4 4 4P 4( P 8000S(/00// 3 3G-PRSQU 8M4p`2 YL\ U8   Q Q  2  i xV @P  i .@wPV$!1 0 40 30=8Ѝ@@(4P 0.|Y) @P@ PU WyP 0 0  | 2 a  w @Pd@P@XX0( 4| X0{'M<L 30; 2 2 2 2|- Mg ЍA-tt1 0!M@P0<80P`J p4 41p4 PP !1 0 <8 309!ݍ0 v|  @ 0Pp嵌PP@T Cn` x0P8TPxP @T@၌~,0,0 {#'KTJ 4 3A-!1 0!M@P0<80`d QPP 14幁PAp4t1 p孁0P5P  0$0(0,0000@ 0ppMPP"@T Cn` 0P8T勁PlxP @T@0S  T| d0 0 <8 30!ݍT00D<0<0D {&I  3 2\HDl 1O-ğFM MPQdč@`ᐤt嘄 T V Z XX ( 0K0;d 0P0S  0KPW  0 P(005aP _ $(Px #Ps$SWj ,Pj(J,HaP $@W ,< L_ #3 0 d4 30Fލ Ѝ|0P3Ԓ MwPwPi /~P@@W  QRC0Sk SIT" W?@Y/ 60 Z`0 IWPBL0 3zTF0 *zV?0 !zZ8x_0 z0X!0 W/60/$0S㈀6~ !P  0-6  W?@. 6 SKyp%pErGF / / /\ /( / . . .y .lz .H{ .$ . - - -T -8 - -@-DD1 0M`P000@P=  _zT p T0U0P @l@P@ 0 0 0 30$Ѝ{/000U00000{P0ݡ0t{0@o{@(]?a/ ey$BA +X @-@P @ ~]?f/ Ny *O-HHǟ M Mčĝ((ĝP "48 80S 0St $0S{ (0Sf PI3DP@Hh0  <0@pI P`6&@06 0!>0t6@000}?, @p0 Lp!  Pjz00S# z0=SPX PUPVPU bP@`z0#S< vx@T <=@00C@0z0 倀0 00 05 P%z00T0 @0 00 4~P 4 n,0$ze00$ze40S@00C@0  0p@D0 T !6* 0S3 P@@P 0\@?@ P ` pL@@& @TP@$@l&!gHPp p`|P4-0 - M } Ѝ@-0 0lM@P0d00p`    $P H0 0 d0 30 lЍ(X0d `h| 0 {,!0 { / gE#ͫ2TvO-tM, l 03?0\ 0 Pp (0 " 40*i (0 8` h;" 0#0<8i;b iˌ! @D`ah`#h,bhD͠lbˌ Pb+`c! . `P% PH`b,`+` ak,`&iKL` c c;lk"`&0P`;a;abk `&T`lhlˆ`k#`& X`ɠbˌb+ck! `& \`b)`+` ak,`&``c c;lk"`&0d`c=a;ah`e\bhl@` `@$e{@bk `&h`llˆL`Kbhl` `.i pp'`#. 0dkŒȌ̌iˌ pzhlpbb+j{c!, `/&hl̠L`ˌak. `ak&` p@c nk,`nk&c0c=da;lk `lk&aa4n`k#``k&nXlck!`ck&lT`bhl`kk`Hʠi`ˌeka. a)` 8p'⢘⋜搉e pxd[f{l c P(n[,Pn[%c 0\PRX\Pd[@踠jp '<SNzmv3he;#0T0 0g;)0隠l c{0P $h{cp0fa"a(f `hHekb.b(e P]@a[n&an( h4bf%bf! Lp `$ R0 00//(@-Mp @``P`W P0D>S 0!3100 0`Ѝ>SD 0!3100`00`00/-p@-M`P@U@0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, ,    ɄDA-@PP`p; =U( X0ES  S0 +0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0X0+00+0`0p@00(0]0 U^00 p@-PP@F 0a `0RuSpWS6X0CS0 p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D ] @I pO-0wSpTM 0@@ 0`004080<0S K0(0_ @(c_@T%X7(P0p000000G @ @  0 a0GS00 _00_0@_@PTЍ+W = W0 -S0000 0` X B R  = G/oS"!"   ( P:0,P_ ,w_ R, ("@P0 @(偑  ( 0S# (p W:,P\_p ,T_0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,P,_` ,$_ Rm, "@(`0`FP`(`   q`(=W +0G?o 2R0S$ Y,P_ ` ,^0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,P^ ` ,b^0S,0(`""`FP` @(`傑0X0 0!0($ KR; I?I00 KR<I ^0 @$j$0`0S^0"SB  V*(@ T:,P^ @,^0S(0,@0CP@(@Ty (2-+ 00 ` 0TЍ'pC  001]0 b\1]0 [\oꔱ1FsT^00(0UpJ 0{+l-L +B XR R  +B0 -R +R XR 0 -R  X@P`QpP0]0 \~80o0P [ӌ 0 B  h0@-@PPM 0{ P@{p`Ѝ0 0:0 [  4P 0 @-\/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`MP+MU PU  0   PN@P PPr_P `000p@8000O]0PH]P Xp@-0P@`T @T0rS Ppp@P0+Spp@0@-2$M000P0n 0Ss 0P 0N 1 00S$'Wxp@2 P! p  Ѝ0@T0S h~[00PwD  088l0x Yèppeeel G-`PPHM6 p 0 p@  p@ HЍ |P 0 np p@ HЍh[0S @X@0>0 ZY<0P R@ O-P4MP@\px WnX0S1 `00 S 5 040 0?!S5 0$0 0;!WbW0^ Y\ X00Uh5Sd50 0 0 0 0@0` P(0`0r 5`0D0$0XT 0S30`iW ,A0 `sTVWP@ ,(05#K 0P` X $ 2@0 8$*&  # #. B@T$0#"A $1?"!": #   `V4Ѝ3 00 0;!n3 00 0?!fd30$0H\.d0La#0L0|2pST0,@` P !SQ 0`V ^ @P,w ^[\"$:600%$0@"%>!!!0C("0T P%"1 #1O"QX00 0" 0$0 0?S%D P P@ v`1T101! T$?01>! R01"_0`A(0l10X00`d(00@t`dP(0 IS  R.1@$Q5< 0A`X0 0A$0PE `0P 0  &`0`090T dWt8H0T dW~` zGG Q\(\) x H ( SQ  @  O-PP@` Mo Tu V| p0 (T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @@0 <0\; \ @ p R@p\ p W R:\#Yp 00 0WT80 'WVllD0 Wzp,@ \?[*!]- t T 0p@-@PP U p@GHT0` VU((h0` Vp@G hEG-P@U T\ Pp ppq W00"1aP: $P] 0S\ 0 R 0C ` PP0 X= V  0s0S0 0 Q 0  ! 00S-*_oRe`VvP" U  !DWxxt0 VT\\0 zVDG0 rVqX00P   C-1 M0 M@P040`P$ Q? U5  0s0S0 0@ $03/!1 0 4 30<ۍ Ѝ%Qpp 0)VV U G0 V0 Vtt0 V P0VD40 VD dC 0 E D O-TTƟMM HMPč pTDe0] X@ 0SG VN 㰰WUZ0U@@ R R0 0C?o2 000RU$00 S0E0@b0S0000SgV $0+F0B 0@ 03/[o 0@ 0000,00G(0 03/P     0S00 * z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ P (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  00s0S0 P@T  0s0S0W04/P/ 0,0" $2 MލЍ  0.S0Sm 0. S|i0S  0@ 0J  2/0S0=  000.SP _ %P 0 @J~P? @ c  2/0IG(100+$0 00 `P0XX0C/Tr0V R 0D00 T0S0 TV0 T0 xT0$ 0QSnV0/(0 0 @  03/0~DD0y|X* $ L/    O-\\ßKM MPčp`Pؔܤ; WB UI YP \U /\@ @ 0\/\0 V'"2 0 4 30KލЍRZ/\3/00P/\V\% p80G/SW0G/SU0G/SY0G/S@Pp PmP 0   R  O 0T/S 0: S+ S 0 0 0 0 PX! +0s0S0 0@ (03/0S0: STq*/80 Rk0xPxP 0I/SG 0 zSxU/8 0R, pm Ln (o SO-şM5$M 0`P000P 4 QD @0~S<   pH 0S/S;RL 0B0 4ZS 0H*0; SP4S 0 0CPR- IR*0S0;R# 0X @H p S    hhh*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+p@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S  s000-S]Q q0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 BY0 [0!^0  @E  p4` L0P@ H *; P 6010Q@@Kp0 RU 0M/R0K/R0M/R 0lQ0TM/Q@7@5<?**[-]8 !   O-`QM@pM R W T   DRI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(B 0SV 0F0C  0WR0 0 @ ]RR ]RR xdd0R/9QX Wf@FU?R/.Q\$$0R/&QR  p Pp@-@P`PM( V/ 0  0 S /0{S 0\ {\ P 0# Ѝp0}S0S Ѝp@T0.PV40.PR 0 ` <A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ| \R@ @R@ )\ L 0 R+ލЍ0[/P@\ p@-`P Pp@0T1@D 0CPP @T*000p0]/cP D0S$ -*S ?0Cs\S0 P0S Q 0S 0 0/ 0p@-0@ TpP"TC ^ (a`00 0DS'0 00@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p @- ! a 1 `0 QM MR050  0 0 5 30-Qލ Ѝ ,p p@ P 0 [p @EO0  P@0, P 0' m  l5O-0$eP`M 500S E@ p#S"nQ0 崭P$ 0S $%P @ 0SSQ0SЍt `p  0@S0 0 40  0Sy t匤匔匄p ,p<0fS0fS 000#3R0 4$ 0000@SS 0oS 0oS0nS 000#3R0 # 000 LP  000#3R0000 4 LP 000#3R0 (# 000 KP( 000#3R04 " 000 0#S 20@ R@@@P00Ѝ0 S S DKP 000#3R0 (" 0@00u LKP  TKP3 000#3R0* ! 0 00V 000#3R0 ! 000GlPT 0@S0 @  \lKP =Q@ 0P0 0 dYKP=Q 0@0 0l⎝g@ 0P0 0lllkk  kdkjjiiiXh h Hhxh< Xg gH gp@-PP t$KP d@PDPPP 00p I0 M fP  @-,@@P 00eO-ȟ MȟpP P`@ UVYT~ 4 DpJ0<, RNW LI U 0p00 2c110 0p 00S? A8$00 0p P3pO<000S[  NUb l'`7 0 0 30Ѝ `s?0l0` Ⰸpp 00 PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S% I BqQ #S( H BqQ #S' G BqQ #S@ L BqQ #SU M BqQ #SK N BqQ #SA O BqQ #S: D BqQ #S E BqQ #S F BqQ #R 0S:U 0p0S7 Rj BC{P `0000  00  `$   @4000s00   $   3000s00S0 @  # 00   pW p[ p\N000@UN@W 0] NN000S FN0 0>NY 0 ![ 5N000@.N@00d@p00,(@ ((@(@00,0oX Xs[  Pky0Sy[t+L0_0 KDM00M  PIp~p` T?pt0`00R0`0 0SCK DqpLp )Y*0p0Z0 M0SY00J pl0S0, `00C0$  Lp8pPpMpJ-[= 3pCkp-pk@8  @ X 8 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF.pP 5P Ѝp\\ A-P`? A@0S'A@Q0+pPpPP d3M@@P  p0 @BAQA p0 p0 $0<0 J[[[[ pp@-p`pP`Pൿ@T T0T0 R@@p+P00ឿ*ZZ*A-P@P`@pᐿ0S |@@}F R"@`K@P00L0@o*$Z0Z)@- 00 Yx@-B`@MPDpP 0S|0A@@V ! @p UpЍ >0P  R 0QTG B&R  8A@Ι4˙PƙRS' Sp@ S'@z@ @S@u@@S 4⧙@q0@@@4❙q6@q4㕙@0P@@4⍙q; @ <  ~YY ~T ~\ ~< } } } } } }X0O-HH% BM M $$ ,u,%,p     000 0000+0IP 4 @0 47P (`P,@\ P 0S x400#S \ P 0S @4@D0@8@\ P 0S 4 D0@8@\ P 0S 30   \ 0P 0S l30\ 0P 0S ll30d3dS`F0\P+ 6 `< `P\ n@P 0S #EPPU PU FP20P0xS~ "p2 0 $4 30Bލ ЍP@\ @P{ 0S `200#SJ \ 1P 0S (2(B0@@\ "Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  1A0@ @\ 0P 0S Xl\10\ 0P 0S Kl,10 1P0P!0 $ 0 F0xS}0S y00  00 0000V@EPW }HW },V`V |LU |UUlU8U$ {H$TTS zSSl ylS, yXRRRR\ x|R@R0R p@-`@@0S P Dp

<@P0@00  $ P *  R%   U/R S /S @00 Q@0Q S @0 @Z0]S-P ]Jo0 RV 0 00@@tP 0-S P4VP]P@0t@ (pP]P \P6 SX0_P 0-SW PY0^ qf[Zd 0^ q  0@P fh2{0 ,F0SKH|<0 "FC@VZP{ St0P#Qq0@}e 0-S P@00`@S 0p0C00@P0V0   峠zZ3  0Pf/Z  %O    pP SP0k /7<0]SV /SZ \S{P n n@0P@-@ P G 0 Q 8QH?o2c l` l@p@-p`@`PBP BP T00pT 00pYG 0 p lO-0Ÿ M pc P   k i10 230Zߍ PT 0 |p H  P 7 R @; 0`  0P ]P& PP 0 dpP 0 IP0@T*p@ E 0 GpP F - R  j ppO-0Ÿ M pc P   10 230Zߍ 傺PT 0 p H  tP 7 R @; 0`  0P ջP& PP 0 pP 0 P0@T*p@ eE 0 pP TF - R  nnlO-0Ÿ M pc P   [ Y10 230Zߍ PT 0 fp H  P 7 R @; 0`  0P MP& PP 0 NpP 0 3P0@T*p@ D 0 1pP E - R  Z llLp@-\@0@`P@ [P0S SP 0p e0p@-\@0@`P@ P0S SP 0p dp@-\@0@`P@ 5P0S SxP 0p dX0 00 iX-H- M 0 S 0  00\100M0 R0    R ^8 00 0 0 30KH Ѝ/i$h-H- M 0 S 0  00\100M0 R0    R  98 00 0 0 30KH Ѝ/h8g -- M0 0m'--M  --M  A-pPPp` V Q @Q PD@h0 0000Af@00 B(80 B0g a4 a0P R   0// tO-t't7 0LM@P0D00 T P87f/02C$ǟ 0 A0 S 0* R 0 :R|RVF@P h l 0 p0P `t?PX00X0uT: P 8& X00X0($` p<F$0 @(0p$0 00p 5$ 0,  p 5$ 04 E @@P"l $ \5 0 'L p$0,% ,00 E @80p8 404$ 0<  p.4"0$ p 4"0$ p xx4"0$ p PP4"0$ p ((4$ 0P  p 4$ 0T  up*3$ 0  ip*`3S$ 0P؀ 30p000!40,460"4!,̠:0<(4(0448",0@< a@P8 @(  $ R  , .p ,=pE "pE` ' R E\ @0s@qTP  A@=@9@5@1@ p (   p$   p0@1 00Q#$P`N#< \P00 1@p0@$0t@5T0A1@00!0 0 D0 30)LЍ p @1"0  P E =PX00X0vhH0X @+Le (=<= < _ _p<, _< _; ^; ^;l ^S;$ ^8: ^: ]: ]:p ]d:@ ]4: ]9 \9 \9 \t9P \D9Q Z7P6VEW_L6 YTp@-@P? 0S0 2<0@0T;  T06 0R/Q T:\& 0 \/RT0C$0C/QT :0 BPU0P!T0x0pl@@@P` EA0D@@@0/S ,@@@ @@6,6 Z(5 Y Y YA-M`P;(A0P@: !0C p0 00    0 b0C S&0 pB0 0U0@S` 0S 0SA0"S D6#Ѝ T1r0:A00\@ YB h@-@P1 0S* ;@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0@  T D@8@0@/S7 W W W`0{-DM  {000p 804S DЍp@-P`%p P@p U V pp@pdVT pP U V VpP?o?o 0C-@c^?c^' ^./ "(0C0;: `pCc&Pc2681E270G2&0H000 /0 @- /0, 0-;BP @@ 7[D0 0/E0E0C004 0-;BP{$@G{6[D0{7P/ E0E0C0!/0Q Poo G-@a^?a^) ^?!1?1>(A14!50;:@pAa&`a43V4X4G0Y00000 /0 @- / k{0   ;B 0/AC0C0 [k{${@{7P/ AC0C0 J@ @-q@ J@ @-q J@ @-q J@ @-qPP `@-=@00p@-@PP  p@010 )> Q?0/R//R/?0S/R/P/R/p@-PMP`V @T 00>Ѝp{ : { 6&p@`($ E 54 Q00 R 4L,@-@00 0S@C (40 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"QI$\)P A-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`9@ 46P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍPP @@ @0(@$0PPPDO-pϟ 0 0XP(<Ѝ 0 P(000U00S  SG 0$`Ph08P p`C PK8 Pa5P p W R0 0$`0P 0p`C P/8 PE5P pW R0 (000@ 000@(X(P(PzW0  GS(  +S{ -S 00 00$P P䅐ಐ/P:U X$P( 2c2c2,,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pP70  P4P7 p7P  4PP+ 0(P 0  R9,0X0!0 B 1X/0 00; 0  0P(10 ,0 c0,@ 0PS,0(111v>C 0C,0  !/"b!!A0,0 X0 0000 0 L: ,0 @:,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(I 0 00X00 0090   0[P(X|X80   0IP( =0 P( X 0P( `8 ,, ,0 0CXP0(m000y 0 P(_000k 0, |,0#/A!b!b0C P0( G 0 Br0 S\0(0Q0X09@7 0 0P(@ c0 ,Q 0PS(, ; 0@0?2c11!, 0 0 0000X60   0P(X ;0 lP 0 0 S0 (0X(P0 0 P(%(P000 c0 ,P(00000  R 0s @`0PPv0 P@ `@ @a0Ka1c B  B0   0002 !/#b!!"A ğK/"bP 3 :bQ # 3,P b4p$ ,  Q000000&0@ 2?3c112B #K?###cR3:#cR#300#0010 !, 00C0 00@TP2 R0PR00D0PX$`p(P$0000PX$`p(P000,P !/#b!!0"A K/"bQ:2bS0#03|" 1 ,0 B00DRd , 04 00N(0~0 S!0r @PQO"  HPI 04 0N~ Q @(P0WPq 0(P00(PP @ ACLC|q \^JS S 00#3P0 z G/o"(PzW (PUSX ZSP  @ 0 P ( $0 0:0O M Q Il' G GnI$ EtP\)\( CD C BX A Q.10PE0,P ( $P( Pd#/"b!C;R, a2ba12TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @\ 0 @V~XP( 000 SeXP( 0000@>0S; 00@70S 0@0 H,0 0P P(00, 0C$0(w,^2000c^\0M0c$P   0P  P(00 , 0C$00(0P @   0P ,  p#P ( (0 b$ 900 0M0Ѝ4 q@Ѝ0,  (@P ) P |0 0 5 30ݍ Ѝ\0D0 5700@700R4<4$3 4,0   M Ѝ~2h--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-鈒@P p`M X X00?+7)00P @ P 00 00 P! !  D1XPF  )VP WT V[XPVppPpW` B 0`f`0 pP `PED8 0 -5W`!00 ! 1 008+ ЍN0XP C0PP00 #+ Ѝ 0 5`pPP V ٪pP `P00?0 4e1\ 2  1@-@ M*(0S2 (0 `0( `1/pwqP0)  0 0 PUR <0PU* ЍPpTP 0S  0CP*600pP*@-P M*(0S: O(0 "p0( p1/`vq@0/  0 0 @ToR <0@To*1`V ЍP`T@ 0S  0C@oZ6T00j*R600c*p@-PPD (A0S5 @Tp1 Rp00P0 h P 0S P0^ 0c0(Y 0P0 T0 SO,P K4P G8P Cp@@HM@0 40Sp 0K0 3eE - -p@-@$PPᵨQp@讨 @- @@᧨Q@表θ p@-,PPᚨ R@ᓨp΄ @-a@P`ME P 10p00S `  0 XR` ` 0@@S6  V8 CR 6!0A0 S0Q^(:ЍV   "Q @^ #R.S(@A a  00C0F0 y3 "^ #RN^^ N0 s0Q@* +4  R  *4 8/ D 0X\S 040:8 R РS /RdBx@-@`P 5LpL0ppD尀 xT   p(X *@-P`@ 50 A-鈆pP`@P( T.  r0 SSS8v S00 S 00500000050 2T40 2%0 0  00`50000  = 70Ls0 20-V00 ^V00;\ 40000 0K/l R000C000LS 0100C0 0?V`000 00000 \ \ 00y ,40000  70Ls0 0 h", 3010CP;\ cP3`b0D001~dP0j R SXc\Q l301K00 M \; =\J \7 00C00 LR0e0 D100C07" 0 0  T 00Ls0a" 0W0Cs0Z2 F0nR  \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00Ls0! 0W0Cs0 0 #\ 0 0 00Pi 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP>cP%dP:00Ls000Ls0 0<00sP00n' ) * *t ( (| (  &pO-`RM@p , [3 X PE 0 0H P@0 `D/PB V0F3 `  [ 0U( 00?7.1[?7.10@SS0T 0 0@D0 T0 E0 Ѝ200Ѝ S 200 $> # #0  00  = ,A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@0081003/0P !p0 $@ ڽ0V0 00 R (bP000P3/0P! U  R  SV  0STYP000U 3>/|(H +x4=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@P00810 03/0P !p0 $@ H0V0 00 R (ХP00 0P3/0P! U   R  SV  0SǦP00 0U 4` )0PA-@P| Pg+`Px rpPh  00^c<!"#b!0CaqV8 X p,PXU $001p00S \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(.P` p  0000St7P0000H0003/P 043>/,8=A-@P{ P*`Pw rp Pg  00^c<!#b!b0CaqV8 X p+,PXU $001p00S &\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(㕤P` p  000$0S㞥P0 $000D0003/P 0̂080SR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP T P00 D0D 0 p`P/0P xSR; G-P0`00Sp 3/00 Y @IP U T 00 00  Y @IP B T P00 D0D 0 p` P$/4XO-PPM M Q \ /\E lP)P:p/\ p P/ `K`\n @ /RR.\)  B R}/0  D0.  I ⤴p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/R_0W0[0娐 !uP-U  1)   RW  s.0/\0#p0 @/R0 X0/ ލ Ѝ @ ލ Ѝ.<0E/ X 0/ ?    PH1/00 +/>00&/00!/00/?00/00A-@P Q P`\PXp@P ᇳP`V .0"S &.00@p@-La P`M=  (00QP0忢P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P Ԥ 800  . 0 @X(@(p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 X, 00 Q, p  00/p@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D ,U(P0D ,p  O-ȟ M MDčpĝP$ 0x 0S 0S 0S t4!S S 0K0C04 8 0S:SYD H R0 0  Q!0A00M@04@@0' ᩫ0:S ( 00UePaE40D P%F0 :SS008$ 0:SS004 0 D   \  $  P@-0 00 -H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 8@ 00 0 0 30KH Ѝ/*,p@-0@@%G0PP0Lp xO-`@$MP l20pW]  0p0 u0?10eGP Zp ?P p J ` 0J0PH0 S": <&$ U10 r 1$4S1!$6t@ 000H$ mH0S "<100S (!1 0 0 307 $Ѝ U r 0pP Р ,^P 5SX0( ,VT00#    "PH H0Si`Ґ  8ˠ@-(@M@@0>PЍм  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A@{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T /&P0 0# 00Ѝ "&0Ѝ0-$M  00 0噩P$Ѝ0-$M  00 0剩P$Ѝ0 -M 00 0 xЍ 㣪 㪪0㢪/C-<< sMPPp`/ V5 @X0^00pAtA堘0Oܘ2{ PP0P >TA{0 0$00 @2 t0 0 1 30sߍX0G0 #V<H<0 #O H |0   M Ѝ\O-ϟp/  M # P 0_ We 000!R !X P  OP4%X 00S)00 R .> 0 3 30 ߍ`. 0zS  000P0C0 pXP l@0 0 P 0C PSP =0 $)#W H0 $ #a`0`F p0p0S8@0 P, 0P0CS0 0000偼0S0p0@0 0 P0 0C P0 SnP 00 pj0p0SaP 0Se0 0b00S 0p000Sp000e  0 P_P\+"W $TPR00SVp!p3`0 S` 0eP P` 00 000050p0S 00hʠ@0^T@pp,(0)#TIQ 0', 0$ 0 0$`-QU ]QP0 ` Q; @$00!0SVp!p3@`0 0X:P0X00 7P& 0  B00  `4#0 p PTPpG@0SW `P 0@0080偼0S P -00SA0p00p0S00 lP 08pG0W]p 8pFWp!> ᔈ m@(0H0p0+0AMS00 [m0H000CS0d000pWH R0XS 00 0 ( 0         0H 0 0(0 B0P0000F SK*N0 `p(@ș0V'(0 `@C8@ 0p>(00S P V ,$00SHV`@ T@0  R  R=  0 BV0 5 R~P/0pH  R{ @0H  R'  `V B   H 00 0SXP HX A 0p0 0000P00p BH H HQF@$p X , J (  x l 0 `pG00P0W0S`J 0000P T0$@p@00Lp0X0 0P00( m P5 0  B0 0  j  0 p P p/ p 0S $0 PS0pS`F V 7 P0 0@00^P ($@X T 0@0 0c0SP [($@  0(v00 ECi00 @V1$  ]R Rt@Pp00@0 0P00r$  ($ n4X y@P0 0P 00p,004@iSP NP IP DP ?Pd :P 0 $000C,00W[ 0$@(k ` @vV @ ^(0R0BH0R 4P-@0 `%V`p ,X@0Vp@H0 ?PH0 B   H `V  0SP H0 p H00CPOX0p0x5Lp0X@P0 00  ?oV20SX 00 0 0p B0V 0c RP]0 P V0 P 0  B0?0C  . 0(  廖p0 P s PX P`Fp0S jP [[ (0 {1(0 SA-@P`p0 &0@@-@`P MDp@0p0 000@ ЍҐA-8R@QP`w v 200S8 0P1S010q G000Pv`$ pW@0PE ͔PP] 0 t00P0 0 C `C000y0'  Q  Q*RQ0 <00@8 0 B`0YP#00P0s0 P ˠ0/B0L0`0  B0 0,`< 0p@-@P d|0@p@-0P$L`T M 0S pW  07/@P Ѝ@ Ѝ0804 H0p \0 00M 0ЍA-0P$L`TpM 0S $X 0 8/@P Ѝ@ Ѝp0 H0$ 00 0M0Ѝ<A-0P$L`TpM 0S (X 0 8/@P Ѝ}@ Ѝ y0 Hq0( 00 0M0ЍhA-0P$L`TpM 0S 4X 0 8/@P ЍH@ Ѝ >R/H<04 00 0M0Ѝ̔O-MD`PpZ@@Z T6 0US``$ZC 0S@ [= 0 `;/0S) @$lV 0S H[ 0 ;/@PЍ@Ѝ0$lV?%.H0Hh[y?/^0HJ>s/H0$}>[/^ h @  @-$$@M Ѝʜ@-0P$L`T M 0S 8pW  07/@P Ѝ@ Ѝ ?/H08p 0 00M 0Ѝ03?0/@-@`pPOxx0p尀 ὩT  0  ᳕$  ⪩᫦p < 0㰠O-ß$M `H0  0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT   ^DQ"2!Q   "  R  R  \00t0!#300@ 00@00 @0`PU*$Ѝ@0 0M  0@P-0 S^^?0@0 0`0  =P 0J ZS0 { 0J ZSw R @ \H1 0000 $Ѝ\v`\f`\r`\s`\00 00 00Cs0S  ``\a`\b`\t`\n`0ߒP0e 0 Dr Ra0\  @`r |qA- Q@Pp`# P=0D?o! D2]R0S =p0$!0@<  14 40 0 V V 0 P0 A ڜA-P@p`jP.T T |0! D32 0 A_T %D0$!0@<  1x x0 (0D,TS6I O-00ȟ SMDȟPP x`pt  ?o2V0S Y W w@Ő0P0  ὐ0P0 [00 p1# 0 S@ PdT- U T 0 1 #TP00? PPk@T`P @  CTP 0@T0P00HC1S@1@! <0`rpPD 0 (0%0S V <0 G0CPap1  * 50_?  Rp1  ' 50>  Rp1 00p1 00p1 00p1 "00p1@\00p100Mp1 L IP@T`|P$> @MI?   P( PzS?  TPS~0 0 YdE? H T$ `p@T 0p 9/P00#3 0 D1 30 Sߍ@@0`S$O 0S,0  _VR U 0004p@p`00 0 (  @ `ɠ8ʌ p`PQ^_A (, ^\*  P2 0*A5)q @. 00 (0<>p ᐑaP ~$0~s$@ 20 ,0 T 0 0S0"700 0Pxvt{00, 0R 00$00S$0000P04p0S 0SV W``w? 4p00J81 `@`,P(ΐ(0 [PY4*(  $0@0S$0 EQ  ᳐P U@I 00P0p0v\< \ 0 t L   ո Ք4 ҀL@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ:p@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝ p@-@QM`P0 0 `sЍp0@-@RMP0  0( P]Ѝ0@-@M 0 00 LЍ-M $=Ѝ-M $(/Ѝ@-@ M00000l0} @ D 80P @0 0 30 Ѝ @-@ M (0}/ 0 0  @ D <0P @0 0 30 ЍZ ͐00@-@QMP0 k0  }ό Ѝ0 ̴0@-@RMP0 T0( }PЍ0 X0p@-@QMP0`0 :0$ }ό`Ѝp -M00  }όyЍ ˠ-M, }gЍ h-8M  $}όUЍ $ 0-$M  00忛$ЍωV `  A-PP @TP ,0,MQ Q% R ``@T L0S 5S0T 0 < BQR@( @D Q\! 5`V `凉V`05,0 $ t P ,0<,0@`V   <,0`dV`P@,0   gP@ 5 0$ 5@T 0   0S00/,0 C /P00 \ F@Q20 X|@L0s ,0 `L0SS 5 ,0(rPv(oI,0hP0 \p,  /P W@ `n ` 0`0 00@kS 7P0 05 -PX,0 U@10p(8 505I,0 $0S005@?@p(0S P -,0 00p( 505ᑈ^``Z0(@U@R 0%$0L 0%$0   U D Pp@-@P T UUp3 0 p4"0 &00  A-PP`G L'p@,0 $5 S: S@T @7T V,0`<,0L0`S00/S , @ x00 jpp@ d00vP s 0 0 g 41p@-P@PP 0P0S 0`0d0Sp@L(n(k(i(և0B0 p A-10 0PS`@(M @Ppp 00 @0 P% 0 0CS%0  p0 0 0 4 5;1:(Ѝ 0@0<0W"0 0(Ѝ0 h , 0 00M 0Ѝp@-@PP P PpPp0*0 ' p@-@PP U p@Q D0B0 U(C<0  p@>   p@-@PP U p@2 D0B0 U(C<0 p@  hO-PMp 0GW"S00`0v@ P-TPg +T@`0@ ǯ 0 0 P p   @00Ds \a0DSW0DA0DS"70DUr Y :P Q   S  R  "000T7 W. 0p0R00S 0qS 0F0 Ѝ0S R 0@0`a00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $7UW ppsW  00 0M0Ѝ6L3@-@0LM`Pp@0 P LЍ`0 嵇LЍC-1 M0M`00<0pPՃt@P U d1 0S ǃP(0 ᓂ }P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0n SP0S  ܅څ@PPP(`(ͅ2P|pnfsuniop@-`T@p@  P@P p~0PyPp`@-@P @$F 0 (f @ @-M @^p 0: S  p  JЍJ00ЍO--3$@,M00 p@+P"+R%1``kX00Sx00w e0$0P@P0 U 0 * m@P 0 Hx P@0  ᩓp P@PE0S8 PUT0  Z*0P` R 0  U T 0F UA᷂PP @Xi 00D0@0 p$0@,Ѝ0 00 0$00S$0`0厂P P 0 !? $pp  ` @ 00 0v01[  `.00 0 0 S 0S[ P ` 0S  [ ᙄL00 $_ ?PP @ `W p@-P ~ @T @xT0 0pp@-@PP U   p@j 80:0 . U;<0 %  |/O-pP M@`0& X, @T Pf W P5@1 P1 5* P  8/P  00[W@D:P PU Ѝ8080  X @0   r sO-PLMP@< [ TUC <000D $0嫁P [ <0S 0pD0U00p000E< 0 0 00 p ;/P ```Y`* 0 ᄀ h @( p RPpp,004PZp ;/P  R ,0WB^P5P1@1*pIp ;/P  R <0 @I 0 @V@ 0Y:V0@  Y: p I0;/P0  <0 0I 00 `& R p0 S <`0 P00 Up `@ppP 000 C Sx 00`  F \0#03\0SU (, 0p4P8`p p ;/ P0 p0RP `pP ;/ PZ V 0W$0 S 0 X 0 H BX 3  S0 0 SQ1: (,0p4P8`0S$*$Q R0B0C0 0Y00|P@pD 0 S, 0Pe 0 <s00 `<0<S! ῂLЍ p@_4Xh0T $0W0T $ o op@-PP@" T( Pp 0_P 0S S]P p@~]p0p@/80w0t $Tx0t $ n np@-@PP U p@ 4_80g0 $Uh0 $ n nd0@-PP@ M T >]P Ѝ0^P 0SX00 _<00 $T 0 $yA m mp@-PP@! T' 0 0S p]P ^P \P  \P p@\800 $IT0 $@ l lG-PP@H T  R! R `V" V  0LXqXp$, 0  R R2 0 00 0 `V000 0`V 0.0 F0R#  0 0I0,$ 0\K/ ` 00 00 0000 0L l@% k k\ @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 c0:0 \ j| j\C- MpPÍ`@PL TB A< VP8 Y` z0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T e p0S % 0p 0 D0 00  T >  RP R0sIHx i iT i4 iO-`IM\ğ4M IM,J͍,@@P p`WP W0  $3 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l - J-  p ^p0<0J8 0BJ= 000$ X\0RPJ 1J- 0SJ=  0LKUV00Wj  Rn R  R RA R R< SJ= 0 J= 00fWV O<  UPj 0SU vz!J 0T  w J- 0S? aUV 00R R SJ= 00:0h1'0 0d$000H0 40QP$ @B Q ", R RJ͍ 0 ,(& RLP P P J= 00W0  9UPJ͍ `P PFF g f elO-ğ M@pQ `@#0 0CPS0 #3 0 0 30Ѝ#3 0 0 300 HD@pЍOWX D#  0T ἆ $XW: 000 ⪆pPCTA0S0SQWX00 R0SS 0SW S.YP00SL"0 T }T@@O 00QWX00VT iT 1i #ZpVT00ypYp  0PȠpY 0@D    DP030#? (0@Sp000 0qf 00  0kP 0 0 1 30Fߍ Y:wp0SX 0S 0P 0 0ȣ>=A-@P`p 0  0P p@-MP`CP@@P@T 0S  R0S 9P@PЍpPPЍpp@-@P pPpPp0@0  ]d0S/. AA0Cq.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M@0( P  0R0 0S  R la  haR 0Sd 0S 00 Ѝp  0S S R, 0S 0S0S 0S/@-/ 0 R /0S S/ 00S S/0S/ //0@-@P M 0S PP0 PD@0S0S 0S  Ѝ00n0 } XT@-pQM @Q`P Q Ѝ0SSp P*V0S# S!  0`S Ѝ Ѝ00S SD<0 4P 00@9 WP Wp@-@PP` U V 0pPp``D0P UDD`0P V((l0P  V V V\O-ŸM2 F 1 #A 01p $0p8 ` P0 0 000000 86 P [0 0 104030,؍<Ѝ0 R ,00,000(0PU,(Q Z Z ZQ[ ``x0 OgD[00@[00<[003 U@ 1 S @-00AM M@P čP`p1 U P P0 n P,@ ! 0 0 4 30#AލЍ0SP 0@ .Rd P @ HHHx0 Z00ꅠ0 R0 RL R, @-t!t1 0$M0000S`@ S2  0 V& p,0< S:* @\ 0S PU S  S0S \Rp`Vp h0 0 0 30$Ѝ0@ 0 100 00 /<.0G-@P`p W"  rkPP   @ @ !d<<D0 WW 0 N O OO-(M$ȟ4M M,&̍XQ,@P@$0 $0S 0S `0 <0&<00!S' &<00S &<00S @d'X7 0, 0 30.ݍ4ЍS$70 000S:0_>pC @80 0P3YP00  03/P 0@&<00&,SS00 40R0SP 0S@p$pU> ,``:00(Zp0 C  0XPPf00  03/P] PY@YY[p M40S?&<00S !T? Y YYT5pz_0D0 X@P200  4 P@) ZipP% $0 D0R4  4Su[ 4Sp 000p0 T &<00Sa 0D'TS@`V0(pX,`B [t H0<0P08 pPh@ 0nk[1 { 0{{ % %  0E {000000HP 0`q` R R 0   pR >O-Ÿ g @00@$0` pY i:92 I520Y0 0 S   S  R  R Q\  ^ \/oQ" S R0S  0PQ ,0 0S Q0S %0P 0 P?  0 B   (KP(GY 0( P p0`4P<p`P,@8Y 0S@TK 0S^ 0S S 00S P(0 0; REP RB R?0S0S ;0S(\!,;3< P 0 0PU `V  :00\ Q  P U V  R R  p Y P` 0S   0?S C" 0c6#PY 7 ^h \S㔐Q^ @ pTp0S 0`@ p$p T d:42 D52H 0SE0 S > S PR  PM 0@P0 0`P`&0(0 e?0 @?/YP](0@ S0 `P@T $PP@P HeFeT$PY@T@ pTt W 000`P 0 `pVPUT c0P$0N PH0:L0 0``H`fPPP=$ e0S5 0S e 0`@  ?3.QRSP㔐  P   P \?oR20S c R㔐J HP\CR PMVo `$p(,PP00 00SrP@T0 5$p0(,PpP S 00 0 P@T 0S00S`<`:  0 yP pY 0sP-q 0P R 00S R00V  P4 0PX 00S#S㔐R0S @@ =6. 00q,@ p0`4P8</dRSQ \`@ T P@P ddTS㔐d ` ` d@ 0PP 0  0OP ` @P ccY@?/ ` `Sca P c` 00aP  0 ``EePPH [:PmaP HHH HL0[`0L* c10;>(0$0d0PpU 0@Yᠰ @H|대`pPUp`K|`0B l` 0  0(TP`ph ! rP pPJ0K D Dp,0qP`K@,FH|,:0[ Sg S/ \`' |X 3 2 2 1t\ .f -0x ,0̬ iI R` 003 Q  R0R`U`7 pr$@0Pp0 0`0 a"0S0$0bH@P P0U 0PbP0U b0`$p(,P  Kb_._> fS hqP1x00x0 bq(`@H`0V00L0`bP\`O-PTMb Zi @` $1q0=>p0=~  PP` .0PE `0S S S T@P `0S 0 0 0 0=P0 0 U  Y [ 00  [ YU,@TЍTDD?/ Z((D0/ ' ' & k &h lG-XMp@᳀P `P@ 00  0 ⼀P 40S0. XЍ UP a 0 垀P a8 8<3P 4PPO 0 % %hO-ŸM2M 0`Q<000 Z 0Sq p@ lr < p A.=~ *8PPh 0#S( C0P$  =;0P  @ PRP R R UP(P tP4 @ R0 @PqtP $K(0K$ K$ 5P0(X PPU 00   P 0@PwP0 x0 0< 0 30ݍЍTTD0/i<<x0/_ꆔ $d $X " "<  " 0A-(M@ p`pP@w .P @PP Ϧ$0S0(Ѝ !@-@ _P t0  @0O-Ÿ 0 M* `@p1Lp! P PX  PPQ P Q*p!1 0 2 30`ߍ0@SPX 0@SZp00 0PO J00 0 P P ZY0 Y  0#P 0 Y:[ 0 0 X  R  XR P 0 tꢓ`A-pP`P@ 0 I 0P 00 $ $(-0AL. R@O-0LMp  D@00`P840 <0T8 0 0'00# 0(<  .  " |b*. ,`Hǂ@# @!P(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍjxǷV$ p|G*0FFi؋D\׾k"qyCI!%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ@-@P 0< <<8  00$00 8ͫgE#2Tv G-PPp`4 W* 0!ᣑ000? 0"@@i>V0: A0iS@I"p ` *80V@@p`F G4\0P 00P   p@- ! 1 0MPP0 00@( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@sLh0t T,00t Cl (  C-("(2 0 M0002"00 @00$ p P`0R   0XS 00 Q !. 0N X!H1 0 0 30 ЍQ  Aa 0s00C 80BS.R ^U* 00ۏRP 0ES0 S S^*0Wy000@^0 8< 4^*0 8<<\- MiP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0DNP  A- rM`PpP: U@ @X0^00pAtAKX0OX$1 000TAΌ LlYP2  0 wpP# 0@ZP 0 0 1 30rߍx0<0 `U\=@0 WP [00P 0P0lB| $ 0   M Ѝ -- M0 0 ЍЍ/--0 M0( 0 oЍ Ѝ/Pp@- MP@0x x` 0 l0  `@P@X@0@T  Ѝp $@-HH1 0M` !000ip @P   ip nh@ 0 0 0 30'Ѝ`hPpW @@T PU 0SP@VTQ00@5pi 0p@-P0@ 0 p0Z(0PZ(P,PZt` 0`0PP 0P 00 0ppP 00 0pp  0@-@ 0 0 0 0 0 _ 0 00@- 0 MP @0tZ 00P 0 @?o20c Ѝ0P2 00 0p@-@P 0U0 0pp@-@PKZ0PPGZ(0PDZ(P,PpO-p0Pj `,Pb 0@00 S S0 S S p0PP 00NPpU 7 0P,@P! 0P0,0S S S@ 0AS A@PQ% 0 PS0Q0000YP  XPP0@@PP p DG-@ 0`pM,0(Su: (TY0 T0U 00SQ 0 RK@D@T0PF   RB 0@D@D0P0S+ T0V  0 1  @D@TPH 00S#0A S0偠0D  ˋ=0S000 3 ⺋,0S% (0p@SY0ppOY(0pLY(p,p@ЍfXP  (,@ (  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0?p 0$  $ 0 5 Ѝ0O-PTMe pE,P@<@0 ppkZPb,V`P^ 0 pp^ZPS,PPU0 @\ \G \Q \A pp 0U00S hVP, p0 06 0@ ` R  R2 R[ R 0 @U 0 `X 0JX0L 0 TЍ @\L@ 0U  0⼰  30 ` ` 1 0 00LЍ 0 /?Ͽr s0|13? <Ͽ2/0 0 0@-S@ 3/@U@-p] Qdc @P 5_2/P ` 0@ PEPET% B B&"@@" PEPEX% B B""@@A PEPEe% B N B ^ w" ^ v N1 $1 0@`@DF$FA!B@  D B &"AA!@@  B B!"AA!@@ a Q@'P 5_2/P `<ϿL,PE PE T% B B&"LL",PE PE X% B B""LLA,PEPEe% B N B ^w" ^ ^ ^ , ($^$^4 ^0 ^2 `1@^ ^ N1@N1 `1@}^{ ^ ^ ^D@p4`@\lhdLH7y @-@P @ ZI0/0  p@-1!00 P@0 00D@1011.T 0@\0 S@ P pp0  00C1000L  00t@ ; A-PM<|p%Mh`QQ`pGQND@  N (0hЍ ,Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2S p 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`i  O-@`!4`PPRPPǟ M MčǟU tT<(6+Q0P40 0 ( 0&6 0x PL < 0H00V000t6p080@0d60P0\60D0x0,0 0 (P00Y00S <0`1  H0PU 0P 0U T LUiT2p0S 4,0?`5@P00P 0U8 V,0?`T5T0=< 0Q8 V 0 "iT,0? )R 0DP4`  ( `P,4 *꘤ t0 `tT P`0X  `t08`4d8`` 00SRP ^P0P40X0 @#p3 0 4 30ݍ ЍP0_P @t0Z[0S 00Y00S <0`1   IT `h40S "2 0 4 304ݍ ЍObR`x,0 (p?0r zhVU2d0E?`0t2h@0B?80d2l0X0X20\08chPF`EV1D PR0 U @`ShX0 Lh XX0  ^1T 000 .)X\PF0 A`EIVdh@l\0 䀉 ;U0 4@0 -  h X0  0T 000 .)XS gS-$s( @  r 4 ʸ p 8x pĨ   O-tM@@ `WPPt0 0PPp 0  0`14S, ἴᾤ0   t6< 0lV 1P80:\6< 0B>M_PU  0R,40008 U}g`1S   ;`1SU0P a0  0OP[0  0CPGP  P7P30  0+P0  0P 0  0P0  0P0 0P`1S|Y~ 8 < P0ppW  0R  0fpW 0pW  0R  0ofpWj 0pWe  0Rh ,0ofopWIpWF 0 PS 00 of`1S   $0 ` 0 `@0 `0 `, 000 0O tЍ   YP H2_P0  t0l002p0 t0`001p0 t0T001p0 t0Hq1p0 t0=RKRh OBftЍ tЍ80 kN&0 jF0 i>0 60 g. 0f&0 e0 `D T  4   p D  ` @ @-@`00AMM0 400p00 <PP0S sD 80 0 4 30AލЍ..h0,@-@ M pp P<`PP 0S <0030 Ѝ00S.S 0S Ѝ hp@-|0|AMPt 0 ` $ 0 @P !8 00 0 4 30Aލp詂d$p@-P@Q`  @Q ,bPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ80_0Pt0 `W00 Ѝ p@-@MP`0S 0 @S 0S@V00Ѝp80O@0t0 PV00Ѝp p@-MP@0@008@@T  0UЍp\`` Pt0UrO"*0@ P0Ѝp  xp@-Q`M |00<@dP 0PU  0VЍp<0_P0 `t0Ѝp @@ X@- MP@?0@0=<@@T  0U Ѝdpp Pt0pUN"* 4```@P0c Ѝ X( 0@-P M U{  U U= 2 E0R8   U@ &@Um U.A@O4U]  U:  Uc  U A@O&U+ UH UpA@'NU\A@O U HA@OU4A@)N (13N0@( P?  Ѝ0@@O@@&N@@O@@O@@}O@@O@@yO@@O@@wO@@O@@ Mt@@Oh@@O\@@ M R <  ި ސ | L < ,  ݼ ݬ ݜ ݌ |@-@k( Pb^  (0/b 0@- MPt@Op0@0B>MO@T  0U Ѝ040O@0 Pt0 Ѝ0 ܘh PMp@-@ML 0 Q0P0<00P@ 0 `0. +>_T @D K000X L0 0 <0 30 @Ѝp@Ѝ/ `.0 To0ꑀ\ O-PM@PP p`0 Q  ЍSs SRPP -\0  0+\0 0 30P0 00L1011 .\ 0 @T@ sq'R Q"  S#3 @ R Q" 0  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0` T000@0S Q# 0R#300@0S Q#  00R0#03!3 T 0T @ R P"  S#3 @ R P" 0  S # 3 # 0To}0 0K 0N0 000J00  08,O-@Q0 dM R R}20?\0QS0N0<02a!##tR2b1!A`2aL6RX2eDPQFW0E0@0(2h8's2b>?2crlqqHL01NਂhLΆbfXT P0H` aNIX ET AP[P0 T XI Z L Y O (0L0$0\0L 0@00H0, 0<0 p0D `40@[ KZ KY KdЍ00?N\0@R@(@j ό 0 0dЍdZ  PY  ͌<  րgibMӈQ  Ԉ@ \  @-@P 0D .R S0@*ST .P@Q QA.@P@@? - @-$MP`@P`[0pv> 00pp@ pp_p  /`Pc$Ѝ ҌC-@P@P p` MO 08/0`Hk= 0PE(P=P000P]0p`Pd 00{0 p  0%p =000SN=000S, -0 \= 0 BR"  H =< 0@ 0 p $ R 0S .S 0S 0S00S.S\P=<<0P=<00S|ppLd @?Pp(@0 p 0D 0 Sh.400400PJ0 0 0CS$040 p#( #,0 @C(0墏 :[@@D0 pd $0Sp(0 ZtpW 0 0ppO D;D+02###<00, 00C 0.0 .00R0C 0 AEp( 0 Z0D:08H+@B0?R0Sp p?/L @g 0ZDX: TP 0 NP@*9 0 0 30 ݍ Ѝ= 00H0<0@00 0 p@ 00 0plypp,` H =< 0@ 0 p0000< $0 BqP0H8 @I0? R0S?/=<00S 2@0D;8d 0R?Pp0 p < $0Pp B;PH<0P`$40p@C 0P`)Pm0 pd 0 P`PZG0@R_d 00p0 dpG 000d D; 00 Sp6 x20d 0 pCp& pXD{ W P zO0d 00 0 ,p 0SD[ =0003SP Tvp0 p DPUD 0Y 1!0E@IS 00 =<00Sy $2@P!200@DKq딵d f? PO0 p P*=<00C4UPP =<00S 10u00p00d D^?&0 p =<00ԀC  4 @PG TTp P 0U0 0 Hp{ 00e0T0PEg 0 plp0 Pc C0 P@D[ 0spV =-00< 0 SZ 0 PF=<00P C=+L0Y 10"34# 01;L0==1;L020 201;L000301;L0<=1;L0L10 1;L0 'p 0D 0 SNl20k@pTP0ti Upe  R @ T) 0d g0 p Y 0=+L0Y 10"3! 01;L0==1;L020 201;L0L00 18!;L>L C+A0Y 10"3 ! 01;A0==1;A020 1;A0;+A0Y 1 001 ;A>A C0;td4 8 Ϥ P ̨  ̌ ˰E ʠ ʌ % ɰ  ȸ h  Ơ @ * 0 d ˆ== ==== 0  L  p 8 0 X P H T  $UUUV=000+S =<00S@0@R_d 00 p0 Bp%  0 d 0 4p 0PU0D[\* pzOUD[R 0d 00 0 p=<00S2 Q=P<0PB@ F0 p*=<00S"0 S00 =<00S P2d 0RO000G pP0 p 000d D;04 0 p  0 d & 0 p 3 0DR  P/0@T#DK1#`0YGt0 opu=<00S S=P<0P< $0 BP^S 0P rpU jDK/pD{ 0d  0 ]p@ /pD{ 0d  0 Kp. p/p m/0 @i/d U?@p 0 3p H`@P< $0@P BP  DU0Pp `DK@/ 0@ d  0 p 0ZD3*p@88] 0 DPZ W0 [ph p 0d @ 0 wpZ pG@P 0 Z 0 ZdpF=<00S? -8L0@d D; R? p0 Hp+ <0$4p`p0PC 0 P0 1p 0 `pP HU 0 QPK,]=P<0PO=@  <<0=<00Ss x0 d 0]?i 0 p pW`D4 1RW@0`P (0@@@@= 0H 0m" XP *, P>P0@@ 04/(0H= 00WHD 0 S$@P0 p @P(0d 0>0w? 0 p ,@,@0 pP0 pb -< ?B !?C0 SG0 ompO=<00S ,P,@,PP0@D;?@02 U? `p0 Hp+ < $0`p BP"Hl=<00SN 0 Ch_ PPi=<00SB $0   <  BP0D 0 SH/ C 1#00 S0 o p70 H{= P 00!U@ *0,|. x0p> 08/0-pPE H{DP80 p0 H{= P 00d!U@ *0,- 0= 08/0-pPE H{DP]=P<0P-0 d= R=<00SD]=P<0P,] 0P CP] 0P CP P$ 0 PU0D[:=<0Ԁ<  `@PTDT l``Pp 0U0 0 HcpF 00e0T0PE2 0 Up7P\d P?0 Ep( Z pz_  TDK 0d 00 0 -pԀ   pPP\WWM @P` 0U0 0 Hp 00e0W0PEh 0 p0 HK= P 00 U*:0 ,XP H 5/0 p0 HK= P 00h U* :0 0 pY 0P CP*0Dp 0 p d A?p0` 0p  0 px 0 Bpq *P 0 Dpd =H{ ` 0PPZV *0,h( d08 08/=p`F `H{ `p 00 `{p; @0 EOp2 v* P0 D Cp& =H{ ` 0PPV *0,p' h0 0:/=p`F `H{ `p 00 `>p P0 p 9*P0 D p =H{ ` 0WPPV *0,|& t0 0:/=p`F `H{`p 00 `p `V0P Kp )@DK@0 p =H{ ` 0@PV *0,% 0 08/=p`FU `H{`pP 0 0Np 0 `p{ 0 Opt H,up0 pi  PDK 0 dPU0 vpY T0@PDK ]@`0 fpI < $0@` BP@0DK 0SX|)p @DKj_0d 0 ?p" f)@DKq0d 0 -p R)0d D;R?0 p < $0 BP 0D ԀC 03P@P-2 c``P 0U0 0 Hp 00e0T0PEžp 0 p )0D2d 0R?@0 p{T@0 Np 2d 0b?% 0 p0 p p@ 0@Z0D:Wڔ0 Npz0 ps @nԀ  o@PPTvT a``P 0U0 0 HtpW 00e0T0PE[Cp 0 dpFPpTڐ @ ( l  h L 4 (  < H T  @* X  d X < $  ``0 (p ` 0PCZ0 p `TDڄtmT>ژn``0 p `p=p<0Pp;+K Y0Y! ##00 !+K Y--!+K YY" !" !+K YY  # !+K Y,-!+K YY! " !+K Y 01 ;K0p PUD @- R  MAP  ,@0@(@@; Ĝ0 Ѝ MM$000 1 2Ѝ/ A-PS`)p@ @W0 V :00@PU &P(0@0T0T0@DT0S$0l0 ({P@ G-0`VA,:@0pT0&0 00 @T T P0S PU0T0 "$P P0@B(00A-QMtp$0PS@` 0! $, (0v(`Vc0S_(0S0! , $P, (0V+p100X&PP, 0 Q,0K+,U,T(0P0T(0 S0P$00Q (0, Ѝ 0F>P$, (` , \:,000\,:( ,00(0 SPU$P 0"00(00A-QMu`$0PS@p 0! $, (0w(pWd0S`(0S0! , $P, (0W,<0000.)PO,0 R,0JU,, (0 Q0QQ(0 S0P$00Q (0, Ѝ 0GP$, (p , \: ,010\, :!( ,00(0 SPU$P 0"@00;(00G-PP@`pf V\ Ti0 H0H8HH <4 T0 SS SP200,2 < "Ì!? P@D0  PT T00  #2<0 W 0"!:T@  H 0 = H0H 00 =00P*0PP00 ӿh80 ˿L00 ĿTW P@ pO-RPP@p Tv 0S7 t" `lRPHP [B T Wa@ Z 0 00@=ZB ѱPM [ [T WE 0@0 0Z 0[9Y^ T W0 0@ 1 0Yp 7:P$T W 0@ 2 0Yp 7:P[0% [ S 0S 00@ 80 -00 &wT W 0S S0S @=S0,,0  Z  ZP 00/|X00P @/4/,/ // @-`MP@lTp@X ( L0 < 0,M9 $V P ( A-pQ`PP@pP TF 00S?00XS; 0ST.C+SQ0,` 0000s0  0C Q7ࠃ0ࠓ0CQs 00000  0C Q700C20@?D0 Y$0>0 RVp A-Pp@GU`, T @ W0``W0 .pPEVp P7000 2000 S70Q00 V00gD0T 0x /\o/\///^l@-` @0 0DM0<000p2 0/0 RP500000C0< 00 0 <0 30DЍbiS |S O-d2drP0੒ 0 M #r @rgqC2(0,B刀B# C@$AR i!dP @`3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 Hzp# W0Y[0S    00000000SW 0 Wp@@ 0 DLp XW  0 M?p Y He0$ 4. Ѝ @ :$I%RX A-`pPӸ0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 p@-M P@ ȍp k`\ p Go4 (0 0 8 30ލpShO<N0-@- M0@R0  IPP * Ѝ@Ѝ/ ) Ѝ@Ѝ/;hPRp@- `@PfP\P0 ?p@OCJ~00pPRp@- `@PDP:P0 ?p@0C(\00pp@-@Q `P$PP0 ?p@ C<00pp@-P@BP p@ p@ p@-@P 0PS <0S P 00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00pP @pP Qp@-@P PtP  U 0 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W 0p ptp 0@`p> PPD1?0 0p 0>00D.00XS W#0p 0 000XS W ppp 0A0C0B QSWpppPg0p 0> 0W 0@ p p0@ p 3333334 b00 0M0ЍX | 0 Q?0S @-1\-- Mo ЍЍ/G-PP`P VV ኦ00 !PER !U6@  ኤPG0 hPU pWW@nPp X1 00e  @@pG  pF00U ; 0@0 0JH0B0 *V,C40 !5 _ _A-@PH`H0``@p e>T  S A  _lp@-@P00CS0 S u P `0 Pp>`u@-@P  0`00@060 Ư ^`- M 0/ Ѝp@-PP@ T 0 0 00 p8080 ⧯T D0 ➯ ^M ]NA-pP@`' T. V5 0S 0S 0P Q00 00 R` FQ`00`6P0\ eT@@p0\ \V$$|0\ S ] \a \bO-ß OM4`dPP `p@dh V Vt Z.` wP 30 00 [ .Q Q\.Q _ :!U!PX [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V P00 0 ` `匪0 0C SA: ϯ0  `0  '+00徰/00H!81 0 41 30EOߍ:[ 000$0( @,\0 0 0 `0P P00 ZZ00勰000 ‮E<4 ⩽PPK U.R}  :ṠP qZ Yp YBO-`PM@  0X0 X0_( 01$P? % 000 00 P @ p  P 0 "00qP > R  R 0 @`V  pWI1:pG`W:\pG`S C0   ` Z`pGA R +& 0 0 00@ߍ R R0 S S  ⲛ P} ` Q PD P@ !T: p% P@D X0P@- #[0i0 lZ  ᱮ[` pG Ka  ᤮ pG  Va NXV P 0$P 䠊` `p R R R RR T * EP  RPB($P@D PT p@`V0  只P% T ::`P ~P !T014@1:q0 80 0e%@ 0 @ 0 @0`pP`R%, 0@ 0@ 0  PP P 0 `@ X V U Td^@-pp10LMpP0D00@I LP0`S. @.0 \P) V) QPP0 0哨 0  CP 0 $  0 0 0 D0 30LЍ{CPpPPP O@ $T88C?F/ ⢬:X, R RL R C-`P@M: pPU, Y @@NO00: 0 ZCP0 $  0 Ѝ|@@JO @$T ЍCP P$$C?R/ P Q Q$ P O-ddʟ UMMLōHj|ŝpP`xE刕( 0 (0S 0 S00  90$0( "0P,0 0 PXS#``@ ,L$0)09 0 L5 30OUލЍ5 00GP0 $03/P PX:0 C/o"\ S Rf  塧P0 `@P@0,嬠V00 H05`00 0T0R?# 0DLp48X U_*``0 C 0@PT0 $03/PL @ Z'  P Up0P 0S4<0S 0 S  R06P0 0S!0S H0S0`5`0`V`*X0L 0R *@  nH0``0L@H000S048H0S 0, d0L 0U \ HQ  RN ZO[ p P p H`BP0 0 0S ! R soQ \ V\pp0XP 50$0W  H0S B@Gq 0SPSPڰP^!P"@Tp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @#L0 C0 0CS`: ٫0S?0 @0 @Pe0 s W?@xY 00@TX @@0P`@(`K S  C'SRE 0c@ 0`0%P `a'%1V?Z/ ␪(0S[]?Z/ ↪S(0P04D0,0b?R0 0 PP0 8 WT D0,1Q:*,p`P @ `@0` CR00V48,p@7PPp0`P@ CR00T@~P`@> $03/P `6,0D(@C 0T0|!0Ps  , D00D0DO" 0(A5PE0 NPP0 B WH0S0` T D0,1Q:*,0`,0᪥0SL@P` 0% r$|  0 Nύ00T0@!RPn 0`P@``,pd0%P R$\0P\ VU,0D(@C 0T0 !0P , D04   I I I G FA-@PPMD 0 S`04 S/0p 0sPP? P: 80 0P)P"  0 *0P!᛫U 00S S Ѝ0p!ᇫЍ00C?. Q! 0 DO-3BM0MPP040@ 0 00S00 S  0 "2 0 4 30BލЍ @pA~ `⍟ p0v#" 0 G_6P@T*X "2P0!  /B6@PH `PC 8 0 0@PH` 0 00 00000 00@!T> 0 p pIP ũ00S 0  0pW-   0 ڪ 0 { 0 tC?/ ✨_ ê 0 dἪ 00S S[ YᲪTh C C\ AG-M0`pዪ@P0P0 V 0   0 pPኪЍ 0 PP 0/ K @A-M`pPY@P , 0 (   P0@]Ѝ0, 0ЍA-@P MPp@`Q UX&0S8 0S0S8 P,1,!080 0<0  P00? p`P 00 ЍU U+ / 0 0 Ѝ0S  0 00S000\ S S 0SP @00?/ ǧ0 ? ( >O-<<ğ DM<h@P 0 (PP `spp0 `P kP 0,0 P0ß RR RR 0 R R $0 S S 4 E@P  0p 00S S S@ 1U g*@ ,@P 0S0 0 0R 0@B PE @ Y8:I S@@3 $? @ I@ Y#:  0 U@Iq E1P@GP `p   I  U>pɢ` V `p=; 0  0`!L1 0 <0 30GDЍ(IPPE pP (P@ P0 0 0 0 0Jp `pP0 00 0 0 000帨00pIRp` > =H =, p@-M`@P ),0,0   0iЍp@-M@ $$ 9 Ѝ@-MP`o @፨pP0P0 ɠ@0@ 0   @0PጨЍ40@-P MP@T 0t  P00 000B P 9 @ Ѝ0@T0 00C-a@P`PMR UX !0 `   p 0S  <  0C ^0 .SBW 0  @Ѝ0 XR   9S %@ pG W0 QU4 8<00T0m0 ҥU8n<0 ɥ @S x 9` 9@O-|ß|3 0,MPQ0$00@` RL Pf PT0@:T000 0i Tk 0#P P` `@0H ڗP Z `VU @ ZpW` @$pTᰐőF0S T0D@ S0 s\b 0rJp<0p [T TP W/00!1 0 $0 30h ,Ѝ!1 0 $0 30\,ЍO@:TP \p xP :Z9V/ 0S 0$ S`PqIp0p V T T0| YU0| <0| J0S i@$ps @.T`@$pTPezPTr 8| 7 6h 5@- 1 0,M@P0$00P`' U- 0p0H 00000002P*  0 0 $0 30,Ѝ覦 0 L0h0 ⚤U0i<0 ⑤)P  5 x 5 4O-HHş tMQl@p 0 R P P* t/ 0 $4 0 l0 300tЍTIP`<0T \Tu T 0S0` Px<0` I 0$40(,04801@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<0000j:000@T `0> Zg 0Sg* 0CR00`:)t"2 0 l0 30 tЍOP@PUF*0: T00S DX"H 0l 1[P3@T` 0Z00S RZ  @T0`zu YPr S 0 S P0@n Pa0SC: 0 Y Y Y@,!0Q 0  HP %x8 @R0PHP`0T ]W Tt T0` RuC0< P@0 j0~ : L0@

0[' + ᳖P#p 0;/pq 00P @ P 00 0 00 Ѝ蚡p p)P 0 Q+ L WY pp 0)P 00 0 SM  00 0;/pq 00PQßQ <PU;O0 {p0 ;/yqP0 r 00 0PUßR <0PUß`X0p\ Ri0/0dX0P\NS  00Q[ <P800CPU0&Z   "  RNPL0i/  0P;/pq@ 0P000P @ P ]00 0 PZ 00 `P)0S&: I y ?J0C0(;PTP 0S  0CPß01G0 APU0 Z 0CJ P&JPP @0P 0000 00P0 Ρ0ȣ 0 ٗ480 ⹡0 X  * *L )O-P,MPp@P` T 000S000Z00夗$0 0PP`W0 00@P $ 0R00SQR+X` P  0P 0t0  VP`P| [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pd z =P 0S   00S S0S S ^ S@@T000S00僜i0\#00& ^@ [ @@ S@ U80h0 ⬠0忖0D &,p@-@PP` U 00F G p 00pt060 ∠UX7<0 0 0@pw0TSs00 % % -M0 3/Ѝ/0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04P0 500 . $ $0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04h0\ 00\  $ #p@-@PP U 0S S S 0p@0/p0p@0/p40t П00t ɟ #H #(p@-@PP U 0S S S 0p@0/p0p@0/p40 ⢟00 ⛟ " "p0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 k00 d ! !0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 200 + & %0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 00  F E0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044>,0Y0,⹞ e 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044K?G/∞0a0G/⁞ ( 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04iS?O/P00O/I H (0@-PP@ M T 00P00 Ѝ08080.-T q[?.$  0@-PP@ M T 00P00 Ѝ08080^/T [?^/ $ 0@-@PP M, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/ɝ00a/ ,  0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044j?g/␝00g/≝ H (A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0t A0/Co<0<0m/B(#[?m/:   * A-PPp@`M2 W8 T& P R P P P @ЍPX B00@R X ЍA|&w?q/00q/W>q/ P` Y0@SP $q{r  ^ _ Hp@-@PP U  ;p@8080,⸜U ?,⯜  A-PPp@`, X2 W9 T P  R 0 R 0\A/V 0A/|| =/wd0d0/pXLL?/gW0?/^    0A-@PMP` 0J U@ 0pS S  P R`V V V ЍW  0SPW00Ѝ W` 0SPV@ll>%.T0/0%. Pp %{   p@-@PP U p@@ <0<0/ٛU$ >/Л#( h? H0@-@PP M. U4 0S S S Ѝ00 03/P 003/P  Ѝ0{0{ 03/P 003/ Ѝ08080/⑛U ?/∛ HW (0@-@PP M. U4 0S S S Ѝ00 03/P 003/P  Ѝ0{0{ 03/P 003/ Ѝ08080/JU ?/A ,{  p@-@PP U p@gD00/-U((?/$p@T  p@-@PP U p@D0D0/ U,,?/p@{ 8 p@-@PP U p@&D00/U((?/p@  p@-@PP U p@MD0D0/̚U,,?/Úp@: 4 @-M@P0.S00Ѝ!@-M@Rp  B0?R0S Ѝ 00 0┚0CЍ <0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / H0 00/ ð4// 40//O- M0 R Pԣ0г Pl \ Xg@.000\` @\e  X[@PAR0SI <  cSB!  S   XG`(S P@p@P  pGW`W0P@W `0FS@0 R R S*   Q @CT00SD$0@ PsT S n(00@ ЍAS0S010! 0 X@P \P!S" Cr <"-  X 0@Q 0;S@S \S ! C]R X@!#!! Cr  @ D"!!1Cs0#Š1 0 D0DX0@ESP0Sp pg' 0`B0i pg'!"h 0`40[000S*. 0 c  Q d $O-@pğp$M W0P Hd``XV @ppW \W* .W 0E0CH XF0 R S.R? pWP 0E0C 5 X3S0 X ń- PEU*0S0P(pW [W$ ܊P @Qq ъP @Qp ƊP @pWv(00$Ѝ] ᷊PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00    0]R' @R " XWQQ   Y I b"r RyA  PRA .R pW@Ne@@00Q    Y t " ^  @WX  P0R XW(@Qp59:fX0  0…1^S X ńY PEUV0SPUWX 0 | 40G-PA Q@J*`0S% RA @RpP00. 0Y80  ؠ 000s0 P00`S`00@NT00X0Spp$0]/PyAS 0SPQP!00P0Yk(0@0  (RO-P3P#RP3 M0U 0p`\ @U @RF R R2 B(00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ a?.P  Y*@T*0P 0A\ R!ɑ" 40S04 0 - M ЍO-pSP$M Y p 0 pS 0S0^@w @^` \rS0  H Y B `@p p@TW @0S @S] pZM ᣗTP @`T00 S Sn*p 0A>Sc B P_^p0Q ^ QC |(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00P(00@$ЍATw0S"@@A@pZ >@0Ġ?  0^q0A>Sp0pS#000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/P00@G0?Q0Sllv?}/PЕ Vw*p/Y P LP ((m?.P⽕B J j 8p@- M P0 `00Dp @ !p < 40 0 1 30ލp@'A $A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ@ tQ:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ 5(000 R!  Q 0 ARL ?R@- RQ0A  RL ?R 00C(00/C/A-@P`TP% UVT ọP @TP 0?Sp ؖ00Ӗ(00QSp@-`@P 反P@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1AP萖(00苖00ꇖ?00Q @-A?SSRB 0@S Al00g(00/-- Me ЍЍ/@-M@ !p TЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@P-TR +T} Y ?pW\`00D" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+וҕ0S \0J0 ЍY@0Te UGp Pa 0A0C0B QSlUPP[`?pa00Dꡕ0 0R0   ЍY @~0T+ U# Pp0a00D~0T00XS"@ 00DAAs PQ0Pp>cj p>cP0?0 hBPp>c00DZ00XS UPpb 0N00XS UpbPPp>c 0?U0@PP0@ p>cP334 00 0M0Ѝ A-$$ rMPPp`, V2 @X0^00pAtA0O `p00TAΌ 00`L PP9'0x @h0 0 1 30rߍL0F0 V0G<0 |> h T 40   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ O-@SM \ YX` 0pS000!R !01 ᳆PP E`#3`7P*Q30A 0#1#2#4#8  P 6   u U 0C  pSPP0 0@pQ 0S  ЍUT 0 @0000@0 GF 0 0 A-@`PpD0 0@D$0$ 0 M Ѝs \P p@-0 000St@@@pdddPP@P@P 0000 0 pNp@-P@ p@G-@`PÓtpt0plp 1 T  l50 @'   G @ 8A-pP@`  F y000@P p@-@PюPpp@O-8b8B`M@Q lRpPt $rpQ00l1PZ 0S` P U [@0Y P 0@[ P 0`V P:Z P0a`0pS PP @T q P 0S 3/0S `0PU@:W [ 0@@00/O Qx00p@@YЍTЍ0<0 0Ox ` N@MMp @-@!BM1M 0pPG040@@@ @@<aP`d ! R a@`@0 ! P0lA@ P; P1 0J8!1 0 4 30>BލЍߒP (ޒ@P  4/P Q Q 0 0#0 00P ’0 0 归 @ P 0S 3/ H000P < H  KK0@-@PP$M U! 0 P% 0 0   0P $Ѝ0XX<0H XEU<<|0H X<@` L~ (O-@PU  RM `100Xqp0S@ @@@ P ఀ $)A0PS,00a000S 000  000 000 000 OI@00044<0 XЏ xA-pP8  0S@P$ 0 @S 0`PP0S PU @P @U000 w 0P@@ P ((<0B/X⃏ DO-(ğlMR  0 S X 3`000Sa# 0S00 #3  04 4 0P YP|3|s|0@p 0V^ p p @QS  QN `P0 Sh @p $ 3/0  0PY@r@RPW00SS" 00C0T@lЍxB0@@@d20\ 000SN  R0200(   @(,0 @p 0TTP 0S 0 @00D00@00qP 0 S PW @@}(0XS,  , @0s R1 1S@X 1 0(   @(,0]6&>I/X␎0S XQ?I/Xℎ@lЍE?I/Xy@^(  (,04 p@FlEE8`DD0C x Hb aC-LLŸ DMpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W@!1 0 0 30^ЍU00ì?dPER ?\00S T?*N>?#c!!"N .  "bQl.5:bQX. 1d.#c!!2N 0  ]0@ S 0!Yw0`0S00p S `l0 @ pE``0 S00C  B2=0Q/,0A!b0dP  @HYF0`0S00? S 0  B2<0Q/,0A!b0dP  @'Y%0`0S00 S0 p@`; 0Q,00dP  @Y0`0S00 S0 p@`H; 0Q,00dP  @Y0`0S00 S[0Q#/ b !S : 0,00dP @Y0`0S00 S;p: 0Q,00dP  @Y0`0S00 Y" 0 p @e``p0 |@`u9 0Q,00 dP  @gYe0`0S00^ S()Q1?0c01Q 009 00dP @0@GYE0`0S00> S8 Q00dP  @0@.Y,0`0S00% Sd8 Q00 dP  T0@Y0`0S00 SU3PU/P7 Q00dP  @0@Y0`0S00 Sx7 0Q,00dP  @Y0`0S00 S_0 <008@0 0@D00dPH00L0080 0X0 &  Y0 `0S00 S8 0@90@ S0 Ř Y0`0S00 S!Y@0&  `0S00 S00(&@1?2c 1 R11Aãd0Sâ/c1S0c05dP0 0\YZ0`0S00S S 08  @8  p&80 S0R`05;4 0dP  0@0Y.0`0S00' S0 p@`0dPS00D4 0 0@ Y0`0S00 SY@0#  `0S00 S0 p@` 0@S 8 @ #pq   opq 0ASn R-Q Ry0c"Q312"0"b0A Yh0 ^ YP ` R  dP Y0`0S00 Y0 p|@W`r0@S 1Yj I` R  a S`]UPs 0@SU P 0P  Y   R ` R  ދP=0`p p@y`20@ S 1h Y)0`0S00" Y x lP\)\( m  ߄  ހ 8* ݰ T ܀ ۔ 0 ڨ H ٘ < ט < ֘ d l D Ԩn ш x hI$Q Ќ 8 ψ0@S 1 Y0`0S00 Yj 8  0@ P  0$ (P, VR\ gR 0` p`! 810 0A! ~0L,, ?A1c$ (P0T?"dN2c 1 11N @0?2cQ  111@/ d0 S  á/c1S0c01dP0 0pYn0`0S00g S082Q0,00dP YYW0`0S00P S ` `o 0P t4 d76C-MP@`ʊp<0@000 08 @pT `p巊pFЍ豊"00Ѝ@-$$@M Ѝ ~XO- M`p@Pl뀠P 0 X0X 0 0p0 @c Ѝw@ Ѝ ~O- M`p@P=|P 0 T000p 0~@5 ЍI@ Ѝ }D@-0N~ \0N~@ T \/T00\&00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q ! 0h !!!0C0Xÿ0+" ?00 #2>`T[ c0 i (: 600+$0+>! 0!Â!!!0C0(AX Oÿ@1+" ?00 #2>[?W'`F@PGp1#1 :#0! a,V"! / $25:(" 0"8#2>@"Q0 3 #P201d0U\d25? B4sppp0/S[0 hs c0 (a"(: 6 o`00+$0+.21110BX2;#(0`T[`n@t c0 ր4#$: 600*$0*.T3$1110B@Tp3 I:#$B0Ns3`0 `cR`@ V0$T Ba!kYC(1 ?  0c0㚀0($(: 600)$0!)>T$ 0Â!!!0C0t$X|ß)" ?00 #2>r/E B  2?A1c1c0R@ 0B 05P!@ 502c,%2c2A@" "b1C S/  0@ p0\\%\:#吅  00u!ό#1 W?0}:5$  *4Ϡ! 5*111A T 1#0 0! C2 ! 02">"@T0@000&  0@00U``PE0S0@P P$ 0Ѝ& t)1? 0 c00'):60 0($00'(>!!!0CH'0YP("0 #2>L<0`0@<' 0 @<0`0@&T 0 O-@P`PM 0S)  U 0$-> [Q>psŸ " 0<0  0 S !P10_00<0 S" 0Q0 U 0? UQ]0 #"<pp0U  0  R!yh&0P l6m&NSp@0GSH0P0 0Z0c 0S0ƒ!100 0[<hhPx@2[ OX10\100 1@T$ <T=0 S0S >S@ <S*S0S -S0 C Rp@0G0H 0 b9@h&lFpFtF0N  0h⺃@10 0*T@T -T00D S0@0ISm0S,S  ;S  ReH .BL S\ ,S;S[d00PT 0,SQx@PK 0SH  H L$ bh& `p&g.l6t(,p 0PpPş (w6"4$ cR,:$cR0#03 1d002c2c# b?0cX[  Z  R PpJ l$hpLP 0D$,p0P @ 0(400 0,p؀##4:#!BcR!:#cR0#03 1d002c2c3?0  cRp c s P R P x3t3p3,p01c000Z0 0D34p00g  00N  0h:@0@ 3 @w 04p80!  Z0S  |*Ϡ.l  a^Z R `S@ʟ@ <  VP@@% z .X )  W.y 5:IP % ^, Ό3# qdO0RS@dyWEVPP $ ` `E@E@ȟ(ȟ ,K(aoZ.h 11:h@h$ ^, Ό3# d S 0@W `PLH@1S\` VPE_ 0":60 0 0Ϡ!  >00Cइ 0R ?# 0Ϡ 0,όក(~C1   ቂᡍ  Dǟ 0R0 pǟ0 ' ^, Όp3p#p q\ ` V PE    U6 00cP:S8;Q$0(080` P@p`PL40#XT YW W0#Qp? 00?0S 8<@W 8<08~ 0Q}P RLQ q"."\R#- ! N,h ` -V` 0V`0V R YR Gύ ` YJ 0PQYmQ ``PY9 0mP hƑhP\QQo  0  0S   l0 0 00S 0?o2 0 `YT00 S~00( R RX0O-FM̟M FKO@P`1 0:S0@/S S  S .S0.S S 0S0/S iPP? 8p8̟ 0 L0}0@07@~T'>080+0$+P=0P0姾`Eo [*[:[4[$4*[\4010$:[#*[0$":[ 4!*[[4 01 0:[*[0$:[4Č:[*[0$:[4*[:[*[0$:[4*[:[X Z2\U}PS*[0$:[4 *[$ RJ@ TG ` VD001#01#00@$,Q6^F  DA9 0PS.`Z00æ0@T )9 F0 0 30ZFۍߍ0/S 60BQ 0R/S  2P  ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2P2SU PyU Ѝ\00P2S `@T 0400P2S!!!!!|   p $ A-`0P0Q0PP MS@P1 V7 T=p`0 80xq|q8OT@D @@p@`8P1TA`NPP%0@ 0 0 1 30ލd0P0 (rVHQL0 (rtT 0 b (, '\ z| z\-(0( 00M 00Ѝ & --8M$ 00  0 0 0~ЍЍ/ &h0--M0 pЍЍ/p@-0 0@PXh`00CS`0p S u P `X0 X PXhpXI`u %\0\ 0 `00CS`0ppSr P X0X /X* %\--00 M (0 X ЍЍ/ $--4 M0( 0 XЍ Ѝ/ $G-@SpP] 0S:X( (S Y" WH "h0` V V,* s0p0J00PM`sT 0 @00 `pp`u0P,0`Vp C000 g r0 0SJ 0 00gQ40 qp0=0 qIbnPD@0 q0 0Cg IPn v vp v@--M  9Ѝ Ѝ/ -- M0 0I ЍЍ/@-Q`PP@M8  C/pP& |p@P#  0P S 0p@ 0$  0, 0 (0 0 Ѝbs0000@Ѝ0 hЍ00>0 Jq !0 t@-@P Ig 0#C@Mg0;0 -q tRvY@-p@-@QPI 00!R ! 00! \ uP 0B RQ`' Q0AP R 0 U00SpeP dP `dP0 PW40 p 00B(0<0 pr 00 s sA- R`#P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!pP  w0S< 0[1!pqP  w0S p w0SB 0[1!pS w0S, 0[1!pD[O[Mw0S 0[1!p3 P>   w0S pT 0[1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% [1 0!p0 *R# 0B Q@ 00B SP i  w0S  qp q  w0S `p  ;  w0SV 0[1!pw0S Cp  0[1!pwX0S 0[1!pw0S 0[1!p}wM0S 0[1!ppw0S  pw/0S 0[1!pWw0S 0[1!pJ pu pn pgs R  0p 0Z  [@ 1, pJ pC  w0S p6  0[1!p  w0S 0[1!p I w0S p J w0S 0[1!p npD gpp T  [p$ Tp MpI Fp)_ w0S 0[1!p] w0S 0[1!p , wt0S p 0[1!pnE w0S p$R_0@' p7 w10S py  0[1!p?w0Sj 0[1!p2w0S pXw[0S pL@ w>0S p?  0[1!p  w 0S p*  0[1!p p P  pC {p tpD mp P  0B Q^@ 0B 0B P$R8 w" R 0Kp0 [1@ P  P  P  P  P  P  P  P q0 S p  0[1@!r P $R@00 P  P  P } Pz }x Pu xs Pp sn Pk ni Pf id Pa d_ P\ _Z PW ZU PR UP PM PK PH KF PC FA P> A< P9 <7 P4 72 P/ 2- ph p P( +& P# &!w0S p  0[1!p P   P  P  P  P O-@ϟM M0Pƍ0TH P@ H0S 0T00!R !000h00 Q 0SN   RT p H 0  0 L ,/찍 4 K/@(嘰d 00080l0`0$00@T$ `%T @T0PFU$0pJ!(0PQPw00$pT 0 @P `~0-1,0`4 0EZS00 Pw_P   R00s H0S P`p>+h1RRhO&h>TQ.`Ckˠ0MPQPDH T,TdD@|8HLI`P$`^P`$`0@ 0@004p00EPqp00E S$UG ,pS2 U zUP ]0P00(00{0$080S 8 0匠0@0S$00$00ZZ ,< 0 6 30U$܍ЍUX 0D \j@U`X QP @n~@\X<D-$0\, Q00S@00儰0AXP\ 0,0\K0~@DT#L^0`P0Q ,pAW%S@0$000(000@T0Sv \raU` P X0$ D -1 00 S0 00 SP0100 P000p0 `P 0BL00?V0X r -!S 80S O0P80 0p0S-0~00s<0 P 0, 0f 0dP0pPE@PK0`0`a0` p :% R 1P) 0 S0~0<0V B<`S-0`~0i @0` dPH`PEUVdU 0 @~U \0  X0<0D03S L0 0< D0010R+ S0bB- C S1!t, BcS0C0P0`00pBEQ0@*n0 Bg   Bc0b S00dP`NdP`0pPE0p0BPEP 0\~0-\ Qd00,0[,pAWWڐ堠 ᘐpGW   R ^ Y P  pGW( 0D0\p0@DTT&ڌp(G@DT   0R0 S X0P00S@DT 0 40\@0L DQQ8LP<@ET@T ڜ0Q`@0D<THX`p<W`  hQ00 PEUPU ڜ0Q`P0 UJZ[ZW`P(pP@FJZ    0RP0 S NX0P000AX0P004 Q/P`ph@qp@\q`L0 0PLP0 S  X0P 000( L@NZl\00S  W0P 00i0= ,(0pAW00W9Y`(P@FpGW   0RP0 S W0P00<pGW0*0 Pp0 S@0$0Xz堠pt@ @ᘐpHX   R ^ W P  HX( 0t@|0\0~Q-Q1@S(-0d0V~H 0 @\0U X0  <0D0S  JWP @@U S(0^L0(0CP0)0A00Q[  h00Q@TO L 8P~@\0`0SR  VP @@f0l0>00(S0  V0P 00O(0S0  V0P 00>~0S 0~Q00t V0P(( - t QS t V0P(  t T800NS `U~, ?0(`0 @P0\@X@<@D0S<0SP 0PS@@Z(x_`P(pP@FJZ   0RP0 S [V0P00JZ0  0\0 < 0  S0 P0Ϡ P0R-0q~0 0@S࠳   @S  R 00P1s 0P0 S-Q0X\ Ԏ@X  D@@H  %L`Q0#"002(c`38$ RD0P 00 S  P000 P000p 0 Q0P 00 r0-10l0XDpdP0pPE3S 1,0P`4p x0D RPPS 00C? 0@;S(0F0<0@8`\0X0/NP000 P0vt@dt4R堀P(PpH@DT$   0RP0 S  Q0P00 0S  Q0P 00  0\@0P@eD? P_ T0p@;  $0@00S0  PQ0P 00(0P0P00P0]P0 00~RP0 0倀P 0p0P P0PP0  P0 00~RP0  00(^s 0 R! ~0ZrSZ 0 0p1@R< 0P1^< 0 R! ~0=U^ 00~` 0S@ R@@aP0 R ~P0!9P00ppP00P0 R~pP0@i  RP0 R~pP0@lP0 R ~P0@0 \]=S(@0P0PpP0P0PP0Z0D \b] B0?V0L 1@ SP00P0$00 00H 00p 0SP0 , P0P0 R~P0@ :P0 R~P0@fP0 R~pP0@ZP0 R~pP0@s @8 S0P0`1 ` 000 P0#0H 0bp( 0SP0  P0 0pp껍@-@`P MDpkR@0p0 000@gR Ѝ ,A-@P`pQR0 w0@QRO-[T/ M p0L30P  , ЍO{[D{&{3`):U00XS Q0X j00Q )Q  0Ѝ|;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:i O-M<0p HJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0SqP [ $EU 0  UE\ PN Q UP   U 0CC10B2P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0J"00IZP0D^0[ @T0 QL 0S@00S P3 4^E *@C $`P `D21 2 Q\` V00 00S@0T@DUQV`Db  218 PE : @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E HP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq >JP@"00ЍSn Sh S4 `Pb@00@0 00V@ !HT 0 PeS5 0 0@0saF PeP\  0 S S II@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@K0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S 0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPV 0 BP @` pT  0 BPp0U`89@-M`p @ 0  B00C2S  6cJ @{k Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ SG0"S1 1  !2R / 3RS/0 00 c Ra `` 0 ` RA 880 ` R/oo`Дo0A-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q @ЍA-(a(1`pP0MS3 U10AT !0S 000嫺 ƻ@T  0S00 0Ѝ  @00D1S@000僺0S 000z spnlD !p0p@-@P0p R pPQ`00App@νD `[80 0QApp@O rppm Dl0  +0#10/sQ#8sQ#4  00/sQ #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P$pP   ! #Fl`hP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  E  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p17 @P4 P1 p@T `P@T10SfP@$ 000S 0 0@T 0C  pP@h0iV0S <0 ,0R0i nhpqhDg G-`0b@TP塢ڃ0TP$ Zp  D p0   a!  \2)R0L`0C\0030 `.pG \ `$-0P!1^$23\ *G-0@`@DTP  !1QF*32\ H*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@ H 00P0S 3 # Q0 A B  02NS cP 0!0P` A-P@Q`pE: 0` P0T @ *\ l1 0E%T& 501 P%&0;B0T `6,#511,?C- M{VP@P А4&66W0p0Y 0 CII5` Ѝ z P `!300SY 0C@@1` Ѝ0S0/0 R /@-Xap`@PMA @1P4PP2 _pP,0S  Q3 p 0: S,AP 0uPP0@ 0$  0,  0( 0 0ЍD00Ѝ\PL0E0 BD00DO00 g 0hTp@-@P 800CS00 P8pP0=0 \B@-@P 00CS00 @0I04 DBp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SD 0 p`0>0 A`p@-@P8 0S< 7 P00P! !' 0S 3/PP೼000P @ P 00 00`00aa7\0`` 0pw5P,080 AC 0P0@-@P 00!R !#P 0C 0;0 At@-@P 0 0 S @A50;0 zAXp@-Q@PPR 100S4 0 US 5000S: 0#$0 3/0P:s004p00P @ P w00< R 800p@0PwCGr4P00s05`0J08 A  0@000 pC 0 @00 a p-Ѝ/@-^@S S S  `0@ d D0@ LbB 0  0@ o@600 0 00000/<P@- 0At @B41S} C- Pq M  a 6/p`@`A/Gpd APpMOĀmX@Q 0pdhPS`Q 0pYhPHQ 0pOhP> Q 0pEhP4Q 0p;hP*Q 0p1hP Q 0p'hP@Q 0phP  T ЍFBOCB, Ѝ/haQ@-P @41S  P hP0"BA-4!@ pPP/1S 0L1= @P!6BPPPUQPMoP &PQp W Ap_oRApApp@-@P 0@@A-@`ĶP] VapP᷶PQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V eA0@B`A@SSO-P M1 Sw$aVp$(q SSp A`TO X`A (0Pʀ R `(q^ 0P@  Ѝ Co$B/0S (xp \ Q @pT`xP0TC G(VJ ( 1$! AT$$(0 [ `(0 A^% S :0  }@P@@@,A \$O(!r5 V(* T$1$$H0 >([$:((~ Q  0 $> $ @(!$AY 0 $>0(S 0 mPb ,0^0{$X\O-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 LlPPu2  $`lP$`  0 `P% 0@SP㲀0C  P\ \1 \"  dP  0 gP@0`00,Ѝ 0 gP0 0 †Ằ[ PಐU I  ^dP(A0DS V(Qp  0pJlP 0 @-@ ! \ @$?,?00,1S@-@0@ ?00,1R@-@1  @0t?,n? ,!G-᜕0S M; Ppw`Y@PJ WQ    Q?P 0 OpE?p/ !P  0?p '0 X$ PU! A/ Qp AP` V @Z|4  !2/@P OpC?pލ8ğ P(P OQ1P aD0!B1\0 Q!N5X QW0 ppP$4q$Q彲P ll 0hhhSh@dC 0` p 0! `pލ> m>Qyd>`V <P "4 008P` aDT=@ P=X PpP^4U Q\3P DD"PPeL4#9P3`Y Š  0$ dPO13 JI< ,0(`QP8XacP0Ƞ jD 04 `8P D ! <@ <PP ~%>``w0S 0>>@p>p[>p0#>@>@ QLa T,l0O-(P`P10p5fS@(Pp5 Rؑ۲P- (( ,0[ D D S 1"1 Ofꂡ ᠱP ر $ Jl< ؑ@-@ 13/, (Q0@-@Q -00 2= 0 O-fMS` $ [pW  "0!0 & %@P< Vi V1 Ve (0aV@ %TA  g%@P# 10CS`*0Fs @崒 0S 0S 0M@T  @崒(0QaVU @b,  1% 6%@P 0VSa V0F %@ % % @ ⴒ[ @Iy洒 U(01ḑ0CS㣠y'*z0YV) ` %V $@P 긑0(0 @崒 /`FvVv @: 0 bU3 @1b0 $M3 @崒, 1Y% $@P 1ᴐV0CSy`!*v0Ya V0F1ᴐቐ  10@! 5% $@Pc ` ` A0b0 $30Cs 0 4 0Fs/0!10@崐  % |$@P8 10CS`:D0b0 $2,0b0 $2 ,X\p@-@`PP 0 00(0`00Q(0pO-@ ƟP LMQDp` $00 2[V  400%5 0 D0 30\LЍ0w R*R* tp 0$00 <000S0 P8080 0Vk 1S6 #P䑄/  00 0!0{Ⱐ0 BR张:1S 0ZS000 P 0 00000S !P$  P 0崐V` S0! 1 BR,*0 H P 20 2r(k i0w Qx #`P_ 0 p  $R0CS㣰*{0Y* C00C 41! 0Cs0 ! 11 0 !0(0  0RK 1S RQ  RYF  # 20 2A0Q0i*10CZh PbJ0V㰐`0 2 i Sf # wp 0,00 4000S0(p0000(01 S0"1!{/010CSP*u00C S {?尐!0b0 $W1c0y漐`尐0N300D0b0 $D1,0b0 $=1 & &<|`O-(0pM I @aP0`f0PP P FPg1uP0y1JZqa@0 R 0 1Q@@10CS㣰N* 0Ks0S0Cs00 VqS10C1(0  0R/ Ѝ@ Q! R b0 `(0p) 0  PQ  p 0 0 p1 S0C1ȁ3b0 $0T> Y3 0I 1pP(00(0U QPEUP*0EY*0 p1Ps YQEQPEUP|*uP0EY Vp崑 (00(0D10CS0I*S ```@0 `p崑6P Q !PP @ PAPV(00 (0V"0!0!0 !PPo 1P0CS㣠7*0J 1wP(00  7"0b0 $00 1paP(00(00b0 $0u00C StQPEUP:P0b0 $/{80b0 $/ "s~X| {{{|p@-@PQQp e!P 0 0!Q X!P 0 0!ppO-P,a V0Fh  1@!@P! `Vp0ഀ0 0 po 10CS0s0*S0SS PP 1b0 $/  H 1zp0FV㴠q1p 0 R 0 1Spp10CS㣰4*0Ks0S  Cr 0 S00s060W10C1 e! R bP  0! 0 +PL! F!0b0 $*/yx\O-Pp@Q$M 1!00 2uT T 100$Ѝ(  @f T0 0$00  `PN  R Lt@Y* :P 0PeA 2@D @dT㴐: 0 bt@.Y:Aᴐ@DT@* 0t@ @DOoS0CB0  0p= 0S0C@0  P 10CS0N*s0SQP@ ) pP 10CS0*s0SC 1 X1@0CS0*s0S!P  m  hTp*t@TsP^ 20 2$Ѝ4b0 $c.T r 4b0 $V. g T` _ 0 0 P1  RA @44`0 0R7 `V A q, W@ t@@DXE 2 q Wl 0G 1P AᴀW@DT@: b$.d3b0 $.   pP]+P{ 2b0 $-02b0 $-G@W1 @t@ @01p 1 0@1@p01 MP@ Iy0   =P v@T 7T1/00`   P~ ,` 0R @T 뼁VpB 뼁0V" p0H 1P] XR  B1r W 崠0pG1 #!0IpGsw0崠1 加1 0 a P5 10CS㣐:\0b0 $;-  K Pwu@u tssDs$p@-@PM 0 0 P Ѝ050 -pDO-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ 5P .00H"<2 0 4 30Jލ Ѝ >@0X0 0UXS 00; Is0, T:)[' P0K/S  0味0P00: S .000S0I S.?00 1X0 ,QP@PV# 4- p!.0SY  \0 RK Y Pm.00W Lp zKP [.@oo G HonnpR Q0P:Q0Q:D-@-@-@@ $ @] Xp@-@P#(P$ J p@ޠ 0@-@T M 000 @帥P 0S  Ѝlྠ X 0O-TM Pp`0H0 @D8  $(4PD 0,0`< @@pLp PP  좟쒟肟 `p  @$ "dXb`%0#  `!,l(a `& `zcna'b(*abf` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah猈b,)` &`dL(bdl+`|.plXp`<%cjgpl& ```ga*aldH(d` &b()`b`j+g .pl\c:%pWpl̠*vP P00 000 0 O(Vv`4*V 0 rPP:Vv` *V 0 0sPP:1bL0d p&|bL0d p&1\bL0d p&@bL0d p&$0$0 $&ZhZHZ$ZYO-4M 01X0CSPᰐ0*10C 1R00r0 0*0S! @p`40 $ ,P(0Y P P0ES00 01P0P0PYi00CV 0@p P`Uv`d*0Pu@S0SZ 000pVwp:@@T,P*t@1@A(0  0R 1 S0"s0&1!V 0 0C01ő YX0X 0Ӂ 0C00 䒟V*R 0P0@Pr V @Bt@Q 01Y00!00Sd*00CV` YPU:( $0$&01 P0P P P r01P0 P0P h\P   r` @p-0v`@Vt@@TB*t0  Y !0s00 s014Ѝ   r   rpGwp@@T,PL:0 $%D00 $%hbL0d p%L0 $%`@p'VY4XW0UDUTTC-Mp`p@P%  kPP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍO-M@ p8<PPN 01 0 0 0رR 0ⲱ 0 1ᰰ0CS`G*v0[: ر `PF 01 00 00Q00岱000 P 0 0<0 007!p%Vp(@PЍ!pЍ 0p!0@P,bL0d p$ RO-\M`0儀pS>D0@ P(0$  t@T X&*1#0Cs0 11 " r S 0 0 0@SD@ a,^p  $8 008,000F 1 PR `V 0`0 v`0CcS00 p㰑1 0CS*0S 00p"@ `V@ 00 0 00CS00 1!R p0p  0  00 0VS00 IY㩐*y扐1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 0#S1 0Cs01 1   00000 K 0@00DpS, 0S 2  0   a0S @ R3@p00 , 0 S@Dp    \Ѝ3@S00 01040封HX㨀*004 1xpC0wp0qqᰁpHX㨀*0x03@S00 01040封H⨀Xx*X 0 0 sP:400 H x0 岁ᴁqpGpWwp*W 0 0 sP:0 0]  IY㩐`*y0V* C``F  001`01pL  G C@ = 9Je`V@Dp  0 00Q00 0 P} 0 0 0각HX㨀b*x戀1040F각HX㨀O*x戀1040`bL0d p" 2  0+ A]@ \ 0 0,bL0d p"/bL0d p"=bL0d p"SbL0d p" pbL0d p" 0!jbL0d p"hbL0d p"Lq0 $"DpQSPPJDIIIIxIHIHHO-@`şM ,p00 q p PG A@D@Tt@7*T/ p @Ѥ@spT PuP P 뤰P@D0t@ "  !P0 @L 0W 0GsP 0k P b$$"0  0Ѝ 2P  pUQZP10CS@*t0UQ 0 0PЍ P  ᴡ> @P 0㼡 W0  {00CR 뼡@ W 0J 1[P 0ZK[0嫰:2b0 $! 2 p P @P 10CS@c*0D@ 1PPE 0㼡 W0 D@ZTj 뼡0 W P0J 1P `1b0 $z!1@DPEt@ up@! @10p } P 10CS@: nE(1b0 $R!D b ^A0b0 $B!0p@Dt0' 1 01p01D P0 1 @Dt@ @U0PE10Z!0s00 !IXFE|DDR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ $@-@P L  0 0@ (w!0 "CO-@P2M0\0(P 00$` p @ ` pP0%0g#" 0," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00ЍBA$0G-1?p@P` @g(XQ !$0@0$0 0@`F0( 0`Hp& ?V8@F?@( 0@  @T 0 -$0<$0 00T 0?`@p?V @?V@F?@"@@< T"?@@@?`V (a "0 "A-@PP $`?7 )d p0(0 0`0$0d0V0 SAh K  08R(@R )@ b> (p8 6 )8 b0 (pR @-S/ @-@-@P P Ό 0 0@ ( 0 "=`R @-,/ @-p@-@P X00m]\`  0 P0 $$pP0P0L0@H 0D0 0p@RR Q b(PPGp  D0G-1p@P` gPX9 [$0 #$ L00L0H00H0`FP`P.VFppp$;  S$P*$0 $UPP`V Pa!$0 #$$0 $VF Pp  $;  S$P*$0 $U`‐V PR @-/p@-@PP C0 E8R pp@-@P X00k]\`  0 Ps0 $$p2R @-H/p@-@PP 0 E(R Pp00@-<PM0 P9 7@0;P4 zP DP6E@05P' 6P %6P 0P0Ġ@ 00 P0H p Hߍ0P00ߍ0?CPv 0P@ @0H ܕp HP ߍ0X0Ġ@ EDCB4P P@0H A噕4pH0<,+*)(&%{ {@ 0Ġ@ 0P^xd`GjFf0Ġ@ L.h0Ġ@ <L0Ġ@ <840,(2.HSPLHHP l0Ġ@ ,H0Ġ@ |,0Ġ@ d     dxG{0H {峔p l P@0H A墔p D0/ 0=@0S,¡p0Ġ@ `R606t658ϴ33T3432021 i0@0/ 0Ġ@ @ꚡ{G-p8M(`P {{FW@W@V@U@T4 0S !Q4 0S3 Q!-VL W`0b U p p P\K  0 020  @ 8Ѝ0SZ  Qp 0{ 0h2{`"P 0w ! r R  #m:VW$ Upm P`10    0 0UU0  P R & U  Pp\ P0 0VwW0 UpN 1 P0  `  } z00 R y000 xP0SQ q0Sy Yb @aU^ PTd0P0  T u(P t t\ t$@ sd s@ s r rx rL, q q< 0 P0  7p@-N0@T 03/@T̑PP ȑ00@T 03/@T\2p蹑H00@T 03/@T$p q q p p p pP@-@M@P Ѝ{  0{ p P(0A0 5 *H-M. 0ЍO-p@R M ഁУP  `B80 S! 0SK: Z 0 Z 0"80S8  0Q@0 E 0 0 Ѝ 2  Z  00  00 0 P 00  P00 2  P   P  000@-0 P R@MP Q( ! 0  0 Q   0 13/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! { > PU p @PnpP pPO-Mq0 P0 pG 0  PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@] P 0 a`F Q P@D pT 孞P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp (PW7:w` 5 7's0z_UPP604< W00S  0 \$ YPPU PBWY0– 2\< Q(( Q :PU 0 SR4@T h000S  00P<@T 4Z @ [`@ UD 0S7 0 4P0@SpU1c/`> SG 0 SR@T *000S $0S !j0` 0S 0@T 90@S c/\f0S   P0 SRPU 000S  8?000 SR@T 00 R 00$"00#3 0 2 30ߍc/\% p <@Td0 SR@T 000S  00c/\@0m@ *tX *㈀2 `0 R$S Uᅀ00*PKY`l2 0<`0p4pT4p0 S ((Wࠓࠃ\^` `0\݋\440 0 < \R< \T0` @ g P0 SR@TH `;00C@ @ `5`S 0PP ` l<@T@@ b W {@ 0 SR @T 000S  !@ վ` t aT< _ ^ 4 Z4 ZA-P`pX@M@`@00 0,00(000f0@؇Ѝ W@- A0@ @ €1p@-P@Q 0P ! "0 2pp@_p@-@P` VP#p0-P@  P 0S RP0/P *0?c0 ?oPP0/0/R00n B-ptx` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/@-$!$1 0MQ020# 0S0* /!PR*  R @ 1@r0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@. { d t/O-p?o2P00#R00,MSP JW@  0R0 000$00 0000SU 0SS0哨(g 0 00(S@C0 $P#  7/P 7/P` 0S 0 0P`0`cV0= F B R Q @E"PBPEUP!U Y*0SF* Sc:P 0C0 0000S0  RR㢀@(@ 0 P   `7/ 0P 0B  P @V, 7/PX X  00R0X 0 00 @`0#!0 R0 0X   S X 0 0 00  "! R0 0 S*S:  X  QX F ^ @E"PBPEUP!U @  B*7/P  7/Px 0 S 0SN 0#10S0S0壀S0哨( 0 0 X BuPS 0 1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 C  7/P P0P0Sy,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 'P 0 C07/PK 7/PPC7/P 7/P7/Pm  7/P e@S@8 ) 7/Pg  7/PP0 0 0@哢)YP `c⃰Z~* P  Uu@P 7/PmY Y   0 T0 0#0Q0 4mL0 (0l0 (z, -0 M0 ЍPR Q0P:Q0Q:@-A- 4PS@M  $3/ dp0 PQ00 4P4S  $3/000Ѝ100A- 4dpV:@T@T 0P0 S  00 S  0@P0`0dp@A A-`M p@P0: StPP ˅P@ P 0 \ tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0?  0@-SN 00AS 0娆O-4 MS{@Ap⇁0PS`*0S'  TP Z !P0 00 Q   0     Ѝ P?  0  PQ20 ǂ$R P1)00@000dS0  pq0Vp 0  $6/ Ѝ 00 Ѝ00O000Q 000A/0@-S@  R   0 0Sp@-@PT @T 0 app@TMP`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 !!!0 ?oP//@-P0Sp@M:Q !SV@Ѝ0A 0`~ P F @{Ѝ`T 0 @00O-PP X 0SL K 0SH p@ap-[0T B,B R`  0S7*V5* 1000P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D0(PQQ  /  D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:0P 00``F0``G  0Y0C00 00dP  n 0 0C0 ` d 000NP nX0G0 R X<H<0 I H00]D 00Yp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0Z0  $0p@-PP0 @`v p@ 0@0, P1 @+p pR0 q R/ S/p@-Q@PP: 100S 0  R 0   p,  0R0y0  0 0c0t 0 P @P Ӄ0 0 $0s0 $0<0  p  d@- aPP`p@M) W/ T6 p pxP0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0d00 P WH<0 G T(L0 > A-"2 R0hM@PP0d00< 0 C 00  X"L2 0 d0 30hЍ 0`0S# p0PO ! WP00\0pS pp6PP0001|0`  0St$p@l +:PA L10F L<10/R  0 p6{ {5{ 00{ 0SQ ` 000p p00` ppl0`  xP+  | 84 p@-@0MP>00Ta@V( Q0T1S O0T1SC0`+ 00UTX!\!R Ѝp@\!000Ѝp@00UX\! X\!0 000S/ pp@-0 00PUp@0~00TQU0` TQUP ~pX1P0X10T0`X1 ph0h 000S/@-@0~0X10CSX1 @~T1O0@~ p0 000S/g xp0 000S/p@-P@0~U0 \AQ\ X10CSX1 p@~`0T1O~0p@~ Pp-X X0 04M 0,008 00 0 ,0 304Ѝ> |p@-@QP  p@坐090  @,ttO-MD@؃ [0`P@HpVV\ U0DPW p T"S 000@0`Ѝ0l 00i 0 0L0@_ 0S Z 00U 000S0S Q +[ -0SV00ЍW00 Q0[00S0S @ X0K0 & V<MX0  "00@ "00-M{,0,0 0{ {000{0tЍ op@-@PP` 0S#U  ppqP%0/%p0:0p\CP0 @0A0 0S B80 L,p@-@PP`M% 0S+U2 0  0 pp00pq 0 :pp0Ѝp@ 0S00 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W 0p ptp 0@`p> PPD1?0 $90p 0>00D.00XS W#0p 0 000XS W ppp 0A0C0B QSWpppPg0p 0> 0W 0@ p p0@ p 3333334400 0M0Ѝ w`0@-PPM @0  ,P 8 ,0 0 0 30Ѝ0S8 w,X vH0 S8 0 / 00 @- v0 S 0,/00(@-\H0 S8 0 / 004@- u0 S 0,/00<@-H0 S8 0  / 00H@-o u8d0 S 0, /00P@-[H0 S8 0 / 00\@-F t0 S 0,/00d@-2pH0 S8 0 / 00p@- s0 S 0,/00x@- H0 S8 0 / 00@- sLx0 S 0,/00@-(H0 S8 0 / 00@- r0 S 0,/00@-H0 S8 0  / 00@- r00 S 0, /00@-H0 S8 0 / 00@-y q`0 S 0, /00@-e<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000h / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@R`P R U  V  R 0 p00 (lQRp@-`P@ 0S0 0 0R0  0pP0l (R S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00QQ00K M4 ,0 0 0 30Ѝ˫ ] \- BMMRč d X @ P   Psd1    \h0@- @-||Ÿxr M Mp$ȍP|`@M TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p0\ @p ] 0 xQBnP`.d0a/BzH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A0@-0M 00 000@>S@P  !0#00  :P0ЍM00Z,0 @-0M000 00@>S@ "0!,03,0  P0Ѝ)00@-@6@60 00/ T0-$0$0 0M 0+Ѝ T -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ Sp@-@p@-0@ ,ppPc0PpX\XH////// L//1O-0pPW`,M 02 00000"00  ( 05/,Ѝf@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+ 00 0 0 00hT0 0R0H00 0J@YYYYXXX`XLX8xT///O-̟ M 00P0Q0S Y [00<,0 0$00  00%SS   SP p0  0 0HZS00 X<  0`P, 0,@0R000  Q 0S00 [0ʄPU*0S [0Ԅ0ʄ`V* 00CS0C [ ʄ0S*00H00H SC  ^ 0 \0sRc{- S @# %%:P b`(a B0S`|t!h>0dU00`0d?* 000D@D 0P 0 `prpo@pl  0  `, P ,@ 0q *XM 00H S V ! 00H S /L|H P@T R ]0P  0CR P0bP 0`BC p-0x $Pp RPRP` p@ 0 0P00Q0A Z"* 00[ʅ Q00CS0C0 [ʄ0S* 0K D   0lX pp| 0000 Rp%\{0S P`@0 0P00Q0 Z0504p0{  R} @10Pd0P00S00LS0B 0? T0SPA`B 0Sb 0000  +00fpc0S 00]{ZUPP0  ' % R ǣp @!#2d00\< 0 _0 0R000 P0 R0   p0@P`  @00CS0C0S$0S) Z 04 0D Ts00CS0C  [ʄ0S*0S[ [0S000SS0S j 0 0000 v00CS0C8` P @ 0 Z0J0 #2 0 0 30Ѝ    000D0@N03  0   0 [000{ 00 Sy*3 P >RPP 0B  @00q 0    0 @ s0  0 "@ s0pp-HA@ 0000 d  @00qx|0D T#(0D T(@&  %  0 0/ pT0 0 G pXꕥ PԴ԰Ӝʹ F PA-|@P@ `l0pP@PU J0S 8/`PEuX@pW0:0  C`t8 0SS S  0R @-o/ 0R0@o/O-((@CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 0p `0pP sx0 h 0pÇL+  !p 0p/ BH B AG-0pS+ S'QU$ X!`@0S  0 0#40S 0S0S0S(  P# `VP@ Q@0 R!R  "$0 R R QO-`BM MVčH1 0!Ȁ Pp `V' 0  '^P@P U^^0 ZP;PH <0 0 4 30BލЍX ? >O-<<AM @ MTč1 0Y,:0`x0(SP3 0pW"W0 0@T ^^  0 P pW p   0]PL @0 0 4 30Aލ Ѝ0x0(S > =O-M Mtϟ0 p X0C [ !R & R# ` 0  0 ?p@X@0  0p t  0 H   R: R20P တuo@ pR KP p ᰐ4P R!Rs 6P PZ@ 0Sf 00 0[ p@`u_``0S 0@Sʰ00 9 S 0S%< d 8, [g0 @0040Xv?D0\4 0` S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@ (wP x@v0 P pP @0 40@ 040D00D0 0S \0S H0S!80S Q<00p  R  H RY *0ㄋ00ppt`0|@ 0 @5/P |4+$; 0 6 30Sݍ Ѝ00S0 Q 4@PD0Px !}D0P0 y  0 : X0p jD0q4000SB0T0C@0`S\0c  0`@V00 p`G /`&0 0$P 9`0>P090Z?L0/ 00 ,   F  +|PP. U<(0 0R0K `1  0 l90 X0L80 Z   80080/$ 00 0 SL@0b0!0t刀?A9c!{P m0S i@g0 P p0`ȟ-  ,80P80I Q"  (<  0 0P _R`1  0 70PX0 800 00}   1 01 080<`0 @({P& I 0 Pa  `1 p 0 60X0 ^80]0 M 00 TX6;PL0&08@ 0 X7@1Q 00U0pI} M 0W 0@`vQ@  ˆ20W000QP M  0 0vp1000P w 0 H5@X0 M0HP80 #{P 0D ~@|0 P o|0ğR/0  (0d0080o00lğK/0d @Ⰳ0W 0ʤM0 +S .0CSEDPB0 @^<@6@40Pa/P AQPRi `1SC 0    R 0H080n |P8R6`!!! Q2   30 @| X0X  0H R; 9 kqW *`pR|@P 0p t@7/P 0 80k`V~ q0 <2@X0 ~=0`!02 @XUP S0 \01S@ 3`0`00S S````P1, `0 m{P00 `)zP101@PDZhP p0< (00 y<00PK00 P 㸠D, =0 = 44 8h,TDCރ8 @ dxL4h TP Br R D yP10d0.P,0@'@ d06SV `v !ZXpT0H0x D0 P TP Br R D yP0d0@0P Pnp0L 0S\(0 0RS 0`1 x 0 10XP 0HX0   Xe'n0 0d @ PD 0 (2 X@`0r#Z0   3H0Sn=00fm00  dj0|p 0 Gr 0R0 D P T Br R D  R,#xPʊvX Aa0@ 0zP`P 1011S1 U000 30 X030 3@X@" 0cZ0   <0d02d000 \4 X0 #00`u0d0@0P mm0 08 ~(0d0`0d0 ` `0 xN l0+S .0CS&@0P ?m0X 7m%00 d*i05 @XP0 @ m&00$X d r/0-P@@0/M- 0  0 R1#0e(6,  Ѝ/;M-  0S R B 0S N   Ѝ/;M  0S 0 0 0CSЍ/RЍ/0@-$MP@yP$Ѝ0 yP͡0ıġ0"c110$Ѝ00@-$MP@xP$Ѝ0 xP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/bMO-@ß CMM,čŸR1 PXd ,p0$P0000 0   0p i P<QP0P\400_ PJ0$0= !8 S000 $0<\40 ; P0 0000 ; PP? P0. W T<10,430FCލЍS! yW 0S0Q+ Q% Q dW  C  `< 0p00 |~DW@W=W՜ # @$@ !C-XXPAM M č@`p04$ R6 ~!0 @` \~ P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @H 3~D ~Vr t O-AM⨑ M  čRwpPLpA@PF "PPB t @+0 @P7 0S4 `  0S+ 00@ p3P00@S 0S0S 00@ @K @ 4g @灮 }@ ,0 0 4 30AލЍ  4 hO-ß CMM`,čPp@X\I@DV0S`  .S@0SVI:TW d1#T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!"" T00 0 00P00S !  @D DR0$0 0s<  U80 uP0 1 00S|z0000   Rl@00S}0000 ~ 0s0S0S tUvoU  O-p0Ÿ\M P@`eT V 0"  #8 0ŌpU@ W 0 `\Ѝ 0FSX0 0 0 F~TP0swp1U.U0SUPPe   B RX00 0 B_TP UUU `H UVTѺ5(10P 0  |0 `F 0S0 s TwT T0sT0S`P  0P`HVTXV H$0@ P\Ѝ`HVT HD,C-@0 Mp`P()@D T@;)T0XpT뵐0 ! T  @`DT0?U0 S   Ѝ\xU LL$0 Pg Ѝ,E ` G-@P` p嶒Ẃ- F0S@`=0WV!9 LT@HT @,:0G?o`D2V0S ?V0*vG`D3T0?U0S X HH$0 P,,0 P `A|=O-0 MP䑐 0S2 @s胟p$` S S0  P$  < P- XPC  tP-0V 0  SR 0  SRS Ѝ Pd1 02d1 ,a{P0 HU{ P P060 P0 d9{ P  P090  |${000{t0:0 P P090090x xP010{  oP020r  Bf0P0Yi @i?P1?# c0 2Z EN0P0YQ @Q?P1?# c0 (3B 6P< @ K/P0102  M&P010)@-@HMsxs% 0{ P  |- 0 x{ 0grxHЍ @-AMT  s0000 00sЍ@@0@- 0 A0tMT0l00  }s 0P0#0U k@ 80 0 l0 30tЍ0@@%   A-@P!r 1!01n0SPpuOp rp0PSp@-Q@U x3s|p d01P d01000pqcXsVxqP //HP /W/ G-P@`>V$0QV@0\!R p Âp QVp "@p O-@L;_M M0@+08; 0P050Q0]U 0 0a01%`, 05p d!  d!. 0`1q1110bPP  Pʟ ~0ʏ Wό", d10 d1r YP( `P \b`0DPS_H [ p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000009yP ~?080}o 0p+0:P 1#S;S 0(S$ 0(Sq 0(S@ 0(S 0|(S p8 R00sS1 S SD(0 n/)(8 R1 S S0S00 S S SS@@ `0 a_A_0P@00Q.0A#A'S? |7R1 S S00 R00S 0P0 S S00 $ e@@ R R| 5 p@ @@@@@  @  uOg?8  . 0GPb4P R^P 04P 0R@x@J0d!S 0 0 0d1p Q0p|ᥨ1 |qp @ όx0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0 UPP /X0$004 0 5 30_ލ Ѝ4 Rq W W Zʠ$( k?$00,` `| k V V` VV00;V0SJ`V 84 @0p ;V  00@`V  YPP   cP 8 Q$h!IP ``V;V #0 00@`V;V   ?P 8 Zl`(,`z3 R1 S S0So00 S S SS@@d `P }` _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ000002"}_ᨕP.P ``0!x3!|3paDP` VDQ }owQTzI`, P 8 Qh!h!R1!RjPp M9p  u p\TmpP/ 0. S 00KL `_ x|x\(\<~$~}\(|d|plH4@zhzLO-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝ|@$0 `@-(0 $0 NrOo A-@@`V 0 CQPq6[P pG PZP 0`0 L@-@00 R \\  $0!0D0 0@ ($ T8@-@PL  0S  T0S@[[@[P/0-` 00 0Q,000 P0($0 p@-@P^0`D P 0(S  1T  0"00H`pp@-`0P"Y@P PYP 00p C*}ܠ A- 0@S  P p00  ( $ 8PP(p`P0d+O- ,0弻S 4Ms 0 +夫   / +~` P @h+0\{p^/  H[@P^_@@ T@ } @Q0 :Q , @T  :R^@Z :0 Z:P00<0 0Pt` `@ 00H4S   !d$R; PSt0 0,0Q090( RC 900 RB ) 0S  Q )0 0($kIk@(p` 0X90 4 R B8ɟ  B QR90  P`0N( ( ( X 0 80P ` I \4Ѝ8 0`P P @d8p0 00  D( 00D0DS: 8B0`800H@004  P`W0 0 0H0C 0 1 ,Pp$p$p(,(\x*ppQp(pW pA$pW P G@Y@`A$ppW0@  ^(0 1,P0 @P(@ @(`P, P  XP P  BR \`A Ng0@(`P,  P1#0S0 0 PPp`@(( Ҟp( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000%4000C?00s( $0KX$00( P A ,P$ppT (0$0 1000@`p $P1(P$@ uoP@` p$0 V$000\JW 30$1,k, 0, 02B0@ (HoP R-P( 01 (0LnPP$ 0 1(P$@<0 (P$@$10$*QPSKKG 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `|@ @0`0V ||||t{{t \y \|\v<trtr`rLrqqqT@-@P  0Q ^  00$0000 0@ ($ hp@-l@@`VpPPp0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0_U@P 0 P"P`p p``@ YbnA-p`@?UPP T  Y000P    E _AnHn4@-@@0/ $00(/000/004/00/00/ 00(/ߠ000/ߌ008/x008/dA-``PU 0AP p_pO0AP%W404 0 ,(0L T3VW/-@@ <0 Mb00a.WY Ѝތll @-@P 0`00@050 r<@-@Q 00 2  0 G-hsPp@M 0㖨p T 0S0{00 0  0 0$ -0{PP 0` 2$ "Z &= " 28 d 0 0 0 *pq| X X S00P0@f ci <R 2"B00?@VY 2: 2 (6eP)0] 2< 210 010010 010 0100100100P 0 R00   0T 0 2 13/p ЍTh0-00cPP 0`2 2y00@Z@P0S~X 2: 2l Py 2 @0 2@001400 48,nC-@`pQP M 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH aP (0 $( p 2 P7 ЍP Ѝd00P("- $X000X "R0#03(0 $X "X002S13/p E ЍR n.@-@`pQP M 100U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00PO-1PSM3:00 X'*q`I`[ Rp@ p W }0 PtZ 2< 2ЍЍЍSP O-MXr=*`00A̱PpP W [K DS@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 o Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0 8 PpXB Ѝ 2< 2 ЍuSP ЍG-pZ RbM* U0U @ RD0  P XЍ@ 2< 2ЍЍG-P഑p 0@E `` I`!\1Q1v`01 @Q=zQAq @0 R 0 1Q@10CS㣐/*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pT00 (<00 ($bP0h t{eeep@- @VP P 0@P yp s@p@-P`@Q g00T T L00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-P`@Q4M -00 Vu 2+ RI 13/p) 0 ! 2$  00 3 p`0 9/P 0 9/P  E`0P 4Ѝp$ 0  rq0 NP 2: 24Ѝ?p`(0 0,9/P 0  DD>I/,,I/D0w NqN}Nu 0A-s %!@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A=pPQ?U/>MW0O- @ştMTP @`ϝ0P(0f 0 ǝ P0 ^ (t@0 000 00P0 R= @ H $ p 0\ D@x N  H ᲀ@ pRڴ R  D@D <H P|  BHL  20@ r00(00@P @r P p4 X $ 0 00CS0s00 R(< @ @r 08pS0Q Ⴠ:8 0@00 00?P R 40rS 4"08<04 RrP\P0p0,Q0 00 R@P P 000pwpP;0s00 ᳠Z100S B CX TP\姘0S$0Q0 00 R 0P 0P 0 $0 000 PP,h40S 460 0`00 00  0P(d0S 0$ `@0T$0 hPY 4v0 Br 0X @.: 0H00( Pഀ0000 000tЍ( 084<0Y40StJl04800<0NLU]/Y? ",.= GG O-X\p0`S0P @L$P K JP' Y  0z S40  0(10S0 1$10$10 0S0%P 0 P0S 0P  00S 1$10$1j00O-MYP@000X00 ``FV(:S 1 !r `p pGwp 叻 0 F pF000H00 B 00p0@000 ``FV=*Yv`E V `!0p pGwp g0I`v`0s0抠G0Zp01`*0ಠ0`0p00PP{ Y```0S0`0Fyp0 ,0dp0 ,Y0v`0``FVk*Xv`V p0 0 00000``FVM*Xv`? Vp1p!w 0S Br p0 0`H`Fv` 0pwp0s0扐F0Y`01p *0ಐ0X0`0p0 00PP @00S;0`0FPЍЍ 0 ,u0p0 ,mp0 ,eheT0 ,]0Dkp`40b0 ,OFEEECCCCG-p`P@ S  R0 ҚU@ T6 P X0SH0SQ 0R0Ӳ00ô00 00As0R0 BY001*r 00 000UU800C80t 剐BY001*\ vHHp0 , 0R0ಐ0CSAO- R P0@ Br( R(,W ᬰ0P P I# O@P 0R  Br( Z`pV Z@  P@@p@-P@ 0^\ ^ P0Q Pp\ p pG-@` 0PS 0S  0 Q@PS"  00S p\: 0 BS P= 0 \ԙP   00(!S$! 10$1P0 P @0徐p 0Tp 0 S X10 B\r ᾐ៙P  $1 0$1(!00 O-\0`0CS0P@Lp M P I GP& 0 0  eP 0z S0  Ѝ0 0S0UP 0 0P000@- M@ P p10 Ѝ0O-@pM 0 0p`Hp` ֔ P PK0SRD0Z 00 @ @ 0 pWK0@r s pGW0F*0@p 0@000S p0Cps0W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 ǘP0 ,t0 ,0 pHHp0 ,00p0 ,0:f::t}:TG-Ÿw?`0 0MR,@pl2SL:0JSI Pz P崐2Sk1! BRE:0CS㣠j*z0Y* C00C 101@0p扐0p  20 20!(1 0 ,0 30A0Ѝ sP0 ZP崐 Z y0 p娪P202 _p 000 p$  ` 0 |p q$0b0 $Tz ,8A-@pPQ`M W00 2   Q Y:1Q|倷0" B1"0001 0 VA0 0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " wЍ00Ѝ0PU Q:(0 $P0PU`PDP  s FP 21 zF7@-0 -M  Tl lP 0PS @P000S 3/e S\U 8 80 $0Q/ $0S/ G< H5<<0 0R/$ 0S/ F PP5PA-@T 0S;pp`/yXP0P@QD 0 <\nP 0A/P&hO-@$MpMoGT|$vMpp4pD0q$4SO 0 ! 8  0SpC((BP b0@S3S10 3:3 3$$ 3$ $ 3  3$$ 3$ x3($ h3$,$`/O D3$D @ \$Ѝ $40$0($0,$0$0 S3000`V" P  2RC\PP2&C<90 p00Sh墋P\R0 p0 00CS0z ًp`  RF(4S VZ  4S8 0V0$R0S  [6@) 0@ 8000`006@FU0`00 W 4S ! D[6@ 4S $op ` V V ,4S ^op Iop4S VMop -op `000 ^op V?@0`ojf &zx&\A-&g&h&&t%d>O-@PMp`P nHfF @@00,3,#Ip: RPGP P o f0@3 hP>  2H@ P PxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  娉PPXPPqT! n`P "  㦹PP* ԺPh0SQ tㄉYPdqP:Sp`@ 8s%,1 B R  0S V X m 0S X  R 7/P  R 7$ F $ wF \YlW5%6-&zxG|(O-yMP!m{E0`Hx00 00 (CKp8`K[( 0RI St 0 0 \vPePRPGP8qf0@S (H0@ S aP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SQ0QK4Q q' P M/6pP/W  0 10S QRpa0S &0S0@0@P0P/S +R 0: S00! [s*Rp0: S 00000#/W00S %E0S0(00S00JpW   M0P0L h50 0"0P @/P05(%0CS0 $ `TE b ^ `pUPP0S 0Sr 00   B R\ L` V `,Q% /0 !P@`@0 !P` J/R  S/R/  # C  R:  ` ^6 3 0S S/R% 0lSR' Q0sX0 0H!LR\0X!\R\ 0X00: S 2 C C `KQ0: S P1: S  : S!  Sp  Sh m Sa S L0S !;oPM,0SK ! $WF0(尥 0Z Z80 S800 Q xPPP1: S 00Z0S 80`!0CS!80 TT0 @mPR X0O X0S !1o0S ! o5U[ (0S0S 0 0 Pp!|&&zx5%y%04h&6?O-@Pj8!C$&Hp6V@ FoP0E0Pevp0S0㗆 PNP E;p4P0805HP40|WpP0t%/,0@pPP8vP00 ,5,%HPNP8P H0  0$43/00P08004 Whp4p!0P01KpPP ,DpP /0P 1r$0 xrP0; S D0( @, "1H P85/TP0PO2PP P0Us嘓0 CS /1#SoP0 0, (S* B"!!0 5p8PU H003/p0S(iH0803/p aPP  &0 S * X  [0 $03/0 0 -Q0  V 0,4p0  0 -1/ 4P0 0 0 ,&0 &P0$ ,!o0 ,ذܠ[Z0 P  0 0&0 &  000 R^p0 0013/w So SCoX`\P0S , "PU`!0X`\PD AkS;<&zx\'%''''p $ ('`O-MMilA^Gw '8Gp 0 Q 0  pH0(0`7G@-Pn 0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S P㦄PU R0nR oR0P<0,`P  o>P8㍄`P,㭹PPP{> URRN , 0|5 P|Ppda4 1SzH0S?80S<@0S9 P0SP {P4PD0S 0$, +ep P44X(D`尠XV 0PU 0040D0S pލЍS ,0SP sP 娠=`0@0S0H0S 0  FrP P 3R㓵( F P3m W` Ǣ0Z åP l3  \I=P TT 0<40`FP MPP rPPT0SL20: SrPPP4 01!P4L  0R p 0P0 T0StH R 0 T0SH prP4T0S 03YV 8SS # WpVH    !  ,"   $ ! , (,"   < 8    L H  3]P   oP40SP8`'->S&h}&zx  /@-04eP000U00SOr0C?ou21@ (Ep0 1000C00S9 000-S40 2R)0pP EP SP l hTQsP xPqD84 4" 4" 4" 3!00000C0yǻP&,d@P |Sv!ЄTXcQLwPN<32S L#L0S@ls 3 0S 000S 0P 0vPၻPH000!S 0 t0S XRd-000S cP~DR@ #A1S bVqQ "gEP2S 1"RS:Ua`0:ErlQ100S S K!0`00~01?z@P6 Po @yPj @Pg 2S 0"r r r2S`A"PG2Sl p0"PP, H0"`(R0 0R'&zx&h-Sb'D' K'x&&@-@MP`/P@P@PH"3 0@B@r0 Cp= 2Q=0 q E - PW RZ R\ R3 0!BSQX :KPS0: SOF00 b Cpd10 ER!IpDNwPePLP PP0 FP f0@ S0 0000 0 0 0 0  Q |UO J@P0: SpGP ˈ@lo'%&zx} O-`M@dV=IqpP! Cp 10a1S 000`F0PmP pP |QeP x̀`YeP;[A Lp@л,0Z 0uJP0 0gJP 00/0 * R w0Z /0 0 U:^Ip @TNZEJP U:HIpn&zx-oO-JM M@jd <`R!Bp1 @DTr0 aS T  a~NiP fP hP vP00`0` 0QDIpP0: S !> PP P 0Y/S / J>00$CP@T ᘾ0p/SX/ P刾0 S:L7p`  pU'Y&zx(^A-`P@McD4 0C IP  H IP  H IP  H |IP  HPhݼd3P0\3P P$P@3( 0UP+( OP3( IP7( CP;( =P?P ( P5P( /P 4P8$@Ѝ(P (!P7P"I(0S (P(0S (P(0S (P(0S (Pq0S GP|!0S0S p TP`PLa @1R`ᠽPU 0E /R 7P(PU  00,0/00u-Z0 0CS0 P0$0v00S t~뎝0s00/ꏛ(R&h۩P(RLX۱%|ۣ'|^'+p@-@Pb;`LP PP `t @ph00SVbP~P R$] 0@L&zx&&O-MPb`:`pTFL&@p @6@X/(60S ЍfP WP! PP p `RP dP vP iP0p0 `rPxP pp0p0p$plq [,1 +0?S: '0S:{KS w: 00PU FP$0 S`0S;D+0: S Rf  S/o" R 0: SEP0S  {P SF 0SF P 0S 0?S 0S(SH&zxrREG-P@`0-9`p!>p 1 R1 p0C@P JpP vP0p`EP#+p0S aVP /P 0S 0S EP0+p0S C&zx(S0@-TM 70 $ DOEPOE@PFU0E0T000D 0DP00՛CS8⇹P3 ]P 30S S S" 30S!  R `#6 R H#!SRD3m F 3! $3 003 3  2v"20S! ( 2 20S 0S(002PU%B;qP@ 0W@chB00CS00  0 , y0S60016 R0S 10S<N=0PR<}0 01 10SO 10SK(Ih1T1PLD10S @10S T1 H1 t0S 060S 1@ 1 sE01!( G0S0F0S 00/r0S0S 00 "@pP@To(Z%l(T(U (](U (T(TI%x%(`%(TC-@MP E_72b@@0 S p ùW"^=pC 0 L1 0ZPl7h DPT)Px DP<)88 DP$)T7 0DS 00S8 @0xL)0QD0@0 0Q%@0SV L DPQz!a0@S0 @q:CP `z@@L4' (P &P &)P 0@0 00 @L3L30@0 00 0 夺PL'' [,D0S lx nDPX)H#&z|&zx###@ tB#@th#@t#&t##b-###؀tg#@-s^BHO-Mpj^06@0o0C?oPd20@@@@3#9p3 X XT 0S9 ZP7 [PP3 .zRPGPP ,l3H@ P PhP dP fP00vP00 3@00P00Pk 1 00T㠢 00B R; :P" @+ A0S #S(d+ 00 0 PP4 p00#@P/0Sx '. P  p p+ uCp y0S<0 0@00ty5h!0C S?0 0S 4$ p6  p0 R qX  Pp P    3/P00 S '$ p6 | p[p000S ~G$(b%$&zx$$-$%#(b%%$ %$O-M M`phpIq^^h5005h5 035 {h$9p 00_P + ZP )P+Q yA0@6S 0Y S~(0;pP hP` 04Tȟ S  SS @x05505 00505057 P ܸPH+ 7`+꘷  p0"S txP  p ~0"S ( z po0"S P 06xp),0z05000001 00 00g0e0c!%\HƟ  R  ^%PS00 00055UU 1 FY5S50`FV%R" 2) 0%0;lpPx%5S 0BP80: S055@%0IS00 YV05s.V1>܄$0P0 H$H⬍po&P wPP`  @d$iB6%d7x500000 0@@P#2 @@`@@@F@PCS0 E m 0SE   ,wpP3ꈼ0#S  ?F&[A: Y0D?o2?  ? PU H@P&f/ .PgxU d1PP/AgBG=00CS0 xP Pp PNU0 P00CS0<x0 V00S:00S:040V5101S'1S 1++PdPh!iB5%l|7V`fHP 4e-P 0P0V0 0Pw0`FVzP@AwP  f/Ѻ 傺T  0x+P(b55&3%X535556-&%5D5U5n5%&zx(d%6$615 *p(b56X6d&&dm36(cP@-ʒ7 0P @`P@p8G p:`00CS`0 PUH@T ЍX0 X @:(P&P &O-dM@` $ P 0t䄟4 $08p0+$p@DTlUU!Z %rUdU t0>pd$0 y dUQ 'RU2 SU> QU040,   @vtPcPSP PP:d @" nP tP0 aPP pU] [1lUT  :  $:h$ ?pX dЍ $,4$ ?p3!v 88 ?p2/( 8⇹ 8 Y  HT@D.PP`p u`TE`8 ?pPP<"X0B/!v  0!'X 0  1 P Q !u@0P0uTK 0@SdF\F0'p08+d08 pᾼ0PU 8 㵼 G( P P P0ZS :l0`V 9 z& ttF0P`\\Q-R&zxR(S^D~R<DD{Rd(D|RsRD}RRSRS3S5&haraydictO-0-xOaM222 22223220`p@@ 0$00,/F7pj ?" 2`FS 20000b2^S R2SVV10 dbV% ``L0q1p L-pP  ``L0d1ppd2S P>PX0: S0d2232d2o``So}0 =?iPpo0S g  zPRP3P/P:S@'P L=1@P A@P(=P 00j0000\ ,2W,00SP at<P0d2M0 2J02G02D02A02>@X\ T @DTaߍ02.202*02;/P_P000S V:p% 00Z / MPP000S D:p 0$0U /;P000S 2:p0 04s0(+2 [000 0B B3P 000S 3 S;3*00Z 0 P 000SX"\2RRX2LZ/ P P=PX0: S 9 PP ./ܨP )0  ^PsQb<PP "U<As=p \:zX10t  Zd `* ;Z 4 !!14,)S$ ;̢03S8  803L8X8 P 0@A RZ 2SW 2S 0sS ;p`!d2SM =p<W \1X! sX1\!0\82T72P7 Qh C>X 3232 32|U\2S'"2Q\2X" 1!8hh%4ii&(8Y i=S 2"0 2@pSb@ETLP ?AwBz|yAd >P@659P 募s`` 2x8< !` 2 8?0 !0 ` 2-86E 9P 0 00$0  0>2S3 bV02@t6@2S8P# !Ar0 0/00`7G@8P H2!` V!0T2<<23Sb @92AS``c*2S A8$)0 8PP ;;(0s$ q @Tl@#T @"20"0m;P`J;PLD itiq%4j1j]jj((jkknj jkk-0O- EM MP 00P00`PPP@ 0 $2pԄ0040pV4$D ލ ЍyPcP PP! TP' i\4 ST@=H$d0@S0 000000  +0 00000330S : ᤤpPqo00X A ~PA0SH8S R) Q$nQoQ0 )#0aPPq "A002"@xGP' BP" =P  |oU.;P cp@.D F8"88PB7$RSC00 AZpWD ` j)]P/ P1Z ?Zi@PHi?o[20S@ ?i `@T  j]`P4j/nP  8p. ;7P>04P(`CQښ. . a0C2,S!R. !$RU>"0n(H|%z&zx{&hz(`-(X{}{%Pzz(Pzz|D|e(h@dz(|6|AAde|v||}G-p@`㠁Q!0p$V】 0S 0S h``10pWA ʲP 8Ų0S  忲pW$ZЍyPmPPP fP E n0@ S0  0 0000000000`URV 0SPPXEPTEP 6X-(&zx`wO-H4MD$` 7P! 6P*60pD00PPP#0p4W00S 0S 0S  Pp3 a X( 0S008P h30S T-L*WPY430S ЍzPOPBP FPL i"P0@*S 002 ᧭P2 塭P200㘒"0 0b i >00P2` ᇭP00 @倭P00 0 c hPx s000o00l00i!0 mh1 P :17n777777878Q&t8>8dO-@`'M M⨆V$@@@ &(p㌦/6p0PKlU00S 0C0 1U0 U!qTPPy YDP㬀H= .p`*$0S   eAP* a@P5P 00@50S $<@Y dfXu9@000@0000p P P P4 P/  P*pP P( e}p qTPXq/e00 000#0 00$00 0%PP``P'ݍ Ѝ( P(@TPY z1 PP(!hP( ]/``PP p8ᢥ0PP 0(`p` qSP 00 00$0 00PP `P _P`P _P PdrP PmP DhP!@jP0`PZ <P( ]Pp` 1P( +S /?Pm``ᾣV":r0 0-p` d!d.P-0SH00 000$0 00 0P0@(p .ps-q-ᇣ0Pa0SJ(S'- 29S!S1X/0S (k\`P@\pd:G(8=a9d&zx=9L-=<:=9=n<==x=(H@dz(Ade p@-P@Hp@-P@Hop@-P@H@-op@-P@HPp@-P@Hpp@-P@H&p0O-nM M800㈎`4P7P 0d~0 P P値PL 0@~S$0Gp000(>($00 000 &p@9=> 0S=D$R$r R  $mBt $Jѧ<$.}p|0A: x0@ <$0p(0JJ-p P" <4 4*88 4W2`PEB@D4T@@ 0 0<@P Pv < $  <  p<$$r $|L P 8<$0 00 X 0 =~0 08 L<  ;0An c; ;$e0 00 0  h;W0 01 p0  0; I0 08 8: T ~:$;0 01 0  p:(-0 01 0  b:,0 08 0  TP:0l:@<:0S P00x: 000 `  01 8 0 /:0 01 0  !:0 01 0  L940 0c0 T0  ,: 0 01 0 ` 888̨@0S C.0, PPcPP0@4 P@ 0 =b`8Ȩ@ PD40 PD40D4z  H r0P$0o P800!0 0!($8C^7@P00V7 000  IL7 G: PƗP/ P b0S 0T4100-00* PEU UY V 0. PpS 4S<4Y1 H$L40 V$,pm?H4LP80S 4EnF/ṠFLdHV0.= 0 4/᪠`5VHLd,4SL$H4R0 &*pP # V,p  4S@  JP`P  =b  jWPP;|%VPPl%lbV+p (:: S@%D. $R$W*@P% 4YpP$ e  P0H 0(0pWZc>$R $0@0$p!$Tk = (,0ɡP,0 r0 4͡P ȡP $<03m`Tk 40S0X44S.=0@+R$)SR- (80# *~壡Pb0T40S嘡P \#00ST4S`31⇡P H3 50~s (8`""ŸR L4H$Q*pNa``0 H$L4#"1 ap<2 C  =a 0. ; pn\j 0P0 8"  㺤H$Ld?&"h4S 01?0V0 `0$$4RT SQ 0 V0  9)px `VS  S!0$Q\ +S0$0 Q$ Qg*'c(X`2``V]&zxbc c2-``&h`````aaa3a>aRav&taaaaaa%8aabbbDbhbv(ݨbbbdcEcXcn(`cucccc(eccdd6dRdTddee%e?ee%(ffdfte`fffLH$ P,} P+P *+0$PtS0] 4S$kP 44娀S04144 0S @4S 0 $L0@4,4S $4R#1ѣ1,40 000$0Uu (t (0S +m놉p@& PQ' 0 d|X0;]P`E} O+ ~P9X+-Q :$43041$4+]T4S,V )d0 |/0)~(|(z(G)\4$8: L4l4: x0<$+0@ 0 )pȤ|P Z +PP  <ep  T<  $0+- 4)O-0pMI Mi4, (!pP_8`4pGs04WZ h4  0YaB 4S<44S$$ 4R0\X('p H h])p 0 4 SP,0S x 4ԝ$t W0 0M 4ȝpW $t1SD $4 $Q=*`D_ZU CUh7DPEUPP bPEUUPP 6 ( 'p00( R0C0s0So p _044s04d0 00 p0 6V0 08 8V< `0AG H0 00 0  70 0: ;  +0 0: ; 0 01 0 0 0c0 |0 D50 01 L0 ,00!0 0!40(40S^00; `$S0P0H$^hc(p 4S &PP$p$V`P#X  L(@rP@4(0(00`V Z<0 00p"#7$p = 0WP0 r0 4[P VP$#05^3}p$p4S80S4l 1S 1!B0"H 0S 8c2P "0b1p1  $4 1 "g^pX2   ]% |pq P lb $$t 4r(4S 0<j.?0W0  4tS $$&R0 $$KY0; 4 440 W0  %p]pW0Y0:R $RĔ\ 0  U&0S Z  &+  Y0⫱Y+(rN-v&zxvw(wxr %uvv$v0vVv^vivwvvvvww0wCwR(wlwXwwwx]xxxxxO-GM MP`h ڠ,t@ $tp40PEPEUq@@5P 3D04030033W(|3 p0,@0p0P3000@30800838# 3@ 3D 2H2"20L02"`2h"@h2H"{ P2 p0V 0 $2Wi2 p0X01!W 1|`Op0x0p0`1 H&p㸐%b  UEyqV0 S R D 0Z _\0S@0SPT0 >A/wP"0 0@ xp,xJ@P>\ CGލ Ѝ6&zx-0<HVgvO-` -@Mp L`K@%\UP \ %P$ph| $$pX `@?< 4$$pJ( 0{@{0{SH{{S $P{{Z$P<;Sڳ$PPA` $ +< !`@ֻG8 ({:< (;S[dt \30T2pGS1<+0X2$,30S# C@4P 09 0(3 P4 P P  Q R2 |[ 0;8;08; 00p2H2Ps4"2 P R  ,y{ k;RS[82 P P 2 R / < W 0< 0: 0 7[@0 010@;E 0@0 00 008;0x1 P P @ X1 R /  1P% 00z 00w 09t1 PP ` 0PR x0 P P 0 R @RE |h ??zG{AeA@bMR`q"))Ek&zx:Vo))-)p)X&t))T$C)|))pPq))%)@K 0; 000  0 0 000 0P 0 P R  Xp<00 ,D`d;2S 0: 0 h>t8@|10!Z 1@2TȌp Tpp̌ ňppPt  KZ 0@ @ 1 0@T`Pb 0C S_0400000,00(00$00 0000000000 0000000 0Vg0p R= @@*ȂW> U*t8;p 00 L0#pw8; 00 L0#pHi8; 00 0L0w#p[8; 00 hL0i#pM 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;p+00@⍝p L0<#P\;"0#10@00 0`K`QHD  `   ` 0#PpK0S `` K0 #Pc 0  00 85"PDVd ,0 XX)```5h%`"P`5%"㼝!2`(10kkkk,a0a4aU 0P````㣝6<;SV">@˟ ]z{@ k:L:۟S"@ p]Vz{@ k9I:`"2RgdD' { h30S 0 I' L N@^IN2 X0引-!pV00 婏@+P@0W0 00DlT)@\2 ppW T p ,2J"P L4"0:CS0LA"`pkL1堋{8 {'NjCAZAG?@8țINU{({ *X PU7 [0S3 @h0xpT0T00p0p+t P F0S /!t;<000[ X1 0 |+ (d2"SS% 0 " @$?6C-A~8@@))&")))5:&hC)%< `H1 PS 2R`2p0Cs0WPP0R?L!Ld0 0 d20틟   i  `0/0h0lp0h{{7{{{h3{{ {  M@ 9:#pR@h2'0h2#2d0Xp |/+<0 00H @02 0BS; (SC; = 0;=(p@0S:p2嶀!0H0Css0S0 0 0H s0<r '( 0 @2币  0h 0S h;    0;( 0' W |*<00 H 0@0&p0V 0,1 J"yP<0[0W l0 0RZW |*<00 H 0@0 0 0D H'p0Wp`'X'pL 0CS0 )%h)&)TNQVr0 qP @0Q,0 Ty'\`dlo'0ߋp@0tplhd`\XTPLH0 7Pt (0 .Pk 3Q0 6')'0 PM '0 P@ '0 P`6 0 P. Q Q ($~ |0 P |0 P 0 P 0 P 0 P 0 P` 0 P <0 P & 0= z90Si BS] S W |q)<00 H 0@0p&I 7Qg~ (6[}) Eis ),SIZ0KWI7LR&DDD0J0ZD0 0I) 0K J0Kb  QJY0KWD01ʸ+Y jwP WD0 &D0J C <帛gWT &pDDD0I0YD0  0J#1 KJ% W%O-M`P@0-S@fP- @3 pȣ#{p*30SP a`F0P[: PQ9 JKP9 `H U83P@ 3 C d0@S  Lp@20S K@HGG 0卓 0TQX dTY'L`P+P`8b2 R $ =0 S  U+ 0 )!r0!00lW p4 ,pk0S%W ` pY0SOP p00@@ 0xZT Vh`~*T&zxc7MV&O-PAM MP@`t6Po&0P0V00-S' @ P Ḓ 0P0T@0p0I\[00`F0S0`@DDA@Du%3p ,0S@bLpP53 Q 2 x P -00  `@[-00  D0B5S0  c00S SPS0 0꼄Y4P S0000x4 |4 0S dS L4 00 8$P   300S Pm0$0h0(0e0,0bt0C?o#2p R0S0$0ǗP—t㿗P㺗Xqy0H" @DT43a00@`FrS= RS iS1 h!tS xS7 㨢в+ E?0p 0A00@00S  0mY3.0S W  P<8 Q (0 B b/S CDn (0S 0 `<eV0S (0S |1 00%X S @> (0S (0 ` . $ Pp+ 0 pPUUral*`\m~-+% "0J&zx$<&hK%%)X&*7(%$O-PLM'P0N0n(.p>;,# PER a0:  @@0SCBRvPcPSP TP LP M!d0@S0 0D003030800H00 30$30(30,30<00",00@)0,0p qW3S(!)P @ P< P /P LЍO3S 00 p, 0 4  8 < @  0RWS[Z0DSPQp! 100gS @0{D EY0`,  aR @L0Z S xQ0-St!0 @ 3R:  "0 0: ` P0 0|:0 0h:43043{0830<3@30@3ppzzyyx||{U ,0U U ,0U ,0U ,0U ,0 5 0 0U ,0( L00L0U ,7U S S0X0X(0CS0 0 PD#8 D#<#  T Q0T0083 00b0,X0$X 0X@0X0 X0X0,0  ,0 =P岐PdH0S7 009@PH0SX'B0- ,0SSX p43 SS0PN/aUF cU2 gU0BP@03S_0Sa 00gS# H0S 2|&Z` 0  d 0Sa P pWpUpWX 0S00#  ,B 0@ 4> 8< <: @8 D6 ULЍ0000H3P0P xH30娐PD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R  B   0{< Q $0Q P0 00 R  B   0z< Q $0Q P0 40 R  B   0z< Q $0Q P0 80 R  B   0z< Q $0Qp P0 @0 R  B   0z< Q $0Q^ P0  <0 R  B   0z< Q $0QL P<0PESZ $3S0S vD0S] @p907S  00&c;sr<  R  d  v   {  u UlLPܓ0S 0S 0S  Q 0   zpqPU pl8 30(#0<  )! +/ 0&zẋ̢̛̑p&Hf2&+0P+0f+0X+0`+0h+0p+0x+0H̸̹+0x+0@+1~͙͋ͧ͸G-PXMp2PHh   NDP b0@SS0 x80 6h(p\80U 0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06pSlQaH PA47=CP :PW0S  fP 0000婌P&T60 aYEPOP061 (VUFwp\= *0+SpD(<6 000R "<0 0/0P& !%T00p00 :X_P00G00XKpL l5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0pq,4 0Q0TPP3VMJZp=V }x`2o`F#P0 0SU030#:U 5%$P+P t=- \z T&P6K/r0 83TvPS0 0$S6# G@ySPEX 0K/r0Py"E0<6Sr46Sr 06rS 0GpX2R01 \ y⯬6S 4⪬P0W0`W 0 ?Q Goy,6S m/X.`P b?`Q0Q "f{PyDs<6S46S^E`^E`@6D&SH1 0 00R8!P H& R$!$Q $&R! 8&R0&@PR  Q   @8 U @  O@+68X- &zx6V+<r+7T+7HtՖ&tZq]&Ոեո0+<֚֔֗֠Ӿ֝־A-P`pI䁟HM!op10PEU THP h0@ S S HHIIp1\h1X1 T1 pa 8P (1`   0afPP K L<$@@`3@(@ @' HWP P0S PxW ;OP XK0 0000 &zx-&+<%( ty2 tC;F0G-pHM`0/BR" p 2B1 pGS 1S 0$  !RS@# P+PTJP<$KxP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0&HЍP PP  0K0S  )80 N`P LPW a W )pGW R $Sw ,0< sW p+=CE&zxSג&-`+=&C-Mp`ᬏPPEUy% p5U@U`F V/@T |P lP .aP tP05 R -4%  PV 0S A@D ).P`VD  tP@PA@3P zP0S<0S000S00S00S00S00S 000# pPU 3 `V= V30SU7 0S4000000S@0000000 0$3{ 0Sr<0Sm00Sh2:P0$0:]0S 0SW`V UUQt%P d P hPB UB U UR@2PEUNPP UH Q PA I U2 @U U60000  /- U+DPK_ 0000 0 z/P  9- v-$0S #/ - p +pqi*g@-T _ 0 s#&  @ #4$P @ᘉP t哉Pd +A&zx-&hMH?c}C-@PpMa M! p10S QฑPE R ލ ЍRP fP74p1h7P` 2IWOJ^P1 JP/0: S2  S)J 1P0 JN@n` 094S00` f0S }phsJ c1PJ \1@PJ0-@+B6&zx3S]`9O-4MGMM -0P,0 <[⭅@P P ;T(X#x[@t0P\+TX8T 啅H;P  0S,;0+, Kh8S <PU hXJ|P@ MOoB:ppR*:(8ppJP `ZT`hgbPdhhod:xJ 0pP0 `*K p`W0 J [U,* 0 W0C 00܌10 l>  \⎋8P`T0>0 XP͛0P- S)ƌ0 _WP\9Tr OP 49h(iFP 9T(X(_Z҇P 8h(^40FDS00  8( 8X(T( |8,8 A8P 00S| h8l G(8, ,, ,o 8,k 7H(g7l 8nn^ 7L(Zg+w PS:?@ 0 x7P(H7hgnpnP78=l7 87<(8 (7T( X(2@7 7P 00S% 7$  6t(6 6P 00S 6 6p l`E p +_+ 5, 5L(5Bn0P0 p5`(d( \5ejH5P ? |5?Qt(^GލЍP5T H+y0D4<<0P 0S n >P@PD8SQmd4 mpLD Rnv vS̃S>  ^ Ã` ^ẃU ^ᲃV ^ ᪃  ^⤃W ^ ❃rq/^= ╃ ^Y⎃Z ^[it bh b`bTbHb 0S0SA  N@288S2bG@Px |b<S P 0S um rmD2 kN @+0v P:B?lC |Q081<Sa\+Tu P*a㪊0:{P 0GkP M@Pf'a a~_['@Pa a0@`zPP0@P`~p@+u0(@0@000pUp,`40U0 (P<P8Dn,(PR00S ,R  \0,0S l,8S= (r,8S +i`1;&&n&zx-&+r &h-+?U ( +vT 8TA-P`a)BE;h>cP03&xp2S l P=EUڏ{W~PO p 9P/P00@˜7' s\rvP3038$Sp,40pEWQU 4 000`ៃP C,"uPE0S3 4# 3"Pda^[3yPpD`p\ T PPH304<|4S ,S7|P  D@p P 4SsR%|Pn l ' PpR},1`<01 1> 11/΅01<2F01$1%{   #2R CzC mp`a P^ Q1s0S qq`|qzp  oQ00S |p P *`3P?o20S R=?o20 P P l{1s0S 0 S S 0Rzp  \#{=`S 0 0000 l{1s0S ev`|d0,*,-L,,,&zx&t,,-(- I-- &-*& ,b&-1-B,+$,+P "x,&l,$@-@`ᲈPP p1 lqd!pX10SAH81P@ 9 1*$qP  P 0 nPbP 9P0P   c0@ S0 VP  00@0 P0  @0  00 ÁD0S4,005D&zx44&h5&@A-`4C0P@00$ 0廢עP0 06劃P00|q넏f6wP0r0 0"SBP U 0+0C0SPP \p8RPPE ꗡtP 0Sl凢P10e倢P1 0Q U 0SfnPsc㪭PEh10S \10LDQ㮅}0S(1(P#­P-Ppq 000000SK .뛈Y"PP`0S PPp00S<8,05f5q,m5a5v5y55555,1L,m5,l&;55,m,s(6 ,m,mO-`pPLB&D@`4"p(2 0 qQ pPpGefuP`P GP IP EP ,0 a0@S 0000J`( P00: S0S00',uPP( p:zP 00SW p3 3 CL3`3prWpP  KxSff0@ KlPPD P Ӏ !3ԃ у΃Wz 0@00P@UP@`Q m-V ((P,@44`(PV,@0,@dB( (P404`V(P,@((P,@4` V(P# 0 0S0 0 0 0 0 p  W-@P J 0K001"1 PZ 0Q wtI 0 ЍpI,,8 +-,x,H,@,p (,,,t,H, +3&h +8- +k , , ,,,L +e, ,-, , c g c,( - f@ -.,D,,PO-poM"0 @U 8@0 @$p`S4 W[Y~ pP 0  GP(0: S) 0T0[0Sf Y PH&@P<  P 6z 2z'PIPg@Pq u4pVaVb`FV` zV" Ė1 d0 X# 00 0430! 0 y200u@s pT0 !0 02QX 000Ḑss` pP0; 0P|* &Pl%g`P`!!D AA Z !(=20!0)=P =% 㑖  P   Pr0S } pi0S tT!0/X!Pp0 [0  Q   S  R#4sp V`P90S T A ^U @p-[ p&zx { ~ - Y e&@th  5  U G0O-PMp00@3}P? ,}P ?M / AӜߍ(@).ក@d?PX1\?/01012 211R"T122ep7^p0Wp^(&[0n0`10 .0>cpZ90n0C 0 0R080 h0 l10 B1!1pq奻0 8PPZg0Z m 0R- = 00+ 0 80 0ZSVPMP 6P@ ?P7 4P〽|=N@P fP j@PP=P <=0X1hz$=+hVP0V30 [0000z00u Po㠼l㘼i 0pѷP 0PT 0$QaD 0 R:0 窸PP  0p嬷볿 ԛ84'0g00d1Zᕙp @ '1S P <Iဩ}:0P 0@ @ Tp 0 *pA@⮨(  00 PQ819:`!*d1 |jp ␨PP 5   <:<@儦p, D&d11`V %zPp)ZGB Z9+  0 `1 0 0T1 5T@匣puDAIq$0 T1_p mcp\7!POp p,k@T 5@`pA X000*ަ0@00 P  {@ e0 30 ~pt@ 0#X TL$# D43 ᄧpI  ẙ+pצ 3@pPA̦!Rd14d11P0@!瓨P0!p绦00!R00SR`14.(Кd1Z   R! Q01Y;(p ǧd1 ᫚1Y3F180; X >< 4900Ꮪጵ1PU} 0S 1PޣP 0S  R 0S - R080SX  R   L1p峣0 S   0奦`V?a4 L / h&j } &zx 3  - S y @  . J j  O   # I ` $ k l 4 > E  X r - l &婥0@0@ Qh8o0   Q/0p@-x@0Ppp@ P T0=p@ 0 0$010H Jxt-/O-1bM!0Mb  [ !1 b0  0 30_bݍЍ  0  "\ ,|`  $;(0(0 +Pp0G  80G( Gpn x8_S  000 00 0 PЀ @G 0  fxP x8##[`@* [xP0 l8 40G PU P0l8  40GP&* I I)F\)̪0ƒ S$*0@- R P@ 0\ R^ H00"@ 800 0^ 00"@0/((p(X@-M   zЍ>@h  0S/ -PM00 0I p 0 S 0 0 Ѝ@|@ /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/~*/{*/x*/cu*/2r*/o*/l*/9i*/f*/c*/8`*/]*/Z*/W*/T*/ Q*/N*/K*/0H*/QE*/B*/)?*/{<*/|9*/#6*/)3*/=0*/-*/**/"'*/$*/!*/*/*/////^*/*/ */< */*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/ L*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: DC,HHNKQUHT\Wd8Zi]ll`lpfniqmqquuv`x}~~|~|HPt<X̠ϔXxݘ ݸ ,6(BPHPRd_0kpw|\\&5?TADJM ZZ```bDbDehmov{ %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s?dB(FKQL@@W[^@@djqu x~t@@8t@@%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdin\8,q[lfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1sETw#Fm%c9wNcinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.BD69`hn<|AJ.O? [SV"ekqty2'%s: %s%u-%lld%llu%d%s: directory causes a cycle %s: %s: fts_readusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS/%s%s/%s ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s!4&4,4411Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "11 eVeee/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+KKK<KKusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression;D5AGS%-Y"VMarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %s ) ?Q[gtgtEZ5#? ?_Q^QFQ<Q>f?yerror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQED[[[[>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error }tfdscmlr pnv  b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:.[ (8mYSgirktEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpectedJV^bfkptx|%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \ "(.25:<>CHUnimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)&@,1:@FLRYc@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error   %d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATION(b,0(a1(ap1(a8(b0(b0 (a0 (a0 "|d(a0 +PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad number                            !      !=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unsetdjs4uLz`pp{LD`commandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp80@lF=`ILR\W[_<emQpQr z'p'>I`0gDnkJ&4#$%dPPIDIFS1OPTINDPSc20220122 BUILD:202603311345Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failed6> DHLQW\agk px ~  &*0option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOP%'%%%L$%&&P&(% ('$ (@(l'%#%L('L-'`3(illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedtty     # 3 # 3 2 3 3 #!! !! !@!$@!(!/!7!> N V _ f m t {  @        C$CC$C@ @      ' .@ 5 <  CHOW\bhnt{ @litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %s9+939;@8@9A@9I@9P@9X@9a@9f@9k@9r@9z@8{ @9@9@9@9@99#9999998999999999 : @:@:::$:*:5:<:B9 :H:N:V:[:b:i:s:y::::::8K8P:%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:or666667 77/7Q7^7|77777%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=1;;;;;;;;;;;;;;;6;;?;i;M;;;;%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:::::::::::1;;;;;;;&;1;6;;;?;C;M;S;W;_;c;i;m;x;;;t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO788 8888$8+828;8B8K8P8U8\8e8m8u8{888888888888888899 9999#/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd %s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:DEuEyE~EEEEEEEE EEEEE E7EEEEEDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>DuD|DDDDDDDDDDDDDDDDDEE E EEE!E%E-E1E7E;EFEUEaEqFilesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdCXCXXSXCXXKXXXXC# %s: IbJJJJ J%J*J0J6J<JCIJJJNIJTIIIJWJ]J`Jftype: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u IIII%I/I8I?INIUI[IbIjIoIwI|IIIIIIIIIIIIIIIIIIJ %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. PPP#%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:(@+TMP.2  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootable\Vklll-lNlall m m( mS mo mmmmmmnn>ncnwnnnn n!o#o$o &o1o2o3o4o5o/6o8o:9o@9oG:o`;oz<o=o@oAoBpCp;DpbEpxFpGpHpJpLpMpNpOpPpQq RqSq9TqBUqJVqbWq|\qaqcqdqerfrgr/hr/ir/pr6qosotourLvowrRxrfrrrrrrs ss@s`s|sssstt!t3tJtft~tttttuuuu u@uHuUu_ufuuuuuoooouuuvv-v2vEvRvdv~vvvvvvww"w/wGw\wywwwwwx x4xTxoxxxooyy$y7yLyfyoyyoyz z z3z?zbz%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype~<z~A~G~Kz~R~Y~^~h~r~{~~~~~~~~~~~~~~~~~~~ #2>Nvfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) [[**_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY3:ACG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:3%@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:Ú7%No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]D=H%AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]?%@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),"=DWbҐҙUnrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functiong%Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:ԤiH%@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored *?Qesbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrFF+++!+=++V++Ogpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: 04d0Ԑڀ(l , Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*  (-26?JOTX\flpx|Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sz%@Afp:sNo MBR in disk to convert/Bi   4 P rDXm !#$&12345689!9(:A;[<y=@ABCDCEYFnGnHnJLMNOPQRST#U+VCW]\gacdefghipqstu-vw3xGct!A]}+G_|!)\6=`s );Ue3Ph +Fa#=]p 9iMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sX%@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremoved%@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]{%@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]%@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] % a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l.!(*,R %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)en_GB.UTF-8 (active)UnusedExtended MBR%d - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s Could not find index %dDetails for index %d: StartSizeunknownType: %s (%s) Attributes: None()start %*ssize index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]UT%gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed %@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l Jd% a:b:i:lunset-a attribute -i index-a attribute -b startsec-lHFS0eCUFS0eC)!haHdInotNeedEFI38*s(ҺK>;BFQn|n֏- q+Q]Qn|n֏- q+lvQn|n֏- q+Qn|n֏- q+Qn|n֏- q+=Gry=iG}ɡM;t?WmCĄ 3KOOyD¢<#*=( YBbRuoqr#РD3h&2: \M}-M^ޔM@jy֬o-ıܹчH-ܹчHIZܹчHI􍂱ܹчHI􍪱ܹчHI2ܹчHLǠ6 %?a$'S@ۿ )Ѹ181*@ە )ѸRW1ۏx )Ѹcn.TSqHBo6֯i~%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL$%@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-D%$o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdinL%(@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeee[%+-/EXXXXXXXXifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s (05 linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroywiz%~iyaliasdeletetrailers-linkstrdescription-descr-description% %% % % n% #%  )%PD% O%D% %%#\%*\%broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6 @ 0"@+49arpdebugunnumberedlink0link1link2   @05getifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %d#G#####!#, ## ##`##@######media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaopt"/"8 %`"A"8 %`"8"8% "8"/%("F"8%D"8%no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %d` pTtunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnel%yT%%r%bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif'%p''X%T'''VLAN tag(ELZgikmoqsuwy{}NONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA> >>>>>>>>>@>?? ???& ?8?@ 9?L?_?l????? ?@??@@@@@%s%s%sunknown flag%s %#x%smounted by %s%d%sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s])nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'@Y@^@b@h@l@s@x@@@^@@@@@/sbin/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddenlognoatimenocoredumpnodevnodevmtimenoexecnosuidread-onlyrelatimesoft dependenciessympermsynchronousexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsffsmsdoslfscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmalloc(usage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node C'C1C<C?CBCGCPCTCYC^Ce CkCr CzCCC@CCCCCCCC getmntoptsegG:jM:m:o:rU:stat %scd9660%s on %sbnorripbgensbextattbnojolietbnocasetransbrrcaseinsuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedupdategetargsextattgensmaplcasecasetransnrrrripjolietrrcaseinsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node FxFFFFFFFFFF FF FFF@FFFFF@G@G Ggetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceext2fs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdatereloadforcegetargsdevmtimeatimerelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node IIIIIIJJ JJJ J!J( J0J5JA JJJV@J\JaJhJoJu@J~JJJ@JJgetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: mount_kernfs [-o options] /kern mount_point LRL\LgLjLmLrL{LLLL LL LLL@getmntoptso:kernfskernfs on %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsrealpath '%s' failed"%s" is a relative path.using "%s" instead. & 2usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath OOOOOOOOOOO OO OOO@OOP@getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead. '*? -($25GJM + Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupVWW WWWW!W%W*W/W6 W<WC WKWPW\WbWi@WqWtWyWWW W@WWWWWWW T@TTTWUU U U @getmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpsrealpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s $rhw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'\\\\\\\\\\\\ \\ \\\@\\getmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled- 1 / "9MR`n|@)KYn%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).fffg7goghhh/hbhhhhii#iDikiiij j?jfjjjusage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead./+-$ '5GIUamz%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @ BC,F8IQL[NhOSabcefh8iDkPm^noo~rsu -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jd@@@h pp p p   ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880bj #'@PSVgmpOXv  "$&( usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%x     pusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uB*O$command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c )+T"RKOunallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s >ZZ ZBZZYGYYYCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood  MeΎθ @lϞ8f%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +8/& Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???FPFP*0 XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip  Y  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/Ррр р$'р 4рBTрagvрр  р#р7рGрYрex(рeрррр р'.рG]р{р{р{р{р$$ р27рEL]|ррррregcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): bgkrw~CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KiKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiB@[Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)-;FNU^fju} malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1YNY^H<cuJ&8EI5 ,oZN`t !j?NQe9& <oZTZNjQPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYEW vtE[ vtpclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4\VValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX%G .8>RTc+AHcccccdccccccccccccccccccc cDMcVcc_qccvccccc?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS^_a%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s4}}}}}}=}}Zf}}}}}K}g}}}}}}}}}}}}}}}}J}}Tam}}r}/}W}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     #3( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. -7 -? -G -O, -V -_,R -l -t,P -u -t, - -, - -, - -, - -,t . .,Q .! .*, .. -t,3 .7 -t,2 .A -t, .J .R,T ._, .f .m, .w -t, . .,| . -7,S . .,( . .,T . .,P . .,t . .,s / /,r /0 /;,s /P .*,q /Y -t, /b -t, /l ., /x ., / -t, / /, / .*, / -t, / -t,r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hfeb/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula 2n : 2j :%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5 8 : :ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalid C& @i C- C7 CA CJ CQ C` Cg Cm Ct C| C C C C C C C C C C C C C C C C C C C D D Da%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF >x >B >L C" >l/sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug!, Q Q Q Q R R R R( R/ R5 R< RD RI RQ RV R[ R_ Rh Rs Rx R} R R R R R R R R R R R R R  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s 2< Y `  | d  . 0 Fd F1L e u %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error ]F ]M ]R ]\ ]f ]o ]v ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ] ^ ^ ^ ^ ^& ^2 ^B/dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijz }l  , 4  D d \ D  |p  |h |` 4  h @disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS \H n8 | %5%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhai8258 7:=@C !&1WQT\_bhm"'7%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new u,rr||}|{@{qjDkqp~0ehel|e<e d\tugfhagdfg<fpout of memory t ti u\ u\ ud ud uh t  um ux t t u~ u u u  u! u"-a u u u u u u ,gpt %s %s -b %llu %s tb ti tn tq tt ty t~ t t t t t t t t t t t t t t t t t t t t t t u u u u u%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredHFS0eC x xUFS0eC x x!haHdInotNeedEFI x x*s(ҺK>; y y Qn|n֏- q+ y y#Qn|n֏- q+ y2 ydp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new \H  |<(8Lxh H`D dä,ltX d8%s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init U[`2 2.`222.4jn22v2:2?K{22I9 w|2Ev!&49>CYosplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument Lb Wc ^d de hf og {h i j k l m n Ho p q r s  t u   Vv w x z y A B C D !E +F 0G :H I DJ NK UL ^M fN lO uP Q S T U V W X Z 1 4 6 E| ~ }   ' 7 I U Z a f m u z       , 2         " * 1 7 ? D T ~ ] i s     option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLl,l,ii(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deletedjhjhrt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deleteililsa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULL - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s q v { protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK) D K Q U Z ^ eifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @DCHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s ʅ ʐ ʜ ʫ ʴ %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s        ‡ BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- :P:P:d:d: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc:@:@UVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory . Ѥ]0 Ѫ]P Ѱ]p Ѷ] Ѽ] ] ] ^ ^0 ^P ^p ^alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ &| \ d \ l    $ * 0 6 < B H@ N T"U"S"QASCIIcs_path X H bc_base_max  bc_dim_max  bc_scale_max  bc_string_max  coll_weights_max  expr_nest_max   line_max   re_dup_max   posix2_version    posix2_c_bind   posix2_c_dev   posix2_char_term  posix2_fort_dev  posix2_fort_run  posix2_localedef  posix2_sw_dev  posix2_upe  stream_max  tzname_max  atexit_max /usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[ ^a da jbP pb vc |d< d e f( f gp h[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d le  O0`[8#n ep$$januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDҵ;15MS7) q:e%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n20QKGC?:64*(++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQxQxQQQ,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%K8F}j WtaJ# 7D1q^xK38F}j WtaJ# 7D1q^xK3# acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error C0005J,.u~ap<o Qunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger/852array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist