'VE1 iæY0 eNetBSD/earmv7hf ramdisk 08Yi<  Yi.t tYi@@<@T 08Yi<  Yi.t tYi@@<@TU Yit`AYiYiYi$h YiYiYiAYiYiYiA.YiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYimD}YiYiYi (08@HPX`hpxH$TYiYiYihpxN$ YiYiYiK$/YiYiYi (08@HM$,YiYiYiPX`hpxFAYiYiYiCYiYiYiAYiYiYiAYiYiYi!YiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYiaYiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYi!YiYiYi4!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi B!YiYiYi B!YiYiYi!YiYiYi"!YiYiYi"!YiYiYi"aYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYiaYiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi!YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi?\!YiYiYi>\!YiYiYi=\!YiYiYi<\!YiYiYi;\!YiYiYi:\!YiYiYi9\!YiYiYi8\!YiYiYi?\!YiYiYi>\!YiYiYi=\!YiYiYi<\!YiYiYi;\!YiYiYi:\!YiYiYi9\!YiYiYi8\!YiYiYi:\!YiYiYi7\!YiYiYi6\!YiYiYi5\!YiYiYi4\!YiYiYi3\!YiYiYi2\!YiYiYi1\!YiYiYi0\!YiYiYi7\!YiYiYi6\!YiYiYi5\!YiYiYi4\!YiYiYi3\!YiYiYi2\!YiYiYi1\!YiYiYi0\!YiYiYi2\!YiYiYi/\!YiYiYi.\!YiYiYi-\!YiYiYi,\!YiYiYi+\!YiYiYi*\!YiYiYi)\!YiYiYi(\!YiYiYi/\!YiYiYi.\!YiYiYi-\!YiYiYi,\!YiYiYi+\!YiYiYi*\!YiYiYi)\!YiYiYi(\!YiYiYi*\!YiYiYi'\!YiYiYi&\!YiYiYi%\!YiYiYi$\!YiYiYi#\!YiYiYi"\!YiYiYi!\!YiYiYi \!YiYiYi'\!YiYiYi&\!YiYiYi%\!YiYiYi$\!YiYiYi#\!YiYiYi"\!YiYiYi!\!YiYiYi \!YiYiYi"\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi \!YiYiYi \!YiYiYi \!YiYiYi \!YiYiYi \!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi \!YiYiYi \!YiYiYi \!YiYiYi \!YiYiYi \!YiYiYi\!YiYiYi \!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi\!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi !YiYiYi!YiYiYi !YiYiYi!YiYiYi!YiYiYi$!YiYiYi4!YiYiYi!YiYiYi!YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi !YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYi!YiYiYiaYiYiYiaYiYiYi!YiYiYi!YiYiYi!YiYiYiaYiYiYi aYiYiYiaYiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYi?\aYiYiYi>\aYiYiYi=\aYiYiYi<\aYiYiYi;\aYiYiYi:\aYiYiYi9\aYiYiYi8\aYiYiYi?\aYiYiYi>\aYiYiYi=\aYiYiYi<\aYiYiYi;\aYiYiYi:\aYiYiYi9\aYiYiYi8\aYiYiYi:\aYiYiYi7\aYiYiYi6\aYiYiYi5\aYiYiYi4\aYiYiYi3\aYiYiYi2\aYiYiYi1\aYiYiYi0\aYiYiYi7\aYiYiYi6\aYiYiYi5\aYiYiYi4\aYiYiYi3\aYiYiYi2\aYiYiYi1\aYiYiYi0\aYiYiYi2\aYiYiYi/\aYiYiYi.\aYiYiYi-\aYiYiYi,\aYiYiYi+\aYiYiYi*\aYiYiYi)\aYiYiYi(\aYiYiYi/\aYiYiYi.\aYiYiYi-\aYiYiYi,\aYiYiYi+\aYiYiYi*\aYiYiYi)\aYiYiYi(\aYiYiYi*\aYiYiYi'\aYiYiYi&\aYiYiYi%\aYiYiYi$\aYiYiYi#\aYiYiYi"\aYiYiYi!\aYiYiYi \aYiYiYi'\aYiYiYi&\aYiYiYi%\aYiYiYi$\aYiYiYi#\aYiYiYi"\aYiYiYi!\aYiYiYi \aYiYiYi"\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi \aYiYiYi \aYiYiYi \aYiYiYi \aYiYiYi \aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi \aYiYiYi \aYiYiYi \aYiYiYi \aYiYiYi \aYiYiYi\aYiYiYi \aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\aYiYiYi\ !YiYiYii!YiYiYi!YiYiYi!YiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYi aYiYiYiaYiYiYi aYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYi!YiYiYi!YiYiYiaYiYiYiaYiYiYi!YiYiYi!YiYiYi!YiYiYi B!YiYiYi B!YiYiYi!YiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYiaYiYiYi!YiYiYi!YiYiYiaYiYiYi aYiYiYiaYiYiYi aYiYiYiaYiYiYiaYiYiYiYiYiYibpf!YiYiYi $ YiYiYi$YiYiYi$>YiYiYi$YiYiYi$sYiYiYi$YiYiYiAYiYiYim YiYiYi$YiYiYi $YiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiY<{n f@2 16S|C,ޱ$:iZ1Z9Bwr`] D*Bb/r }wh>UO+(#.4BPA}/tsL&,#[vVudJ|\b EeCK.* k +U"(<n zmoL.O'mywL|Ǐ+jqfH#Lˆ<s syAK,NI<;?8=O/u!A޿SyЂ%dڙ 'O7c.=uļbUU*QQ\P_dU_o7+0VR$<9YTnaʇelaTbm^Qq\lt`'ǒ|py}Iu$>|jXK݁K0:@QK*/^w@OQ{"!ʴ.!q?wXpt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4z4 (llxxxX& LLxxxNetBSDKwGPaX NetBSDearmv7hf3D0D 0p@-h6!F(F;hFh@oKihB F\︱I&H F\4 I&H;h+?U H)FCN*jB K Fhh! \(u  h l 8 0MF Fj@2iF\C!jH` M0# 05 H\h I H IhF\ FHiFKh(Рmd  $P FIH\B( I H* hH\FIHKh( F@9 0P FIH\( I H h #H\FIHKh( F@ ;P AIFFH$ #E KXbpG8!KXbpG!I I I I  hh\ľoCFO2H#"#K]$0!oCFO2H#"#K ]4!oCFO2H#"#K ]@8!oCFO2H#"#K]L!?#F "HK]Xx!?#F "H|KK]o!8! KFh[ ?#H" ^K]!z! KFh[ ?#H" BK]!8!?#"F H*KF`  F#| BIOr-A#@L#F?I?O#V#hY;JBD#CS#`#h7J@*J)=4I @F+F 1IBF =!="*F-IF#;Cx*I*F)I#"#"hhB"IhC#`Ch@FG_H<JKFJ`! KC#C#`#`LKKIK!!8!! #=^D!|A8KLhMchk`#B#A khc`##81bh;a??xE][!8!!KQKpG8!!I 1J kF[ijG bj IkpCj_ iIG#j( ""C#b6##j"G??Ah+#jC m8@F:BF F@5"Fk pFj.؃k"!0FhGI nk0FhGbp#F FF IjF \vk2F)FjjGFAz"iFh \fAr` Fpx!K-O(MVzLFF+N#mK 1FCEr =2DK2#Rc V#BsCai i:i#iDca.#RQ@F:C@YI" O\ V3B\(#RСl'k jG??bkHI BFGHQFe(sFFCbkAI @h+bk=I'FP&2A&2 #:N$2 B$22B2&2DINEB&2 #BB23B2U23B2M23BEE2?B#k 03ak#H0#k[bk Ik FFx!,!P b*R*xBxKp p: F F*2Bx0L<L< L <L < L < L < L < L<L<L<L<L<L<L<L<L-CmL2C "kI [2CgI" [!\Ozw aH! sT\LAqSeUls Euad!V#&%#######EJ# ? F [n #RQ#CУhHch##H#####oH## ##o"hH##H### Ma@ B;h O +`W+iNkaBܳгokj+<ЀKa#a#3`O|K-|Ka #a zK*j *Fa>aji3hO;;3`i1hB3`+j+BвoвiI "hKa #gIaidH#b6 g !#f C +j+ڀ$.SK@C! ?j+3hAFMN26i2$BF#"jS! # F#@HDF FAFHF?#F >FFHFAF?#1FF>FF 2Cc# @! #4ZF+FH#!PX* |r]>h!8,`nIF@F? UOsEOA  wFGFH+k+?j+#H#b $h"kk+"~H#JxhiBx 9F?5CF1FF>F FF8F?(#3 "WȱBFAFjH# 0$h NЧF h 2h 2 2C# @! #FLH"LKj+ xcQrVzDH !2F+FxAH"vmiBz09F(F>SFIFF@F>FF9F(F>#F >xFF9F(F>#1FF>lF1ZF SF&H")F8F> /BOA)F8F>q  /BOA)F8F>`1I{"+F2F@!HH!L F!4F I &`9F?`6DB pF Mk\*F +E! !^x{~pLj.k(?hI*FFH""Hop&b5(F[k9c a !  LFjP.Xk0[bk#c(F!!" I HN K3<3 0X!P !pD L`)F9F0oF$_OxF(&(F8`-n2F1(xxM(F@, *D+ILI>(!F(0 Bp@B, F4D0!F30(M?.h2IF5H"5H(0;0+1Kh/  0#` 0+*I>T( (H;(K\i@0x+?|)mh9hF_[ 0;0+Khԛ@IF F2?? H:!l! X!(!!P !p%NL3hh3U3`U,3h`;3`[Kh C p!(!X!-GF'L#hx . .$H{oJF(#h||xBN3#`0h'6hF0B FjF(0#!i #"#QFF(F [ B$h6 F(к!`!d!p! Kn:f*oB (КmQeppGI[P -OFܑ&nLء0F+V8FFh]ѻ`+Z"h E򔀶F`hOz  D0QF30O(o?h2UIFUH" "F+D,MFlL0CD< +QH=hB10q i30+?huYF)#i@3D ",еhB5@Bp5F5D i0)F30?`hIFH!H[0;0A0P;0; Kh?<?> i#U>`D!! X!!!-OFFFF)H%!6&DyB { x405BI%H : x ^+\(\  YFHF;D0 5@DO500 x00 x00  8I"@ h#jF ` IZ( ۽0+;J`0+;JS`]X!ht@  KZh B)iBHo X!0-GFMFliO !+iB$4 F6FFi+ #"#9FF0F7P F,̿4,i$kiBHIoX!@-CFF0H:oL0B̿H F FFB (F4()i;F"F@ (-hLF0X!KJh30 Hoa9 Ki" 2 #Da  IX!B Kh30a8Ki@Ho X!I-CtMuOli:h`3xY2I +"*6` )ŀ.Èé..ooooooooooôÓ^0-и^ LD"0?ظظ @:h30 A2@ (I>h#HI "`lCF;3>Xh"+@HWo F20ZԸ-и^ O3#DO3 3H>4#.I "`8CF;3>$h"+*и.0/li*/YBYA0xBEz30u*К Xxjj;0jikh`3k`,i[B,+iBڤO4X! !`0#Lc`ci3chh( 320`x,* ;* bh*F#*c`h ѣ` Z x;+`aBу X!! L FF  +U{3B:!ElX!8F Fp>vhIFH!Hp F8##+iat xB <\+9 N0 3h8"#3`3iSI($HF=r(F 0F9FDc I F,/*/"bU"Zp3iI" F X!J1h8#@ C`X!F H  U;"@hO1#@;fX!'8Mha1da, *1I @B"``3x 3F30, *ћ+2x.*rx *0300FF0;0S+h F" jiFS`B#10;0++hԛ8FFF(oX!P -GFILSBhn8&E+(EBEA030%0FF@FhF1ea0hIFP#10;0+_ hKMѽ%2FAF H0;0+4o#i9F B̿z*F(0FhBF*@FF8FF03`^`00hB¿h5=D#h  8FF@FF X!-GF2Lh2gaBF ܺB ]OO -4 '00F30%F0;0#h J* 0;0##hԛ6h=`i=F'0?Fbi@FFF(oX!-C F*LF FF 0300;0+:#h 2 L#i9B̿h FHF1Fh9FA#i5p[9#10;0S hѽo X!-OF`LF'#iB̿H F0FFUEX!{B ۷=F0Ou5D30)FQ(]0hP;0##hhԚkEJAF10Fd SbF(y0>3fa0 (Cbi(FFS(<0"!;0+%h9;(F(FF(M*i1:DB< y1IF>|hIFH!Hv0;0#h  k0h;0##hԘYF*i8D>T+i-hDPoX!0t xF,La.3v01F30F>$h~!IF!H!!H0;0#h  0j`;0sQqjB .D#<(F#hԛ;x\+{x7?+7X!t x-C#Ll2CЯH!sF o!B=@B0 F5D30)F>hIFH!H0;0+#h @ 0nP;0##hԙ1%@!"p x +8"B!@B0.F6D301F(0b;0##hԚ*Fo=J1Q"ZU8x!XBXAt!+B%+!nB$۵F0Oy  D30IF(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F|B0!B!EE.F0FF6D301FM(?10n`;03#h?<?>0nZ x1ZU1 [x (H1a+DB!ݳv 1F2 (?0n`;03#h??13Np DBvp{0++1{HX!t xH%FF+D++Q*>D !J1h8#@ C`X! KF1x!+ I

U<W%EF Fn)p)l) x + JHEE1 ho(FaiFF( F+n*p*l*0 x +1 (`iE0EEaiFF( F+n*#p*l*0 x +1 (#B3caE0EE1#2+Ech+HwSx310Z Ho X!(,F(?r% F+n*=p*3l*60 x +M!i (Yg1(R(3x 1KN!0F(@NJ#1O3`J`5E0EE!+ОH"1F83x+H ch+Sx310[F(? x!+ѓH%E0F+n*p*l*0x +ޮ xH"8HTEE1 }H!i F(ҮG @ (ŮG/V/(F1)F31(E0 F+n*p*l*0 x + EEbh*?%Fn)p)l) x +pRJx+?PIQH zEF EEbh*?ݮ%Fn)p)l) x +F22+?REF EEh 4H,%EF Fn)p)l) x +1 4h8EE`iA#F( F+n*p*l*0 x +1  B?E0EE ! BV\!t 0h`Wx(%3F+n*p* l*03x +/9FZEF0EEaiF( F+n*p*l*0 x +@(%@0@@aiF(xLF(pch HYh.'#iB?#FE۾BڠHIE0 F+n*p*l*0 x +41 R0F=h"+9Hbr' !!`p*r*-[x +)џHE0x *"HE30EE2E#2x *0b30 iRF0;0+ƫ#h "" hB (#b20;0##hԞ=!2R# gIX(C2Ճ# 2 xn+7p+&l+.aiFyF(i F+n*1p*'l**0 x +E1 c!2C22 2C2CE0EEaiF5(&F(ch+?h.լ#iB?Ѭ F+n*p*l*0 x +1  0FE0EEbh*?Z%Fn)p) l) x +êEF EE8!Q(0O5%x310Y)aF(?!ich C83 F+n*>p*4l*70 x +}1;3x!+ БH"1F7^3x+1+?`NH#vW/F0F(o#iB# s(cE0EE1+?U2+PqLoHbh*? F+l:Ҳ* x +fH Fai `D1F(!0x1;+=\I "\N`0`@80=h"+ TH5`E0 F+n*p*l*0 x +ةFK*Fhh#iDBFOEE%EF Fn)p)l) x +ch[h3HEE!ich+?%(% F+n*$p*l*0 x + 002+HE0EEai `DF(rhFݻ HYoi !! `@'HS+&]pG\!0Ix^+0x]+0x]+ +[+Dx.۲+ % F/F])ѢB0 ) F 0 F-GFP,F#xB +0e(!BU@B4O.F6D,;h1F3;` (7<h+IF+H+H;h;;`(Kh 0[+\+ 4F(Hq&0Fcx +HF g;hJ`;;`+Khԛ,a*F0F0;0;%Kh?H?J/ 2CHBh  C"!F"(?쮪 Kh+# "9F F(i:F!F0D<" J+iZ # +?Ůp!! #X!E!-OO$BLFBMF0&h;#`>K hKE &`S`9Ho h0 `:FF\ >!hF`(+Ji +hO 3+`0FF+h;+`+"Kh Z "hFeB+h;+`+Khԛ&h  XFF$F(:F1F0F8( l!!d!b!X!`!-O[O[N;h3h3sh3VHToSL#hRK"`T 030S $(F(<+F # C |Ol E ^AKh t3h0sh;`s`0;0+a7KhV  S2 ܾ' `FZXZP :Dhh  JhPhhh`P`JhhPh`P` hQ` ; =?a [h! k!!!X!l!!-A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FDF#F!l! h!-CF LFFh"hB#hO bh8F P#50F h`0Z"`d1  "`%(Н IF H H(`h !{ <IFFHt | -O]NF FF3h˹IrhK* FG()FH ipCO<#`o Ob)F6o@(eH)F/!(F(W/! F(QG9F@F:Fo.ڧ o)EE X>.#0*@FWF๼B<.#0P@FW됹 PBBTBB?~3i;$si F+dpCO^W(w!FF'F)F@F;RF!F@F; i+]йZ(OX8F8&IX"FD0;0+@F*,F8F (0' Y/IHWXBFF8jpIF:.BF3D`FF !i\F(ѣ(jrF(ѧ 0YF(`QF 0(Dh`:jJ!F0(D` F.ajQOsEq9vJ!9j(+?KBsD( !J9j-+? KBsD-;B//3VUUU-CFKNFKJF!Fk+" FF !TF (FCWkO((FNFx;h(F;`;h+X/IP0;+R#!kjj kjj k$H\pJ9FFH#sal[\0.+ѳi+"!F(F3l+sk!jHAF(FFF Fk+/ѝ!j H#sc!1f -CFhFI L 8(IjF V 0 J`#3V#a'%O JAF0FCrэKbml C"mCЉH<bK`mh3"ian#ehCCC boo CCR "hEC E E tI8Fj+[b#*G+8+7 iKc`l+@Ocm+@Mh+@K"mcKcI* F*F#c.B0F`i#d|18G(HO|WdotO #`#d#3`ce(m3Oe`#3ced#`#3cedO3e#"2#Od>`O ## 0#cf%E#c#cE !ht@ ] !9d}xev#"cdff#cdf###`##`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@;IFHb jK#n Km KK+++KK#n Km KKKKKI  eeed1dedCeGdsws 8FKh<jFHD\ D8H!8FKh<j FHD\ D8H!l\ $J@A AObV|C;bhIFH  ]Bh@AiJ B#TH^KJhhC @Kh# @ AHF @!D!!K\hjHVHFVH!hpl K JhhCKAhӱMK "!CS!b!,0i pKhK *FKhU(OsAq4NF F0Fp@V9!!!!! Kn:f*oB (КmQeppGIVP pC O س_гO I * @O г`O% /  | @ = ;K-AFhmF,#6HF5Kh5Kh+9 #"2!#0 $*9F^D&K&JhhC40F#KDhC"KhKhpCOѨhD FKhK*FKh1<OsAq9F F@F9F$K0Fhp!!!@!D!i!!! -CMCL  Och+@IjFh#'0UL e(:$9Jh8FO60F MDhOBIFU,(: -Jh )IjFh#0U (:&JhOBIFU:!JhOBIFU(ѥeIhjF#'+o`U(g`1F@F$!I8Fh`jF I#h+U(:kh Jh8FW m-VhF;`+ UhZ` "ppG-GFLhAUMO3JO`#33+a`;h+?bzFK`kahBЩi"h+sۏKh(kюIhU|(l:\kiJh hUO3`#`XOr!0FUn(`:BJ3Fh ^#`{KkahCЩi)"Or@a0FUN(`:"qJ3Fh #`&#`iKkaOr!0FU4(`:dJ3Fh bKka #c`!0O0jpCOji WI_1UIhU( ##>h+a+F$2C@ƀ.8.$#.IO#@HKOsBF8C@5O#"#h7??9h+###.@o;`.O`*K)Jh`)J`+%JOC`OH$Kw. IGQ0B )OX.+OX !`!  "!  m8@@!+.u_3I O0O3c`.qP#'"h6 9'Jh8F-c+ڣj+!I"F!h6),9vJh /K.`u0F)F7JCII#h0Tx(9R Jh # c` !&K@!Vml-O]OK F:hX0 x*F}HV20[bS#"F20+<;h+܀졀!0FpO##oJNVV<JF7KFOq@F:3FOQ2,@^J(h(F< ]0ӱVK!0F##PJRJOQ 茨7F T;h+'IK!VHORFHFV<7\SFOq@FKFOQ,R4J8Ih5K z.Jh,O0 h0Kj;/K!0F!J!HF&K 1  L74 FOqPF\OQ猨7tF T W,[|  !"!`! X! "h!H!-CXMYNYLh+#3`30 C#i+NKOOh8h=MKMI8hhH8h5hIIhTFhjpCO$2C`iT`@Kh+?Kh+(h(!ThT (h("0 C #i+ ,O2H9h)K8h"`5FO3`2C#3`)O#3;hj3b0 CML+h# h#+`;h۱KHh8訹KOR%hPOI7FF F(FI " h5 `!!x"""@!  "p "wX!H!||"؀"-AMI T(9 Jh " T(9yJh wNxLsjp+^0CZL0#qKrHheipI(F8<(nI(F86(#i3+j)F?gHfHfKh;+9dHpaHaH`H`H@A(F(\I(F8ع#YH0O3s`VK"`O78F MRHQHQH+x jxOH)F s+ S+ Y+`i(aiHHy+FH{ĀCHsCHp@A(F(4I(F7(+x;H^0#8I j6HQ5I(F74H(F7@CB0H(F(F#8#(I0O3s``a%H)F#猀" !"   $GIx"<]Wv*FIjD"KFhC F0O0  -OL =OOu-Kh+,I <,()I"FH2$Kq"hBFB8 I O0((>0+I HOq$&H!FiGL#(  W) !FH J`W   `!  a! "-GO $7H0Fh95F)FB#кXO5(F +I D(L'Kh+&I&I 45FO $"0I!H[jG0iF RIJF$H%F2J kH!FG(5F H Kh+II "k HG(232`!  4Wh!a!} "/!MFHF'p1FHh/##p-K)FJ -O0 MK0Fu")F7/#X;9FK JE#p l!`!hF;`+ TϺhZ` "ppG-OMO3F+hm( (+hjG(+h kKhFF+7рL4 F FgF( F((O3uKh F# F(.@΀nI" SkKh  (ڨ FV(оbK4+`O"FS(88ZJh oP ;+! FMKHIH#y/+ 8KH7JIFH2 / F FEKh+ F(0K@J+hZFKF FCFн@ֿ8Jh { FFS08J#Fh h@pFTCF8h+ ++8iFh(FT0 pCO$ F&p+N+8`-G0 AO;hlG(;hjG( (O +;hIB FlG(UC F(2? F(: F ('! F(!#y/+ `8H7~IFH2KBFHKFVKd0[8&Jh ;hjGI" S  aU#AW( "h!l!m! P "-O/0 /[M+hlG(+hjG(( SKhF[QKhS8OJh jMKhùMNT+hjGII" Si |(ڷ ++hIB FlG(8KSA F(0KS# F(+Kh+*HSh((O;h C#HSZﰹ:h0B`CXRhBAKBA F!(! F(+He+KB "" "h!"(!"l!"!h!!"#y/+ 58tH6TtIFH2jqO0:hClHS0+g;hKB`CXRhBAeKBA[aO;hKaJ+hTZF_H43h [Kh ZKh+ (;4+B +@;+9OHF+5<1YAکP;h+?ٮCO;h+?Ԯ +<;+ P( HP簀"5Sz"h!""l!!!Ѐ""x"`!"h!|""̀"|"FS( 88Jh ?P=P!ګPAFPF(PHAFHJh!h!8LKbh#`KhZhb`O IOC O5(F8IOsK``Kh( #D 2(8!p" " !KL#`Kh+bhOIOC MO0IOsKhv( #hh D 3(p"8!  M!KJI`OB ``pG8!p" CK-OFF?I  >L#0c`(O9HF2PGwO{*F0F[F9F6g BzڭK *FFQF(? h0j -z / iB!#h(&"h0DaDa`2 b2( K"`hiDa I "{8!   p&N-sh;$Kh+#I nO0p((K L%1h h( #haDa2Br 2rh*5B I ;(ۄ%u(  8! FIiaFFS8!S-OFٰ%FSBC XmQEU 120"& 7aKh+2O 8F1FS(=Oz&,VKhUKhRjRKh0Bu)8F B,Cs2S(7SCJO98h0F7t>JCFh  8F  (+7`S3J8h O92BA BCX0)sAF8F3(O9HFYBCX0BB RICF( V 1FS8( 7SJ8h BBBR ICF(܀" 8!9KspL-jMN)h hj( #haDa2Br2p 3h#b (ۄK"O0`8! ""P-A  2N2BOtqF FDaaPеh*F#F6tDCFDjFPFD!F(Fj(O00mdD[B2-t2+OqqnBOqFЈB*Fq FFiFDdaFF 8!-CFP FF.(F #( @(ܭ-ȿ(FB0FFFIF8F7"6 'D8!-OBCFX OVhF88FSPOz # ,v#*/5,v(2C$O0'73J[Fh g@JBv8F"F(/F$Kh &C4 /*BCX)[hsYF8FJ0hFO E ѼD0$fvbDO U4BIZF K"8!-AFDL- #*s'%' h0BA!DAq-#h!4Fi*F7:F+Da0B BA*I S (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF7F3DaKhYi)0F!)(0"hBDa܇8!" " "8 Li#hB ٥i!*7.Kah8@X88! -AFO FL- C,=iB1F,F&DF"F7-F#DaO08! -CFdFO-v C,8hOyBv 0O,FF"FF7F#D,0f %FO0 8!-OBCͰFFQXVh 1F"hFF7>=KhiF8FRJ( 7*S7J8h -v U)T.I( BK#*1Bv8F*FR('0-fvD0&8FR(T7J86BBTI(O0 T7 J8h c VM܀"9e  T 8! F8*TTR(7J+Fh 8Rh(74Jh (J#4`8  p"0F(FiFRb(!Kh '0B CXRhBBB0CXRhBBI*F  " 0 FFiFR2( '0Kh۹pCOI F6x FR(-7 J#Fh O0 FR(Kh37 J#F"  " 𵯰FF6F4#g##9'N3h&Kh  FR쀻3h[## J!Kh[##J!iF FRj`7hN+7J#Fh U/7 J#Fh K-iF FR0   MbN 2 pF FFR p2F)F FR>(Kh3.7~J#Fh O0"y  FR(hKh37d#FJ@h " -GFxFF/+O80O/ (FO /!3F(EЀiF(FR,`@(Fn0/##piF(FR쐻p@@O0&Kh#:F1F(F!(FR (iF(FR`(FAqa#jF(F`O&O0"-CFh#x/+ 1Mhh(0I"#k`O09 "C@ARU0UNH7#h"J3h ^N3h B'0`!h;FJ1+ (70C@$8F<@0 K$h3>4 JAF *4`Dp"  ! "+ Ȁ"-AF FFFFR\(@.Kh (BBBB#I2F }O0pCOI F5h FR(74J#Fh  FR(/ !F0FR(7 F(/J3FAF "<  Z k S0F(4pCO)BCXSh(s RRBA## E `iF(FR0pCO  I*FO0'0#"#iF(FN SF( P Q# 18pG-AF]VD,Q(69J#Fh 57Kh;@$ F<F2Jh(?+=( F .K.JhhC""RS 3 F#h4۱5 F)FQ( 6ZJ#Fh  FR&J#4`(t'`g(t(@0CRx Rt#0 ' "Ā"   p"-OV @@2(tO )FM@FLFF4;+KHh58툹Khs  YF FR00pC O9F F,X6𼀺"шKh+𾀅J#FQF \,@2 FQCu6}J#FhIyKh0@$ F< *(@(HF4́+*dKjHh5 ! FRx(  FYFRf(6n`JKFh  Gq F#R)h 2 F0#VKh+$SU 3QJBJA"HF#>z,FTPGWS9F3 FS#QXGG9F FQPIJF F4 FCQmV(S 3 #!<H!F@`/GF(FCF F#s#844;+c$ؚj FKѲ3 C " KFI F4 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`*I B F F2#" F+ I B!F |"^]S 3#F9S(0H#,7F FC3^p!x 0?"hF^)FhFL)F F0@QDFB*OЙB+0,08FK ,F+0 ,08BA,78a,W80%)O4BB7;$)'ѕB CO0 0= )@pO F03W3kpP0!@DpP0ЕBB F FpDBҐ0x+FB)F; +-*OF8ЬB;0;ڲ*APqAq@ECO2?oEBpBu7k AaF F;0ֲ . AqAqBAֲ. Aq 3Aa;ڲ* Aq 2AAqO0F0;D,&ѓBCO0 0; -@pO,F404W4\pP0!@Ap04IPГBB FKh(  IO2` "-A F-O!-LF9`!hy.Mih!` x-) !yO &I1 !q!ya!h  !`!!q)F0FAQAFFDF1h*hCFIH?$)F0FAQ:,Cx:+ KhBU"2`9` F*hCFIO4'"   pG hhQ:s"F3NC FA2oBoCAF$%F F)FpBxm*% b*k*x**"x* *w*ѪBrjaBRBr0 FFBR*!B20aCDBqF F-Ax3$I (O0F I nFI,!`u4 :00  `HF;x+,!8F1 F#p=!8F1F(I0FD'F$M"sF$F@J`%(Fp< +4 FFK"`<1F"F5#+U"IH  dKhQЂB`  L I IpI_ IY0  -GFFOIHFI  F@ F8FfCF 5" J;Fh 0F/#cUVF02-OF/!hl(D0M?I)FF(J#OlP%,F.FF`;` cKO XFCѽKhKh_RJ)+@K`0C@>0hz(;S e-a{mqu=CIOU[--#'7yܐ\1K(` /I 0@` 3*K)Khx-*(JYx#``#$K"#K$J`#K#K#KKh+!H|0@ʀK"`"K` 0K"`J#`J`J`O"D"   " xK}J;}K5hKhkK5{K/{KcKhWwK##0OtI`*學+SohFQIPF4(ҀOIPF(@̀RFKIKI4(@Ȁp4+#OFO }F(ѻ'8F3IPF4^#0+?qRF0IZ8F.I4L(Z0HFO 30"'|"" !"$""؀"!^ T J @ 6 ,  " " ""LQ "   5.I"HF4踹030'8F# O TFHF#]"9FHF(#RrK#FLF'hoI8F4`ch+?ծ04030"8F4(߭#F>X{_EF'h\I8F4(h`h(?ܮ4!(ήTI4(gh/?ˮ4PI8F4x(FNI8FF:FhhEF!(ڠ !y(O @FcF(ѹ9I8F4J@F#0+?:F0I4ϼDdaЬe_ +ؾ  uI# `tK`*``qK`rK`#+``mKnIbFDdZKhA(DTgK"DT`eK"DD`cK"DD`D4KM"+h]KL#T[K`D4o*h XImXIXHt#WITHL#TIQHPIRHdxI:F s=I# +x##a  ;x{!F8F0%2I:F V=/&a*c* C*M* &iFm*&iF$I;F 9 F#iC#a#И0@F0IBF#iC"aBA I;FBF  Fig#ca Kh` ``hTa0lH"-CFK FFh@=2W! Fѹ &I  h(BBѽ@F#eG$ "H Lch !@y``( IO0 "gCK-OF_h/ZX4+K84+FB0CP@ShPF2W!F\F LF#BEBB) i, F( `U##ca9G&@ ) FI 8O0!h @@B., 4+ ##4i;a+i h0w Ft  ""K-AF\hS8$*-4+);+&B0CX@0F2 T!@U 5#EBiBB F+ѽ h0+ FA& "K-A\h&T4OV_]/Fi8h8F -ѦBѽ "Lhs!LGPm`0I O0JKh S BB L h'K`03J#h Jh  hO """$  Lh !@ '`( IPO0 "  L#h !@= `( I6O0 "AP" 09@ @B-OZNF3h+qB C PO0B0C XPF0CEBCO#CFGFF(Lh0AP"F(@BB`"([ZV (QhxaB C`E` BEBi##B0CP   BE""C"FBE/ X##h a`I* nI j "q Li !@='a( IPO0 "-CNiñ%O F@Gi\Yd### hj5B "-OF-F'K0@=HF22X! FSFYEHEBBЛj+0 DF `v(H%@ F5I Oκ " -AFKFFFiԱ@=F2T!@jBEBBB(FO0` h F " pGF!KMFFh{x/+ iF8I*F u MF( FhI*F g, F M@(F `(3`## ##07Kiab`"L c  "-AMNOilcha3h cjh h;h C #3### h Kh!j h: hi Ffi "Ā"    FF@(ȿ@8FĿ@  FFBL"DBD2F eE28D[[-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, F(q#"#0)_2FAFBLU&`##0S' aC'@;#0#BB 36 Jh O0 M2FB3"J2FAF2N(B`CXShBA  3 Jh  F3JI )    ! "$ -CF*KFh7)I8F @" W F5 QF(70FF `p(F``0G(@h,!h0F1(fh(F1F1(0F7(Fj``( I O0LF0F% F"I "%!R!m!F KFFh h@"T @T!h(F10ah:F(F-0`h "p%)O4BB/.3O.O TliTB CO0 piT@Dp039P0#B9 FFF0OpB DB0[(DDK-A]\F@. * F7JO.#BD#<x/+20JkF@  D (AO0 ]^*) .'D|3F^D?)D3FO<p\'JkF@   (JkF@   (ڽ JkF@   q !!!!pFh FF*F3e-p@(e"N=F-F h#(F#`3`pF F I!O`!KhOp!pGO`@"0# L#`\3  hX`ah!`!`(̿  0O0@"8FxO08I"1ZKȹh2"` IO"FOqF(F O0"`!( !pNrFر%hI(F1Bdh I F1<I#F*F  K 4 O0p3h;+I#F*FK"`  '"1"7""@"-AFFOq0F0O0BB! FU2S #840K;+cK@A @A ` @\K "dFBH}"F (lq"F<ti" !@|??Dy`" !RB`BPBPBK`PBpBK`PK`S hC 8 &2)-1):Ж($/5)<#BB4#($84K*K) " "$T }hQBC]`!C#4(4C C(43y/+"#3q `#4#84(4CCBB($BBxhX!QBX`C!C !L"T"-CWŰF4;+: 9("((Kh;&0FETI( TI(T}I(T{I(  BAr 0 R "O0 ɶECT>I(g[B@<#@<9K! COS#(F(<#F( @#(#%@F #IF|F(z@(F#1F(#lF(j@(F(O6 !@(4 +?&@"""#&#C#a###" pG pGpF.xcI"0F1FI0F1JShi CCI F#a"FqOqF(FFBFI2F O4 Fp!#@"#$-CFFOq0F0O0BB! FU2S#84Yq_@FY@B-b/#DG;0K;+ٜK@a1@F@A8D ` @K "dF" ! (|uBC ??P" !B`BPBPBK`PBpB0P)K`#QH1("tF@Q#<1 (1("lF<WG H 06+ 0+٣3*pEE.$g+أK*{#4BCXZBy`G,"G#(4CC x+HJ#4(4CS(4#4(4CC(4#84#h;y/)#`#q ($4+I BCBS""$"F(4="FFQ6*K#oCCH<#H<2+($B B#($4#BB4#($84JRhK+ # #4BCXy`ZBG,"G# I JK+ F 1(JI "[L"T"C$@"H$y$-OW}F4+++СFY;c+<ݵJRh+ d;KDxF32/*ѥ +[IJF;++ Pkxl<+=+/ Hkxl|+#F dkxl&+#F ]kxl=+!#F V jx+*k' Njx-*k( H) F% D# B$ @#F =#F :,FF  \")JP"'X"D"!(FKHh@"Q(Ks[hM.h+` K.`0FH"xK*F1:"` F/2F F10hx1*h3IxJ\ HL3(F!Fp@"l" s(q()J(pFFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,/FFp/CC3DAa?  @ !CC@?   XA@XCABq BA !BABqBB  BB @@P@Y@CC(((-OFF t0%+F F,U G9Fv0&+FFH##FU1FG;FFPF,CMFDFF F(F!F(@""K𵍰#FF#,F F;F2FF F(F!F (Р +h9FF F/. TF F F FJ!TD" @"(8 FMh)+85!F@"-OFFFFO O ,p,x,7,:ZH,## LFF$,v",1FHF0#+F F MH:'+عnIH  QD EE'+#.ѹ'8JOO3#FE68h" 8hF F## kK #%#3F9FFHFhC $$##3F9FFHFWCC.', JO4$&F$F!E`")(((@"-OFFFFJ##FC+FF F@+ FF1  0E$"F@F FECF:F0FF F+ 0E`FF&FgFF--@"Q(-CFFh +F F#F F0+##FT1F G;FF@F%C C$$% F)F$@"-CFFL0+F F##FU1FHCFF8F(C!CCO%%(F!F@"𵇰NF F FaL!,CxI+уxN+ F'70 !,p(a4`aj!'hF F#H0'(F!F@"0)(-GO(Mh7'L &K & hh0*x  0;Jp0+k +0+xF;F=F+{#hMF K(FhFF F H F ,C  eM  l"M)L)X" Jh@F#F/))`!``"0FͰ M0x/+HiFLJ0&(FLD0&BB*BB  S)pFOu(F)FF`H FKX` Fp@ F 06h"+mF0.hFHpp`"U)pF Nrhr Kha H`F (Fp`p Fp@`"h i)-CFpMkhchmL #h3#`kh`#k`#h;#`#fKh lh\h"cH ihbH"  _H!F ; F8F\N/ x0X9F(`WK@h3`;x/+ oh;F7x*F"""8-  -OF! FK! Ftt&ho` h@EF 6K^bױ ^0khE F& 0+IFl""  (-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=Ftq+{#h;F K(FjlKXjZK"Zb  "X"-AF!LF&i3ahh!/^0h+#i;#a+ #`+ #i;#a+#`ifb;a;+fj*hcj * +Ѩhhfj++" -GF4GLF^`fj  oh/[ `i3a/h)i0+/7K7Nh0A 5H h 0hCh;C`+= 2hhY`="pxh &0hCh;C`+0 2hhY` "p0h f"yhh hAF^ fj"h;+#i;#a+`?h"QF8FhhhZ`hZ`+#i;#a+`ifb;a"" H- l"-CFF Nh`h"3`Oh,/h #"h dh+i(F3`YhL# #hAFh +#ieh3`{j5,Fh^P-{b mh#Fl"" -GFhF|*h J 0chSMKNNhNK0hd 8KH 53HH --GH (0hCh;C`+- 2hhY` "p0h >N-3h3`! F8RF!FF(R-5OHFS#{b'IF0h " hZ` ((3h;3`#%Kh h! a`hG3h;3`#Kh -И0㱣hӱKhK0h H KGh +-'!xb" l"M-a-p-""|"t- PK0ɰhh##*JK0ӱhHKHMhHK0h pEH mhCH g?Kh !F` 6K`hFF;VF˼-ѐ- рx8 Kp(%F (  0 +QD"x0+?;+ JB?JB? -G%'x03+ (x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + }K"Z`h`@"` C O3wKk vK!h+ |(@jpK+`oKh3B@L h +Y\#x0xbL9!`` #`I h"c2 `^J!`"]I `]I ` b[JhJ"JG`b PK` (TKUJ`UKUJ` &# RK`FK"Z`* c2@ ;KB@6+ 8KhQ`hR`"`*@Z!m;K&0++ѽx0C[hh3Kh"`"%KbJGF)(a !K` S(K`Kj*Ob@F F  (zCK`Kh+b_.nJh;h`3 FFHKh+{#!$ "t""t""'     T" "|"-F+vxuKh+tJ bJd+ pKqKXjhpKBh +` iK  j^!C #F P^L#cb h*@ u`b[K"`[Kh+?. *SKj;I>! PJ`PKh+h !IN FA V&5F"+h`#`Os =L;3`3`#h3#`  FIH!F"pCOH!FOH!FI(PCO (F"!FF(%F(F)0"-..p%LN(Feb3hhñ3hh!Fy&c(Ffii3cafa`jp"t"(L HhFbi*i8cj i:B"`F""a" " pG pG-CHw& (9F 0 FAFFIFF IhWq"F Hh F -  FFFIb.h/ Y)F0FT K`K` F.`|""-OFhFF/T* F%&:FF;:+гB@F ,\D0B&B@ F\DZF9F.+ٸ#!J F-hS`I*FF pĂ"N. -AF F*sL$>Kh3"1FhFFah5H 8F A2H 2H )0H1F z.Lk hCh;C`+B j"hhY`*"p hCh;C`+8 \"hhY` "p4H H1F -M`h+h3+` BFhF+h;+`#Kh H  HH1FhZ`hZ`"U.m.v..  ."|"...8FL h0*xxB%+`h8)F-(4P8FL h@x+xB)F-`h84O K "0%h I:0Q;+г(,۝rh ̂"-CFL%dd#h3#`|-#h;#`Kh˱C-0[ChB h;`8h(5+0F"|"̂" "K-AFhO6Bt%3xF+B:*,F:)*lM+h+"..` F.`l<:+5F*%*. H9F(.F,F.$" .-A&MX+h3+`|.+h;+`˹KhA0+ #h`h;` 8 FCKDh00 (F#h;#`;Kh#0@ 0" |"!@0+@h -O&F7F5F4FHP xc+,C-H:-H6H O 1O~ .O +,/0/B/+/z////  //"////0!0t"<-OaLFaMF#hF(h3#h` .>Њ.؀.:.2 .'/.3SI h: `*`kF *Q"!J!J=J!J!J!J!J!JIIF@F=J z9N03h33` hxK3H F(Hh$b,"O /*ј0/+ F"pj/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZFB*`B*` L"X" .0-L-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`O3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`$ci3h;3`+;h+L""|"P"7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +-V# "` F\F-Lh+x =+T Kh-+x+KhBۛhD: *G;.0+0F0rB'F I"FO  h(3"&sD;+K 0 ;+ ۲ +0;0#;0;0R ` #FL""|""X"-L QK-OF[iFK G`sh`p`JKF0OZhVhFK3   :DEѸ#x+ jD`F xɲ)\ف(FMF Q)(K+H)TEF(FO 0=D`th `p`@l 1B- %F'O) ,FTE"x*Ё* e%FIF)(й HIF)l%FlMFOF,FL"ԏ"8 30P" M L Nhhha#hh3#`#ho`;#`+3h+aL""|"8F+|0)FFR KjD``b8L") FOF";F;#9F`F0FFahhh+V(5`.F*h2,`2F6h#FFF4`&F#h+%`F! ȿh1-OO FFF[غ*Uк?Hк "x*4"xRE4V' غ\"x*4!xBx% xҲ*Ak"x* bx:@ 4"x* "x*4Ax"xQБB4"x*4+Cx+*+Ё+xҲ*?+[+ѠFF8F?) *@߀bxB44"xB{x+ѸAx!)^)lт[x.-?u]-!)^)]ц#"x*+WЁ*UcO +xxɲ)@*?R[*5FW:)YNI(F2(QШBOqx)ѱx)HШBFEKY\A B#B " pF K .F+]*[E??7F4t:F>F#5BЕ  85qE8*\*F5F*x-*&jx]*#Ё*\*5k#1 ( #6 (ؿO 5BO 5F *?OFDF*"70)J-OFF F #x*+N?+L[+@cx!+^+'ѣxx.2]*<[*&Zx:*&Zx^r]*/*Ё*њx*/*/*@#x/+(Dg4c:*њx]*À3F*3x/**3SxҲ*ف+4 UL+FfjxxҲ*ف(1 x+ 1B`j)`jH(BL$BICBx/+E#%>KAJA`pRF0F *DSذ1JO,i )/L+J#XF3x@+*Kh+{$O C@*~uK 8( h8 `(hCO ` h8 `( hC`JCJC)JX"L"  >0X"\"-L ( 8(hC`o~p8( hC`pr{eJCvbJC$O \F^N1h'0`N -8FCK[x+RH:F#x79)-KNIM3h;3`+4+hZ*`"p8F*h0 RFYFh*h0CYD D *`32hD3`y%2K"Fh2Kh#:C+`#p-KRF1F8F) 4U(#K*h"Hp[x#+:Hx3Fd+H7;x:3F78F :Fs-ЂihaRx*3;%KYL"X" l"V0q00-O F FТKYhVhC~)PF)F F &'#TF)؀)1:)b=)_) )Hh2`Hh:`*x Pp.B@F'@ "HW &'>F ( ( uC_/0+  F) њ)ښ@)њ =*O( \I h: `* Q!p&LB "p PI h: `* Q!pHI h2 `1B "pCI h: `* Q !pB "p( QB ): &'F4/+I h: `* Q!pB "pL+1ɲ ) !h9!`)H p h8 `(D@ )p fA!p]D@Hh1`ԏ"l"X"8 L" 8I h)%B 8 @) њ*)@)њ @`f )@C F0Fr *F@hJ h ` FKh8`(C0kpN ~*I=)+?C#)F FxC0B pTF\"X"-CF:KFf0 "7L)Fh'a0ih#`1Kbg`hga0/K` 0vS030 `p#hp;0+*#hZ"`p h0] F"AF#j"`+i )FvW#j"`i*qh `s`iC#`p2 0#jG`` b L" l" X"h""FuKh@0 -OOq4Lܰ&h01O;h;;`+FO#hZ"`"pP0F{5D(Fu:0 h!K(FhF Fh#h:h0D `D;`+ `!Jj!h F+F+*ѹ"3D0FY#h@F=+D#`;h[;` C#`#pL"X"l"0 -O*(NF(O!!FiFF;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI   HaJF KF 07L"X"  008-OFrO+,FFi7 9! @0308``K,ah5DVDM ,|,!,FO B ;h"pJF)F0Fk(fфл44tO BӔJF)F0FP(K#FНB ,* *Fx)22B8FtBJF!F0F.(AbЕB <+ +Fx)33B8FJF!F0F(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030}C;`#pL" X"-CFLFxh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FF F7C#`pL"  X"-AF-LFA,H hCh;C`+&"hhY`&O"pB"HAFu hCh;C`+"hhY`&O"pB hZ`W&6)nDhZ`W& hCh;C`+ "hhY`6hZ`  00HH0HB0KhpGhB` Kh) Khj3c1 i@ pGh(h pG pGx" Kh2`Zh:Z`pGx"-AFMFlF+h3+`0j  (0j`bKZhB`h`h$hB`g+h;+`KKh3A$"x"|" K-AhN,j3h'i33`@F)`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x+h+3h+h#+BF!@FF2S"!@FF(($H3h"`Za2hchQiWa Dc`F)F+ *!!h:`*;#`+#+p#.x+pK03`hKh1.pH`"`!`!)o x"  1  (1 L#h;#`+chZb`xD#h;#`+ڽ@9x"8 L J#hh`hRhaabhZ`#h`O3 ``#3a x"FLFI#h3#`"!(FFN3hh(7hi`#O`a K"``#s`#h;#`3Kh@A"l x"|"F-N!F3h33`F4)H)FOFxpCO)"# F(XC!" FF (F I"( FF<H)F#" F#(<C FF,H)F FBF" H9Fp3h;3`# Kh +"B1P1U1r11|"FLF#h3#` . O(F}`) K^`#h;#`8``3Kh@"x" |"pNM4h+hh3+`(i#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@vp "x"|"KhpG pFNM3hBpBH~ "18ML+hB8 "8FPM+hh(d+h`8 KhB`pG %Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` ć"5rO FSMhB%RKhRL(i hCOH!E `0 hKI ` hT(`GHFK"N '8F'7/8FFj `0F@hB! V! ! 5O! F*9hB F0*Vh"F*H 9h h0;*Fh"F$HFhB 0FF0*2h"Fh h0*$h"F hk! O3#`R! N! J`ć"T" 1r1 P"12F0+fH2K2Hh2KaYC1-0N% !Ow3h33`B 0B(%K(Hh%KaYC103[h? ѻB5!0*h(Ћ FH OpO5'; 3h;3`Kh@Qh сBU`p2ć">25rO"~2e2|"8FM+hB+`Ћ@! F]+h;+`3Kh8@x8"|"-OFFF 0hI FO_ؠE`BԺ; F0#0%ݪph1FRFKhBE?  ++ +E :0+ї0+k8Fx0  BmnKnHhnKz@hZCB]а?\O B -" "!cJXF XF)Fh  3h^J!HFHF)Drh  Q=XIHFHFO )!FDXFch;c`+ F7#h"`!FoG;3m># fW+" "=J!XFO#7J!HF5J!HF(OsB "IFashHF)D(H  @IFR˱ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#h6Z"` "p BFI F12ć" 5rO222222220Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8FvL4F69FPFk(((F&lKC;Ԕ Z) "R,B4HH$ 23ć"23-C.N/H@3ic-M.O+h!hP0F#*H*HN!O1h O A$H2yC1!0CE!Ch;C`+#} hY` "p F+hh"[h*`+  H 1hZ`ć""3t"5rO33#3U32  '=F>F:H0s;D+7Hj(p(g(F'%0Khh[h .H!F`+Kh+KAYC1*H&0FF.)$H $N0B# kC H5X0hCh;C`+1h0 hBԿ # #P`p0;! KCX0hBԿ # #Q`.F]3a3t"3ć"5rO32  3Ki !V(@Bć"JiH#;pG2 pG pGć"KF60 Kh Khy Kh KZC200hI FpG T" ć"5rO3-GFKM+i+G?_#+a@F;@DO;h3;`(YOhp&Fkh",`O O1@"F:3k`;h;;`#3Kh 0O! F;h3;`/K0;#0#63Os0h0p. pC;h;;`#Kh F0 F40O QFF*T#F"EPF2B03 *4tć""|" F@JFFh`>K?J` F F ;K`/i..9KN0+A0˹E6F)F En뮹2K)Fh0*hS@RF+H90h!F %!F !"K60s!F !F !F /K"a.!F !F 0+F(EH)FE( I .T"t"L"ć"  23 FF JN js0+""BO0E"F -OFF #`hL@FCF( (F*`h+#h+$|0300F0"B/00MKh+~LK60[ BvѺt+t"{qDK!Fh0;0+?Kh+40РO rFSFO BӾ АSBЀ0!0h?ЩB Yh?= O{YE/Yh? O{YE"3AO1Y`!0`FO#P"0C0EOqE"T"  |""ć""-GF F F" F(.KN04,N0h:FEB4hEF F0*hh@j"F HO| &@0BڽO0C0C0 F64Д0ոД0#0*F!F8F  2ć"$ HAhM,+hhјxFHR l(p(Z($$$ BK6 "0 D@Nx!7h,"FF8F+h*`Xh(0h!FE3t"3  -O&OFHFїKhhOZ"0FFoH1Fn,p,H>hO F!0F H1F$к$ F {JF7h?!'T;shh*݀$! 9V-@.+"F0F h8A3C!F\JF(0T<0З0+!8F=F. F0FhWQK60+8F0^C0KВ?м<F X" ѯB!(F0F~s0 ;!KCX/J! 8 *(F_k]?cWF 2S) 1>0%-?; *5?2 *-(F"&$$ 焋"3t"334 4ć"pFDH3M+h3+`F 0/K1Fh0)jh@RF(H!F 0+ #K$JhSCJRhB! FD! FPF& :(OrB)0+ F+h;+`#Kh E0Fp(OrB&6瀂" 2ć"5rO|"1Kpi0HMD0F -H%+H&1"0B#(M(hCh;C`+&*hhY` "p Khn0)h/OrFHH51hZ`M F+h3+` F1+h;+`F# Kh Fpć"#3333   22"|"HKhh@}"3t" FH h@p"38L0C1"B ۓPUP-Hk(F#ca823 ć" 4-G!fO F #0F.0>"#;F;+9jv UJ)#>;*;+\+"э0\#0"+рF;+Њ+؀+=+Yأ"Ҳ*o%H"0F8J JFFHF  0 CoCE Ё"#)J rF;OOaO}bF"0 +J$#"#I- K IJF%:#s*0 }+If0 w J$#] J"#Z*FXć"W484O4T4 Y4_4R4𵇰OFF,mi+j%h-$7]rEO""   XUM"hBJ!~(F"hh:*+߀zHB`h!wHwHh.F`h!sHh%`h!oHoHmHdhh=޹ch˱iH hh!+heH-hcH`h!waH dh5F]H`h!gPHYH~h!\hSJHtSHqh!ODHiOHOHd`h!B>H\JHYh!78HQFHFHFHJhGDHD`h!AHAH;chh7`oCBH:'4, D4C hp$r5UFF-8F ApG, 4S l)F@FDh(F'F5-OK"M$` #HF0Kh+hHp/r/d/+hx,h#%8$ F#!H3KdN(F_J#Fh2`$"  C(F.'L&h.@"h2"`FpL :&#hDE׀#zH"Fn!h"(hiU(@_8F \\+˹ FC>(ѝ J+KEйIF$f(:[HIF$`(@𻀼$hh2h(N:2`QHh:`*:[FF},Ѹ?wIHh:`*[FFkF e?c2h:2`* [FF $MyF sF A,I(h'F:2`*XF0.$J#5h2`#OrJ3h33`p"(h" " YF$(? HYF$? i ""5t"5(65X"  I",M$A8-A&wHbF(@030CnFCj0;0#kKh =jKhh-|.u^r#5F0#5kDw" ,`5kDx" , O <^r#03F3jDw!%3jDx!3`kDOHF,\r# 06kDw",6kDx",;H #<6L h/#h[3H'8F&d/H!F+x0 *")FF@t0;޲.'H)F?BB+r H)F0(F30rF@CF0F0;0# Kh }N(Zh)FF HCC,6|"t".6  6>6D6c66"-O$f%&FHWFl00BфKhg [h˱H_S/a/H/FF$=F vH)FH.uIHF&'D(qMHFF !;0_ ٓkHIF?zhHIFC 3Cz O0oAZF!NBq ӫE U iFC0_(hFUH.8&,ORLT <{QL h'#h[NH'8FiF CT<,T FH&oCB?6H-=H ! ! 4%4,#!F F4HO4oELFMF!аE iFC( (LhF%HDE 0+ K`oCLB?HUz #!F FHJoL7t"p7\77 7776  87777H"8 86:*# p;;+pG8?  pG+B pG7#Fx0; + "&zB xZCO5ABAH!FH!F088x0; +?+ pG pG8F&FFI(FnI"F(Fh, I(FP+x0; +(F8 8 888 KqUy]"FFgy24Bl*Dq 8LM6N+xñv@CtCCtC,pClK"F(F8@8 @"8-C FNMF(l)?LH,F%KI( #hCyHF#y2D- AAF74/AL hCh;C`+"hhY` "p:K$)h9y7J8H+2F 45,ѽhZ`1H0NyyB*h3D-,H45,$L hCh;C`+ d"hhY` "p*y!HhZ`)I'hF F4y8,ѽ $&U6A8F& !F0FC$6. H:FDf0- 99  939=98L9T9Z9 KF $yBѽ@0(HD|0- 88Fych=U h8@佈8-AF T 0F0+р<FFT_e L=` F##qe(FG \"-GF8O#{a O +*OоaUUc(,D ( o(.ј0ñ @F)Di3h+:ИF0a+-*ZxZ-*ћx{%ph( 6)Da)F FHD0- \r( HlFH +)FL%$ K@@,sh+ѽGd\"899 x"-A(MMȿ LLؿ FF a#3+q fih#ci#06ѕp/ %`@F%@6p0+6060+ЕN0+60N0F02h+"b*x-+#F0$K y03)(ѕ0ai!iHiM*`ha b#j+`ci+"ibq "h`FFh32%`aAh*!Zh*3"ba  \"9"(F#@FF L #h3#` Kih #h;#`#Kh "\"|"x0; + "!(K"Xq`\"-OFF8F x.>`` {4<`^x-.ћx+FxB [x :+V;hRxh*<,Mѐ:2"F-H@`F%VF#F=`Թx:+ "F#H@`FO? I2FH\!FH$\xY:, 3 FI2FE3;`YFH"O F=h %3wF I"2yF%(F::99 99( F H= K( Yyh)!`aYqK; :\"l"pFLcj x9ih px-)Yx)aYx-)ѝx-Њ3]xBRxF:*[xiah Ha( HVxP:. 2Fb%eb\"@:-:-C [M Fih+}PhWHx-*l4hbaih[h PHx-+0FD ,h$$+hB,ۣBDH8F*hAI h3 `Fh #FB"ӔF#FB#o #D4 B#DB#` h; `#-Kh A0FSLSLS B F2F+hBH$OFh+`:hF2:`$thYC+*;h`;;`+~ Kh+?yu+yi  \"V:g:y:"|":p L M#hk+p+h&;+`+k"hk;cs X"BhF"h,4#FZh:Z`F$hD`8FEhkC`+݈ #C"bZځ"h`8F !"Jhij`$ F;  pGxɲ)ف+тF3۲ + pGxFI\pG\?+ pG)JxFI\pG@ \=( pG)JFKHhkb ;pF FFa(F[h(F.KhB`KhB`p+x-+kxO3`HKhkku aH"D"; -OaMF+hE?F:x[HZKZJZNhhh2`+fѹ?:xf*3h;3`+O FLKkhMLK(hha\:*2`/ (F02h:2`*'+h3+`?F2h:+*_2`۹ +h3+`?Fњ*F&F2h:FF ДE-BFFYB ()h1)`h`C ( Q (|+h3+`Khh`s["@F_ *j ;  X" KFhFlFi +їi8F%D;F (JJ"! F5 F%8 DnJ3F!+ F J2o-Jo ;;<;𵇰F FKhZ*F! FKhBF%OY KD1+ѠFC Si3SaFKD1+4F; -Gʰ F%Kh[hKh}K)Fh &Fi8pK"!hZ`nKF`nJh3`+ F4gKhF&cK `cJh;`[+/%h-@ ;XKh ``Z`*`VM /h -hF+(!O0wMKh+FKHO,hHKh00h3 0"``(FM (?\(A-3K9Hh02 (F;h3;`0h`[h["-0;0+\#;\(`($(0;0+[F;h3;`0h`FJh;`+#; Kh (VBF!RNF,FIY t" " |" =X"BKh#h+S=K"hZa-L==  O UA+7Za+WQ/٧XCoҩH+h +^F+ho3+` ?c?G#p۲ ++h;+`#cp+hF;+`{u?-+`; c#pCɲ )*h!:*`ap)h?G9)`p۲ +T+h3+`#Sp+h;+`.+` c#p3Cɲ )*h!:*`ap)h9)`pA۲ +S+h 3+`Pp*h:*`pFoV+`;c#pCCɲ )*h!:*`ap)h9)`p3Cɲ )Q)h 1)`Pp*h:*` pB۲ +K+h 3+`Hp)h9)`p?GҲ *\*h2*`"Zpo/n+`c#pcCɲ )*h!:*`ap)h9)`ApA۲ +S+h 3+`Pp*h:*`p1AҲ *Z*h 2*`Xp+h;+`pGO G ' ''\(B Hn (-0300h '=='?'3D[+h;+`#;+h;+`3G+h;+`\#; ( 0300k2cshZ:\(`(}(ۉñI²+h \; 9)+`#;+h;+`+$$("(ћ++h";+`#F+*h:*`\"bpFqh)+`#F!)h9)`bpF#O3DB)+h;+`#;0F!ChFF`"Z)ۉ+?{0FChFhwKB+h;+`#3Dg9:+h;+`fF}HB#0FHs߉O0F0 Hc+h;+`+2ۘK{hshd+2)<+,S+x +xF+6O5K`hBډKhBȿ`>7-%>(%##`TF(F(u0 Fbb00Fa0 @(FTF|(#&(###`5%u<(>(2&(.##'#` `0 (j\`a0j-("`00F`\bV0 a)`##F#*h{(2DK\8?K{O *`O+h*h2*`h#(FRc}(F1K\ 08 (DR}(2FO 'L L)h_9)`)1:!\F )h=#9)`)d\> H"D")J"0 ()h_9)`) FР0 )٩F )h9)`FO =#FO FLOYF8F"f(I)h9)`8)O:0O {'shY  I + 1N-L-C0h $i4&F0h *h4D`h3 0 khhZBZAhF Fkh`Fh+0"F!iI"0ij``/M (OK0h!KKP0 GK h  C BK h #F2(P8K:M$!F`6K`+`3M"F3I*hj; )3,I)Mi !``2$KA`F$Kh K`K hK`K`+Fa0K`K L K` K` Kh+!# |KKt" l" /M x"n><-GM"+ha#+h ($Zi2Za(t!cc{[j;`" O F F`` i `( +hi*  U+h F tFp` C l`" Zi2Za +hi+ # #F` U`` % N` s (+hjiWH [ #`F+hik`a+hi *j*MIi$(* B#`IK`#`C`+hkai``:*Zi2Zak"0`1+h (!1`ib`Z* wnF++h"a(( ! & `0F\& *h #`Fkk` +hk``1.h3i +Ii$IO0O +hi*" "ak #FJ;F+hi++hi * !  >> k+hF( +hi*! vk 3am+h"`a(Р +! b ( #3`+h &oF` I#```! +haf+h (/Zi2Za#;`%#h+ L#4F` "K0F ( +*h8FSi3SaF F[j;` -AF:M '$+ha+h (kF/+hi3i *\j4`&Q*. E+J$O +hh:h0FZcH'0Fh/!!FH*h##`;hk#a+h``^c FZi2Za)O0' p7`#`F+h`kG``a  >>-A%"&L0a(< Si3SaF( "#F# xF`F` &FqFo``4`s(>F##` Si3SaM ZVF0F0H5 > 8!M*hQaa` G+h$`<(*h Si3Sa+hh+hiHH8 F >"FepGChBhKFhpGCh hhBpGhЋ"F FFFch```v`FhF@R(!H!K7ih8FBȿ`#F F9F F@!"FF(@! %L! %H!F%D! %@!F %<1i*Fj F@H@ KXh8 pGЋ"F FF)O@FBѰB0F@BKhB` F)F0F@B, %h3*F1FFH F@$H#F*F1F @+@-AFDh FOt`{h;{`-- FDF:h(F@h+Fh(Ћ"pF N L5h#h(F3#`+h(F3`#h;#`3Khp@pЋ""|" KpFhp.! F$heh-Шh(@-hЋ"KpFh FB`FBȿ`BF@#"!F(FCB %>h(F@0F!FFH{ Fp G@8$Mkh +ܿ3k`@ , !bF@`(+hB(`@jK2Kb , $`8d gfffЋ"pFNh +JhBh !(F@2 KhB`B(F@8 Fp%h+ h +"!(F,F@%h+Ћ"H" 8F F0(KEh``8Ћ" KFS 0hBh`5 F@@vFhЋ"JFhpGhBhЋ"-C@FhFF0 -0ܿ#KUh;+[ Pi IF0F@ sK$`%\!Fh*1FFoH!@!  F@hKhB`-@;dKB 𰀲R #)F F/(x%*h)FFYHiOr@!0F@BRKV0+5i!0F@6BFOr@!iF@0%h F@R%`?K"`%!h1FF>HpCO F@:%#`&iOr@aiOr@ !h.=0F20FO@ *F1FF)H - .0# 00;0# Kh '#)F0F(h%h*F!FF(F@4F@1z*"! F@B"FȂ"`@  @@s@|""pFF FXO0p !FFH! F@BF.%Dh! F@C .%8h!FFHK@CP@@p-AF"FFCFB#O"I2F8h2 KF33h8hc%I"FI8hAhB BFhCI8h eIF,h$-$ 6  AAAAAA8 !MFh@C Ѫh* b ! F@E KhB`8 !R F@A " ! F@B" ! F@CHЋ" A8F KhhBXhFhBch)FGh@`8Ћ"-OF F C 0 #C`FpKh``ܱ 0kKkJ`0jKhJ`h0BdKhB`3h F;+hB FF8 |!FFXHc! F@\(%hF@ FCB(` F@Z Ffp+pxh!Fw(j! F@60300(  +7K! Fh0BF2@CF'$h+ + +$h!FF*H ! F? $h+0"! F?KhB`-"!(F?*F!F8F/0;0#Kh $030BF0Fvh-$zh+Ћ"  $  D"AA |"H""-O%JNFXFF#U`3`9FJ FA:3h-I(F6F(=ь,Կ##Wk.m0FMF0FF03x0+x+0F#`(0Bc0B_iH1Fòs+v+fHN-POF;++-+^H<  PF#0F1WHQF BPF# ` C 2h"FI2` F#BF!4+hBCL h8#hXc-["! Fi@BF?up "O2Y*,$#`$h!FF)HO2"! F?0F) " #"B! F?0$dh!FFH?+#F! F.#BFHS , M' $BA\BA)BNB  BBBD"'H"AF F)^ h;+Z/O2+UZChֲ;C`+#hZ"`p+h2x<+Ѫh+h!F+h+;+(i!F>+Ѫh*I F+H!FH!Fh*ch;c`+ Ff#hZ"`-"p I F F@BCB8F$K,hh hrJhB1+K"`$`8*Qh)Qh x),!" D" K60+,KhK`""|" F F@I F0 F(O0gCFP0J#FH !HHqC"lC8FYCh;C`+#hZ"` "p%(FIF FH -?- H!F?-8!%ch5;c`+ F#hZ"` "ptCwC-A$MFO+h>3+` #;`+h;+` Kh{A 3Y;3Yx#0YvF4""|" Jh`2FpGXX x3 pG pG"FONF3h+L[h+Gx+ %%HKh+a/_-],R9,B,M3)djF F$d0\+L-`YBYA F$0O&DR-! FT<#>,33H$v#`"iF ?`3%$+%KN0+%!K6 Jh0+%K60+%%,%FKN *, Ф* ٓ603)ЩB! Ib #@R CB<"T" p"(-OF FAѓIh#X(=lhI F#R(𱀎I F#J(5'I(h#BF(@c/6@.Ҁ$=O Um?(F@ȀzK*hzIhO (:lhvI F#`tHtK!hO HF FoI#F(^mOnMsh+h3+`ph8!q` F+h;+`#dKh 4@,#;`(\N$%FZh[hxYH(F4)FVH ,UH$u5@-QHn$kh{khxcLHchh~ FFHH4@,є&Fcx>p+''.ـ5L.@/F4N , $,$[h6H3 F5F.HX --H%%4@,-(H$'/$-(HO R/L/O D0+?#H-DH0CH0FFH yCCC :D|ClC  C""|"CCwCCCCCTD ((,030 F:F OZhXh8D@!0F0;0+Kh+?/?t/nKh }(h(f,h#x-+cx+$.?]5'/?W%,F(|""-CFK"`kONH $, -ѽCCY0Y0x3hAF33`x3h;3`#Kh Q4"""|"pF LF#2 X,D2;+!(F$8#2p"KXmh+(x+ pG pG"-C' L N131#rQ3@+1;1qUh-hFX2(FSAFF(FT+hF""K? !8 pG"8F M\2B ! ! ! \B8"Ͱ#IK`a)8X)42d"AKAJd2`K ! *$#`" ??6!F?:+P "@S  CC ""t"""K Y"8F IL'!F F 4 `]8 8BOrOA XD8 M Lh#h3#` L#`k`#h;#`3Kh8@̾8 "|"-AFF %FD'*F1F@F?v- F7 /`$h+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+\3 Mh+hq`F3+`hc``0D `H""|"8E F?C K[iB F8@ch;c`+ F#h*xY!`p8 Kiܿ KYiֿ FH2!FtDR]pGKRi]pG Os0 FFR ;B0!Dd#pH<0@pG-G F'!F8sx+[I0F 3\ch;c`+ F#h!F0FZ"`""pXch;c`+ F#hZ"`""p3x[HI0F7\0FzF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0F F(ch;c`+ Fz#hZ"`'"p'=FDXD KYi5 HGK@@ Fxr+ HHDDh-Ah h2xh+xB,K=!0FhKh0=!F(F@B!'F=++x;/0;0 =*+O%p=F)F0FA?3F/F5F&F+p  X"ChL!2hJh F F X"EFx B #` Of\ 3F[EB{]#@*`)J-A("l DF: 0('FF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;t"8Fx#8@HIjF F"B H!F8@'+He,F#x+8'! FFH!F"FHE E8E;E>ECE-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`JE  NE-OF*LFF0; #0% XkE"K)F@=& qhղB IA%`56h;FT ZFKX"t"C/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O"7` KDi,hB Ѡh*FAF.7`'F$ht"X"HKFy F!XDiF0FF(lChZ `0F#r!:Hg`h0F@4O:h2:`iRsq Ch!F00DGkh`Ѩh*ikh2R"*a T##"#$TCKFBB0 ;h;;`Khӱ@>H$E $ T5Fh`` PE"X"|"Kǰh!Kh2@ K` K`G]K`"K`Bt"l"-AFF=!F HBF!FG(F3cBF+$t="+*U"Zp&41F('`(FA 0F!D;cEKǰh!@#K`G]K`t"p>L0`FN-0F (0"#`0 BF p@X"E(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp". ] \"p"" @"EpF MF+h3+`T+h;+`sKh[p@`hd1F?$hp"|"sM,hLH0h `#;0p@Ah 0Fx0Fh"`` nkh#0Cc`h#a`5pEX"DF%O-ѽ@ch"h2`Ԡhch F 4h,5[ՠhch#@c``&Ft""FF BhiC՘G(h3DhFKFh(F"F!FmFرCh2CiՐGph4D gh)F8FB0=!8FD F$hh甂"-CO hFF+xr+'':H6FX7Khh޹А$0n,p,Ѹ&/(F3O&)Khh-#2F9F(F F/Ch H*F$Ch;CC`0 h-!(Fnk\=+ 6&pCh#C`.:F1F(F.(FW(H)FHFt"KFjFF"FFChX)8M*h2*`q#c`+h;+`#Kh ! DRx I"8F^ch#c`chCb`ћԠh"h F` "|"8NO@#heh0m:hhH"8h Fh+Ѩh!"i:@hh0DGkhԨhhk`h`#i+aX"  -A%.FFH FhKH7Ch>V Fv, e, f,Hx,%&%.FC/0h)F6CFt"(ܽ@(H" F-CFX FT030;x-+F!|xHM(h*hGI"0t`3`0`;0+w?Kh+sC"8FF=!8FF8F%A"h##3a%8FB}hBh`BB'B0(Բ` "i#2ac`h\=+#8F% KB 1\=+ 1#30"C0B)@)%!8F|ch+Cc`  |"X""X"8F F8`h)FC$h8H0N(x(I($ H( M+h*`h@8DD$!FFFt" hxxpG hFxxPxKxpGsF"# "` FFF"h{"h"+ jfC2s3H!FB JhF3x10Ix BH!F"F(F1Fp0G AG0Ͱ FiF>D M0&(F><(6BB8BԿ  BA 0Ͱ FiF>  M0&(F>(6BB8B  BA 0Ͱ FiF> M0&(F>(&BB*BB  F F>. I#\Ch @iBѤ5j>bB!F>dؿ%hUFF(F>X8W 3jB8FaFxCx-*xKK"I#`x K " I#+K" I# I!(H i\GsHLHdHTG0Fx F!+Cx+x8 '0(F(𗀰0+@𒀰P- - - -iF F>`(X  x@ @ x8 F>0(=-c b#)/5bPbAFKbbbY^!hF<!!p@O  p@Op@_p@Op@_p@@Op@ O @+s >"B>` +x(+ #x)+kxbxC  O0RO0OpFFFF(𘀰0+@𓀰0;+z !*9HVdo)F F!@ {)F F!8 )F F!)F F!(Կ  FF(F FBB  FF(FFBB FF(F FBA FF(F FBA FF(F FBA FF(F FBA)F F)F F)F F.*cxO0p#x!+)F0FCv(++x)+kx+0x@ 8 FF#I h!^X=!IT%!VHPD%-/00 chx@ 8_`hC0\xx!+B Ѐ(+x)+Sx+H gHiHkHuHFH!Kh~ H KhHI3Fh " I7 "F xJoECAoBAI"F 0I-OF F I/eh~+x-+@kxl+_E+-+o8FF(@yJ8Fkxh320[`F(@>.pI!(mKO U;x%+8FF(@)hdHO>@FHs+ѫx+KЯ]I8F!hF(8FF(PB8Fx5.+MJ+xh320Z(F\(Fȿ,(F-h Fr0 FF AI"F l@H =>K!h;HThx+M$y FF0o.?A>s"# "`8F BFx˹OBoCB?I H:FViF"h#I!FPF=0 IO*hH?IF,,I!PF=CI IIIIII  I JI!J08%K&J"z$Kh0=!(Fh(Т!(F "ă"P )QQQ8 QQ8Kh+J#`J`LKJ`"Zaa`%heKJL`hKJ`a`8 6x"x""Ћ""   $   8 dK$` yKO2`K`KS[L<(F% #h3#`-KA"!:#h;#`#Kh 8@Lx3(" ̇" ""|"0pG8F F8+h)F`h3+`$hpF&N F,G#h*h6 D*`+?!!!!!!&!!!&&++;;;;;88;;66h)Fhh)Fp@ȿh nkh3Dk`h)Fh)Fh)Fh Zkh3Dk`dh i)Fh)Fp.RFHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<F" S-GFFF MF@. HQF$&o#+a,DQF H:F/D5D#Hu"T"-O#N(F F3aeKhS#S`h%!'J!F(FC ћKh-  L(ѷe=4#FS+`sa,FkNKhBh+ц\. " FOKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+|7F^H)F8F\I^O6DXI FV'O4{xxOxp غW غ%;Aڲ*KKH)FX +R# IIIIIIII } e     I IIIII III I II +R#  ; I   4LF\HF 0F\(ˁFO\ ps#;ppuaF1F"F(F"  T T2T'TRT(()Q ,(.&*Sb FXp'(\("(4 Y>o p Ff n r t v O\ OM ( ^#? pHpaF-#(@@^#a e a!F(F=F{pKikL hD"h0@*#I S"zP`>dO `5I"dh PFd(x!!s#;ps `H#F2F)F0uL"yI#n`I"F d#kBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I<(I ]ttWI <(I nt }WI <(I ot Wh"phF F+x-+5 ##bKI # ȱhԢj* H)FD,3h2`[hccH)FCh FG pUWXXFFFF)h9%x--41hF FHh9h!9`kh C ;` 5 F0;h--rh CC68 FhJh@(F b8J8(F$( JD(FT(J<(F<(PYDZZ[8FL#h# ##`e`8P") F2Bh:*J!H^H JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHf^X"P"^^pFM.h6FihH(`p DH. H H!F0H!F+hDP"i^p^s^v^-OFFFF@F0F)FBF H,Fٹ HDЯHAFD'H9FD  HhM, rk  ؀*+※逺@@/@+@ @+@N +@T[-ڈHY,foY(dkr(y~H5h, s@  yhge*@p+o@v@}@/S++@+o)ZHuh,(𶁸/@=NH%,MKH%,-@GHh|,c+@sd+@]=HH=_ ` `-`9`^@`G`|__N`U`_{^^z^^^^^^^^^^^^^^^H,  HH ,ԂHH,-~H~H,*{H+zHzH,wHwH,tHtH,*qHqHpH*8,kHiHjH,gHgH,cHcH,}`H`H,v\H\H,oZHZH,iS VHVHu,c SHSHj,] OHOH_,WLHLHU,PjIHIHK,I+FHFHACEKD<,OAH?H@H/,F>H>H&,@-?>:H%<-@8H?8H-8@5H5H+8 C2H^^^^^^^^^^^^^^^^_______$_#_)_*_1_0_8_7_@_A_I_H_P_Q_W_X___`_g_o_n_u_v_}_____@DiK_KJiF8,R^K5**7ѻ7к>ѹEѸL/R-X RO %;h+p-Z~|SJHJHJH 3*FN,ٻDH BHA,ٺ?H?H7,ٹHB=I0FZ ":H:I0FPFȹO3F;F@F ;h20HCF2F)FP0,I0F0FxO3F;F@F(;hT0"I0FF(CO3F;F@F(;h`0mhemmmmmmmmmm"n$nAn"Fn"LnYnmn{np"hyI0FFxO3F;F@Fr(;hX0FoI0FFO3F;F@F\(l;h\0/eI0F cI0F鈹"O3F;F@F@(P;hd0YI0F鈹"OsF;F@F)(9;hp0NI0FnFOsF;F@F(";hr0DI0FXFOsF;F@F( ;ht09I0F@FOsF;F@F(;hv0/I0F*FO3F;F@F(ݮ;hx0$I0FFO3F;F@F(Ʈ;h|0a_+sx+H2F)FF0EH2F)FH#2F)Fnnnnnnnnnno!oAo)FHFxX 0 ,ĢSE?j)FHFg0SE?ZFI \+ZЙK#":bPF2\J3h20[@#PF;FF' H)F4;hO!+@򰀇HRF)FDH#;`0 )FHFCE?(?֬)FHF8`CE?qH)F4oH3 D@ "1F NF8H(Fp6 I(F K"1F(FS$4(Bi ioKh@:#`O0\ 8F&L5+h+ 8h+H #5sI(FX(HKKH]`(F5 0 J(F I@( Hp"WEVfdpmd*p\ !3"gd;pFHBOr F@"KJIXh\ d"mdF1 BpG3+P@FQ JOa Fr舱 x (( ! F( @pG#pO0 P  L!hAp@`H: h 4Hd xx0MLKhF!h )F(ѝ0c+ C+S+ Hs+##` M0#h"xxpmIFhFF( ѝ0Y+ F(H mp!F(FC(Hyy'yKFHh <" mI#F"hFO("iF F@ m5yFJFHK!FH@h<" <" hhTpmIFFjF0H mpkBf I0F (ѝ1Y+cFHrdAIybyy*Fgj zF JOazzgzGz z ]y7 FFRFF+x$+kx+_(FBUxT)GB))HQ x`0B,a 0O E `D0 CFh3ScE*FFt  eI0(F"+(# l%^BxI(FlйI""b0FZ1FF8FD@kh+9F FG 5vJ#R(F`#(6ѡD0i a F,iI b(FC?m@kx+S+x`+Pى+x`0BJSa;RX[hDkB XH)F3"+)FUH0|U*h a FOI b `A?1(@ЦikO a0 F[F??@H a"#)F F)kB8H)FO3B{ 0kAB{.H a(`"AF z0)KRF)H!Fh:'K[h+?ۮ%FO3& BЮ Z B02F0!FH%#D659FH@ $M}}d ~z~~~Dr*<" h"xh F0:*F`ڍiBhQ`p0pG09\p FPNF1FN誈 F*hrh@HI" F:EI" F2!FCHmAH!Fm>H!Fm[0;0EEES G"1+8FeB{ 1!DDEBs238FRC,3qDqX"# F)F 01HHHH H Җ 0Ojx"pFe}s+CJ2;B2BBHO0 }pT"ZjF0F)F 0 2 H;C I I\"! F x"$S]J"h pGx"C C}F !O"OF F`0H9F }\" F I" F#\"! FhK2+h+#9FeH#"i#BBhB#iB]nx"#0N0LB d2C-I7(+Ht+J !>0(Hj#B d2CI7(HX2 FiB1o"hAE"0H)F0 )+&J1FZ0B0)+6!J1F}0. E#*&+J1F#0pX #": B2 1FZ@F|! {F(I 9x"M Җb-AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA7r1H1*F1F/H 1*F1F+HG71*F1F'H1!1F$H@sD*F1*F1FH1*F1F?H1!1FH@sD*F1*F1FH1H*F?1FA7x"  0CTfw-OF-@F(i F3r0Bw0FO A+ u FI "jP зH l #QFXF( "U*_Ѭh /yd CW }Xr+@΀Bv J#F( T+ |Bv  @dEv$&F32 ( I Fu O ISFFUF$O O2ISFFUF$yO/yB? Ѭh dCTXBF #B? 2b2 +@k/13':F cHrC u+!##3F"FYHFaDEvFc+΀MKih B󜀺k V@FHKSF `B#c Bz(=H F K E| A 2$A$A 3vK'i&F"F"F9F3F]˹#R"F3F9FFHI "F3F9FB-?DCXPE  砺"x"$)ZF~X2[BBBBF F1FP@%^u j F/q` j82+}B,@KH(sЕxO 0O Oox@s9D#?Ht,2:F;4#FF8Hf(2?4#FF2HXy0pop9oy`pO@s(HD#=,2:F;4#FFH/(2?4#FFH!qoq`q+?62+?1@CQW R]pG R]pGHR]pG R} -C]$FiF?H$F@66B&Az(F5?7H(2&F&"""8Npþ2d-G FI#F5lOs zDFH)FHF5RBFЗH(Fz'8FґH!U*Ѫ)ЌHl"!O3o{d 0g`#`'8F(ЁH9F)|`` }H01F* #aa0jcb"bk}icab*jabezFkHt zFfHk#iclCcdgl kj( +e*(0* dR\HKjHFjcbc+"h#cZC;F#k"hSCBBQHOi1FHFR5CKI"0FIIp"Fع1ù11U+і1+ і3S3;3U+і3+<8H 8I QF(;5K'"hHF3`SS 310K13#kZC;F#k"hSCBB (H0Fz@Fz1FHFR5 C'#k;1c1#d cckO "hHFZCSFrck"hSCQEB$Hd@̿*FhRRaAUAFHF4BѕA0  O"A0蠱akO AHf  0B=HIF\  e0FzJ@FzG(FzDm4H1F%h ik)F@23D f+H)F(HAFcjCbceBF#HjAFclF e opBBdeH2F@sB KR#@r[OsBOr[HV1"#!e#ef DgF F hz5F$H#k%"h8FZC+F"h#kSCBBH0Fz R1F8F4*#hCk8F!"l!"kZC+F`"h#kSCBB HR1F8F4#hC0Fzz(F羿hsFhFlF# Bd,`,n3f p  o3gK ,,mB  J  Fl H@2FSI (O3 +`3I-GFXFh FF (Fz8`8H)F< h#@F UV*F3FBB H%8hzm@F"h9hZC4~m"hSCB -O$D FFx2mO@Fy FXzHAF(Fz$ F BF!F*xpikxBxLm(iOpEx(F(o $Bop@E>x(yѕѕ ѕ X, ,y,ly,Ѭy,(yyhy(yxMI"KI $lOrB0opBB/O 3mKE+(FzU8F'zO`OpE op@E4I`Vx/IIM$lOpO  B   op@BX+O @0FzPJFQFCFO 0FzPJFQFC QF`0FJF3m[ED٘ O 30FQFPZF;D  lCQFH J FpGHpGHpGbY@-OFF FFO 'P0BHF !jE!2K P@F 3F8 2 6H9FZF5I ع#I 754  F9FZFF)H)I +j#b#%I2F(#j+bF F!H9FrI2F (I 3F9FuBFFH]I (I2F(#H FBF9FH I (I2FiA^rpF$+mBpkhBыYl`Q`-AFF IFFTF0*F1F8F  IH *F;mB4X*O30`<-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhBёh,F" FX,٣BRhB 5)2Fb 2 F)FF'HCF*F1F8FtI ,УB H"F)F BF)FHH#F)FlCF*F1F8FTIRFF  :mB!chSE =RF1F8FH#I e`tX,W<-OFm hF FF_C8FyFHfH9F1O HF:F!#lfNci!ipp+pOsBopCB m!OzopLB8O FFhSEz(Fy+p!pj`OsBopCB &&l!F@F"r((Fy&2F(FQF*PFyOlY `REO.bEn2f2 px3lf"Cl1n2fFkFn2f1Bp3D`n2fN2 3,m@Fh"h f&3F(BBHO s  f:F)F@F4BD-CF FFF%'#mB#kCkJ8'!lKD/^(F$0B' 0# 3+!,0( 9F*H';F2F!FHFCF+ #Ic0:F1F FE7nBHI M(n'c#mBn+ X+JHI 5("m#BqXA#d!FHFCJ3i`XhO? OBڼB`\&knx05"-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#BF+F,B@E:FPF4B#E#BFPF+FB@E H Ha ;:FPF4~BB$Y"-OFFFVF+q+++H#I kxBlJB@FJAIF1bRF+F`(AB-  H H ;B# 4X"-A#NF/'e 3c~@Fl+FB5FAF$|F$h,F ?",+F"K OpyBh %pG"-OFp 1F /B+@ mB@$O3%F'F C 3D04 X0`3v0 #  BBПHe cO3=F BD00+8 @( [#  BB wH(1Osp 63rx*F*hHFFlHkI 4(J(1" AF#(11&(?tB1۱"E!DDD(1'DD#DspC(1@JK@!  +EI((1C(1D3{+@sxXF 3 #- =FF Or!XFWF8{  +D; # ! SF ( ! ( ! KBHH5'0+?BH>-5'9{ BB5? ;F/FF'UF  ;F/FF*"3K"Or!F2{ g3F!ϘB# (D {);Op3h( h'-?Ӯ -=F HF#!O3 1+FAFC%"qz ). D3spz  3 \zD OD= +8O p/@LopA0B_q}CC}Cc_0`o uOrYFO0O3  \--/׀ :Fu#AF  +FC?/ B1BЃHDD$!GSC@ DFH"I j(5wDDvDL opC@FBuuu_#__/ P0BhC`^ `ñ(F FHI 1(DD#D 0wwsw`Iv \ F(@Ҁ ! 1B?HFFH}I F(" 1 1v 1 3wL opCB"1su#1ui 1FCR/RBڲ B? ' ;F/FFRF'1SEG盹`I00h+?mFYHl%+P BRX2 2*BhB?R8F[XoFJH(Fh_FGHE^#EI F(#spDDDy 3 L 1FX8)FF7H>F6H6I e PDDwopCwDuw5wvL BOuuu`DD#I(cP-]/h 1/?۱HFFHI ,DD qD7wvopCL Buwu%DtJfnp(* !BHFFHI F 0 1D/FFyH1OrQFP( xZ rH!Ch55Sh03h0埱/#CHDDP0Bd0h_C`B(Fn$!;FFZHIZI ($q; www; ?w p#d0B)(FMFMH+MI s(d !$1%DEY @FO3Q_`#5# ;F/FFFj7K 3.B$DX+P0B?c =F HF#!O31AF +FC!D00ӹ t BB ]K*F3B$D$@L If&*Nr"-C F#Fi?NOAEF@FxVF08HAF HFxHF(8FyM1HIFH8FyB@Fy?+HbOr!clСk)#mB"H3 X( +!ShB khC`5 !縹H"I jk" P $F H H "%N|8!L5% %5! %F %%UUxx@U8YhZ`F F!YhZ`9F Fh)И`FF!h"-CFNFF5F$ FU-28FU%JFi`AFC"-OFϰ F tIFFprN55hpIE< s O dh E|fOO 5jnDB $5Z hnx. ([HY 5 !*$%+mB QI."x2*$ 41:(hCCHF2#G+W#BBEHjnHF 3knB EnOr!38FfCF9J !#G8 jn0SC$1FF FN  !P HFC C 1v 1 vlopCB"1#u#1cu$1#w$1 cw&1w'1wL 0C 0#T#jT#BB H\jnHF 3knB ,"" L xo# 5"KpG"KhpG"KhpG"HRI ~ , -GFFF5ILch!hHhS!hH 9F0Fl-PFyFHch{ chS6$h!FFH ").<B R]pG R]pGHR]pG R} -C]$FiF?H$F@3B88F F#T#E#34+g"fXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,cW~FxH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3BF F)D!F(4#h+%(FLI F x:FF!kiF}~P.r# 0 #kD#c 1aq 19K !*q0E0 XF XF&c0Fa b,)оB*{ BF F(%k`(F1F 2v5Dbr 2#h%c+I F :FFNiFUD0D# 0gKc"<""-GF@Dz:"2,@4$4UB:ۡ@IFFEPFH0ӱPF zqilD J0hCJhC Fq ,"4"("FF'F pchK x+`hF#BB' pch x+ `hFh(#BBРh(}-AFFFFs)FFee0Fj9FCh`D`@FA-OFH M)pH2CnK hSw>C OsE0F)Fe %bO"j;h]kUCFh 2O [br 2PF MVKh*F$SOFBiYQF[;hӈ[Ӏ# 0 #Rcs #*sO ;DO F#cF #爈  $oO`FFXF0 F@C0[0chGF9&J0hC C*F0[02FYFF ki0DNn9h"i ORdKih -0iFi# 0Y FF"""(",""0"4"MFFFF H(!F(Fl X3F:F@AT -tK#BAH!F(FF( x Kp@OF M"7 FF0𵗰FFFX"!FhF#H0K7## Khr`h ZhiF F o`oQ$"(-OFq FFFnK#Bq𦀹v𠀑Ev~ X"!F(F#H0_Knay88kd\Kh.`hd.~Рh(e.zRKOzJFSFzC ;Os.gJF C SF0FYFbk)F F<@ ;F @BF@A @F9F1KFIЀF-OP0   D !C! , s ڹ-U30RhC8 ; o{`oTJF C SF0FYFkDFF U#0+2 "ů$"""2C8 XF CcK0phOzOg)+  JJ  P C  @ C) CB|8u@5@DL0@:F~Ci+@ȀOTi! 0 iCiF+@ !i 08hDkDB# 0vKh+m  )@ C EC{8%@5 Dl@CiF+gaI"i`H A^Kh+T]H# 0>  ;hkZ## %!F(F jbbJ nHDfj"FYF7JhFfv5H:(,K*K0hOwOj%a  a@a8 K"`L 4jF$ b anp@mf m$"" ""<"-OFFFFBBh(Fq F`"##0[kZ##F UwKhwK)hO@g 'p :FQ4p(FJ@)9"#B0 FiK)F6 hgK *SF`0F` FFٱ0ZkBiF F)F$%F F)FOrOsj"iFKhi iIk DE" :Kh+Os#{+Cx!F "#F8F"HF/IL*KhD0FAFx+0FAF~x+"F+F8F)F F^AFhh0Fj)FF Fe0)Fp F^x+x)FF FSAFG0FNC3C0FAFF@{0wPo`4""("   "$"-OlMFF!X"(FF9F0FDFLpCK@OF0F9F0+XбKh[2C ##; lM2HSAFC3CLP@! !H0kd#H0Kk`KF h1Phdh)F(eF|##PqыH$KY (цK"`oPoH0[L0" !#9F FRH !ȱuJh3`0sHP"#mH(ѯS  !F@8P{XFQF0 + *jp@OHSHRH(\" !L0#P?i H !^9"#p#H0YFT""$""P"","-CO +KFFKFp:FC&H*F3FF$L{F;B22k VV s8UH0`E@K%c(Fh+ OOxAFkF`cF8F`bbbY0`b)FOpvZc(H V"ax"$"Lkv#cx"-OFdFF0+dLKhkTF Aq (V(VCF80uF(}AKHFAF&h~>K(FhS"!`(C"@S f #3FF 2p(O zEغ $'O'N(M;h1hB8d1(hv1+hk#Hz F87A?62O`^&0X5X6B?BV`+h;h(`d3;`3h*hY1`B#@"L"X"H"D"T"$"8F K Fh KhS" H*F#F #BBh8L"X"pN3hKMh,hC;+hB 0hv(hv#+`3`pT vX"D"T"K"h pGd"-OFH0$ FF+ ChGFPF $ K*j}(@N0k{0k_oFFFB"ZFX3FH1 F^#BAK(FhkKh+>ѻBiR# B#3 3"DFi   E# 0K!FhKjh~KB~Kh[oBWBUۣiO #aO hi)6R: Ih C O O kJOa(FaKhi "  \JhRoREWK!FhR* OYB*SJLKFi)HRhS0C""*BѕH0+oSkCK @@A`##>H A6uao0HB/K"`S" :"V(FGFУi#aS":CF(F6a0 h3O G "$""e"<"(68" h-O+]F# `KF h F 0CpG_ ]K Oh@(5BOpq۠Hh<*q+@-2C!FOrFL2k@ T' AqF F3D2FKFZh@؀+Ҁ85@Ȁ@%D NrLIm r  @B @ +! C ""H*𦀸3+0cK"E@A`##^HE]H(SKhSKhFkxC/+uQHQK"`75 /wEKhk 0AKh*z %k # h 8O kCOxav6Kh)y2Cy3F"FIFXFX?,K   7hZokC3XdDfn+?!F"F^-, kQ2hR W狱 F 0XFG?}0hXFR$""P"<"(68"(9ћH0+,v K"E@A`##HEH(w@KhFTaOH"K"`^:L=a8<"($"68"lpFhe2-B+r3OB2py1`l2 8Flhal0Fx(F( KBs 8 "l$he2BB+r3B2  `8FF F0H Fj-tX-K#BAR!F(F)MF)HX)Kh+6+h`ht ph#HH F!H@ Kh+FH8+hF FH,+hӱjy!8@FH0| o+h+`hiFH oi8U"$"^l"fn"w|jFFF)/F1F.+Kp@OFXc%O>h$H$J1;A11H0+   #k!F(FKh˱IOr(F.#p@[H(;h+ I" K`""$"x"x"<"0F FH#v !F(Fx) )HK+0#p#K-OhPF F x+$%F F)F $%؂&#Bu8#BB F)F0#ZFFJFO hR Bs>V! .8 &^E(^F0FuFH F)F{xF+4EYh,!S FBĀXhuO|K F)Fh C `UFvI ,\5Bii(YCL|hġLsȱPF;08F cK h*+_KzhB#B\HAFYK 2YHUK" zh F)FB5zm 0 # ACq#@ C 0;j;;b4$;4L3B2$ h:`OR8KhR1Kh#F=# 0pCOг O?гO#3pi3aO  #34+?|!K9Fhs#3pKh8HOfK F)F 5KFXFwEC"ц#3p\"@"T4"U "0""$"""" Ox#e8v0  Xm   +HH AFXFO[ @POh!'J13A1?#Kh+?>3sp8gb(н Oxd8"0[m   +H HAF8a8baXFO[+KPf"("-O`FKF`h# 0I#F\Bii'MCCsh{MCszN(F0i F tJ3hh*ǀ+ǀqKbhB#BnH9F$X"!@jKHFAF9fKhF*@h'**XXF ""X TKh*SIOrXFHFAFi3#pX0+ #  KDJ1;A11,RbhHF9KAFB5{m 0 # ACq#0# 0#j3#b4$34L3B(L$hi2`OR"Kih_3hiFLi&H ` `+?9 !Fi1oQtVd[I"m\"T"4""U $y$"x"""0"x""-OFsKFFqKPph=pJF-00 !!OO`   B{{ $XFDXC>A ,vڍ P~ `GKhk 4)FX$ _*?mJHch+x%%d%aedl(FhORfhn 0ononFn#p00#0 %1hjBPt=#0#z0+(H'K"`l+?o#h$H0"HH(?_H)Flx !IB"/(?J#hH.> @#H-h>#Hx-hD@ht5"f-OFH0v+zF3*sƀ*j8F1FF aJv^J1\A +q@#XHAXKh+sWHVO@F+j(O2H!2A!!  C  23B4F2 t%#K`#H#H(K "`  0IF`F` hB ѱBEh``BEhO^?"C"]rv"<"i"""Kh @pG4"KhpG4"Kh /pG4"-O=F$2Fp pC7FF+TIp`" (`I" (V "2C#p = I(0" `IX " (V ѣn+#HH(#0;IOrI"K"`KMa)hZa7054%Br  k;B2IBr OѶOyvKh+TuH2FKFN kBBS;B2nKh;pO#lH(+hp^kOyIFF0F+cK/GhHH)F#-0 QOsIq )FF-OKh32FQHKFV#OHX#@HpT(@epGKh+R8IOr&$O@5A0 - w(F @+K G1O h(q?X@> F('J13A1`X(x sW(@jK`HH(@g > 6"H"""x"x"<"""""4"c$""i_?y Ow)GтKh+CrI3;*s<ңn+9|Kj|Jh +hd0 (  F QFtHsKh[#rH 0#ih2FQFF(0 0ó dKh(%*:By5`I h<.y.* ! CIEGu -w ="'- Gfn*IEu *Xo=QC'D 0C##2K5Kh+? QFT#WF1HQ*0;#WF F(HQFz  jo   ˱40C##2 Kh+?b  T*SFHTQ*0;# 4JF F H  ,""4"""P"<b``Kh``O@V F ##p##Jh3` Sp03KhOsBFBOrF g`gyK  0 0*G`hL*BРhP*=РmAFhM F ##H0W0+E+haKh+XmXCC/XH#VHhUK"`#px o`o`n#eFKK h+ #OpC@y+hCKhZkSVsC3eDe)uѠnGumFB(4KF3N`p O h#H01 kKD~F=2hi U +m!85@$@5DAqlRm@q # C AC7 0PѺEk0@FGՍ"","" "\"<"4""BB#eH5Kh;HLS0FH0+?"##### H( fI""N[x"K!-O'LMKhjB2Qk'0HHDDLTNEpBu_X"! K% K K 0$jBaQK`0<\Bii!pCL FViLvIhLrsEr1 F F*FFB @Lp  3BL -#F*FECBs4EB  0!FnLkCF #3\Bii%aCC FhgLCs F]Ki@Fh _J_Khh*J+J]Kh+MxpF3Kh3K`0jB00,QFFd pC3F'I"F&HV#0J"7Hq(5J"h*@;F $HF0(IOr;#q#q8` 'J0hC%J[y(3 #D@E:#hHdHU(?JF9F F H$",""<"4"_Q("H!(?뮠 g!F _\F0F H@FUJF9F F @24F3B2uC;C#tP FFy3# DJE2#h{ 8 %;hc23B2xKhwH;h 0#$0RF9F F &(;hk23B2fKh 4;h&6#h   !F@F RF9F F hDF21F3B2C;Cy1('z./+q(FJ%DH%`H(aBK``z.(@J3FA1K`H(ЦKh3 !@cIJ"K X"!#`0K0`BFӒKh*@`B݁P'@OB3`B< ! |]HBxHA(~H<(?v! iF @@ysH0˱@4F `Cg;F*FhIhHR#0VKj++cOcMbJQ)h(F*XHmb(5JK"`D*h:B@#@A]#SKj)hx+OI#] 0KH)hjMD(F0mb+;h!Fj +@WOr!(F6K?hjh+@#OC+/~9Fj;F *F(O (%cEg *0e0e0+f### #/@(o/{Шh(F4K<"oT("" $"""64"D"T"""I] )QH)qP3A!lj# *F(O (6cE *$#4##(#8#| 103 ~hop"`BvW( *!Or FFjKY(,PhhKh)@!OA!61F JF%B# #& oh FRA! JF6B 21 `oVKP?j+?#BB? ???#CF3Kh+2KBFKF[0K#k;k+OKFBFIo&s<&K`C3Ck;k###K"Tkwx+VKP?2;C?oCh`D`B$"4""Ic<"KhpG4"-O}pJ0hC;kKhB }0ñX<`<1FFd `C#F_I*F`^H#0WI)1; Cx1 C*SKhRKxRKx*(q C3C*ѯ&HMP+hx*ѳB6F+hB#@FIF#(7KC;4HAFP3HO(?y{X"!F(F#H0##'Kk`kd&KhzphBdbh=)F(e0FlH@FIF#k(?AKk`B)FS@FIFC3C0opoT"} """"p"$"D""-OFآK@XF9FhOsJFI#F\Bii(ACCshCsHF30(F JKhh*t+tДKjhB#BБHAF%3j\FO [DL+c܉O1~HG(@0zHI0nNiF4vOORi8h l09hi&8hg81Kh+o0I/L8h!F.J0hC,JhC9hORi !hi0iFniJ# 0 0K pT""S"@"id"L""8  "T$" 8""`""&0"X"\"""4" HH;h-hn=F"E@FX+U?B9hAHcyK"-O, p$JO3F!FF`K+( hp#)FFH$0!(F*K(`hp )FFHhpC_БH)FH( , KLx+SЂJO3`#hHH)FJ#`J#OOQOp`J 0a J 0a pvOQaOppnxIF`OQOppesJOQaFOpp\pJ`3йРlH!(F*`VK(`_K"hhC)FdHF1F(Fr`I0F*H]H1F}IKh *A J0FKF07 SJ `RJ`n#HMNJF+h\Bѓ0+e+h 5(&@5K"hh*e.b=HO06Os:K"hhC C)I X~CF(F h0/H)F0#,H)F*IP)I('H)F`$H)FF!H)F""D""d""8"""p"""`"' L4"8"TT"ZH"i4ыH)FшH)FpH)F 2zObPF21FXF6#FFF|)W*Fd0yK`7g\5SEH 1JFOsEq blH(?\jO&jB0 \5SEii&hjn[@;`I(\jB[[HM4;r8)IF"O3a!F(7 2y 0SB)F00(D[080ZF XF)F}BF#0F n:F@Aq[@!69h.Hw,H_)h*NOR 5i#s 5%Kih$KhiFyi# 0&Kh++hH`K*hh +&;զKh+cJ#hSp+F\W5\8"T"p"0"4"""8"T"hCMH0+h@b<^oRjO|DIBCk `"J` "BC:Nr wwDAGwC w`DvG *@ܰ *l0+@+h0+#h+'H)h0F0"!Wp0L%P%Or0#X30@FdYF)hOR Kh#F5# 0N"4"0""$"`""0+7#h+EH{)h"0P%ORc0#X30Kh^Kh#FI# 00+?W+h !1c#{H1H0(')hOR 5#c# 5ZKh!Kh#F # 0+h0+(نHH( )h#$OR0,xKhvKh#F# 0+hkc)'qHoH()h #ȁORcbKh`Kh#FS# 00[+hL%2@+hL%2@ł+hlkB0TH*hk[Bd#h+@PH( DOR)hAKh?Kh#FpAJ# 0 0+hl[kB0"<"J"@"vKh IpCO س_гOг_ KhK PBOг@OH 4""4KpFh3H2I0F F bt/Kx.Kh+-H1F,K p +KxD%Kx+)H1F p'M1F'H&H Vkh;k`+ HIJ ,kh;k`+(F (y,Y, Y,+hZ*`x竉ռ+hZ*`x +n,N,"d"""e"P  pF KFFh H2F+F!FlHk p"3KOp-A$-`0K`0Khk9Fo=-H-KOaaOp @ao*(%K9F%NaO @ @af( F( n9FFOpo F(,(Fn3h4Ean`+`5`]`O 0aѽ,+ѠFh"d"" "p""-OFDKFFh 3%*FD:FBSF7H"FH:F!HF 3HOEFB ("FSF9FHFF(@F IFFCs# f B*K(FhJsB ) 3D@OsF 8 FF Hb0DD#HV8"%*Xf4"-OFFF8PZ3ZFDZEK"`H2FCF$HE O)b9FJs# B F_HsH0DD"msf8"-CFOi F3K i3Mh>#B)Fi #i%0F Pea#i'KBE'O,F.F:kL3B 0F#*FIFHF8hkH$L4aCCsAn  @"C CH@IFhJ0#*FIFHFh;h4kD;hPB8""""4" 0pG-AFIO hIn ;h 5C"3;`#CBBK!Fh H{h2F3{`+Fih\e`a""""-A F MF I,hBdhBHd`  G C!BB$hiF F2 F`Z`+he`#`\`i,`Ca""pF FF!X"hF 0hFep FhF)#  H0+  Kh[ H##`  HF H(##` HK"pF N Mi3h)h |Kh32hi(hp@pp"\"4"K"`pG"8FL FTBA H Kh Kh #T0BXhH8"@""H -OFF FFFBB ѣ3C F@IO)۹HFAFx;+6I:F(FT"YF'p rEEOHp7$)KF>iFO8(F $)F;FF:/"G,B'F3C #0b9F(FO)K1F FFK iF?#?;p<#4C0>@B"\%ZK-CB}F F@𨀐0+)Th@O`m(`OH8Ob!FLKhKHKKh+:JNL533hOOx)hF{OHhF Wq:F V3hIFHFkiF"2 E[!;3h)hF\(h:FiFWp :3h)hFO020204#k$ \3#j$ 4$bj04#8$j<@$ DH$OR#0L 5L53 #P50"0#"# }TE"l"4"F F\#IB?ѓ); Wp0b  L1WqOr]K)ӸPEPE@@@ @ Or]KpGT-A0Kh+@CJ`L h(ڢKhA)FIKx+<ПKh+8ОM+h+QНHKhKhKh+Oі0+KFOPMOR1FiKih0FkKh1F0FWiI h# 0XM& hO)FiMn h)Fin}h B9iB!H~H.(+h+Ф )F hi6n(FnEFpJ#]M`oJ`+h+EaO;h0?\N3h+5hH +h+59hSM#OR0ci #X4&SKih8FQKh9F8Fi{CI h# 03hKPHOH((`MKh#MHLK6M"`OR8Kih9Kih0F7Kh1F0FiG)I h# 0pkB6I 1Ka~Bs"#,!F`A@O E@Ҁ FIF/\5!FHBii*XCAqKhXF{OAsD0HF uJ;hh*+rK B#BnHQF0 Fh vsaJ+F"_JC 00BO `0  +DFBO. NHO|2[Br2kLcB a0;02;B22shn;s`AO3IF5:MORij7Kih0F1;h1F0Fi&0H `t F ` )F O  I  cD3[ED+?G IF>$0 $[$04[4hb  $[` F""T\"4""U ""0"""KpFF @P%8 m 8 HCCiB iT%0PFaD%@ ap<" KKi@P"0Bi@"0pGFiBiapG<"KFh 5p KBBB BB    "^F(-OFq h WF FFEp(APF!F(;Kh| @ci[E"YFwF 2B2#RC#CiKE K"IFhZ2B22[B2"@""pG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R74|XFn*#\(   [@²\@BZ @² @²I Fn*"\@ Z\"@[\"\ACIFn*"TX"@ \# T[""I,UFn*"TX" \C T[""I9+%-G F$F)@  nIIF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF}E$4IFF!B1Ri"-O}FFFFJFF(hI2F (  eI@F&ZF`D(F(F_I*F@F(*0 h+ZHIFO0 }k6j`j`+k#akkcakakka@0#bB0cbklb@/}GI:F@F(0vBI*F@F(0;AIJF @IQF8"F F ,"F;I0F9I0Fh 7I0Fb5I0F\3I0FVh"F1I0FB,?N/I00FH"!8F 1FHF(`0' 0ByBOЪ# (5D*#*#0w "F ]( #d@edAzd@R.C-CDM$OcFF!FFxCFO4 F DM"FF;FHFF(F'h,0 12-O]F0{$1FFFF@(B۳hrpC`_@/!@FJCxr+ #`OO4shm]Хuhh(,O4JOaV!FBV` (sѥs1F`(t(ۥx(3h/8F1FO sh(\F(gѳhpCOT {0_JOaXFXFOF,1F F(|(/R F'(۸sO ""`LJ;F! "!'hlFI(\(Q 6h+` F7'4H|O_I!'BF'FOr@!O'4_FF#BBХs fXh1F($`x%|#3 F( 0I F'OI F'(ۥshmYUb## F ] F'FF F@Kh @pG4"KhpG4"-GF""<"<""Kh 'pG4"-OF$F FUBz 0kBOst;F (F!F 0@F *FIF#FGB " 4#FF#$BB1O 0#FF[EF FF^F *F#F0kB$0+H ^E " ^EBi"a PjF Fi#a"-OmP` F"C FFF(<F;FF3WEE#љBB*#2FHUKhHl  H0(K` "<"-AOB F !FFC0+Os#FC(F"#M+hkBSi38F1F0CKixk)h" i"avOR Li Kih0iFif# 0">""0"4"-GFiFF{PF F;OKhoF8F F|FHIHHK` FKhEKhk2+FiRF0F" i"aBPF F8HԠ0kBOst@GF(F!FiD#8F#`" .HFe !K (F#!F#"CE i"a*F8F#F 0kB{i+ H $"M<"4""n<"-OFO L"hcF 5 rȲOR50IhP tL"hD#xH(+$1$$O &HQFKh+𱀈H6#hc"h BHQF&~H FFFp@O #hFtH##RF "F#c"hkB Yi)="hD R50JhC^HQF[WKh+X[Hp hIF&#hq "#F*#hkB Zi*AMH9F(LIiLHKIFhByIE XyBوAB@HQF# i#aI;H(L9K"` 6H(3Kh+:*F%:l7*K`F)K BT(LO3 h 0F (рE t(# Bz i#a ""A4"^FF^g<"$""Y>"!h- kF !O 0 lAUK!"I%YE 5Y%PO 1 @  0F (D 0w +O! k,FFR9I! BM6JhQ#\ A51H0+4/H4 *8 C  iD k YCLq B i!a`4I H(K` 300FkZC 0kB Si# H9F FF竪"<""-GhELEM+h#ABJ@Jh"#Fv+hkB]ie6H!Fu 3L2Ji&Ԡ p4FE ȐBi#aA"F8F4+   S%@ 5#AFH###biB0HX#8F###bio($i H( K` ">""@" AN<"\"8M+h %3JLBH#h 8# #CH +h##CH #h+H H(   "^F"Typ ' pG-GFvFFFIF(F:F3FF8FO`f#TD&O` FB`۽#D# 6P I-GF4FFF%! F@F KJOF#` #q  J# #!F# F :F @m# :F^^F: p FFFn2Fg2F`2FY2FRppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   Akk@P!ABBh-OFF"iFF%@B8K@J1AQ iiBv FF!jF  ]E#  'XF@XC1FBYFHFbh vDUD#i  'XF@XC!FC)FHFbh7FYGBv+F7F7i!@BK@}1oQ 5cEu.FF>FpdF qE  .FF FEBv F5F5pF%ckBӮk+K@,11 ^;ch BhZ`Bh`lD#kY(5k;K@21[p&PjFKh[Hjl # Fb#`kC K@!0[ k@l "gPjFCK@A @ml F@l츓-OF-FF# -Nе?9+$+F $<<_<(Fk*F!0 #k4`"vPF ck0 v 2BB & ,PFvF,PVK)hB3B;BQHdO$PFFuPFPFXF0O OshBihPFv#BB:Hh& FiA B43BFOL IAQ PFIYȱqBB$Kop@ 1"AFPF6I  #k]`40`@00 S"`H`C"80380"LBAW5sNBAW0O/FOs hBki&0FBB47BFOL Y AQ fPFI80+)K@1r1;80h BhZ`Bh`k6I hPSPTvkT@h(?P0DkT`F>O1F >0FkP`hT@ .h3DP0O &-GO CiFF jCK@FQp O0$kFFkkCE0Fk F+kS(p#1F(F#JFXF(#IF0F#RFF(?h-AFCi&F@jFCKOVa+p `1F Fy Kop@aQ:FCF(F (, F$R-CFCi& F@jFFCK@qQWp ,1F(F|qKop@sQ4DI "FKF8F(#AF8F#kF2F(F(FRK-sCFh F N3hBF HKF`BF0hKF!F p""zK-sCFh F N3hBF HKF<BF0hKF!FT p""KpxMIH8N$+hmBp(hPHH( j(hS2hR[m HS4Rh4d"""09L h@j . hW##`"7FHh(j,)F0 F"8F FKhñmJh K@"h`B #BB  8@n $"4""oKsh;+nKԿO@bO`b`kM+h Et`) fHfH(W a)7)5`Hz]Hy(]H)h\LOR 5i#s 5#d3#a3TKihhRKhiFTi# 0#$F !$p#x3.h e2#F FBH!H@H/9H9)h8LOR 5i#s 5#d3\2Kih$0KhiFi# 0$*hd3+6Y)6ؒaqK+-HH(?k!HL)h#ORa3d3i"KihKhiFiy# 0$+ FpHF"""f0"0"4""I"@ X;#-OF3FKF   h3SB/F=FѴJAF0FCF"ѱO;hB&(_# F#O3 #$??FFS kdt-h- a-7b-$НI DFVi +R#tttttttttttt F0 F Fh F>#F ;hBЫ F ##>F8mBrI2F Fy(F5.q FF9iI2F Fe1F FF)6mBmB^I FO7FFF0 FS0UIs$$#XF l# FFII# F FBI @ P :FcF2KEB FB22B;B2 28$"PFT F 0?n1F FK @ FFcF2KEB FB00[@;@0 08$"PF% F0??J!HF~#I F%###rKFc(X; 4Sq-CF jF FF&PNEBF)F F*F!FkCc8FC\2F)F F6k#c#-O < F FF3`0 b/5A/7L/.ЬI k'k$O0c/i/1F(F0ТJIF FCFџKhBЛI o(FAF(F#H4pCO#,FO  F  3h 0h! F&F2C-ЁI FB#ѠI:&V03h+bd ^ $F( FIyj kHD D fI F&S0F&k,3x/+0F`J3F (#$jkFXI!HF% FSI)3%(7k\VMI P IF%0!r C OsDI F]Or1F%p0B FC? ifm0F" 7!3G 4g+J3F!-#(FI##j(F#(?3a#mCEؿOF?TW-O!FFFF0oI FO0!JU#B4+hI2F;F F(Fj #pFA\)#32*V6+)YI"# F#"S F###"#;((Fj ԫ4+II2F;F F4+DI"# FuBI2F;F F#"S F##2F;F(xs0s+ P [ /I2F;F FEр$* ,! FQ$I10*+rO FOG(?Aha3` JY HFQFFF F0$-OFF OaFjuF8{ԮH1F,$LTet@E!$4###F840FOcu0% >h +Oc"F9F0Fu0AI F4C4432G1FOb FFI FdB$b Fja%0zIH4pBO30C_tI F$4{qI$B%0nI$4 lIUvWAjIb%0fIUvW1dI$I4Os$4FUvWtBFd#8F1FCSI:F3F FEEvI4$$#8F1Ft(FqFF F FCI(k4C3F F>I:FJFCF F0:IS4$ C4IgZ 2IbU# F80U# F-I5"# F#%0"# FAȱ! F (\j#R JEs F0 F ZhK`d@d@Vr4?ɮZ ?Ů h+Ob1F F Or@!0F$#F4BB* I$0 I F4 I"F F@%{d@&!Fu(I F9 ! Fh  I! F_! FY4I4jlF jFjF1YC#h+ae(F(a4 9F F0I FO01F F0I$Խ@$I  $ 9!+OտOs Fp!Ap!AOaOq!pGjXm j0pG$4jjPm0pG $4jjPm0pG-G FxF(A FIF0F꨹M 2F;h&IH#hKF.FEO0M RFW&06H#hKW%02F I5H#hEE%1 & 5  0 ` a$$#Qh8a#*N FsF7hIO08F(2h I(F#*#s2hI 'i   -OF hF# F*OUsڋj k#*s }BO0 0F}(0FF (Fi+Zi)WУj BS(srBBG(srBB;90FIF0F# XF1X"AFPFG0F0IF0F"AFG0F0ck0Fi I( 80$!m#`FXF(-i"QFXF( FFFFO0"1FG F_0 4"1FjG Fh0 FzkI -CF F uFCIO0F$d#HFAF2FJCIJFCF F2F#8F)F:FFCFFI:F+F/upFaF   K-O F O Ih$l FHF&'!F[dP6.I"FO9 #Z IhC C#I F'@  H pFL%#i1FT+H=pH  -OF%MF F$IFF{   C!x2F F( ) YFF' )h2F FKJ5BX-2! H#x2Fq+F Fp2F Fl F H 0   -OF FF F)B G C -I F"O60F(mB%I*F F9 FIFgF(I*F Fo o  # F" # B;C # 0IF FK #@ FB@ F;C # F0I*F F  : V  hsF FN "0h `xK*Ѱ2hI(FO0pZ `Yxi)3FxB*3x#h+2hI'v  sFh F޹ "` N0hF `xs h #`2h(FI O0p' Fi* s* a*)0O0 !FFIO0 pFF FPN!F0hz02h(FI'O0p' pF h FLKh4(`0I0FO0p F' i*F4 a*b*&L*1IFs*.t*  FxK!Fh68 @B h+IO0 # `10O0 (1F01 1 ' pF ! IFF!F2F!F( H#0+F0H p0   )-GF FFF ) FIO0OI$ iFHI:F FOi#"# F#RFCF@ F I:F0Fi6 *  E  d -O!FHFFkXI F1O6F0FAF ! FZF(#" F cPFFчI$3J7O#B3u 0E E sH[CsREz9B: F'i pIWEzMF9WFYiI=OOO FG770$HFiF^I#"# F# PFiUIr4TI O3k$ o$ \"2$h F!RGs !h YJ2  80?B$4!  BAbEPP jO "T 1P ZE +!2FCF! F0? F4jW#SFhI FA10?  4$$j jz $j$$     ' `G +K0FhB)I !0@[e%HU#'$#HL$$U#F FHHp! F0HhO0!0jHh * #H #HJ8!hFviFH!mH    36H F$"8F-GP#FFC FMK J3   9F0FCF+4BJhB0AJ(F^L*oТa+"+ hh h`hh4K{2I@F렱1I@FFx/IBF(F-I iO0)LO`h`&I(FiTE F"#F@2!꣉ZFIBF(FTE F $ ! @(p~(F0x(Fp 5'~P FF (!FFiX#vT3#3FHCjji F@i-ODFF,#h  FJ Bq A B A@1@F,SFaI` $i4\\I@FU%(FSiEBEEx(. C F,MI@F4%Fa#bcbб(.FK CK.CI@F0(I#@ BS";I(F|2*8J@!8H6K*<* ;+J2Kc:F#(FF   (Fv0?z(F0?t!@"v0F #0FxAF(FG0I(FYK 8H#1F&#sD?C3 s6 $@ 4\X8uS$"!-AF)OOHFO h   F>FHI2F FO0 F0I2F FI;F2F|(F+++++-GF F07-4 d$1!OIF 1j$$j0j#h(F##&##.a#e(a F0IBF FoO0 O2FiF F FI;FBF0F+++,)-OFgI O FF F!q@`I F7O0! Fc! F]!  FW! FQ4# $ NI)|(@JI籱H$ 4"#!+#!f F0ѹ("#!竱! FF(OO O "# F"C 1I*F3F! F0ѓO "# FF'IAFOrpJU#*F13F#" F#yF F0I FA_I FS [+j#BB?~ IF FG+ь(,<,S,,,--#-,pPF FFC K 3  1F(FCF KhB J# FN  F30I pd- l-KSB@pGX;#-OFF F   b-V FwJ9F0FCFtKhBQ+s F.'`i+Mi+JaBBD # F# #??FF* F < 3 F FVI".TIJF Fq-  FN0LI F(F#i$$#XFQF  FF&@I FiE6ihhw2BE[  лz  #C %*I F[ BF1F F ;F??FF2BB2 A:B; F S0  FY0?x F# I#JF- X;-- .:.[.-OgFW#F F##J1F(FC ѭKhBЬI Zq( s("F F0O0## F#"#??FFEA6U#I FW#$$Ga@Eq  s*FI3F F! F Z ЁI F! Fj {I! FwI4! Fjj Zj #!  F $ (kI F Y !BBeI FL a# E f EyYI*F3FyXI"@F 8 EyFF a EyKI B A-v B A ))9@faH=C"W!]HF\HWDrѷp1kF  !SJRHD[O OHxFR8KHKHKH2CAHfFGHb+jE!Dp E EBY10)=HIO ;HFtF#+ (FaFX(Fg8m#jF$!mF/H)F*BDkFBHF=J!r+F!J!H 1+Fѕ1+H}FH=C"UH$)Fl0fx111111111121111n11p FmiFCHF#AH#@H4i=Hi+ ;H#!#"ji i;+ #j!2J830H mp,J!"")Hz(J+F!#J+F!""#Hj" Hb!J+F"HR #ROaBNFHD(FgF(FH: Fg2$202;2I21S2]2`2l21v222-C]FFFFT(F=IBFO0 ]iCE$iy&j2F!F(F2 AF1Hu#.H#KF$$u#)H#KF$$!&J 3F.!#J@3F(@ ("I @ HJ!@@Hm#8$!9HH #RH`Oa2222]2122S2222-O]FFAF@J hJ bH 4OC KF@## "",؀# 8# 2 < 9ԀQFH"#!#"ji^ # J!&KFj!JFKFdF&6 I&"&H2F9Fi+@K!JFJHF2F9FF2F9FHJ9F$ #O 0.l!PF(wHQF0 +$4ء 1F! 1FQF lЀ#(F&#F t 8m#$! 2F9FYH2F9FXH~ #R!UH$i/"j!F(F z$i, ]F2F9FCH`>J F!ofOaXBHN#QF#"jFiF-Ѐ#(F&H3#(F\)KDiRD(8 DB%J?1# *! #]  i+;+#j83J&!_&2F9FH#jg h 1ff333<1*3]21203d"?3P3J1k3}33233-OT& FFF4F`QFJHFAF@𴀁Hb(@Kf0Z@ŀ}I (F!(@𘀽*x-`- H-bW-fA-XsI a=-S%    ź     Ѻ     DD8FL0Ѵ8FD}DzDwDtD qD`nDtkBI8F+(e=I _ .ؿ6[@2QF# # "+]8.$.$.P#0#$*KhKEd!8F04]$H !F8F` S睲8x##OsH$+ s8F!Xi+iseBBͱ"F)F8F%i33P ht@3t" 3d" 43>+F(O>@"l+?.(?&yѸ\J8O.pAF8&pWJ1FjUH8F3F@- ( 8FI#EFIHAFLs8F#6FAH1F< G Di)k?(O?8F# (E8F8F# B8F6iEF &O]iH####!F#*ji -i-H333 4444-APFF FC 2K    h3SB7F>F(K$3AF(FCFı!I"됱 KhBJ F"i*T* L*I ka+, F0l*ТsH O0 F0X;`4 p4m4Q+B@+pG#𵉰F F F /J1F(F\C(+s F!`i+Ei+BvBB<ԱKhB# F#"#L)a8 (!$I  F0, F;, FH i5 45h `Èˀz rF /0 //B/pG-OFhF F 4689 : ۉ>0sxs+sxl+%+O& "8F|'K(G"3Yi*F FC- K'F " f `J##i?0)FJ F >0=0<0;0:0 v*F FLBѯ73/Ѫ67.H57-C FFx[PD FIFY  7#I"F 6 5  3 2 1  . (T'EFȱ1F塀#S˄0 00**+7/O08H5pFL&{@!J 6 {c{#{zzcz#z#h 4G. pH57-AF L% 7 8#1FH4+CF*:Fz=ѽH5U8pFL#FD F5`ir)Fp@XpH5-A FF(?4;=J044rABOA66N  #38NC0 C8dCS00hF)F#@c0` !HO! CFI FDO0'F:FAF0F!I F20F!4I FBI;F FxD0F!0 CC0S؀c8p8888 FFF(-I@P"C 'K  3    1F(FCFKhB#J F4J FU*L* F 0a)K@I u K9FhH0h;|; m ' FFIhK8SB@x"FFRKh JS BB KSB@Ih"-OKFN FFJ)F FTF3 ѢKhB СI ?Oo+3hF($$*ڗK!tI(XHFF8FF(M8F$I(ɁILF(@HFI(Ff92i;++zF4jOsvI"FOF1+fF8oIZFP(FlIHF8F!(FgI(Д!(FdI(Д!(FaI(Д!(F^I(Д!(F[I(Д!(FXI(Д!(FUI(Д!(FRI(д!(FOI(д!(FLI(д!(FII(д!(FFI(иѠF()F@Fn(  4r 9IRF8F&(?|6i$5IBFPF(q5j0IhFf0,?f F>>>>?>X;>>>,?D?=6B$4&!??ѸI^BBٶIPFdF(?I^(?OrF(F I0FN(?F(?XFxF@XF|JU#"1#D??@𢀚I F*R$$)F $4Bf6I4 I Fi@FI6r*DT(I*D@FL(rI*D@FB(I*D@F:(rI*D@F0({I*D@F((rxI*D@F(tI*D@F(rqI*D@F(rmI*D@F(Ы1++ٿq; O31ȿOs1Vr_I*D@F(r\I*D@F(Du$$)F $4BR(F(?ѭ@FF@F$$3F Rt??@BI"!(t5I 0F(?8 ( F7I6I 0F(?% (0I"0F(?-I$0F(?*I&0F(?'I 0Ft ($" I 0F*(? E<I[F FYR?d?h?m?@w?:>}????>???????O@>>>>@&@+@$:"(DtE$JF)D DHEFT$4!??KI$BF)D "E$1F(FO\ @ZFAJ+F8 O39/bkb 6+c kcˌ"## AF +e#keIFe(F3F(a$$`??#I$$)F $4BIFa(Fa.addp$4's(a2?? IW$$)F $4Bk@=@@pF" FhF!ih"hFoDhh3SB*FF A?AHALASA`AnAAsF(J  ,BI $"(FRF$(pah(Fph[x+ F/h`h' $hAACh/hB(F 1-OFFC BFyJ (F2FsJFbh h(QFhh"mI(F<(:ОjI(F4F(IgI(F,FFdI(F$FF`I (FdF(2Ѣn# (F0&NJPQI (FF(0+ѡn)|"l0F 0onFIF#  ***ѻ YFX kױ7I5IRF :(AF0I .쯱09F:C"l0Fn x阹"l0F!n r0bnl)lckB(FJ>h1+#o˱!F(FG0mI*"l0F!n F0k0Fm <0m}AAA BBBBhB,BLB~B-AFFF$ F8FF FZ(FpFf1FF8FF(AF F( F$:(F`,Iz]B-AFFIjFF|F+ ^CFO0&8FF(А"!F"9Fo>I0F 0н #FI@F*BiF0 F@ FFF0n#`O0RBFb?#8F^"FF(F`2(! FFFF0H#`O0,BF( #,T  CK \"JFnpG BЀi -OTNK @@ D`Oy0FI :Q DJgI B7I DD@uAvB;L5FD60Z7IFF'FF%F&FF 0KXxF Ai)i+8@ U,BB" B@FG(!6@0 0#KEB SEI BA@FG(By @FRIɚ;6eII"-O]FFEF 3FFgAFћJ O IF AF F*F"FJ+OaJ$n#on9FH"9F(Fn2I*F0F0&цK)FI`@"9F(Fn I*F0F0)i~H 0 AFRF FU0 qJ)i)qKZ`p#R:Xh"9F(FniI*F0Fka@#+a\iidHP! FP"9F(Fn#"^I#0F*FaD0Yhic#F(@VI :!#nSJOao\ {0۹:##nOa z#HJoJ0+QFEH PF20DYFAHXF(0D0AF FGa*F4I0F+a05Ii5HPFdW3MH0k F("K/It-HAF FH0I0{@Ā`P-ŀh"AF FGi z"9FPFn8I0IRF0FD05JI0 +FgIJJi`D~iJiKiKJsKaKKK"IKiI =N ##J#R@#R/Hp#R+H@ #R&H6&H##J#RH@n#RHpc#RH@X PP-?=kh FG-h0"AF FG ]KI LL-LL8L-OF FF` )F F0?I:F lFFH9J  p FF3I rFĐ/KO0 " F@Fl 'YF8FꐻYFPFPIZF F> K0hՙL0hԙM0hՙN0CO06[AF F F(-h. IhhxFBLI"kL 𵋰FFXFI I(FlO(PIjF(FM    0h+I I"0F(J ;`;h I"F pYzY<#8i(YYY FFmtI#FF Y-CF"I FF@ KOq ZN4h NF(FF8FFȱFHFmVCF J)FHF$p$(F$dD O "#`@Fc)-~I8FH(sOrYB?lQ)?gy\)bA^ [X\0 X p78FcF(?M QF  9F(F,F(Fc|/?5ri;FIF0?,i+׀,ԀYF@FqF(@RJCF  h( h (? -3-#O `TXպ@F(Os X X0?Y*##!O;HO;$M!? F F YPO;+?2kDO;Ҳ^ xX0T:,;+?w*kDx?#*Fa- W<+ #ɲ CF!FA-7<0< ,ـv^y^t^{^^ ?px1\F(Fc,J+ i"FF FnJE ch0J^-AFFFF@F0(#`O0@F(F #ji!F8F0h Vc`-OPF%FFFC  3pW;F:F!FXF5g`9hYFhFKFG( F5x F00g+Ѕ- F]x#`O0 (  l#` -GF FFFT#`O0:DjL#!ia00sIFPF8 0h($h0-+ PFv(( iIaiybh*=C$70hh( 0h`(H #FF)F0F0ck xk`i+a8I Fh#F^FF$ !FFb8K`T7`^FF !FFb(KeDa7_-AFFF`i0FFB hcaac& bF0`ixO05i`ahcaac-AFF (!FFbmF K"1F`FC/:Fa0 Fc$ F%w_-CF F ,!FFbFFFK")F5FC$/2Fb  ;F0 FcO HF_-OF!FFFFFEOh F B%`O0lO hBԹ`#h:FY+ FhF[FdFG(|h9F  7 h[F:F FG(|h9F7-G%FFFFE(Fh_h'ig1F h1FFGFPF k  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#AhO0O0`k$h08F Fb`ciE``a#`a#t F8@O08pư'IF&IF0F~Fh#I`" "#`O0Fp(FF FxxFBI Or!hFx)F/*("!F/&*(" IjF0F0 H0_7_>_N_Ji_IH _1K!-CDxFOrB F8 Н9'$ 8N@CFF@C2Fy. 8I@FI(8F,###p(,""p])hcNH#F DI8#Ki___I"m0I 4 Ii_pF NM3hB3(hp(h F"!C(`F4`($ h#-OF(pFhFF_x0+(8ICx h310x+ 5 3K2JF,xT!FPFh-K,J5 Bݒ!HFp`'痱ha0ix10H%(FEHH7h 50IJDh!LX1 XW90\ I@O0<h0@W< C K5  ```)pF F'x0+$JCxh320x+H&Bpb\20 V1CB"FQ H)Fp@ Kh#FH]6H `` ``pP( FC C (7R%#`(Fp"#, ۴O,F!(FoA\ @T`bF(2F K$"#F FFCF I 8F8FI"(Fl*F1F F@?``pF FF!"hFZjF)F F$p-OD]F F(BJ  |?F;J#  PF06J/Or!԰(F$"1F(F@< D]ah0FFhKx+ё0 x+"OC+a*F@FyIka0I>>$hk|KEћ0Ohx[s@C(ѝ<1O+K ZFn`i`8#pFHx FCF >h++ &pI "!hF"1FhFl"x!F*("* IjF(F@0 h1+h/+HUa i\aKx;@FHp"laF FF Fgh(F9F2$hhKxB8F( IH aP A F FFCF I I"( J+yh320[ I"F0F0O0 O0aa :i"F0J bIjF F8#`O0 I F00I F aa9ia"F0J  ,I F8J#`O0 "pxK I F($0 I F:0I a ba9ia"E0н0]#H JbbpGhJB ~BB J IBFpG JBJIHpGHpGHpGPcPPPcbchJB~BBrB J I BFpG JB J I HpG HpG HpG HpGccbcc-CEDGFF FF(FB:FIF0F=F 9^), "FI0F< 9d%B 5/ IE\BӨE0F=K20sQCccbIF00I I  F8KOq0 F ICF H F$i&c6c@cicPI FC   C #C J  I F0I ccicIFjF"@KOqnI F0 I  I F0I c@ci&cic-CEI OsFK0AJ  `?H # #%Ss #ccb@0O3a#bb#c1I"F0FY0S.I D-H "02$+*0/H8i(iXeeieeeei8iiiff"eeeeee),.,C0C**+-H xh300[Kx:+* 'H"* &H!Fj&$'i) H`.??7/?;, 4iHN;HH /H@FFH2OsB H* 1 deeeeff0 I$jF%DED D D0I(F F0i8QdP  IjFM C0I ]idIFd@ KOq"P I F0I | $f@ci3fpF FFHF0FE< &D3+ H=ѽp@> - Efc0P%C   FI>CFH F 0,FiHf  IF8K!Gr ! FSf@c  IF8K!12 ! Fhf@c0" F!" H  0@Ľ"!(FXmFOb)F F ( H F  0@񻽫x+x+i+}ff IF@ K@Ak2f I! FU0I f@cf IF@ KOq2@ ! F/0I l f@cf-O=P I C # D0.OsH0X(ښI 6H0'+ @Ā.F##"F(2D !<(BF'-܉H.C F .)8L(!0!!"F 詈kԣ2*O |3 SnJ$;2+Fo  O1 BnzqyOa F`IE#_KD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pGK)FCH|!0D"0 +_ >+ D '+?o =/ #LJL 33~@B9@B+JأgvA6B'رO &f13?,!!@C;2%2^A$1Bc22Hr 2M2zrG"EoB1FF#x*+р+ +Rhigh̄#+h"2+R+0+𾁛 *?)+;'+<:< ":::::::::$:::::::::::::::&(*,.024680[cx!NIFcx 3D ) *КJ&gx+F7K e B> PWH]60"(@FF I0+СxH0+!y'FxOxIN cx;6vFEݸyyy(yDBwH7FtH0+СxpHC0nJB;mIc |0+?~hHpUFFdHh짉cI>Fn 8'p6_I_FF,;D ۲+s6'VHFl9؛0+?DQH !FFJH*JKF>JErEEJEH ErF?H  8J>J>JBѣyI7F׹8&7;I  FF9K FDo#+s7(HF [  ?F-H<-KF+JEМE*J*H ErF#H  & 9!I$J$J$Hbx!F2+$!Jx+FHHHHHHHHHHHHHHHH7ihh g+ghgbg!g5g>gCgHgSg^ghgpgxggggggggg0IFjFzBF HN F%00I L(F$n(Fi+#`Y T! "D! 0"H!"aFI f` MF(` IH!Da([ k`0 np#{p& MFF HIPHq"F np h/(0TK !oCC !B K`!03 CBKK `rrr(0TKH!0CC !B K`!03 CBKK `rrr(0A Fd#%BF#CL`BK`!0K `rrr(A#ȲC/F۲L`BK`!K `rrr(ACS_FL`BK`!K `rrr(ACCOFL`BK`!K `rrr(A!CCcoF#CL`BK`!K `rrr(pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `rrrrrK"#I@h]M -AF!'FBO@F`)FF*()F$D(77 FhF]I*Fk(F`V `0Fkls F xn+Kxo+4'k%FI00F`7(F'x!Fn+ Cxo+0`(=F `(чrsBIFFH ts -O]F S D`utxt~ttttX ttt tt-Oi$ F #cHRFIF%`N'h0 '߱^KB@oqZq{;B;FF8-Fp~n5F0ON-1Fp^)(xhd5FNsh+tCH#-FFTsh+f)FL###B# ##8sh+Ocor#IF@FRF3F`#xS ! F^p"H"FAF H $ OOV <BV<K[hcIkV,-YFHFV <' 6W Kp= I H $ O? I u,uvt#3w>wvuvu8FF T)Kh@ (F(Kh8#xn+Cxo+0K"`PFC 0_FH: F` H4%(F,/0F FFK,!F0`{#zzIFH z -OFF"! FFܱ؁oJ%FF#5``09FjJA9 +;+-%W"4O5@FK3hZ\C3`4#`#gк-@@F0@NIBF r(d(M(DU(aG(,e8 (S q))){)))))))))))))))))))CCO Csg{#gs%kC!I2Fi2I biXCO Cs`gHo0Z-?Y0gS cg g%3+'|| {| '] e$#H)FT,0I+F"F T<[T< `Oa2Jkr `b |||7" FFxB(I#F*F 0}F^( FI@ݿh}F^|( FI@Ϳh}"FBx (I"F }8F F I"F #x/+ !FHN)FH8@8}~,~XIFH @~ -OF#F` FJ F|;`#`0J)F FC0,o(I#:Fi I 6iU#AFVxhQFON'h~ 'pm c"F3F#H)F#F2h0&h++ h`z H2h?F+F"h IH \c8F FL I"F #x/+ !FH)FH8@־8(AIFHB LX -OF#F` FJ F|;`#`0J)F FC0,o(I#:FiH I vi.U#AFVxhQFON'k` 'pm c"F3F#H)F#F2h0fh++`h` H2h?F+F"h IH ăȃn8F F I"F #x/+ !FH)FH8@8΄IHX -CFF F#3`)FJ F^AKh,o(I#2FiI i~2hR ZU#@FOb `h9FC/3 ('m f"$;F F#FH1FN0jh I F 6=8F F I"F t#x/+ !FH4)FH8@|8ˆ>IFH  -O%FF")F F`rO.FFFFqJAFC0nKhB5ѻ.&X#4Whd58F`4#`к.@8F0@YI:F u(f(M(V)9(:G(+g8(S 5100001C10_10001{1'1U(oC oCgoCoCoC8hO gx8hO `gq8hO gj8h&c#%I8hif#I iLU8h%No ^.?] gW #g cg.0gEhCj0oCg#0+' `Jm f(+F"F#H1F#F*h0I3F:F 0+h[o eOa(F2 Jj0 H0#!oT ňˈԈ97" FF4xB(I#F*F 0F]( FI@ݿhF^( FI@Ϳh "FBx (I"F 8F F. I"F #x/+ !FHp)FH8@8&;TI hr Il}R1FH h 7 " FFx (I+F"F T0i8KFF K%*F!F8<F I H!F~ (F8@_#-OFFH"F F!`F0IH" FOPNJQF@FC чKh {28F(S 554444444444444546 64444?644]4444-84=84e8844844444444555644'64Q644Y644a6585K8]8k884}887Kh 6K"`N4Kh+1K"`i#saBiC#0ha!iCSc(JhC`/iCi#0hD!iCC diCcg!0hFiecC 0hI!iC3biC@iC3 I0hJFiF I d  ' ###4AI hB `Bi"aYBiBbaBiB@aBiB"ao~Jh*a|J!` zJh*WvJ!`i"raZBiB2aBqJ!`Bi"BaBiBaD"`D"`ZeI(FhdK`cI(FhiCa`b^I(FhiCa bYI(FhiC3a`bTI(FhiCSacOI(FhiCSacJI(Fh~iCCa dYEI(FhriCab@I(FhfiCa c(F#hiCCi#C0hR!3K`0hr!iC`biC#`0ht!iCb0hw!iC b0hx!iC ciC###;`Z#ObXFF hhZF F### ?#DJPYcmx~ -G], d gsH#:h9HIFdLE0hK+i B9hBF#sa,,IKFBF 8hJi GOa8F2#Jjhh # " >2 h@C28h H2FLAH l kkKk kjjKj jsi ] FH쮎#8F F I"F #x/+ !FH)FH8@"8"7PBx**I AdF@h#F(FhO3c`#h"!XhO0#hhe`i#"!(F~#h(Fii@F(:F1F(FChsFOzrF FhF!ZC(`h#2F)FpO0pGsFF F#!F`(F##2F(F hJhB`h(ѠhFhF`I*FhO3FpH#P(< `0 <pGFFI°B2#>FOR@##" #>#? F!(^h_ IF nRH#`O0B B@~o -GF FFFEIP#m`D3OqB BORD %J%Ih0`L<DOsPFD4HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr  F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3y)`+JJp>s!tYh#I(F>t!hXkKbO HF =GD02ppJFI 2@eDBL @r[ CSfd04 @+F#"}hkAoB@jBoB@gDoB@dHoB@aCB@^3B@[3B$$#O @O ;FgKhC @`O*Fhk0#F0FFf`" XF~@FX2FM.@ !2F4Or! Fx Ozp>x!h\eCC5HB@0OA###O30`((?h2@eDlB @r[ CSh0thSC  (FXIcd#ddd#c/!hXkPF?h2@eLDeBr[ CSR 2Ln   L Jk@L+FD0F$ $ $ $ $ $ OqD0 !@0 !H0!L0O30!OA0qC?#h2@eDlB @r[ CSR 2Lh Xn  @C. A +F" -OF-!FND-  Gco Kh+[ Kh/W K4h$h\C#0 L ## #H #\ #O;A"E@B%D@8F)FXEFA"O18F?F@)F F~1A"8FAF@,OQOp]MF`(OR!O1Op]a(O2!0+@O3,5KhKh4)Hl h)Hb LJh!hhcZcK BЉHR hYkK BЅHF h2hYkBڀH< hk_|HOR. hk?vHO2" h BqH oKhh#h9kBZSB@V\3 ؿFfK F\CVEFXhm++#$5kAkT8ESBdLKBD'a =Aq%@8$05<4P@B4OqsH 4KhK 08$<Fx 8@jw(+@DAF8&FU"FOsXF9F%&8aBA"FXF9FZa#O3sӺHAFr&F0$-BOCȿOؿ#1L 3JALq*O 3BCBsBL @`p  XJ#JCXC3G/3GOCGsG0 PlAG#r(F"OpJ3@,@pIDLsXB8F/('Bv8/Fx:FOJ<"F AqDC4bBXSB=F6:F#(F1F@$HH@J` DHODBڛa@"FOsJqV#1FFF(F0H@`0AOHDB+HF\ %N9hPo`(F!@#i8$<D0`a ,`Eݲ 8$nw#09 F/Keh+!F,H3d3d4  $I D#KO2%k\5#O#t+ gZKh#3T  @#*C@C9FCXFO""D0FF#F?"#ON T # #nT4 #h!%ZkRhaH4PkR3bisb@bb@5lc@_OSfKhcKheKheKh0cXTcOs0HUP0nhckP @X0DGhbijR8d #, #@ #D #^Fd # D#T~H # #  # #O`v^Kh+U\I # h])hOPObhObxi6PKhyihh0+xiOr!Wp0+I#DKDI"FfC,(sѽJ0+P# 0*z+x; {.hO`1F F)1FOP^Obt "FF(ObF)hOPF"H0+hMj0:4D\Bi"iBCDFhInDr  @#"C@!CF2 J~P#T #P # #P ht@ȨT+hjLO ^FhjB@YH 8T<OsOF  "CBA\%IB& #0P D.4<`DK B D p0C_C  CBvۇH`( h!i |Kh `0 0$%*Ŀ:n@yJȿp0h*@" t o[Bx0x #\0 2`0 H$%*cJh;3#h0$%2l09nCHd0 BTH% )i ;j D;b.  O FDKE@ӀzhAK`BRFvq9nh$%* ݠi "@nG\:CBTi4K i2ah*Od jzh*KB)KTzmR 1B yhP%BPCm @{*@i d0 F00x FPC' @Z2R8  D~d # TU  T #H000+ j;B,00#T003X0 BKzhB5smxBpijYh:bJB5smxBpi;j;;bhkZ*@ЛO Yk1Yck)FyH+DBӀZB"D ȡ`0%8 {i*DB@〝B [!Zk2ZcgJ{iBPh$5+nO n9D#2F8oESK$%BFQ# 2A# 7$ $ROjE;h#jjkFh!jjPn1Rk!b!$hj!Zk`bh`iik _OU(D2;h+aihi)Dhkci6M 0o+F(#h\%@*MBii&jCAFhdAq   C #)C K\%BM+h+^6\ zhOBvr:n 1Gpizj2zbU #TT #{hJF`SEvq9nh$5+ ݡi #@n\CTi i3aKh+Ld{hSET{mS 2C {hP%SEPCm @*,d0F00 FPCL@Z2R80  D {hBvs;n5@ Ui{j3{b  +KFOL O +$BFQ#0A#B @I 8x z @J k08PRx`0@OEFEeiE=D(FN5 @E #kcDBhVHP5U\Bii&ACE Fkk   idEu E   ,C)CDF [+6Kh+@-D?. ;h.K  FF'I2"\Bii&HCBFhqFBrxn  @B #:C@H2DDXDBR+h+*hj;$ Kh۱ H0 Kh۱ 4 T #fo1o O |:x* (F0UKhUI TLghcgQKh+30304040JkhSC#oCIOb`iAMfib!`+hh1F:Kh9K\5h0+WpOr!2KhrCF:Fk+h+hiZkFAhPnHtL  Rk'@Ci1CLjcjB+h#hFZkh!jj1Pn!bRk!5!k`i.hiYkI( D-/'#td #  # #8  #-O}FFFFJFF(hI2F (  eI@F&ZF`<(F(F_I*F@F"0h+ZHIFO0 }k6j`j`+k#akkcakakka@0#bB0cbklb8/}GI:F@F0vBI*F@F0;AIJF @IQF8"F F$"F;I0F9I0F` 7I0FZ5I0FT3I0FNh"F1I0FB,?F/I00F@"!8F1FHFX0' 0BgBOЪ# (5D*#*#0e "F ]( #d@edAzd@Vөܩ 2G-CDM$OcFF!FFf|CFO4 F DM"FF;FHFF(F`,0 128F FF I"F #x/+ !FH)FH8@и8Ū YpG-GFvFFFIF(F:F3FJF8FO`f#@TD&O` FB`۽#D# 6P I-GF4FFF%! F@FKJOF#` #q  J# #!F# F :F @m# :F^^F: p FFFn2Fg2F`2FY2FRppFF F((*Fmep-AATB A ҅BAӃ Bt ҅BA E|   -OFFFXF# " `0FH xFPx(PI3F*F m,3a,M,%A,!JI+Fb< ,P$I|e{e{e{e{A|e{e{e{E|e{{B%JkihSCB@6B4 4IF FHD68FbAF MCAFkFObmFiIhб hOhU#  E@B 11h' FE#p+FOb9Fo M#####б-GFqLFFPFZ)F mJ Qh ;CGѢj# !06O҉R "##_J )LXhRF+F@!kx "##SJR 4Ckp06&Xh+F@aF 06KDډ:ځ#i;#ajO 6SCBw?Jgp>SFG700F9FFF$&F 0(0A  6    J J &+FHFQF$&0F9FKlV㱴X AF0F0pC Oz&+FQFpfHF(FGZp"((`:F3BEC FCh`#$($ -AF8N0 0FB FZ8F"F+F@!23j*FBF[ (FZ+ x2(*] #!3+BD +\C J @" C+T06&h+F@qF(FZ0&;{A0&3hpi;` D#-Oð F! FK 6" O3HA lFD(_kI *jiiL inPF;` 1DmD D0O A SE0IDH`0 `0 F+ 0HDDѩj 9  0 щD!^PF )j)K"q!YQF8"F FZ"F;I0F09I0F 7I0F5I0F3I0Fh"F1I0FB,?|/I00Fv"!8F(1FHF0' 0BeDBOЪ# (5D*#*#0d "F ]( #d@edAzd@Kȷѷ'<-CDM$OcFF!FFeCFO4 F DM"FF;FHFF(F,0 12-AFF("`8FF Fh3,x[x+&ICF:F S-"F-G= -S%E1O;Og= +dDTv0F!FDT$D46DICF:F~% I LF H& I Hch5"x4IH- " ۸-AFFFFO)F F`BqۆBxI+F"F L-O}FFFFJFF(hI2F 4(  eI@F&ZF`(F(F_I*F@Fv0Ph+ZHIF O0 }k6j`j`+k#akkcakakka@0#bB0cbklb/}GI:F@FB0vBI*F@F:0;AIJF @I\QF8"F Fx"F;I0FN9I0F 7I0F5I0F3I0Fh"F1I0FB,?/I00F"!8FF1FHF0' 0BebBOЪ# (5D*#*#0c "F ]( #d@edAzd@[ؼ$7L-CDM$OcFF!FFdCFO4 F DM"FF;FHFF(F,0 120" L xk%h3150 +۲T2 *0 ## K"`pG$1FHO0?FH -OF-h"!F}R#h<chh#icii0#j$0j*#k3ck 80c%@0)B0$D0#F0"G0l2L01#m(T0-@#+ +gHdKF(bHXC9 ^H2COr@c++F3UH$ZcPI"l(NHH"#踨!nF FHIF3l ?H&h+npC_ICE7H7I"눻^pE_,B)7xrWBWA 8ysP")IjPFf8J'QFv(QF0Fp/4'78F# xNKF2F:BF  OEcrHqHqK" pOaX`2+F@"D3`2!;rhCWI`K .ձ@ +qh{:+Aqq`h hRBFOrEHq;F2Fp2 @>K {(W #9Mc2ADIQE23)DB2,H ԧ+@ ph#M'! {:";F@ QEW;p`)DsF`F'+|$!$#@$h$Mb\ h* $@"$c8!$6e(!$ɚ;$H H; rhP [B( ;D Hr`B03;KBr` D;$H!$ɚ;6e-GFFFF ` o jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  -9FFH&0F }$-CF#M -FF(F@ h+HCF:F1FHHIFh?  ?H !!h S0+h< IC﻽@@$  Kh K* F%F+FFH !%y IFFHK"FHXF"F Hq"FHHa"F  pF FF+ * *x *##pp\* Cx+IH.(F;'*"*+;.F;B+I5FH@ X{ FKhhSIC h\B Kh ( !(O OCOC`O0"%d"%0"%FFFP;F0O`#S`5O? F`,HF+Jh`)Kh[#h(I; h\B#(FÈ*# ##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#0h!(/#@# 0"%"%d"% hhȺFMNO F+hh *3h[S9hO  A L#"`c`ycy 2\ F0"%"%d"%&% K : *B ( QppGIJP F6IFF(4I" F령2I(F(FF FDB ,I-H (#x/+ $I%I!F(Fh*F+FxQ<,Fp/+#xk/)F F1x/(`FF+/* 2* cx.+1F F&F4F** I(jB=/+ -O]H#1#3@#SaKbKSbKbK 3ObhHH##*SѤJ#3J`J#3[h+(INMFtFOBFIH~H:hOa F:h^# * FD8D"F9 + + M#SpFp1F0#xs1 @ObU%""tvMFt!Fx+F3/+" AOb F% @"@!)hM C0iH5`4-cI PaJOa10 P A0ObXI%#8x+`+)?+"D+PI LIJI!% @)ObQ#$;$+%#a;+R#I׻;s d"IF L( @PF F?Ү CK"`KhCK"F+F @= @Q}Q(%&%h"%XL"% 0H"%*  LF (E @yP? ( BHr A1l IF ( @ÈԑI BK# IF F( FKhK"`2 IF (tItHsrs    # )# O#s*s3s;s3&3RsZssY d]IF LF( @F(?ҭQKhchSI; h\B­NKh+h+? H@F$F(u)F@FL1,G@F(B X|O #! SF*FF#BRD D/I-IF+2BDSQ+FQ F 9F8#FCCKE@+?X%* #F"#hhchDs FFFBФI"FH$r "#2D(hl`<(h Ob`p K2;"(H[>%. ! H~CF@ @U F #`C`* MK-OFhðF.IND4mFBC4Or!(F3h"!FFZq0 0(F&40+Y[Q0C+h30 yq#q hEy3#3E,0IH靖0IH y3#3BQIH*0 I ~FDB؁+h(FND "%G% 3Ga0"%pU%K-OFhݰIHNOaL#H#J#h0R+#OaH#J#hHEJIILMHzJI 2|IwH#OazH#yJ#h0R+#OaqH#rJ#hnHAkJgI0gJcIfHgI@fLfK"ġeO#ch P +vpCOq!UF[HOzr#@FIFzW"0G"`3`2Sk "lk bl bh`!i "ibi"r(4H;J;I%. -p&% .%Oie=%n 2  "%/L2CchpCOAp&%-C (OF@Hch h Ob.(` !Kh!I!HF%(F2B#c`BKh+IHZDb`VI,(2EOAKh+ IJFH:X"%"% --GFmFFFF0FX#*F040F#FAF mGG#*F0F#FG3F;J@A7M:iFFdF1I0YF-I찹MFO F| m"I2F"H!I2FH yKDoObIHFFF@B"h#n:i1F>%+ .W-AmF.;`3,/*h$&I8F&F8x+0F!($ F miFN(F*FF(yB02F)F(&h->%8P F8f"iFF",F F8$Fh F@U>K-OhIH0R+ эKOaH##KJhL4#+ щHIHO1I`HrhUIF|HIbyH烉'%$"%("%-AFmFFFF%F(@H:F#FWOr@a0FZ9I2F9H8H&hU5IF3H m*i0NԀFw2hmiF-0F\ FZ o/F0FOg:F0KIHm#VhUBIFHL T0:F F0KI Hm#6hU" IFe  >%p&%*U_$"%(   L4#+ `"#|`f#x#+ H"#p@HW* PF FFK#BqH"F+FO F)Fzh;hES"qbC"` Kh vj#BBI0FX"%jA%"%BijB ћibpGiBтiapGF+IͿPpF F K#Bq Nrh3hS"p#BB@j X"%A%PpF FK#BqH*F#FN(F!Frhr3hS"03*F#FHp@`ZjBB `p$FX"%A%!MF 'F(FkFkFk/..p hiF8i,$ F M5.$j8/!FF$ F8#p(F/##pF(Cy+H)FFL/'6*yB H!F F)h F !9B|`yA%FK D$D"`A%0е+F#Icy+ i I F#jI FP'@I FI F Bg0F9F;i0F9F F h K&FbbнF(iBiaA%pFFFvFI FciB F+jeaa,b/!0FjE hx(F `(F: q F!h80C p# gK-OFhFdIeHdKh+acI8FdFhhU#_IF_H,^H9FO #`#FBr @O &F#Bs QPN$shB}NK8#0!#HK##"FKh+F0髉[ ~hT@IF9H?H9F(F6 FQF:F4J 2y 3a!20h+Fri[F0FYF F6K !$"#y3#Dcii i i i i #j i cj i +F"(!i3hS$0i+F"!4p0"% "$"%=? JA%@"%P"%"%wX"%K-CFhIH&H~O"#`!x`T8`wH#vH"#ÈCÀ5"HFF hTjIFjH jHIF(F( hTcIF`H bHIF*!0< FTF]H"F1F(F(*hTVIFPHUHIF(FRKxR)r)vPJBB(ЈBCIAKHKH 0"(Fv(EK"@KBKAKh Q # O( #4D}`(<`1D'B4(3( 3D(B]S(,2DC(,S,C,S,C,S ,C ,S,C,S,C,(3HW/ :`00"% A% @hr "%@"%p&%P"% "%X"%pG)w ͺ+UKIHm p&% Kh)Kh,Kh2IH F[h9@# FKjFIh(thT IFH* h"%G% 2 mA@pGpGaJFhS BDKBKm I H ]"S BD G%Ip&%R F L Fh"i DBH4h*F`i9F0D.Dp`G%x KiDao J3 Im Hd lF]G%p&% #MF`+iBli FphiTf0FSWFha.aK(aHm##2FK*G%p&% K FhCK$h FF`GKh I%"F??KgmhT I2F;F@ H(F"%G%$"%p&% 8ML4K0+I"m*| JK$#e###c`*H!48G%p&%<X"%vTL%KsFh F;H F!F`nhGKhK*F!F0 KEm hT{ I"F+F`H p"%G%$"%p&% 8FL hF F8)FT_(4pF KM`khB NTvSg0IH Pl`p"%2 G% /K-AF.NhC5-KhñȀ*O:!(FpFh#(F;u`n(7  I(F`I2hTJ FIhhTJF3h33`,F!F HA"%G% "%P #%'D\M%L"%𵅰CL##@IF@H22CkF;I9H:I:M8#8KF@*1*+F6H7"1M1F/HH1.h.I##j&IS1F0Fx2.h2C1ZF"I0FjI8#NK*3F7"(h Fu1V(h!F1P)h+h[  JK p"%c sY%% ("%N-OF(ðF FLF0# FsHtIDDF\E#hEӫoKhCnIkHDE FJ{10eI PC#y+<  cJOqPFy0[#y^J\I#hhUH.#..2Vy"h`y1A:KR#D8F!yNJ0/GKhLICH#hDy"h`y1A:KR#D(F!yAJy"h`y1A:KR#D(F!y8J 6Ibh4I\X0+$I0HFy.B"D .F8FJ'J0#y+QF(F#JQF(Fr!Jy.B"D . F8F(J0Ѐ!(FJ!(FRJ "%32 >M^ oz0"%Kh(K[h +kpG2 G%K(-O", )$Fh*C(ЮHKh+'d;`z}I"FLzIHBxHOa"hXF#hԛ0 +XF+mIsH(jI$qH"qIXF9#A mI bbH#F@kI `4 ,\I -,FORKhB )#@C9 , "FYILH j `8,HpH4+?Į#@!@<ո `8"% p&%h"%G%2 p"%-OFLh5)BLp#1FB\ y8@%ch(D+Q9F#hF)0B ( 0pIpHV09"h*<.:/F%u-oiKheIhH@#h+@eJ9h`0h!Z%ObHFN9399393HQF:F .?/O#0 5D//F-HIIHHK *3*(*)BIDHDKh{CHX :6Jh">I2F2Hi#Ob5/F5F.I5Hm4I,H#2I(HP!*Fch!(Fg(ajhS%IFH#I#*Fh??G 3 9FHeIOb8DG% 0"%h"% )p&%@4"%Wp~2 pQ%"%"%sJ#-OFh,M*@iNl"BkKBBИB ,MeMhCeKhdIeH&#` F(]Kh+ h ``h~``hz`hv` ir a`in`aijaifa _ n f   kS c`kO`ckKckGclCdl?d("x x||!hMK+("%TG%0"%  """a" """CÄ ehih iÌ sn(? Nk#BNFB宧KhJJh"IHK"`uPFqFHFmFi@FeF^]XFVFRN8FMFI0FEF(FAF=Ob! F#Or #`OsOs`Oscaa00 sdcS0dkKa#ca0C@S #eKa=;$ & `Jh*7 Fx3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccfEH&"hCN*CICH + F?1f#RKNh+@Or@a F (ThSxI"FFpKh#uI"FoH_ #qKh[ FsÈmH!FOaKh#aI"FaH# F|PF#004_J`IF`Hr0KQKh+\I"FPHrOKh F WH"!FB( 2C F FJF)F F 9F F #2F!FSFO0CKhCBIKF*Fx FZAF F +Kh#;I"F+H(+Kh+r(Kh F iKKq F J(hR,I"FF)FJF F 9F F L2C F FKh+HKF*FxOFp&%) 0"%q ,"%$"%G%D* WG%("%$PF]qJqIFF#2F!FSFO0zkKh#jI"FjHjKh+߮hKh F Oq F (hRp`I"FF)FJF F 9F F 2C F FRKhñRIKF*FxPFDJEIFFB#2F!FSFO0!AF F DKh#4BH[hGJF)F 9F PF;J/IF:H#ZF!FSF0Kh)Kh+`2C j f#Khk'IKF*F Fx A4 \ HYFhG FF4PFhIF HAF Hi0"% $"%,"%("%"%K%iI;KK!𵅰jh+GJFDKiEKBEHFDH4+=BJBM4;O34RF`(5&0 Bo0*5ѳB38F(51JPOA`#S`'K"$ (H@:(K"Hm6cK7`m;h+0DhR.`DD)BK Hmp"%p&%TG%X"%N{𵩰N3hIHLMch"PF((`zhRJIFH "hb+`K"O`I:h hS5#h CDF BchF(FHhRqIFlHPF bO.3LF(h L KOccK^H%3h:`)^IQH]H[O58FZJ;59;99;9h3`HIPH6OH2#h۱KKMJhNk#)FKI9Or#9#Q :D3s93hAKxt+w>K㈛IH6I H0㈙I H(Z IH"[ IHHU%U%8F,F`hT Ic h\BI*FH F!8d"% pFNI*FHH0hCh;C`+nIJ ,0hCh;C`+b ( y,n,ѤyXBXAphZ`x3h hZ`x +L"% HR Kh{ H(F H( F>@pG 4"%*sF FFKhS 0(&hRI3F*FH p*Kh H(hRI3F*FHF Kh  I+F  H, F|1$"% *W0"% 8 FF)I)H F'IF%H`i$IF!Hi0!IFH j0IFHi0IFH`j0IFHMcyj+*F HhH FF8@* 0F%B#OaH#K:H0i5I FwY%<LÈmFIf FC CFhF h8 F[ ` q F0FhF m\pFCy+I: FKhF@ z(C@hR*F Ip@F H Kh3*FIp@H p|$"% 0"% -A/!F0D'O/?/+0F'pF`0F4#h0F+F+FC뀄FCy+I#jI F F# CKhF ( hRq"F I@F H Kh3"F I@H y$"% 0"% FCy+I F# CaKhF ( hR0"F I@F H B Kh3"FI@H 8$"% 0"%  FCy+IF F# C!KhF ( hR"F I@F H  Kh3"FI@H $"%5 0"%] -CFx2LF.+ FFCx/+!h-H 2F )I;F h-A!h%H9!h#H#J h"IJk hIJ/I hJI hJI hJiI h!h #h[I JJ("%twrqI -ANODFF8h "F (I 0 +;#0B#H+pH!F]%@pmFFhF!0lFE*Oa&H)F]F (`O0#xF+K"Z` mpA+hFhDB< +#<H!F7I 6 dU]%\FF FF K!FFh 0F FBI 1F(F@]%𵅰NL`NI MI VhKI`II HP aEI#ihF(Цh@!0Fj(`#p=Kqh?+C0`h*F8H#7K3FNF `(FQ.*2K%hpOOpCco h5%AOq h ^#"! h V" h! N hC Z7 *_+-+H1FP ".FAOq *(c]% ]%"%0ðFFFJOqK" FZ`*FC0]%Lbh*I#c`]%𵉰 FJ!FhFH"iF F DB8hbq \I O%]%𵉰N FF F !hF OxhFdiFF8h "F)F8h p!a ]%LFrP!Tp")Fð JOq<H"C]O0$pGF FKh.F ZhBZ`C!+I:FI2F "h!(h"^phpt O3hX` XBXA F]%8 FEx- -*F!FF H@h!FFH8@H 'H!FFH (7((Q½HpGHpGHpG M FOa\I M] I n; f+X1 񬹋mZe "ppGP FF9;H@ Ϲ9H:8I8FO51F"! G%  `kex#x˱;C3D21 *'O$V (>,5x--J# `PFhFM LFJ.!H,PFhFM C J.#(Fz I$ HkIF H4 ,ч ,]%a]%dKFk%+'x)ГH@ xH1p!Hx;+ D,,,FzJPvyIhah@i!isHf! * qKL*F`ih kI硈kHNኡd++% eH@"!B aH@ v_H_H_H_H,"^H^H$"\H "[H 0P1P2P3P4P5P0h(1 203P4`5pf(3 @ j8(؝=V < ;:9876p7Hj+#4H##g/H硈 H))&H(H'H#!i&H%Ih.$H$Ij'#H I j hx]%h<KUbo}#BJTv!]-O$bMFF!FF(l,` 0F*F9F&$""##!"FD D dQBOI0FpPFKIF!DQ~(FI>DkCDH:+hBH[V\*5O O bF#"2K!F@;?VIFH p H*FHMMF/h{+`7(@qBM@A\jp`\rF P MT1ORS/M;1@Y#Bv,p  H!*p!H~F(I F  F!F :<,vIFH  pFN4hxF324 RFKFK,) ;Bx1h21 RpI pFбh+хk`& 0B Pm% UCcPep(F`5 7 FFS+ hhT"h ۓB(F)hD)`"`0@pGF-GFFP" !r ,FLE ѝ0 +>1F$H |" !J @F] J^p0 #x !J@F"## #G,; Y2 o`jD.#/<P" !J @ E  $F%F'b V" BmI#F*F0 J \I"F(FP 4?@H8JW b ^ u IF;H[1 @  7MI,hF FL"h"ch I(h(hh3`0@pG4 j%#8FLرh+;+J"2ChPP8@IFH2C hPAIF H%#h P8j%j%,Q-AF("F"0FAFPD0 I FO1F(FAF0FUP&0 FAP'K1+K9FHZhI[ B 5V# 6H9F\j%4 zu -CFJNFF 1+@1!S /}BAK"!F(FC +CF+F FY K]h`!F*FF H)HHj%4 pF F&#fO`0 p*I"F Mj C3F FG1+K!FHZh1+ OR*#Hj%4 z-GFF`kKh۱#jH# p (%_U(F NFH fO7(%7O QF JF("D@F O0 K FGO i "(" BJI2F j'FFCKj Ce#("9F@F (7k  P(O D    eE('FFO MEݹ 3.K .J! ,3FZQ   2B22QB22QB22QB22QB21HAF#H########j%4  -CF`"*x FAF/#FH#P(FNFP y#O3%F%9FHFUO0 b F#CO2B,I2F ,0/#C#C  #"F1F!IhjC!F0FJ3F!u# #5BܻO1H1F<B  H.)F# H5(j%4 YJ0FF%#UOt0 0*I"F KjC+F F[1H!F zH zgzg+z;g+;; ;S0+j%T-OMhOFF;h!F!O[E,k FTF(^J  ^ TZF4!O FPFVIO lFOS AC@1+*F hO0?Ѵ@ O MT")FHF?F)hE >IJF @h")x(Ѹ?7IJFOX T# C/ID# F#F1+Ѵj2OCCFOR)F0F,j2C Q#1OR0F(FXF<*F1FF @D0h(FNy P0AF$"1F"FF @D0h FNbsj%dtv-OFMF FF@FLx@F r,LB+ KiV(0 JKKF\E4 u j%4۱IK- F?Ibhc- F.r 1@3+0KB,1+ぞHQq`I{+H_qtT/#h"k@ҁHFH!lHD#3p+I) @IOrHIOrH+KX+ AFOrH+ I}HOr,AFOrvH+{wIsHOrAFOrmH+{nIjHOroAFOrcH+kfI`HOroAFOrZH+k]IWHOr_AFOrPH+[vUIMHOrpp_AFOrGH+[bLIDHOr\HOAFOr=H+KPDI:HOrJ$OAFOr4H+K<;I1HOr6?AFOr*H+;*3I'HOr$؀.J[F !*OrAFHH*Or IFJ%HNl$HHj#HD /@K$*JBh/3u 4 4 @ tn%",4>BGQX^ar|j%tmH H 8X"OcDOs0V(0 )F0FZF0oF(0`#N@0lO;0mF(0C3N>XJh34m;3 1IHmC3H/k#h4+dw/`F(aC- NFH5 QrH|akHv,p+ ьIOrH(IOr:F?chBjBPFNF(?}-RF:yhQq"Ts3FGjJ!DDDu M"l H )F0F"SFN0 0{2C@3+`H#l{O + K^"F)F0Fk$*ѹ 0NILp#C3F@G2C@3+9IDH *;ck O O 0oF%0kN*F(FKF0FN 0'hC*O CDEX@FN F@FNh +O# F%;ackCEK0 `0 C $IF0F$RRF ` gkj%j%u tn%m%k`"AF 9B   hBЋh;C 3D( KhBъh*O:XF NF( ! 1 *)F0FN0?#CI* F*)F0FNl0?ٮ# OcO ;`BF;F)F0FNU0!h +8hNKF(?F;F)F0FN?0  E?PFN@FF#;hRFI F*')F0FwOHN0?CFNF0K JIh\FO;F)F0FN0?jHCF:h!F Fj%4 -OLF=!''aFBj%4 Q3[nx+h+CoBABOA1I@F(9.?3F0+*?!a)" !!!!!!!!!!!!$!!!'EEEEeEeEuE%EUuH9F"p"rHBF9FO O O Fl+8wF\"F`@FEaH2F9Fx+Hh+o@CABOAhXL TEeL " (@𺀹@IJIH9F`"F`@FECH2F9FPx+h+*q %pi\LEe HL*" @F0 (0 0`BEe(H9F@F0"F`@F"EH2F9Fx+h+kMEe#LXL# *|"xH9F Lsp ˹ H9F2|^9.?TEe4 &йѸ3.(JHL+ХH9FѸѸ؝H9FћH9F3ѹP@cp#I8F(GxJ#8F@908CEuE @ "(`AB J*h @ #B(+`0#u@@Fo H#`#3`#3FN0-hNQ9FFrH4p#.!9F* !8FOq1`AFpOr2JFfK$cJ+h8 p09FQh#C ^H9F 0p'#4qWI"8F(usz=+ NJ8 Bm %15DNH %P44O C 2F #Oy(FOs;`@K8 : < > 0)F0FX"QFZ xsp41F`S,YoC,`#BF;`;FN0ThN)FF%Hh#CXI!H;+J Jt'zI"8Fh(fѳz=+J8 B^O D=!PFF0PFqOO 4 j%@ 'CXt 4+H#4K , ( Or 0Or #PF0 JFK"04Ѹ1FH1FqOrxB=#<I"8FF(3z=+?~J8 B'17D+tHh h#4%3FT%u#h!(F1 oHd.RF豇hO- NaIFfH+h*FdIcLp00G##u"@T"@%.(Fp \ F@B@ـ(րMH)F0"h`!(F & ' X 'pp:FYF`(Fh F??8` `h"* hNT)FF1H7 Bx.H)FD0h(/((0:h h`;3" L !MO0:Ѹ ;hF h!C '##0!XFFh+4 j%a 4 wm%Q4h,",,ɭ#7I0F##3I0F $ '#F.I0F#JF#FX#(I0F##:F#MF(!I!HFSF9FVM0Ѹ 1 FqOMɼ6h+"FHFI#0(# I*FHF3F #3F MVj%IFFHpK"FH=Fh^"FHb}"FH\"FHV"F HP"F HJ"FHDH "F> F/ 8FKhIFpF CF H)Fx` 8"F)F $f*FFHo%JOomFFOahFW. I"F fhF mpmFFFOa&W8H!F2 mp&iFDmF(ZH!FhH!FM2C&h k`+h  &2F (o%mFFOahFW8 H!F mKh  hiF `(o%-HO MFFtF0 v,izI FD yI F@й+*hOa FW sH!F IoI(i#0((' F EFhIh FeIh8 0FbIhF(n_Ki _I(,!0F F#p pF ,#+p>UI lQK 3x3QH80FM%痱NK@HFFHF$hHH!F"FK@HF %;Kis;IF(C=IF-oYF0FFFݱ5H[F"FnB80FM4 F)F$([h&FpEC]B]AF(I(H#FFEF0FFF"H"FB0+HF(H!FO F FIH#F|EFO   o%  1 B U [     -O'OcjF9FX0CF=FO WQI"F0F0!sBѩFO hEP(FMGh0F  chB h9FMF(=I"F0FF('F0Bҗ0+"a `Oa0K7#9E  `8, bF&H57$I FK gOa8FK8Fh0:FFH^  8F(:FF H `( bFH|dedA !!!o% #FFH&F0L+FFF H( Fp@MI F(1FI pJ!W!CiJipB FИp5 FF(FB )F Fp@O0-O F-"F F .ܫH '6OdL%I t2F ڞI+МK"FB- --їNOc FONOCN7+@NF-6++@@/F #  7+@yhAQ&zKBOAxKB7AvKB7s%BqH %SS8S&OVDFFT,0P;3Z+ OK(] EUd_7+ZRN O O "F+F!0GSBF!0 MP =N#<@F B8F X <h]GwX %{ %y %w%y #% #W<B1W H+F@<O"Mh27p<B7h7 pE=ѐB٢\+ZbE.F"p$+P2F!C ~K   x x8#tH+p,FxK@:fм[\Mм$bRENU2*$(\(*XxB*32 _x0/!٘xB31 \$LLl,4L$LO Bp73oDGH,,(3B #A$+h+;3hXh F(63h,Dљhhxa+A$Kh$K *F,9!K"Jhh;#<$"3hYhBF'ћh#8F)F(FL M0&KO2`($ J1F(F (F O#F#'tK&'hK&dK&`K&' '-OLM`!`HKO2` LM(|J!FF (yK yI$`!FwHN(luKhuOpNI("FF(a hK"ȑ%iNB0+fKh/@_Kh+?OS%hF(4]K:F `h[KQ%hEYKhF+rS SBTKhd #FHL8!hOKhkMK"h`hO#h3#`GK`5h*x#hCJh#3`2h*h)F2F(6K;J)Fh4Khh2KhF#S B)F/Khd #F1h)a)Kh+?\&K h`h3h33` K`M@FI P"O a #FD   P%0#hKHY`K&+'L%bs%%$P%dK&hK&tK&T%0%4%lK&7'(OI+)0+"Kh+:hF(3K" HhKh]KhF3S BKhd #FLR!hKh{K h`hh#h3#`K`XF$L%dK&hK&tK&T%0%4%-OM(FF0`)`;#3`Kh$`3h+OJ)F0F (-3h+*+h wF(,9GKGIhGK: hh";#9!*1FF@>Kh=K>HhX ;KO2`$ F M($5J)F0F (#F"F!F  YFF-(%.h+(H9F$2&K +hZhRE-ћh#4RFKFH9FK K(+hXh??#BA$0FK#'lK&dK&hK&dB&%S'`K&''K&'J2COKK)K&''J2COKKK&''-CM`!`HpcKO2` M(_J!FF (\K$[M`I88K!"Fh+h!FhF(5K.5J!Fh4KhhF[ IF(:$#K!J1F*HO 2C7s#B%Jh"FLm YK!h )Kh+Khh#hKD#`K`H1F`K&'L%$K&dB&%bs%4%X>&dK&lK&hK&'T%0%'%( FM{KO2`'I`h@F0KbhIh  "I0FJ&`2COO#Ob1F(F((FL M3x+;F"!Ff` `K&'%''K&''KF;(FFpG'0!O3J`HKh #`K&%((pFFh@ `]J(FHF*F(1h h( Nh I0FKPI0FK(O0p '%'JKK`<%,(`K&0KO2`Kh+KHh@`K&h%%6(JKK`أ%j(`K&(8 F%%Kh@ $K"L$M(F `(h*#h;K(hhK )hH#hKJ!`(qO3J`8MhI(FK I(FK((F(Kbh IhK`|K&'%%(l%`K&'y(JK-K`h%(`K&JKK`%(`K&LK"FK`#hK"`l%(`K&|K&JKK`T%(`K&-A F(O3(J`(&L'N'O#h+ ###`3h8hx+8F HL##`#h(I@FKg##`I@FK_ `8hJ3hNIx6h- F>1VhK`&*8*@ KO2`](( JiF$(HYh(K"`K&']*B&08X.KO2`0(+J((K (I$`7!F&Hp!M"FFP $K`h#x +`+h+h!F(!FHm)h(K"`)Kh+K"h`h+h3+` K``K&'L%bs%]*B&0%T%@KO2`](+JiF(+HYh( Hh( K" JiFh(`K&o*w**B&e*-CFhFDIp]B]A.D0F(n>Kh;>K>HhCs\;N%,,,-={5KO2`O 2HNF]#JF3!F.K0F+,5p*HFx(K*F(FF FK|#z)FF;Mh, FhF(FH(KO2` FCK,0FIK^(F*dB&%**`K&*'*****-A@OKO2`(]+JJ(CFL;R#!B#aTꀱx|+ (`($6Ih<5K5I` !F2H( ,N$-M'+h3;B,Kh۹ %K"`BKX$J<(юh, #;F P""R$ 8)hKh{K"`hD+h3+` K4``K&'$*L%bs%4%'0%T%pFm@:O49K` mp! $F(R$ F4,! -H(-K/!(FF F`AObt&Khk%N F1hx1hh;`+ -#KJ FhH!FK O2`!F hZ ` "p" FB1F c H$`K&**ȣ%%$%+++0# 087KO2`0(4JiFM;+0HYh(F;+,HFh)F(HF(F!F(F, +!HnFh!FHF F!F F-KHh,+ Hh!F F!F F KO2``K&@+I+Q+\+d+n+%v+4%p(LO3#`нp@ K NMh 3xKB3x+)h Hp@JI(h##`p`K&T:&X:&%++p(LO3#`нp@ N M3xK 3x)h#p@HŽJI(hx##`p`K&X>&%8*+@KO2`]((JiFd(HYh( Kh Kh# K Hh HYh(K"`K&++h%%+,B&@}KO2`]((JiF(HYh( Kh Kh# K Hh HYh(K"`K&+,h%%%,O,B&M FFFObhFo$B HiF( V$ObhF&BIObhF4K"` MW,;&B&@ KO2`](JiF(!H`K&Z,o,@ KO2`](JiF(!H`K&p,,@KO2`](+ JiF](+ HJiFL(`K&',,80 KO2`8 L#B%h#`H%`IhH`K&h%,,8C+g KO2`8 L#B%h#`H%`IhH`K&h%,,80E KO2`8 L#B%h#`H%`IhH`K&h%,,81"KO2`Kh+Hm@ `K&4%,81 KO2` L#h!F 0#h!F `K&4%!F #0(KO2` Lh!F H# FD!F FlHF(`K&n+,p8=KO2`p(:JR(Xh@F33K4Hh/K1Hhz,K.Hh.H!(,I oF [z{'Khd K&Hh F)F Y!N"I0F*FP0F41D0F " FhAOh8GKJ h;#`q)F )`K&,%,-!-t%c4%:-P%J-xK&JK K`lK&M-`K&JKK`%Z-`K& FOF(O3;`(N#3`KHhZ3h3h"Ih H33`;`B, K"ph"@Hú`K&hK&%t-MK&@I0FJ4(pO,7Шhg,5h`%! w!F rF$-H.Kh+9-I-K.H hh+Fa*Hh(OO%&Od%!K`!K`Kh{IKH hh+FaHhQF )IF % K` K`(?|$O0.' .h%%%'%%%"PK``K&0KO2`HL( Kh Kh# K HhZ H:( K"`# Jp J``K&.h%%..B&X:&T:&s F(KO2`pKNh31hHp@(Lhh "L)xjjhI0h<#0hRF H Ip@6`K&dB&%S'K&...80uKO2`8L#H%h#`%``K&h%&/-A@ZO3MJ`KO;h+JKKHh(8+GKh#CKFHh$8h "CNYh`;hK@J`"?LchchEE3$ch;c`+L7H (Nch;c`+O2H (E1JiF(ѩZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhv#hZ"`x +`K&%%+/T%e/ % %P Z/// %08O3J`0((J>(!Xh7??F FIZhKh-t##`K&'/%08^O3J`0((JiF(!Xhc??Kh]h I*FF F+s##`K&'%/0KO2`(ѽ@Hf@IhH``K&/0O2K F@H2I@h'% 0-A(M8O3+`((!JiF(XhF(H~FXxK*F0F:F8F6D4 Fl"F1FF"FI@F"F9F@F@Fx@F#+`Ie8FIbN`K&'**;&-O@(KO2`(($J&(!H&F(7xK*F FOF0r|#!FNLF;#)F;`#` #KRhX(FIL`K&'**|K&K&h%'(pF FO3J`phI0FJXI0FJI0FJ($hhCJ KI`` Hhhh#$`K&<0C0J0ܣ%%R0%-AFFFF8K:FIAhw@hI#c`0F JhF``B=H"hIAh`%}0h%0O2L"`((@jh5I*2F8h "0+h+##`MON"`K&05 %o,(NO3 F3`н@gHh OF0jh8h I@@hI#c`"hI8h#3``K&%}0080? KO2`8 Kh3 K Hh8@L#H%h#`%``K&dB&%0h%08C+KO2`8Kh3 KHh8@ L#B%h#` HT%`IhHN`K&dB&%0h%#1(1*8 FKO2`8Jh2KHh8@ L(OIh%h"` H%`hH`K&dB&%01h%]1e1-OMEXaKO2` M(ܛJD(ЗK$NU|FEєKzhIh"1Fxh "64IOB(FO #' @0BKh#FF+21 VNF#xӹ3p,0hhCFktKwHhmK`0B4$+ \+Wcx4;#x+4jJhbxP1@*#O "dF0bx P1@U,:B U< 0FBS+hUH;FJF)F .;I"8FN(# `#6I"8FB # `獱(hF `hh``hh`+#`x(H:FIF@F FO0 E(F*FQFFjh+3`c (F`` h++Kh-ѣh;hH+8` K M4#5%J5+525:5H%4D%4h;`+ڊiB ( hZ `ppGY-O\ I"& F& (@O3`"F`;F (FIh  0 x+Й0H)FR$6, 7 F \ h.3x+;!0FF(xIIwI FI(TuI FItHsH*F!FO ##p0+.w5x-w/!0FBF^+^eIFucKf++@,Z#x+Y[I FO-+x3TI(F#FO (F@!F~@KKk`F:!HFn$FXK'F#FO #F(H%F4F#;+(F5F4F,FFF.Jh0*!F|0 kObFXF  ` "0 0KhHIF*F06#F `"`+5i5m5~555554P%5%4%g5X%+:FHF5(к UPFJ,T$-+x+𰀸Ob!FVIOb,)FOb& dObNI 0 FxLJ#E0XhGMOb+`]DI F`QF @w?Kh$ "!?B(xHA(86MtN:F>g0*M FRN*$+=&BL-Fs8Kh39K"F=I5hx8F:I9v0Kh31K"F7I5hh5I2F8F)'M* hL! h0` AKh+K%Hh$N #h$$0h5,J2h7F(`MF(@ !FhO5FFFO ,F ZyУ%4h%K&%9̣%<7Y7A:V:j:::p< %80 "(`!F8x3J3h20Y5O4O%FFFO FJ [FhxO O4^F%FFFF O H.@{@{? Hu+? O5FFF&F IXF05 "FJ)5x+к6aXF(SEaXF(x*+Cx/*ZxX6**036x+kJ2C~iH9 "FP 99x-*0 "F@ FvBy p9 "YF, F c0taXFPuFC } y { ~ \(?/O3}x+(u|:!aXFu(*FaXFiرaXFc `aXFX0`"3"qXFG"I6BF(?$HXF$qXF0(+/+?.bH1Fr*د#@ոИ0 H: 4p< <:K&K&:;W<;J2CHJ2+ݘH@1KBhKMAAFO!KBFIhL#M@FGKBFIh>H0FH^@FHZ;hx|+|! ~a8h0h+++9h"1 xK)drKwHh ??qI `H`SEB%mHʻ%lI"++3%iH%hIhK)hI :gI 5UK2cJhBPK G^Kh(7а?O0oO`FL UK SKh3Ow O3O0",U؀*.8FHO0&##"1F` (2h 2BF:Hh"+, "##`K4H "Ӹ00`0hx +;+#FF+ *)NL6  `,10C0+?J" KKh+?FK)s7HJhBOpABK h)?K# h~ E+)?KB':#??\!F(F:#b`#)+G+%)F0 )K:h-IF F K#*s (KQ) K  J!L2BBAh h h h |K&=%k=l%%%@B%v%x=4x =K&K&h))+2$K%"hhB3MZRW>BA?(#(GX#($#$GQ#$&#&GJ#&'#'GC#'! m+)h+G#h+ hG/##`~x%s" F"IFb( I" F\@#FF FpI FFXI" FF(I2#F 6MHX Fp@yh++x+I" F&F(#525=+5=S8#!2Hx鈱0Kh++p!F3(I 'I 'MB Kh+3!F:!R#\(KBh "`!NR#\4hdI F48#x|+ FGr#3`+¿33%4%9v%%x%<-AFFGI "F F3h8F#3YF(D4>m5`K&""Kh `Jh3``@%x% "Kh `KhSK"IhC Hh3`Ch0!6`@%0%%>x%h KhSK"IhC H 13 1Ch0!`0%%>x% K"`WKhSK"IhC| H! J131#@;`@%0%%>x%L%KF "`% Id" Kh0YFFF FH!@%>%y%K $`J#`J`Khxr+s+I F Id"lId"Kh0YFF H!n Id"@%L%x%K&U>F>w>%y%O>FF0$@XV0Y@<# ?`YcXBXA@*JOsGF 1Aq1BFIF h+h#+D\T #BpF =FfT#  #K# # @B%%-O,MM$I ,` AIF s4FK" (FF`Kh(< ]K h (F8юKh+5. ьJhCыM )h(hDEKhB %%GICN1 0hp0hIF @#`QF  -#3Kh+ 5./0Jh*@3JhZ//3/K0Ih@(F/*Jkh20ZH0 !h3`$,R,DKh*@+ d$$/d,(-d$/@-->K"`35x%ʹ-`K&У%%h%ԣ%% %>%>xK&`B&> %/,@Jkh20[ -$Op 'C..FE8[)-4JB[$$+h+Ů.Kh+? G1.O)K"`IF QF *h@BB IL#hkKE йٹй? G 1kKE кٺк? G0$/$R,?`K&x%ʹ?%?-OPLlM"F#FC jC C # K x 2 ;Fn (bhGFxHAFwKO2` lM;h 4OrYi Ft@7='<OF0+ѕ , <  # !1'@C`F%Kh%JhO2`[F'"H!!K*`F( 0;#097+ѬKJIhR0+?߭ѻ ?":`%A%OAģ%nAA%Ah%ȣ%A% % @4%%RKFRLh h/1F@@:F!BFP@! h0H#h9FDO#0LBKh+ؿ<#Aq!! <  t#9s Ozs"!"rmC \h+Xh#+'HP&H hO3 #`4!K(6 hAF 6h+2h#+H h*F!8F'`j0Н90+ #"!#8F h1F\%t%MbУ%ABx%'B-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?Kh>C&\B&XB&C&4%%`K&pK&x%"CK&0Cy%B%%%*C-H((F#h+(F#h+~ K1; HHKO2`*Cx%PC`K&-AI" h F JHI Jd` Jh JhRKh5:+x-+ +ЇKIhK]QhKhKhB:#O3!}K}HbF(2{L#h[zKO2`3@3@uL h(^O3#`+@ +@bK `kK ZK w eI dI SLtQ&(8_K OK`(TH!F(@ڀTKdVBOA8a(@CKh)Y9)` G`#2F#FRx|+! Vq^0F> +vP1FHl'K`6Kq P/K C ؉(pCOK%Ih@K0# 2F#F):H/ ؉%%K&>K&l%h%%%CC&C&?y%%`K&t%K&=P x CCKL#`((USFH(⮙K"`>  KO4h+@AK`HK0=JhBЋK4 E]Kh(bа?O0oO`L0 :4 O03! kyKh+DxKhxK[h+wKhwKh+9vLvO AF .@E#BAp  0~-@ Zt `cH0 [+h`FO0F;+ A ؉ JKJ ىSKh0=4-(!KH # G# $ F S?K#*s (h +s5K 9h# ?8h#Cs##r [?|23B2 0F)0?m X?h23B2DI#BAK hTK# hK&>*CB&%`K&Cȉ%ܣ%|K&l%K&%C&%%C%HdM(h(,` # \# KO2`^ Ft As +?} Gx >xCt%`K&ǰJ IhU# FJA `J g KL KhKh@ +DхKh+]O2#Jh;#~H!j(W|L#h+O{KO2`3@ƒ3@ÃvL h(fO3#`+@ +@fK`eK``K $hKh+,Mk x-+ +bKbIhN^K _IhF+  G WI VI MK SI(R x|+N !(g /!Fh+ h + DH`| ##p Bı ! /##p(;Khsh + ^5H5Hxh + Oqp( /H+Kh+-Kh)Y+(<H!F(@+`+j HknKh+о %>K&%K&l%d%%%y%%`K&t%h%%CuC=CHBpK&FBDBDC&CJhB!|~K@}KhB?ۮ3!zxK#RvH(Ȯx+!pH(nLp kH!(ecKO2`gK#*s jM+@ tQ(u\KM \K`\K` C ؉0 "pCOQJ#`PJ`PK8=OJhBLK< EJKh(rа?O0oO`BL8 < O0y%% l%d%ȉ%%|K&%C&CCx  JF ؉ L ىKh8=<-(fh +]љK  # G# p +@,K#+)?{C@-Kh+?sKBn!k???a!8# ##0PuK hrI*FF F@oH( mH[kO2C&$ "#B&F JB? (4F# Bv#"#(QOm43 $ FS0U19h# @8h#hAs###BA2 3B2 (F+  0-; Z `h +B%K [ `l [DJ13A1` AF ,N ,-LI#BA K h K# h HNȉ%%%d%x %D%D:DK&%ML/a(h)hc` I Kh+?:  8 7 +?A G< <%>%pGKHh%D81KO2` L" hF( HKO2 @`6 2`K&%DFIFF FdiE)F"ܸ8FL hF F8)FEG(45  L hH H I 0 `hOaKH*FH%3G:G-G % LP H I v0hOaKH*FH%[GcGZG%F H! FFhαF,FEмB20!FF"*Կ8FO05 -GFFH8I@FF0,eG,^1N1K2M )FF(hH F! FG 8 z+F F5WPFCF ISFBF~<,ISFBFhn F "PF0h0FGBh I "\G%G5 GGG0?L8x!*$*(b*7FxF2 ) ))X(*2F!x"-92 -?%[(88+=+? "((xK!*F0"8("("8(\-]x33x-"-![3[!3[F#8#8%t< 8LK (8 K8#8`$8jFF $838%P%P%ML(8{ShqxF#FICICH#OB:(ڂ0)$8+ 8hhrCF 6H(8Kh;`+ Z hZ ` "p)H'HCz3,8#H)h "#0F08 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI bI ^p %HP%P 'HH @2NF-O#CS@3E cJDTE+UKV-vx۵sXK)nVJ2F pEq caA (F1FA0 Oaa! p {Z(FOaaF(F AJ8Fqdqx5JSFZD #HO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`xI`hw4K&|< MK& FOF9FD.!0FvF!FD{Fp9F0F*F|]d F$$K&-OFLFF#x{I FMhf`h+ЁH!F m@+>.!#1&(+0.vK(F 8+p +VCT (lKhFF(&F;+N!SvG68YHC ++3hn_!QI(иPIбknD!F( HHGH hn.O0}A(0+8HknBf(3H3H~G(0+&H+Kh[hnBhZ`x ( (hnCh;C`+xD K HhP ()KHh"OQCT xTIhnCh;C`+,RAI+ KHh籟%MK&MM`B&MMN7N%%hNN % N%hZ`x h 3@ B""p ( ɱJ$pri2`hnBh:B`*BѪhQ`x!J`"qhKBKHhthnCh;C`+"C p (0~ B 30@hY`x Z< O#p4IHF % %%OK&NKhF;sI FCxI" F hK"`320[K"Z`I FCK"`I FC K"a I FCv(K"Za UOZOdB&_OkOpOh;`+ڊiBò +c hZ `ppG?K@Nh5hO33`=H(6ѕ;I0h O33`#+` +hN3hc!C&0hd#3`#+` K `V$I"F V`4%%t%xK&0P-OFgJMfKFfLFhheJhr4 (*#4{4+F3ph(F4 M$*@RKOb(Fhr(DO0FgFHH(dGH !J#pCH.!B#p@H&(2>I"&K"-A`KMhp.hO30HL($H !DxCx"+0!F"@<x bE#Tp.`"+Cx"+020;##pT:&ȣ%`K&RX:& %h%p @BFFhFhFIF  p E F)F(H!FX +x/+0F1FFF(F((]/(а@ RR-O$hF%FB.K4$hB"!FxFh1F0DpoO CCFE? O ;hS%5B8F&  DE;hX3FrhBE /  FlFB3 #K&%jF KIhhC$0 н0+P#J``P#%ht@K&(FIH*I hKhD` hKhD `h+ JhBĿ` h+JhBݛ生%%DR%%Jxh320[ "x RxJ3h20b; * +  O0]@p  7FL#h+#AOq#F0!hH,L#h+#AOq#F(F0!hH0@0ܣ%nR%R-C&\5FO\] GBҞB#;p",, <) Ԝ@BDU85\,ѮE5-O;FF$x %)УE#F"TcF9U FVx c.L3/.-.G%.2Bc%!B٣pM.wKh+ۀvKvJh+F0Z#F)m..)ИBT3m.n.gKh+hKh:0#F)ИBT3]M+hS`H..Ac.?F=1#F[Kh3+h+WH/+10eF  +ђ0  FO 01*0;  #;)FB F/+ FF!+x/+хB5*ݼШB^..0фB@c`B9pB44TB-c/!B% *O<p݃B9"B p#+!pB >"\TmB02 pBT3/* K(JB3Bc`#F4%`B&RP:&RT:&X:& pGFFFF1F8FFꐹ ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ H ( K#`o#`3hZ2`x +0RRP R-CF!OFF8FCsFBFH oIBFaB #H9D;U$BK  J K(hhhhB+`  2`P%RRP S(%,%%-Ol FFF & #cQF@CHFPI@BBI2F(F>~Kh+6Й FqhBi.F2i Fi|0%#! bh1@C1ii0jI `@B a`fHO0 l "! FBF^I+FH@! F0XH*Fv`#$0<`0+ ( !XFb !Aq !RFIF F0jh$+9 iO 0+;!HF@  t#9s Ozs""r!8FCE\h+Xh#++PhA+?u"H*FO2";FAOq F0;.* #2F! Fh0 I+F{U C(<#`S%!S4SfSSSУ%Mb8F F{)F F8@ûٻpFFch;c`+ FDCFѣZh+ѣ#`h#+h3`(Fp#hZ"`xF FF!F8FCFѣZh+ѣ#`h#+h3`(Fp FF I FFhI F#x 0FpH)FJ SSSFB I"F NSBI B T F|0I"F 44TI I $UT{T𵛰#FFF03 FKhB#HB#H(F(򌀊LN/lЊKh8FJF(FFD4 F|"F9FF(I"F0F"F)F0FBy7FzH9F(F@ԀvHF F| F!F F<mHF(F!F(F.,@eH~F FW F!F F x+T[H@#h*F0h+@XI#WHP"(7SKoq0hYPKO2`%B #< F!F FB#< F!F FB(F;I h>7HjF(F!F(F,/K`/Kh4.KO2.M`D-KhB)F+Hr5*IOB)HP(Khh'Kh.%J#p%J`%4,f)H"(%TT%%p%TTTTTUTP T`K&T UP:&%4% %%UUP%(%,%X:&T:&78C.h+(h#+$hO2(o Kh0IF F|<#`bMb%UУ%ShFFF{O`A~``0 #`#bOc`jj%B1bhp3" #FFXjj+%i&0F#ibhY!aTh%iB m`h5)FA/(0 +h0FahBD5*F#sUh+D`FFFF1F8FFjK,o#bK#` K#`O08FC\ *F"T,##`>B" +FF0 + K#`#obVV"VpG!x!HlP&K!Z0K<13H1hGpGlP&? NVK-A°h#KhCKh,@ BI BI >~Hl! 6! 2yHTwJ1 wHwI !<hGqKrLh!hٹ FjMA,ƀlFx@+7kN#hx#bK1hG+jeH(F(4 h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`QNQL0h<F(o1h:wnF3hHIx3h@x +(FRWe33`3hZ2`"p(HnF3h9Ix3h8x +(F24HF33`0hkFhx:hx,*hx *x"#QpN!J1h[hG(F h2` FK!FFh+3<*FOq8F((FBH[&L\&t\&AlP&VaV? d\&< h\&|V[&NVVVV,Z&kVK! `,]& IK"`$]&!KH`b(]&tQ& Kn:f*oB (КmQeppGI7P -CFM O"(hl1+`&O  "(h 0s FF H>I"(h,Z&? VtR&$]&&H! ! 0CF3И`BH! ! |F v!F rK/!LA F`A" F I Hx I !FIHnI WW? WW&WK"sLXhI1N[P+x;(FR)FFphI"phK "h0n+H p\&? 1W\&3W\&5W HP"iF Khs K\A F(H!FHlFGWW&? MWaWF K!h FdH!FHN  \&dWiW K|Al#x[ FK!FFhj ? ,Z& K7FLA/! FHAJ# F+F0!F? rWF pFx# + + `F+FK , ,њB10 kx pSFB-CFMFF  *hjhFh!FH$F Z -,K1 (?p F FF I<1 "K"IXh J! 0+џh* "" @BѐJf HcH\&W[&\&\&,Z&? WW&X\&X&#XW,]&$]&p°9HOr(F(@6K"6IXhN! ! 1J! F/K0I"hv%,H&F+K<1C $(Ha'K""IXh %J! ! ^! ZBp FFF$(݅BK!h )F >)F :H&(FW\&W[&\&\&W? LX\&X&,Z&:Xp°;HOrF(@8K"8IXh! ! 3J! F81K2I"h%.H&F -K<1C *Haq)K"$IXh'J! ! ! Bp FrFF(݅BL)F h|! hx T)F )F H(FW\&W[&\&\&W? LX\&X&,Z&:X0MF(hI FI hBbCc `!(hJ! 0"b#c,Z&VXX&0 MF(h I FjHC3(h!~ 0#3,Z&VX7HOriF(a4LhFbcy#cq0K"0IXh1 #10D#00#01 1 #11KHk1#!1K`1# 12 #2 23Ht@HHYX? \&`XVX$\&bX"LI h ~ hI"@,Z&{t zt F,!@ 8F F 8)Fg( pmJM `y h h mpB(p#hOa>F:K(hLA8K,Fz xhh hhr n#0J!F F HC +H\X R$IObFH0FB3x3`3 +IH ,HIHBoIK`!Dx *#CpHwB8V? fXrWXuR& XXXXtQ&IHP"KHBOr@!L( ` IH@@ HOriF0 HP@KhF!hkx\&X0]&XW? 0P"MI HLHQ(H M0@(55Or@!dH M0@ JOa5hF~ J)FhF) M0\&XtQ&XXY&Y89P"IHFй HI(8@ I Hs M"FlVl1+Kh8@}8\&X(Y*Y? ,Z&pP"m I!H MHQkF(H mp@"+kIFRF8H1F mp@(J5l!jJOahF IjF F mp J\&`$$O4O5 3IS"PF -J`,K,I Z*I V(I R&I N;h%J !%Hv#H(O"I0Kh\&Z&= k^ [&^ [']]]]]]]][&]^|\&^$\&L^L\&0Z&^+^V&^V&(I"(K2``p0&I&H!5-"H#Hb c\B\A#J1#<1K Blh#13h8hMh:h IfHK$[h[ \I 3h#8h3( L\&0Z&^ ]]? $\&^]V&^H!@V&6I s(2H#`1Khk p-Kh+P 0h &Kx+ !!V#K`"L h(HK"`Kh+!~F h+hO3#`KxCC L! hf I h"! O0&V&[&0Z&,Z&8_ t -AF`M.h.s@^HF]I \H[J x/)@=XI"F>i;UODW)@RO;hCQI:F>P0OS;`NJNI>FMO0JJOc`;h+II:"=1& >` *aCI"F RAKP``@N3h+)2h?K`">K`>K`"6K`1Kh*-1KOb`5Khk`+h3+`lhT,! F#;-Kh`` F#x/+! F4`H(к{7 OR`"H!F HHX+h+q>m.8Kh`KhI"FW&;_@_R_> ? Z&_P\&_L\&__Y_|\&h\&T\&[&e_u__[&_tI:"=sNsK8 `3hsqKh)ր8h0"@ 0`jK:"jI`=ghK" gI:"=]cK"l!cI:"=S^K"``I:"=JZK"`\I:"=AUK"!XI:"=7PK",!TI:"=-KK"/I0+J#`-J>,I0)J#`*J>0'J #` 0`[&$\&h\&T\&`? ` ` ```````"`%`0Z&(`8\&? D\&? H\&+`@\&.`4\&1`<\&4`0\&7`:`,\&=`(\&rIFFHKH"F% d` JhI W&t HCh;C`+C hZ`xK[h+ ##@P W&L! %H` )FW&`J! X&J! X&0)MF (I#`h! d!H!FN hLDch;c`+ FB"p @ < KhXBXA0#hZ"`x (pB3 W&,`P 9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+$Y&`( K @0^"ed""f"HpG(? "de"W&$Z&8FHLM <8 <Kh2ùlFH  <T< "*"FHz 4`= ? W&``0 MFl!F|!F|#SC@rp"CCI 2C32""b"$ !b#sCcl!~ 0#cW&? pMkh FB (h+ H>#x+Dq2;p@HpW&``KsnM0HKhƲF*xZ Bl "Bjxԝ$F Hh0FG Fp) 5? < W&`F+O,MA #xc?(0F\F#I F#k` I F#k`FPI F@I F0I F8I"FHH#!FN$M+4,B+! F!#!? W&`````a |> 1Z&K1#Kh ? 8]&"KIXhKI"h@;\&\&\&ð#O ")F8h&F+x +M##p1㹴B!#1y#0K "XhCB*8h")F;Kh( I0Fh K`n#y#0#1\&? \&8]&aJ 0[ `pG? -H!M XO! WI hTI ;h#`#0`##O2! F(GN"8h1F(3xS+W+B+Ob)F O@ &6IPh+  *Kh++F!!E&NZF)F 1+0+ж qZF!(Fx @+o(H  Eٛ ^+h;`+ hZ `piB (fF\&0\&W&? ,Z&8]&8F L hF F8)F((Рh )F (4?  #KCBA@  F F@y! H@ 'y;+&!0h&)F0FP0F?*(F^`H#y#P#qcyCcqhB`+x !;#B`+x"{a b-AFBL%hk!+@OO #h"+%`7h8F3y;D%`+O4NGNNNX;n;;f+:oBۻmZe-I 0{(I5%` n; f+ oB ۋmZe!"p1h!H@X1! H9F6h#h3#`2FX#h)FD#`h9FH5%` #h"+#H#`AW H9Fh#h3#`(D<]&P bbb&bpFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,(bF7I(9 ! FF6=! FF(8#p FF(Ny5[!(FtF8Fn4F`y! F4#h+L#h+H##`LI F(FF)F?! Fpp F]F@y!oh(F#x!+ ` FK!F!FHD3b<]&&b? 7b>bpm$L%F h\1Oa!JhFd IhFFPN"F@1hF Fu0#u0 mp#y՜`#y4BT<hD<3h HiF !hFD#phF8? Ub_bZ&abpF FFy[ FF(F pI0F FXF!F 7b7$MI"(h| I(hI"(hI(h"<H F0(*I(h("0!HX HO!( HK!( ,Z&cf@xt yt c@]&0!I$ vK,3CLF0 f 0KjK "hL FPPjB +! D]4B8@]&? ,Z&H!H,0@ d@]&"%L&I h #I" h ! h{?@ ! h{I" hH}0(3(HH I hI h" h!{I" h h,Z&xt yt (d.d1dHdf@dpFF(gHO0> (P ' TFFC O3>FF=FF o    ,𭁻@ 2*WpO O O O O O "F2 @? mHCO5F ( DOX GwTй#_H:O x*"+w#WH)>~>{"'(FQFOHNK"`O5F"3FF < m6O #e x*О*AH32&Y FO0> FmHlMP 'C 3F! eI " Os'8#o h    m\FHp0F>H(FIF4`H ùO2 QF,5H/8FQF mn UIy F !k(*H- !k(1F  2C #ЂBH+FO2 m~HJ+O10FC#;C# "1F(H4HzdA ffffg-CFHFF 0DH#&o` FO3??e" F ??4H$&F8C0H;F.HBFFrH;CLG@@p@BgGG/9!KBv+&C4Oc!FXCEzs!J kD I, ,."H,H)FC4F@d@pDtv K#gEg_gngug {gA -AF( (H%(F*A>o$pCO &,$ F>TFHK[h;K2F8F#%oFBF(&FAF2F8FA6DѣZ H+ HJ8F!*Fggl^&ggg-OFx]-+@xKh# ]Ov!F ]l,FO 9F F@`0#!Zh+ F FXD0>FHb!F2FL  DLFH)F[IhpCO~H!Fe>xOOh@Z)F FF !FtHr%P)F0FD0F0h+(F*0H Fh0B_г_г@O ! F H!FzH!FA hhP DhiiFF+ * *pGF \,\&FRa/٤A/  A, 3B0O0KOh`Z`I KhK Kh3 K"`a x  F^&К&l&W H! ) sj>38Fn!D)FFzB F8Jh3`pG^&8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F*!0I"F`shu`+`hh!F hp-hFJ@!hFhFB ^&jjF@Kh# F@)O0^&8F F@Kh+)F F8@A8^&FFF1F(` +`#` 1F8F `(H1F `KjjFs(x08 Kh+ F@^&pF-J+x+G$I(Fh(!n0J1F(F^pj0FM FkhB F!L!l` 0B KhB!pG^&K!i Xii^&-A F xFx9 KF!a F M' J)j/`^J F)j/`^+hCE4F^&H-AFgNsjB$b(("#b #!wb kc<#cznot=؆(h)K(b!(X2(YН0b03c0sc#s#xC#$0#0 0"0n(5K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo$K "_!K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕI^&'T&7 (IjF'LH%'H(1Х b0P+#b HH"(#jK b`#j+ܿ##bűfH0(nfn+ܿP#f0H( Hf H(ht@^&jjB jjjj(&Ll(D8(A #&)@@@@@@@6((O0HHHHHHHHH(#ml0HH(# # ^&jjjjjjjjjD_&j-AHNOkL@ 8`HC#`K(FF_z(H#`w#` vHmHhHcH^ aHZHUH(#FF8K"`KH)FxKp)FHN)F(F3F<)F(F3F<)F V)F(F<g(Fh>Eli $ #S``<0hB#+bNki  (i8h,@O3a<K!F<`h@\l&^&Kh@@ipGl&0F hDHh8#hBC!B 0ZrR@hBQT20BS -CF-M$w?+)KBKb+B..+A0; + "##OO  H!  sBH!  jK;+#c+$3x0;2 c($$Kl&m&m'mpFFxM)h! FhlhM)hY6H1F  % 5 F@hvkh "` p 5B lC ?mFFFFرK1A?+x2*+!kxcxSn!(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##l& I<~HyFH H H H ,@KH!4!!8!!!TmUmm&$m&0m&FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`pl&KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF l&F I I Fx I FPKh+ FI@ `m&Xm&lD &tD F I I Fx I FPKh+ FI@һ `m&Pm&|D &tD J Կò\pGl&(7FIHx H0(@F0ӲHJ !*H#FT!p ! FF H#FX!KOq$8!Fpnm&"nl&FIm( FI@fHm&D @DcB ѡ"c+ !@%cXBXApG pG pG*-A FF FFF<`@0FwF(Fȹ(F;F0FO1 J)F((F( $$$m&FHFHI*FFK"0F FxHsI*FF*F0F I@I*FF8F;, Frrrrr8FHKFhpI FF阱 I F@p F8@ý(F8@ (8rrr-O F F  FF8)F(!pCO0I FTF F;J(2FOa(Fh8)I"(FF(F0Fl F+* * *# pI(F@I(F0I(F +x"+/t#h+ ;#`2FOa(F0(+F 9FHFGm+*F! OTF O\FFF s ss's.sdT xT (Hÿu&sFhF(F!* F"h#R3FF(FppF F&h "ap#i#I(F&a$h4s FFO1JFh+FF h:m&L (8B8#D8 HiF+2 8 8Tm&u&pFF F):hBAhhK`hB%`J2M+iKJ`h(ah(hkjӱJ`hahhip@{3BJ`h2FIp@*pdT s's4sK"8p ((((O2KbpGm&dT K"( ((O2KbpGm&dT -CF|O N'#x:F!FB0# (FD ((D( (F#)FHF((F(#m&m&7% L FdDx(F0"F!5m&FLXN8xJ8x8B&hF 82h;DB8 8;D 8hF+8 m&@_&𵇰)L#38B=B+8 (+DBO&8#D;h[scڢBh(0F8 8[ 8+2 "[Dm&@_&%LN8#Dx3h[sczx8HG F>pD+m&@_&sL8xhFK (h2DBF(F8 83D 8 )8xSp;B8[x+hF+ 8m&@_&pLXB"8^]k. KO2b 8B x@ p 0Fm&dT K8x#@m&8 L#x%X8O2pKb 8 m&dT pFM F(F@sB p(+BB KO2bh@ xU;;;m&dT 7F% x0!*F F ( K$ `pGm&-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@F`Pch@F0; F;LFh1FN(#h`&FF"FF%pGL$XKjB"!F$8"am&dT K-OƲhLF{'(hh.M#8H9FO*( *O(h088x#8+#+(F'8F+08Y#DB0(h(('#8(/$0 B1I IA(Fp(F(C+sz"<(oWc1Fe(#48v#48#48k#488x8x +#488B< + 8Bm< +?h?<#488U#488x+?M#48E#48O#48O"#482#488B< +8B"< +8B< + #48#488x + 8x +8x#8$#48 m&m&u&dT (pP/x?(p5 .FE :FHIF(POkHIFwrH8x+?48(@8 ;#88x0F5ѠEMmKEF7EF@+; +p; +R#       Q +R#       7+E+Z/+ѫiF#+b)ip@Thq`p@ #x%F4++ ++L h:+x #`(F[ `Ax"+ixp@x"+i@xKh+|p@ \x!+hj: FhbKh+ohjIp@ʺKh+b  I Kh.YF(1FHp@.u&^&^&ssspFKFFX`\0F)F Fp@Թu&/#NMis`@4@F?(Fj(F H, , K!F`@HHu&ssv&ss0*LhG7#c`Vh%HbhY#H\h!HVh[HPhHJhHD%hAJ+F!45-ѣh H+K"`0L##L H Hu&ssssssssv&ss!Kh@T KXhi8 pGu&COppGKiFH;]h s!F KhD```u&K𵑰hd#xS%oF;.FG%B W&>#x5 k&!F J#`hD` `Fhu&DF F-G#-Le&O`Kh3s[;`O ch 0 C KhO0J&#hOHod ( NP_ԁKh& 0kcPLwKh0 k+J vkHB80+e.-F0+e.@ch+s/+F+N++D&(@-y-@k+7666666666g666 F EH9К0KO`: PFK7+i+$ -@>,0 +@9.-6!(Fd(e(F+Hch #c`ch+(F(À((#Fi.@chi+*0FI#"(F#jcHi3@_-##b>u&^&^&^&^&st4v&uD&|&v&+-@-&!- j+| - Y -W=-U(FL(|--)##CaIp)#@a(@\(?_xa;+##a b"x(?Ei#a+ 8U3+?4'0 %(?(rHe&>#b}i#@+$УikJR(F(#j+(F b0(F_Ha+##a j( j#FF/ OShX@x`_*-9@-E!-o -?(F(ch+f+ƮDKh+?F(?>N+x+Z :Kh 3Kh+#7*#C`Os,Kh+ch7+Occh7+##%J#!01+ 8#@ch7+OCOs~#;+?^)(YJ1H")F @ (ИhFP0f ts8t&T B ^&Nt>c+R# Is!ӊi݋?CoMA5)CyY##Ցo5+w%ϐًŌs)'55I#" e&2+rJ`#*sZKh "! i2+rJ`#*s8q"! i#*s#"#_Kh+ #*s "#*s"##C"?K"Fh8~K"Fh#*s#"#'uKh+*#*s$ m#*s"## "!#*s_Kh+"!j\Kh B F 2+r;`PKh+ )"8hFG2+r;`"8hFU t rd?#=N*s#"##3`'2*  #ck ie+rd;Ck+d"##{(q 9p(qb) F Kh^?٬LnHDbtL&0&&H&dtKh+ Z"l K`blK`lK`[(?xBKhC`#*sج"##KhCB`h`#*s"##!i 9nhCsh&LCC`#*s"##!i `Lh&s#CsFPBPA r=8eKhHh`dK"dh`cKbdh`dz%bKh+@R`J `IhW]Kh+@H QN0hXIlFWH0h>UHIFTJ#TI h hPKh!v KH!(s "##q(?ӫLH0i#:H*s9K9K 7H!(s "##Z(?#,H*s'K'K(s "## oF(EF H(s "## yFFHl^&x&&&̚&gt^&T ~tsttT s^&ttssuu$u0u0F(7 ???.Kh'((s "##(?H!?Kh0Fk  0F0Ff#&abF(?1F#aR#wIF uKhSuJuHh_.F0F qH!ɺŪmIF F( -e& % -??.O1(F!qb#^IF> F( - -?(FK#TIF nhFs( - -?|(FuAKh+FIF% QKFV(d - -.%(FF(X4J% :I(Ph.%#6IFw1+q3J`3HhBOvv&F`-K"`0h+߿*Khs[12+r J` I hD `h+߿Khs[2K"`|K`Kh+?#cH&@u^&s^&T stMuXueuqusyu,&x&v&@_&x&Kh0pGm&FF #O2B@# 3-OFFFFhD,FW E[լB< +4##pd@F>2F!F(B'J;hB Y)(*B8FHFFBFIF(FQHF9HF9hFIF`[K# m&-OF'ѽHtE0 *5"pF*xc*"pB#ҕ0+;+hx]DFhTENF>/#F*+N%F{upF FFR ! 98+hD`4D(``` pO0-MFOO O $ò0 *;p&  `Sh T4O07F e 00;+ (ݝ0;+ A-@,A, Kh+ C B Kh+ B C 0m+KhB# $K"`&^&v&F' d 4F<`E$hxxBD-XXx](g(B 5`@(. @,A,,e !Kh+ C B Kh+ B C K!h;B# K"`D(ѽ@ _Xxg(F;+xF0-((H30d(f(i &^&v&L h`hhh@Dv& FFH0ѽ@!HDv&u FFH0ѽ@!HHv&uUK-GFh/@9F(FqF(FO78F!9F("#(F?? F9 2F!F(FF(FOsCEE F9S #xCcxM+ѣx++xG+ <<+1F Fu@ hcFh h h'F(F h!H##`K  0^&v&KhSL h8; h@&^&L h! h^&O1pG+Cѽ@0F) F (6!Kh HGa(D(O(A(H!d( o(Oq FK`Kh+0 ! FM#"(`#??(hO3+`H^&/wmwA w-OF(0B"x0F:0F " HF(HFKHFe 1@FN/F@FoF`@FO3sF(@%F&I F@I F F %F=FI F|( &&Kh+g(db(`ЃH  (%F K&iyI(FX O3&sI(FN O3&(FFqH8CF9F F (F ( F`Kh@F&L(]H9 Y(FtLKHF9F@F'FIIFHK1F"`EK`EKhBSCN"CKh3h 5I(Fh (FX@3K 7Kh(sO@[3h#kyw/KI F"`I F` Fw(K"FFh (F8$Kh L F8 KhHFQF ??FFd0s7^&wwwP&#xv&vw^&^&&Ě&^&^&^&x&T &D&^&W F FбF.XDHZEF, *F I" 0:!LJE!FHxW @,KhF^&Ki0H! 5@H࿘v&Mxw-AFO FF.@F=F\ @F(ѽ;hѠFD&KF"h^&@K" `@^&KFO2h^&K" `^&8F$ F~F@>B F8@ 8pF; FjF FrF Fh.ep@ "!0F(pO2!(F|(FFF FA F1Fj F8(FY0F8B 8F -GF!F$'FFhF!FhFEF8G0F %FF)F/F@F8ZF('FPF8J M8F)h@+hB0F Fk8FG^&KhF @ F@U^&F xpG%*Zx%*33s*0@0pG8M(h0L(`8 F,`v&x-G!Fd /Od O FFsh;s`+ 0F (F'#8F#p3hZ2`x - 2BOI !HF9FFuV8FGF8@Ft[CL,*4i( Fx-AFZ!DK"xxBFI4F#x##8F3p xBcxB44;>FF4F#x+5*FAF F,D;;T T -OF8$F%FF,K,JF,K8F!(FF=!K)F!JxsKx Fx5BxBDKJ(5D$O 9F (FIFt5D0;//pF FT T x-AFHF FF0I FA8FXF(F!D4 F ;F!FF(F8 0FF0F8 Fxxx-AFFF %(Fx+ZF0FV!D4 F8F( JCF!F:V/!(F"((F8JxFH3!F"@x-AGF=F$?s!`FF?(F#p#+%+ѮB,B4jxB%+ Kh(D#+%+ѾB,B;zxB%+ Jh(F Ft FD^&^&-GİF D$"#(F??Or(F1F(pl5>`8hB,Կ  0K)()F8F4*F!8F0+F F8*F9F0FPF.(4m&T&-C?:KhF+a7Mx+(F9F(U TFq(FHFFF FBD}>7!0F$K1Fx!KxKFF6@F8o_+F8F_8DݹI"F8F_F8F8W^0FYF0F+x[(F8J F*F F,F8=^&xT T .yFKh#! Fb3F!FJF(FgFp)FFF F4F88F8 (F8 F$^&4yF I`I F8I F@  x8yOymF iF F0 F m@hF mHK-OFhFF3EKhO0(BHsFбFxFF3|*-* F(F(F 9H!7I FZ($C F/F(FJFXFFQFD4 F*F[F!FFJXF7PFFPF7{-й *е@ "c F((F(O3H;`F FP H<`(FNF(F#x+ F7>$&^&gypyxOy*K-AFh F.IO0%HF(?(!H1FAs(FF FF8FF(FF0FDD4!D F5!F+F:FF0F7(F7@FF@F7, FA^&yyiF( p@CXBXA'] 0FL#hx(Fj!0)FFt>I Ft iF(F((FF F'0$hpCO(FD!*0)FFtI$P&W W F((#" F#&??@.BD0Kh;BBB G F)FO GoBB3 F)F0+B1&O qKhC@𵀿gF(ıFeԹ3ݹ q F)FƹcJ0hCbKhе??b_Jh*^^J^Ih h CX"` ZKh+j(WKh+VH F)F??F FѺ!F(!F(Kh+ !(" !OwLFMFt+K"`1KhX )K"O0`OM~[???&!Kh+D K FIh hC@sC) O1!)F F)FF F??O,^&h&(&^&v&T&&&W B y& l&&tw& KiS Kh( Kh+Kh8pG pGBppGv&l&&^&-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhCBOqu1 FO3"F+Fk&V"KhCѹF  F)F??F FѸOE7O0G|e F)F. }Fy ^&&&tw&(&-OFFFp.  X FOo??F F>!KhùOܼK h9(#"F@F+FFLO F F (o??0$%FF F l&^&D&-AF FF??F F &AO0C*F#F8Fh8 MFF+hB(hBԿ  8??4^&K(FFhB pGW K(FFPhB pGW F @F޿8F(Mc+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8^&W v&KhpGv&-GFF,O=hFBh F(G0FFPFEPF70F%` F7B-8! F0F`0F#EEF=F#wa#a 3+h 5`\`ki,`3ca#hB J F%Fh3`(F-hZi2ZahW v&hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7nec8@kpG-OFFFgF$??#(F[FQFF0#!2F1@FIF;FF ,-O FF ?? O4%F F)F Kh+rѲK FIh hCEs) O1!)F F)FF F F)F(ѤN'FF3hB (Lr8FIF>FW8FIFFBx>\DF (e 8 K 0O4%F0 .q@eF&.F F +HЀKGE{KhCў?i uKho2FCFF6H nJh к  6H ( (O hx .O (з6FeuE WKhCBO aMPF"+ !8FIF( FKhk\E FF8FIFAKh+??7L ( (0 O~| .O  B0Fanұj$L#ḫy (0[#KO"`F FO JHaux . .,=F FQ ( ( (I (-F FOFk&tw& l&D&x&(&@&0&t&|&??  au7 Kh[ . . +F FF##hNT@&7F FpKh*Կ""#(F!F#)0"x&-OFF.x O33hKh+њKh@BOqx( FO32FCF KhCph(ыKhF , ,фL0h#h ( (0{L#h (R_CA(R O9EF# UF3?ybKh rgE (O;h;BTZx=* јO+ Zx=*јO- QF "FFEOIZx=*јKJKF!PF< ع+й- kiB!! =kiЙBolkiBԿ!!)dkiB̿!!ZQBQAkiY!dFFF; +7#+Ѣ +<\+# p0+?;   *r=!PFEF:,+*6  XF.0x(O!h7H@v&h ɵ˵͵صX !HFU@UPQ H H H HP8hT#iiC"Pi3v&w&w&w&w&w&-CF$ F0+3iFFF(F!F4ر#JOa *L(M  +hB! J??ЍBtJBA JOq$! 5 @Q5&&v&&A A `&(&KhKhKh+Kh3pG(&&`&&8 LeiiBcia0#`8#iS%0+hHY]5v&w&(F FF0@7Kh#FS(bO4 F1Kh (A(: F,N?i($$+2io@G;D)FR#?8iD3iS'D(F(гi (F'хBJhABJhBJhD$d(!F0F2iC;)FR#(СKhom&v&g&g&g&g&-OLgF FF0??t1+@O`D#C?? з??вBADg#1-𜀣ih+@O1FiPF+ÿC!i3#ȿQ#0)F#FrKh+{Ѹ@ O  1B8#??08g+HFFFE} 1B~ )r0F9FOG(QKh#(z1+#1F!O HD #C ZE  ?t ! "g6  "qO #h(F  a0KhDEu Fv0"!]60B$H {& ")Fv-H_02BuZF#aiBܣiN a0 1PB`1h" =h\T!iQ"2A#3v&T&&@_&w& &-AFKF FFh+ 8ȱ")Fg(p Kh0D(FKhDB T&v&@_&pFF%*F#FOHqp@-AF MF$x$1B  2F;F $4x&O?h/@# F!PT&Ki(!h,!pGv&K(!a,!`pGv&(FK8  v&(F HK!F8  v& ( ! ]#3` Ch F{)2Ѓh#\)   \B\A` h+JIBk$) 3`DI0+#C`O3` F( F0 pF FF!*F F#hBF0F(p-GFԢFLFF0P+ 01;0#10#0({1F(FA-JFO0F~ 01[h#0H jF(05}HN0q0 ` i)F0 1B xHd 1BFۣitNh0rN+D*FO1,B ([eH3`4050#01.gcKh*bKh):BF;FIF Gi+`iBhD @%i@8U 0BF;F GYJ)@ F \*h;hO1DFhBO1a!iFi2FQ (FS<*#h(#`#0;5F-u0Ihi hI\iB"iR#PZ_./ѫ%E'L#h+.@0+0F(0FBF;F !GO300 CEE .Kh+ Jh*@+>BF;FIF Pv&w&w&w&w&w&&&m&&T&_.hEF _(E0FjPihD]1FF($I0"h01+0݂B4A!FdJ)F (~<,yI;Q#B;8A} BF;FIF0F#h+PJF)F0F)dZ Ex&5-AFNLFFp . (#! . CKh+BJhC0+ #x0 " F0$+5M)h9:FCF0F(R Oa$1+ +0FCx8FAF+ $1Y#DB$aHKXH#I#0$C$1#0(+h+?w$tv&&&m&x&8%L0+P8(Fv&-GF@LFF8 (%#!J`8O8쐙0+2;h"h3DܠB߿ch#`ha;h"h;3DBOܙ&Kh;h"h3DB#" Fs"iFGV i#hZ;h3DB"IF UKh+Kh+Kh+ Kh+и"! ;O2! v&@_&&lg&pg&T&& & I0peCiB0T# poCD# 3v&KwYcpGv&K zKh+~ # `8#B ` F@BDRk `ZiDihP"`\v&4&K" " pGv&??-CFFO0F/F(AF`` -j0 0"U 0;`.4`0;BH(8a 0U4Fv&D&(-GFqFO0F8a($O@h<U (FW0Ah#D3`-0;+`ѹ? ,( 1h:D DhB@ h<Fv&D&-GF hFhFO D/0h3`+h+`"F!\FCF`"F@F4dO BFJFFPFF?FL#q1n8FFiqO2O3W(13v&-C NoCL$L'F5h3`F0BܬB5` ??07BF`@_&^&v&8 FCFO08 F0 (#xCH!F0qv " FFl(Z {CK 0Z KB hB Dh2[b20z&Kj+ KHh*J!`!`pG0z&`&Gv&L#j+3d+#b 1''b]ABvH9F3O30z&_K!F9 K JcbB  ! Zc3 pG 3C I hB2лBr ېEBE F)F-hB 8hbBA/O4%FiEBy"F+F0FIF# FF)F0F Fѱ??6I (iDEBx # FF)F0F Fѱ??>i $0z&D&-CFTF FuFF??.0BEF#p JCc`Kx8HxH& &08(H!bK"`pG^&(Kh pG&0L#h+ `&0 L#h+HiF#2##`&0 L#h+HiF###`&0 Khs Kh[p??ѽ@&^&(0 x J^+pKxp]KxiFH`h p()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhH&ܚ&07Oio(0Z09$?+2GK`0R++D+++BHiF0je *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piF̚&KhSKh+Kh(Կ  pG pGD&ܚ&&Kh(KJhhDpGL&^&&-AFxFFMHiF,F F!HDF0`&x0K\.cx;4F4k$./1F8F(#+p&x+ Ch*!J HhH]Bh*!HhJX&!# `](KiF*FQqIFHLH&(hS@ pG(h ЀipGHpGo( H Kl8 pGX&KliFH ]X&Fh FFox-+0''x0; +"(F!FO0 "1F(" ##`/@B-OFpNlȱh+ +Ci G#d @l"iF `FFx*\x-(^/$( (٠ ۲)F(+(#3eG#F F(#x++K2!`a F29($/(z$ 7 Fa O O F FF,S+KQH:n(0+Xx-(3+(@3% FMO@5!xF=*phOr@5HK3a O O -Hh;+ :&2U`ci!F G,o7[ 2-ѻ;#;#[xd F3x *iRF(x+"QF%X&^4&^&𵇰#@FFF(FgH-hZ aH=^Hor A-x* h;+)>ic-ci+-  G@-hpFh+`+f-Уh>K"`-&--"ih[ `2[ %`---"ih/;#`%;#[#%`2;#;#[+H!c-- -!+#i`H!OF+#iih #ih+H!#i!h3T#.?~2v& 8\FhFF'xF0; +#O F"x!F40:ײ / "+1`M#+`8F")F4O0+ܿ3 PC3KhKh(   pG&& H K"` L#x#i h`h!ciFG$4w&\ FHx FpGBЁh ;B$0\ -O$,M#FF'FF*xb+A#`O XFnh$5O 1hRF@F, A8(ټ- IEIE 0h7F^F#F@DBDAh O )vh# `+?h`\ H:((ĿK`lh  pGYKhXH|UK" "`"RKhBPKh oo F WHJ#DIhB `G #13BKhBKh+AKh:K1+2!.0 :J&0h"oO23KxB ,JohC`&K"`c+Jh**~J#`!KhFk,KhB,K"!J 1 13 1+ <h+?Z6h#+?TO4qon&&T&D&hz&&lh l&`h Ț&H!&hF]Fh2\F(F@F0F<!D4 FJ+F!FF@8F"F2N(I"FHH)&-CFGF"F;FND;F"F)De9F0F(FK FHEK"$Ĝ&d Р *K@Խ@ϻ @!JpF 4 F3 4i@)F F]p@ ǽKh $O`K)F FhEDHKh^ K44DhBp@޿"K`kĜ&&g&xh g&@_&v&J2m]37F F0)F F0@KxJ)F:F FN0`h d8F F)F FF Kh+޿K"`Q, F8 5@_&v&F'KQFFh+ѱ!jF ##F)FFvB. )! K)FhK:h"[ CBF3`0F1O0 H! h h1&` F1d&&^&|Fh h1##`@ pG-OFFF(V_QFD,KKPDE 0`(`3F*F !FSFxѢA 2ҲEјBЉE*31B%*F3F BKCO``Ѐ#KV#U# B 3+4+!F: "B"6f   "FdpF:/ک *FE3B#s'  /F!@E! \,E!@F! 1d&HpGB KhpGKh8Kh8Kh8p@Ԡ&^& K"hKhFBCg2g^&Ԡ& K Jеhh\,нSg8 2 L `;,``'`8&ܠ&h -CFMx..`;'#xC+hBЖHH :+8 %+-.+𮀍0 p?+ \+cx+𠀍0F# 0#ZxF ظK ظBးD FFxL,S(1Mgu(hB  x?? :Kh+497Kha6I8 3Kh+?m;C -Kh+?a??WZ0W(Կ  M(KhX???;(q3C?/}(q(C"q"(KhAܠ&&kx&^&l`&^&?~#EBF6?qS(is)35E)h"B Fр+`"p??, #=jKh3(qfKfJhh E8a:,0A??RP !l8a(qNK8hLKhLKhKKhHKhtEKh/F@F1 ;KhP8EBA*sz(q8a(w[sFF&??F F*sHFAF\PFF?{ BA*sq?F F5 9 ()"" Hw HuKh(tQx&&^&^&^&nrKh2h Kh Khd )U K KXhXK"`&&ܠ&h ^&Khh FhhX $ i<кB`s0F`uBsh.bEsF FdBsDh,`%dBsۄh, (F`0Fh h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1l# Fc`@˹pFDhcBv! 0!F0F#3kh&``[`#l`h0 Ya` p&,`-AFFF F`"Kh"K`T,`hh1,#k`T FA ^!Fh`m `F'B#J`h+* K"`+FBF1F F (O0:F!1(#d&&-AFh F~FŔfFRE~!Brڱj iBRrh*!iEj~EڑB)5BERE~ ijB RBrڬFFhhBqE`E58F#hp`Fa `a`#ka.`Ɣ)h9iaBrEaE##2iRQBB}8F3i`F` a`5aKi+?n hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAzKhXh}@ h8 &-CF FU#@!GtE+hjhXBEњGs2CB#tiFHElhGt  5&-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fn3hBB4 0"#2"F( F&K""`ZapG&FKh Mj>#bKhb FQ?? Fst4;h;BqO$v&&k&^&2K-Og??W-J h,KhQh #Od&Kh _%,F0;B4(C2Oú F??FF@F[Es ۱??ІBw XFQFW F%-DFA A k&v&^&pFh\ KDD  p`0 F04F&H&8F L 58@ $i!8@Hj[ b&wH0&8F Fu 8H*F#Fd(#BA 0&-OFF #dK2h QbKhaKh]YF F ]KhF\KhBOrr 3OxFAFFF??': 2?? K3%F^F # GKh@ 2??8՜BF{ ڻ B s 4+6 K )ȿ4 FYFĿ342uSFF3H??G8[b??FF$V??FF6+VSFF;hLFFO FHFQFo'GF@_&^&H&Ԛ&&D&Khk-mBoJFSFAF FYF({ђKh3Kh Kh 5Kh*ЌKhCEKh+ЇKh+ EKh+E)FFF J0FFtKm-@?? ЌB{ #B{,&hb"!OLEK{ `H00MFVFLFF-i-(PH#"!2( KqV ; +BKh+ KqV 2F(p+H!*E% F0J[YF`R#` Kv##F?Ev FYFS(PO Ku##F(Eu ڱEK `"K` 5E0(0%5 K# X`&Ԛ&ܚ&&&&&T&0&&x&v&7+!+! JFWCH7'FFR#` Kv8FAFEvکEO7F7x5FFO38F F H*F#F(#Bt(F!F8Ti0&8F F H*F#F(2Bt(F!F8S]hB4FF0&FF#;`"Kh˹!K#??MEu ۴??(ЖBt$F FH`??#BAڀj /#;` Kh++Kj+Op(&A A &&&pFF +xKm,K"eK`p%i F F0",F! X#2F)F3F`a#0 Fp@0 Km#a&v&+Km8  &-OFOFFF;kh{k(OJF+FF򲀋F# B@#??е??ДBuۉI Eq  1U??𷀀KNF FFQFhCEu??л??РB{F]FEqȀh ( O #C#A#oC#C "F`F +F.(5 # ??yЂBsrBAsBqm8a(f#F??F FzL+(K #YFF 3FOO0FQ??cФEqdNEuEzk0KhC EOqz۹ jfFFY&FF1FTNFFFQFf4FEFfFF#n#??ЖBx.x0FAFw`#0FFAF??Fh;c{cEz+EFzF&tw&0!dT??oF F(FO1!F >0"KbKh+ѽ@&&8! KFhF M#"F(CKh+ѫj  8T &&L#iKh#`Hh@&d&&-OFF  x+NGG8Lh{@ՑH!8FFHr(O9HF M+h+ЈKh +h+ѣj#bX#bF(5и@??F FuiF F0FF F#FeF FWѰF??+Ѹ%@F+FѸKKFhFFF0FF F??06BO4%FE??FFѺ?G.Kh+-Kh .H!2&4F5F FO;#O2)FO3LFx#h+Kh+? { ?? ZFd#h+ Kh+?B@E &w&(&&^&H& I|JhC`Kh@19,D&& IdJhC`Kh@i,D&& & IF J!FhC`mKh@,D&&FбI (KI h+!I ! I@ F !F ! !F !F,^&i,9,,-K-Ah,SСO`B! DU(F)F )F !I  0K"`MN7h*h3hBEџB 3Js[`p K"`b Kh#A D&i,v&@_&^&^& &-CFKFFhHF)FFFHFp3+] +@F9F H&-A!F FFF0Ft!D1F`lH#wa F(F`!D)Fal48 M,hB K""`8#hS``/i/ F/h H&-OF[OMhXI `~F h/tSMXF#  `F BFOaHFFx@Fh+;h0F+`#k` M0!+RFIFXF( 0 + + `Fx+FF#` )#!p h `x+! FuFaF0F>{h`C``hx`3`F#hY!`Zx^*!` F"hxEp,$*O3O O pF\(02B#`P `x,  ~h H&)-OF M F  MM,O`фKL `O  "FOaXF(f}Kh.PzKB Fx DFa( 0F (F7F@F.FPF*F8F&\D4! D $SFBFFB8F/^^IXFwxFXF/V,VJhB+` # k`XFб80 + ` XFF;IKB Fx(#3`l Fo> (0320[#; xFF1+ 2@xF0^20^F;X2 @320X0FF)12I!xFF3)12IF;+320[O *2x*И *0F*HE0F&F@F{h`C``hx`3`H&h P D& KhI FP I FHI FDI F>I F:x! F(<     h  FF FY( ( H!@H!;K-Oh{FT F1FO !2аFF0 F1FUFF5G??#H!lO4&F Kh+JFCF(F9FKh+ "F3F8 F1F!rFwQF #Fz3F"FPF/PF/+LFFFH&8`&T&D& IF%4(F O* 4ChBаh43F%: H&h IF%4(F O* 4C^hBаh<3F%: H&h KhpGH&KXhpGH&Khh pGH& v8H!( !(KK`T&pG pG LW" h 0 ( 6+#(FT&)ѲOs` )+ #)O1BA #3`pGFh/#3`#C`pGCh#h;C`\pGO0pGhpG!TgRcA(!g pG2BF F0&F'O a|!h!hF)bh2 h/&`#Ya`TFFFFF$B9]0F4"B`-GFF# FD DR@F!FvBBBF#F8FGH F(@(7(/(? pG8+)08pGa+)W8)78-AFhFF`x*"""D?(F4BF ?(+ =pF hsFFx ha;+!# %')"!F@ p ""##p4 4`+` # # # # #[ \-=H -!Ix,[,D[-e pDx^,00KLpx])0xa])p03F*H[)ѐ.ɲ)'FOFksF].kѤE034F.H4F\,FxK[.0 pFB0 Fn. $0 p\.B FpB#0 p FT|K"pFhF;##p H;d4 F9"F)Fp@ +36 @ ;K-CFh G $9I3FF:F1F(F0A(K)F"F*H\Zxb\hF3Z x[* آ.۲+(Yp3]*,[,>?CF+"2< Pb~Cabv@F;#3<0Y#FC{'Fx+2hF;+Y2P@#+;+ 9V`FC~`eCvjHX( 9BF``@F(i2hF;+?jY2I,+bFEF;#320[ 9F`(FFP1hFxF2#310]#Cc~CcvHH7;h<`F@F;+?!Z< R;+}+>H6@F CF2P<E\*5H#_55< P1HAA 9F P" 0@ SF 3 \ ѓ3 @F3˓ъDHp#i@F09 aoOI @FIF9FX& ]&2]h nOEF;3<0ZԬI(F7Kh aOr@ a(F.`a0wI*F |H{O3cak@F;+3<0[ԛI@F;C3<0]ԔIF#aJEF;#3<0YԍI(F aF+x˱B%?< Y* 9Y*0H5I*}H'ED0B 0XFiuHYF*0 \+pH $! 9"I`a(FFjH e x(!F Q e 1#*`% `<2+YKAP h kFh09AKDH<xX,D o[F9DK R 2@F04>KF(=H\)}-B@ŀ aU `Rxz R 2hQ2H@/J(FX"+ID9 #(Y" h#O2 0 0-𗀚F1h*FF;+310[)xg)9)0)) )HQGp&cQfsz&\&GX&2 x9)/)i&)8Ш(0%\)%: 2 8XHH \ px0Ҳ @hBҦHB X,PH xpX,QH\!p )љHVH,kFs;)zI)#0p) w)0i)ЍHO #05H\H  "X Fh"+-|HPX\=1h5H\*F;#310X S 3 FH, * H\,++* U" 5pBeH](FcKh [Or@ a(F0?ǭX\ dihI `a-61h;+?(Z1 R;+ (FOp 8#`aF@30 \+DH d"HFAF+?H [8 "YF2hxF0#320[Ԥ# 0FF.?F! |<*H໤#FF.AЁE"Hλ"Kh+D#T3Ѥhx1hPF;+?Z1 R;+}+?H!h xTh3`#h3#`up&@e "!FOl("!h@F.S0CF#0Ѥx+ !.=F"U! | h( !./F0x ( "hxT0KD0#hCD#`"TH"!8`1H"YSCJF @ BF!hD(0@PFix+x ]$N!F`V[4,Kh+ XC8K`Kh08 K`h/h#h Hi(F=F.X& &&&&8F F8#`KTh``8 j F 8t"B`FJQh`CKS` j 8Khmh (FI(hF(Ch;C`+ ڼdC !F\ F 8hZ`x F`&-AFRLFF"j*7*[%(Fcj.3`bZh*hEIfcjhbCI |%"c%bh!?J?H>M(=Ijcj%c%hcej9F@F`Fj3b+ј #*ј n*a.j{@3`cjjhcbPjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?kpj3b.#p"ceBp`&&Lmchh Ch;C`+ڼCСm~ hZ`x`&-OFL Fm#hhkchI |JKeX2#c9;e#f#cfTMmرCh;C`+ڼHCСmBImmGF@"k`hZ`xmPE p` (;мp0۱H~I kp퀱|I kTXzHxp4tH $#p0p4m@HEмhoH^!k(F#e0hHp##fcn#h[h#`#h+hch c+9Fp!k8 F]I |P#cfh YH F   |2chxObMHahKHOb,o"k KI|!kOb*|!kOb `t*|Fj `} >JOa[F(Fo(FmHEм5I(Fe(?=Bmh Ch%fb%I ke(!kH#aK\#f瘱nD< + E CF`n0F*Fj 3b`&P п&Ȼ&л&"Kcu OaM cS+ FK JIhh|b鐻&&Oa M cS+JIHh h M]pG&&F N F0h-)F# Fm$F8;F)FF0` Fm0h&])M)O&khB&Kh@>$Kh<h+58h.I"FF | #*hsCX+6h!;h@hI@hF(OR#F!hFtF F;h!hF 3 ]&&&FMF(h I |`+i" r libF2H( h_IF |  &-CFALAO2DF[ij2B Ajb8\iDba"p&--\-Jx8h 0@0՘ \*&*Fij2B Ajb8.iDba[i2aAF!"iOR Jh??R??i-j2*DB aj)Db8iDba"iFR *F1Di*DF+D& FBhFAiF*DFSBAAai8 a `/*F1F#c`Dv2D"e`ZU-OJ#L`H!3#cKh-G#dP^ k~@(-h.eh*73h+ эKhrhB#` +bk"!kphعhh*ZhKhB+ }Kphh @ x8 #`#d(h+ak!k@h(Ыhh*ZhjKhBhKh`+eKBhhBK*[h+h+bk2F!k@h+WK@hhxBxAz.w(?|+~=;>+?wR#YOOOOOOQOORROOOOOTOTOOOOOOOOOOOOOOOO-QWuQQOOQR+ROO7ROMTOT/UYUUWOOXMXXOWlbhB! hYCZd8 `fh #"h!sC(i6Px` `f`&&&X&# 0h˹K(ihKkhC ўM!bk k+hRk)h dKl+[(k+ek5&kj !0F#cA0Fbc#HC#IH"<## H#IH"/#yK(ihp uO:hwKB<#A tH@x3@p# nI  Z(ѽ*0+0"!&fK;C06B9haHZ9h$ 9h ;h[&ZKh h+h-_UI"FF { QF-AFP ٚ0"! ZO $ 06B9h@H9h$ 9h &D XF-XF-0DFB9h^F/H;hJF!PF`"XF- BF)H(KF 6B:9h"K& J 8h[DE 0O B9h^FH F+ I8h[Eџ i&x&&$& ht@&j oKkhC nN!bk k3hk1h gH!" #cFbI`H#"^H!(8k+3WN!bk k3hk+?(1h "k+ !z@FF@k"cccF:F!@F0k# .?ccc7KkhC 5M!bk k+hk)h ylbhB! hYCZd7t `fh "#h!rCki'k hJiRhBi K H`ck9FXF#FF(#aFkifk+к!i @π#i!kHhz#Gki8Fj#ih#r9Dx&&&&&F#iBB "i#H9Fhki8Fj"i2BB]DhO FFkڣN H 00<Ϩ H<jaki[hcO!rk0k;hk9h oih(rгk+o;i3[Or@ a8a0Rkih}I {BpvH9D#"#iFJ1CDhFF#"9FXFF(]V2F9FdH2bEBCL2DhF "#9FXF( O ki inrkkiBQI"id(JJhC `h+?#`miyk+ki3 (iOr@ aha0*iz hi:ckB8I"hi2(?g"m"3I#3H3N 0 <Ϯ 0<6Ɯ:k+64?0J&kh* 2DB#3x0;f3xp(p?1B#"1F #" H#6&&&$&& <&H"! R BE 0F7BF$ !H (1S 0D|0 h0<ǜΨ H<h x0h0KIhKh<&&&&Kh#"I#H7h`~{) RihX&$&pF FO6Bp#~w+{+s+ciiB(cih I {cia$h`iC"ifa!h`i-CFFFF ,FBI {#`@Kh`O>I8F \`^X.U(FC-Zh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F {C`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HFF(#;0B+  HF a T&8F!Khı`h )F(7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$hT&'"0FMFbI*F {iF 0 I {ObiF F@ Fv M047 K : * B² *Ix QppGP I0;0+ B0Z "ppG1 TP  2L!FRh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@\&K0hci1]xx(+h(#H|~C}0#+#F۲t#ɲv!ҲBu"'\&Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p\&'p1L#hZi5kC#h,J![ikM*N%3hB.#'Jh*B"hRi( !J!M#"hRi, J!M#"hRi40Hrp@ >#h[im)FOh J!M#h!J5[iMIH+p'\&& G8FH`3I P I0"FH,JHOq0M, F8 !(F#p+x3,IHLP P\&eX!H&( sFHx?+Cx0!FO0 F/!D Fx(Ѐh;+ H!F H!Fh#`! z}uIFHj t KD |<0BєB4KFIHRKh[i1cxB [x;IH@K,IH,؄@I@F H;,I H"F I@H/\& '!*=GZIFH   7F F"` F#xx<|#`O00th"+ #?? O0 FF*hiF F0I"F zT<#DF%pBݜi*5XB2DB<#? _ 5(j 2p! h3l@dpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3ldpG2p! h3l dpG2p! h3ldpG h+#`pG H`pG# K`pG`pG8F K Jhh@!B - ,O@C#8##d-' '#pG `pG# `pG# `pG# `pG# `pG# `pGK J`pG'K J`pG'K `pGK `pGK `pGK `pGK `pGK `pG!L0 '# K`pG!L0 D('K J`pG''K J`pG''K J`pG'' `pG# `pG# `pGK `pGK `pGK `pG$K `pG-K `pG:K `pGDK `pGNK `pG`K `pGmK `pGwK `pGK `pGK `pGK `pGK `pGK `pGK `pGK `pG@s @O@/g b # "O1=]" h@! IOb@r  .'Op h%*O!!D IOb@k  .'"I@K wA+'I"Op D'OpK%*O!!D D(' h"H "I@{K w'I"Opm 'I"@ a 'OpK%*O!!DM 'I<"OpA &'I<"@ 5 'I<"Op) 'I<"@  'I"@  'I"q  $''I"e   'I"e  n 'I"e  P 'I"@  'I"Op B''I"@ '"I@K w#'I"Op &'I"@  'I"Op 'I"@  "'" hOpI+##Du  ' h I 21("d b  F#IOp"KO1h#|1U d-'8" M F h(h|!F(h)1n 8!hF|d-'K hh* d-'p FN0h)1; @N! O0p$ h"F|A)h0h#"R0h)h"F Fd-'p%N Fh3h|Qc!h0h*F(Fpd-'F! F!  F! 8 F(F!CF(F"!F 88 F(F!CF(F!F 8F!F(^ "O1 FF  }K` %'K $`7 FT&K $`+O FT&K!jFp #0].tgzK!jFo #0 ].tgzK!jFf #0].tgzh!@JFc K!jFh #0].tgz$ F `x F $ `p F $ `h F$ F `` F Fd `  F `  F `  Fm `  F `  F `  F `  F ` !Kh,!F  d-'!Kh,!@PC  d-'OK!h,! t d-'O@K!h,! f d-'!  !  !  !  Hh Hhx Hhp   K"`  'K    G z 8" h@D!F4; HhHh 8!F"H}"!FH} "L@I4; Hhj Hhh A"H}xA"H}rD('^,' "L@I4; HhB Hh@ A"H}PA"H}J'6' "L@I4; Hh Hh A"H}(A"H}" '$'  I HN0 I"d  J#IOpA+'_+' I H00 I"d a J#IOp'7' I H0 I"d C J#IOp#'#'L he( h"O10 d-' FN0h)q? @N!O0$ h"F|A)h0h;F"R(Fk Fd-'# `pG# `pG# `pG `pG-AF| FFF@0B̿iOiĿ 0ȿB-$KBriC#S)Ѵ0iB"-aҲw*b1ʲI7z﹣k۱2F)F FG0BiAӼKBD(1x"+ Ii7\8FiF0FB-OFPiCF8h`h@ h(} FFF !2 Fi^AFZFB^>3x+sFO2# iC 0Bȿ8FљBEF BBڐBFDNFBE# FETڣj2F FSF FF0BѴ0+#K*Fi1FB"iF8 0*FKDiYKpiOFHBF悲"r₱FEڢi 9[hSX2F9F FSF7^FF"pFFF.F0F**FIF Fp@»<F)F59E< KOq%*""Di@J@ JOqJ@IHHXJ3K@ FOqJ2J@h IKOqF''''7'6'F)J048@"KOq%*""Di@wJOqJ@IHXJ3K@ FOqJ2J@J@K!h+ ""KKOqFD('D'A+'_+'^,''%'F )M"&<@DhOq"J+##Di@J@ JOqJ@ JOqJ@IHXJ3K@ +FOqJ2J@J@K!h+ "" '"'''&'#'#'$''%'8F)70hOq%*""Di8@J@r!h@"hI $3#2Oq@ Fh@B8.')  JOqiw J@ JOqJ@ JOqpGB'''''&')  JOqiP K!hJ@K!h+ ""pGP '''%') JOqi,JOqJ@ JOqpGn '''&')  JOqi J@ J@  JOqJ@ JOqpG '$'''''&') J@ iJOqJ@ JOqpG'''&')) aJOqiJ@ J@i!pGB'''.')) aJOqiJ@J@r!pG '$''.' H`pG H`pG H`pG# K`pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pGK $` FT&K $`{ FT& h+#`pGI"Op 'I"Op 'I"Op 'I"@  'I"@  'I"@ s 'I"Opg &'I"Op[ &'I"OpO &'I"@C 'I"@7 '  K` %' K` %'I"Op B''I"@  'I"e   'I"q  $''IOb@r  .' F N0h)q? @N!O0$ h"F|A0h)h;F" Fd-'-AFh Fpchc4ihFC(!0Fl``&0Bܽi7Yih,pi BY!M6ǿFi7 j8iDF j@:##biEi@2#aJ'F`#B7<2*/i3aд)FB<#>^5(j ! r@Q! l@Q!@ e@R! _@R!@ X@S! R@S!@ KIH  H8!L#h+87(6=>IVpI"! IO09lO0AM(hCb``(hCf!`(h7@ !`*] ap J0C/B<##` 8  &'(j -OF,򇃞KhB@iS$@,|#! +(Os>|Ejj#i FG#k FGi*@D0 P.O O i* 2B3QZ գFO `hX   h0x+ppK&_F&`O FB3FF !0F   (0F BFF #-o mBBF 0 D PB+ݴ D %u@ DB!I"+>0 qQ ;I;H%#7RBF.&*VF  0E&>,I2F*H0KF iO  HhX+ rBF  0E?"ѣ Oc 5P-um8DCF*FQFDa>f I;FJDB & +!7IHO1i9TiO1A8#մ QFCF*F8DD bE!jKhD  F$@0%zs C+, F X@00h3BۏI `i(F<(y(FJCh20񜁄I J(FGF BТiRԴ DBDゥ0+ݢi;RԴ Bfj&kI hM(hBHF(hBL#FF8FD(F(bOEAF(hD8h?j0F-&FF+FF+ E?8h@7"FSK8hAH+F"!8hAB"!8hJ8hG8h<`'003x(q(>(1d(/<(!>K[h;NE`jO F *  u(XEа ڰoqD(*I @SB+x+&K[h;D>E0+?  [R#s"ri7$ 0PAB `p3D7D!qB9FBֿ2Rؿx(хc愼'  'm& ?Ѯz(`(x(8a80BĮi[? (8?o|`D(^Z?G+?R#ςk ߂ڰ?(?h?<(@0L>( (uO{pD@SBj(F@FE@F@8h&KiS 0YpG&(KhBiS pG pG&-OFFF*$ PB*F $ FD!m PPO U$()Ky.FFh.=320[ Ը 7I .F=>.=320[b,d-nT ѹRFIF8F8FFBnb"D<""##[#C RF9F#;U8F O*KERFIFF& FMh౨`BnF0FBbDC4+hB F)Fdhh*F"##8F&F M(hAKi&O3+`" FFdBFO0p#"#N#FaF ~(` Fv,hc I Fb  0b ܀ &@u#BpF M+hZЀ N2jB 00iB,hD Fplh܀ &Lh6Z"##&Kh&Kh&wFUk F1F*F p@pGSK!F*F @pG R]pGF F@FHu@FHٿ-C 0FFFX F8F ZIF*i"F!c+FcL-OFFF@B:FB,-F@%*4)FF(FVF+x+|CBw5V'D3DB~۹?dtd  O !R(kѸ*FO.ؿAFܿvv[Eȿ3FCfF(P+FiKIBF%F5F*9F# F62!FPFCPF? FD:(F0? F?'kx[DB4''%F'}0D FCF !KFhC8F F8@F F@"F F6 FF" sC`F F8XF0F8 F`@F0F@[p'&L   𵅰F F FS{9F*""F!c+FL-C 0FFFX F8F IF*"F!c+FLSK!F*F @pGI8MhAFhA D8& "7hFL~Hx $=%h}hFIF(F h: hP##`L%h}hFIF(F h& h>##` KhI H0'XXH 'X& Y-Oð5IFF(R,` G*F!.IFF-H F) *I(F)\ 'H阻@t Fn!FFFXFBF0c 'DIPF =*4I FvID FJF!F'T.2F!(F(0FC[[ [[[(Y0Q# -C#M`F F2F(;0FLF 5+I "(F(h #`9FhFf%IhFfr)FhFfnhFZ( F(1BK@F`)00FX Mh ``h)(``hF @I((F`6I([[FKhKKh@ L '%'H$(BH> ; @(Op@ X[-G -PM$O3+` F(> !F/+h+5'B'iF +Y!#]" )F(@݀ F(@ր   !F^ 1!F +(,`6qMF!F(h0[(!F (h!0P(!F eKh+ ^F !  B+h"$!(6F*hX VI2  (v+h)(k(f (?r_!0)lF(VB"p"6B.&E<F.FBHOOp EGӡE1Y j((S (!AEE(U!@B1Yk1"BEE(p3U"B2U& =H'(F)/86V h0G( f3kճnczRnhR1 [h V 'd-'<'Q`( FObF IOb Ob `I `Ob & (  ` I#F"F DDDD!F a T`[``` FObhFIObhFXObiF Ob I J ` `iF k  ]T`[`0P$ C FK ` F GF Fɲl(;L#h$*!P*hѓ)ѹOp0*]h0CG0#h$h0G#h$~ (>(9"H+(4!H&Fx XKMhF"F!F(hH(h6p(hFiF #_"Z! p! H HG HDY#0 'd-'w``''P$C "K `  F, F< Fɲ(#Kh*!$,FiF FS#`"!F FW5#0 'd-'-OFOE 3x3FxF3 **O0F pO [E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " FZ B $B5@5H`\+ 0+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?z3P,hC) ThPziS)K 7hFL$%hhFIF y h h##` 0I `xI(FdhFiIF(F\ hh)y J F[ LH '`````p i F Kh;#+ *FIF0Fp@KH '`'7hF#L%hhF IF(F> h| h##` 0IZF `XhFIF(F$ hbKhch) JEF[ h) IF H '`aaD'+a4a sF5M F(h5!(hBF(h=F o!F ?l@ e?@ ^!F ?\@1F!H4@ H?a 4F(hA$!"bC(hBF0IHx !4G h(h7<F F7(h?|F F?" FFH$ FE Fp'Ya\a _a-OF- F F1  z  "YFHF1.0̀ O FFƼƜKFNI3hI2F2h*ѡIPF2FI2h*I2F3`Kh`KhZpCFr(@ 2F!H1!0F<Fͬ 0MCs 0BF1Fy2(h8yI(h4.`tM(h@uI(h*#+`rI h@pIh`h 4 lH x& x 6 "hFdH t}QK"`El^KO0`}ZK!F h~!hWHVKPCJ!  `#` C P   C C L01 T TFė#QFOpF (w+h;O(`'z O Z" B <"8F!F)H~7U/%K h3SBF"FhK `h  vhL ' ptbtaf@'H 'aaaaa'aaaa%'+badh+.'#"0F!F>B#h*OrBCKhBK%`<#hh 1``x;H@L*h)6IF F'_FI#T!F)#x+?TP1 FD+h#u(` FO I #(h!F?(hE.#x{[* ̬ 0<* OrB ` h(F'%'bb0b0#"2%K!" S#1 #IO3i I H Kh H )FI F 0@ݚ 3b' -OrFF(S+!"(!F>HO0#0iOpG5I(pF2Kh(1J(+I(pF(O OW 8F(F@%0Fh?F #cU0F-ѶEKh(J(~(F{Bػ F(#0O5 F9F(lF(5pRb'Tb(-OF'RK !F.@bI"F v'-6)F !0F F0F5 FOAF()FI2FID3F@FI0FpB x%+@+*!:0+x'+5<*+//!PFF#pPFF߀/#;@FC XF(@̀T'0EPF(XF(I(F7.5x-D'P<I (Fl(0#(0*0P#*0oɀtM.ht"0FH2(hE  !FKFFiHge.@@ F(F^O@F(F@;hBF !F >;h.𺀝BѸRH>x?b >tO?@E@ @;hB(F@!8H >PE:HCh;C`+򖀶 @8h5$8h<!8hAjE2F!C{.+?) AFF(T'0 FE7(F(?Ʈ DISF?I?`H>[h3`gEZ a<%F(U H F(0F^Щ~(.? OpGbp°@(FPFp+xc.!(FBF0H")FBp")FkHH"!F&&-CFhVOFB# F#p_-и/-у k20#)F@F[#1) FJ+F4b F!FFF"RCFА"!(F I"(F/a*F1F FF F,F F&pM(FF@)FF 0˱) )D<.+(`I@HI@pHp&b&&p/I "@0k"F*HV*I "@0k"F%HF!"FCF*PI"FC   .I FF FL텹M1" FH1*F0p)F" H5F H"!F!i&%i&&8i(b6&-O6]LFX6 +@𩀀J© 8(}Kh!}KM{I|H  Y' +j pF;x+XFD_E 6ROs82#"S,:iI8F9FF0FyT#cIp8FaKh0D[Y sOp"1F05F F 0F ( \23 P-0F+f(0h(5r!(FO3&%ѩ9OsBH0©CF:0# *s:IP 1POp(#X6# K!(F' F 0Kh B.NF r!`3#rClB&@u*FcO3u AFff5Ft Zt tWO3;`@9F ;hY( @F(O 6]&b'b ZI : @F3+C-wSMosSI ;2'5OI(FOd# "O1 SF#(KACIFd)Fd UxR `=I pHU(h|#x36HF4Ho뮹W5C2I 1J1I /I v Xf>X6x+<CF"f.є4SJ0FI"K0FIr-?{sg' h&h&`h-'kh}d5&zhhhd&iS&i:i&h&h(KHpGbTi-C)}F F.HIFFd(<є3+83pD# "q%K8F6BIF ZH!F8@F&$ FI(FP9F@F.I;F FP F&,.  I"F@F +F:F!0F\(kkkkh-GP'[hFw8F&HF@&F(Fc#hZhBh&@`$X6IhhlG(#X6RF|#RFt I| #hP"R:F(FL6k 'pFiOpg+hzFS `"FIF0Fp@ lh-AS1pUhF;h8F)FlG(I;h\o)F8FGF#K#BFBF#J!{h(F| SI"(F "(FhLI"(F"!F(F(FP0B; Ic$ I*Fi2J8 'l(l*l-l1l8Fi F[Fh F#`#8@ҽ8-O'F FFFE!8F&F(6&0F&W@F&T`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F&F(FO   B;#4K"1FOp<#2#:F9AF< (F+ah h1&(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 19/ Fh/ ,@B*аOp( ))@@Op()@"( K3(FpGHpGHpGHpGk4l:l>l8F K)FPF, 4 IJFXF#40+a$OzRF!O @F&P6xI2F FC #: 3qOzssa(3~+@逸0HBB@񳀸60DNRBEF'bI#F67`/'+ZskDl'*|SD ?(+skDl01((HF;] )s ' #O r k|!F O3 ],ۀcOr`"ZJ`cO2`" Q+  xO (# # ` &1FFF) B󱀹 sЦcOwP#KsK`coC"2ЦcOwP#KhK`coC"2#!3'1 7:#O3?F?~ gO: Y [TI C@FO300X?dbR#(Ѻ?#"!21 #~3*FSF?FPFO300ZЧGW#LF@F,Jк?GOp-L"F"*K`#"F1 б OOUHH  @%05,3qO +N p ,TH @"02PFKh*"`o ''P i1l( d-'"E` SEªOsM$ #'F BKh+>ªOs$K@ K"!Fh#T }1(`0U Z(h""0R"!FHN,1,1 101$141L#(RR#8 1$!YC#JCR#, $)h1(1)@.,L., 101$141(1R.R81 !SC$!SCRB(?|  Jcn#)J!'I0FI%cn##J!mC! Jb#nC!Jbm)K)FI0F`lYI%~Jd-'nknmoŻo 'oo-o4o;oOnBoSnm;"n*SC"J!Z!I0F& I HI0FIAI0FI9I0FIM2J0Fm+FFel5#!!1B"&F%F#OO[oaontonononon-OM+h*afHeIOFIF0F+hI3F@F섹 9hH!F  FI(h)q/x09F(J z|b|蜩PFbxI F)FPFF#hFByI 2 2 (n 8FbTFFXF%Op#*F!aFF0F%%fI:F FNdM+x!(F-bI FCaI F?`I F;+x#ZJ F]I4#\H#F 8FWJBsjUJVI FUHaTH^TH[+xRHVRHSQI  F x Q3F~Op  [ 0jhC j+km+k +m7hB؍+hk z!#h1OcxRFkG(SF# +~ km + +Q#OOOOO{_t d-'pp'p.pIpeppppn 'qqqqqpq'r-r3rrFD ЉdETAD !LLAPAi#F IF(FA0)2BdFFHFBF8F(F$F7FK!B(MFF@@FGFK"K"$u`&3uZu uu FiF\8p@XBXA& OAJxI K"!H`KKK!H KH]ڿ ]n '[u ''%''u'<'OApMdp9bhC#K"F#!30F$p KahA @0 p`&u8M !FwFpup F F8@#wt?FR[)F" I*F rI#F #Y0@pGuu O3v( K J L` J!F HJ!FH &''u%'<'MHiFyp툹 I*p I*@ M O0 tuuMHiFyH( M t0 O3 +$ F0K JIZF(K"M!H`KK K! HS Kz '$''u '''%''u'<' O3( K! J H KR KJ! HKJ ]'#v%'''<'J#\3!+pG pGl&I"\F (FpGl&J #;!pKD 1C 1pGm&`&0Q#0Xh K) !ؑ D !`&KD 1C 1pG`& v} :O  p F*vL#h+I .##` ''>vH{L"FhF2x"hF( D# Ix9x /!H0K`@HUv`&dv.'Qv FKh!FH 'R]pG7IS[F IF )F F FhI 0@pGmv|vv7IS[0F IF )F F F<I 0@pGmvvvHN!{tHV@HR @HL vvwF( 8I D"X@  wFIxH FKFH)FHw''D'FI^H FKFH)FHw%'<'H') F4 F$(NM( BFB"9 BO10h2XO1(h2RO10h98(hO1920h7(h70h@(h@d'D'7FtpEh#I"F+FHH06w w0 ŰxF"F(F !(F#pKhKx:DjQ IE0I.'`&_w]w };H&:L"F F FP4Kh#F3J!x | "|!.HtX,I h< r#H"(K !0Ff&K #2 #"1#1F O1FR(FO32H r! :-x:!JJ^H{"F 2 J| }hw`&.'}www% wUvFH0iMxzX8F1Fȱ0FF@8F#XJ!xj| V1H|!"tOs K( hi, F7 F@d `&ww !F@< iF O3A]iF O34]hFhe#hXh`"## 8FLch/+ !h)(F z84 KJ(FF'&'-G-IF̀`L*Ns'O =F(F&I"F jHF(8 K 2h%IO %(KO @F FKI"FS%@PF (ѝ0Hy+SD0a#0030w'}wP 'w '''www-OF-FF%K$!F0F F+",F({$!0F?=FF,;3x+h1F(F_0FDEE_5K@%   " F`t V+ сE Z  $! FF "XF `N F V*KEҤ1F(F"F,DD FZ#P)F_V(Fx%$!XFF,p8F x-CFFF!FF#Fб%B@F)F"FBFG(F# FC#Y%0D%05-pC F-$!&oHO >혱D " F` V+хB p$! F FHS+]pGыFHS+]pG-C@n OpOF dFIFFv@o#@q GEF~K^GEFxK3@3/F@F_)F& +h+;+50x8 T+)F) O3+`+h+GeO;x+dM+x+И0+^K F_R FbꈳYICF"FoBpD0FUI;F*F1UKhV+hJFRO!\@m cB'ucA7O3TJHg!F( + CJ)F F7@HQ4갹>K`r)F;IF FF0F_@ 5J-KhJF!OpO3+`(H")F' x+h+)O;x+?]'M+x+?X0+?S#I F_ Fb"(K"FI0FI+F:F (:F2FI I"F FF0F_&xx '$''T& t.'xxxZuB'''yu)yCyLyM iFH!hFD IjF ^ M]pyM iFH!hF, IjF F M]}y7p%0:% + "\ H $u` |H|<IT  0 yyK|+H"|+K`HK`HK`HK`HK`H K``&y.'y2'y.'y2'y.'y2' F!F ]K@h5D'$-P#!}  V" B 3 #]H!FLعpCOXH"xTI"UHUIUH" }QOOr !!"F`h@A"?@AiC"``Z(ۅB AKop@'! `=I F`h"h)i 7K"pO3 !F#` h(@())I,H_ ()Kh+!n J%H@"%2`B] t#!Sl 1@33O3CF pm 91F(F(F3ht!q'y%''<'&yYn ' ''&i-OFdðFF0qF0IH.h0FuF0FE#FDJ!`!Fv0F۹:;Jh3` g*F!!F F"0F"$(hGF( FC+JSh3S`XFkh+%I \#ICF SF0F*0F"Jh3`I ]!F{I 70;Kh#I F+jhKD !B !/Ji3a'z.' z2zz[z%'z`&&'7FCh F+ + H[J#)F F#40Ib2+ Fzt-Oװ@FHFKhHLPJ&O1FD  Sh/+{!`N#x /|(F"h)@B@  {N-AЌI ( Op I I I $1@ـT-@׀~I q |H1F*zH0$븹 0BBsHsH@rI OoIK.hP;D 1+1&2q3h+I  1+Cchh c)F0F!( 6>c``0WK!WOh;6,?1h#a DNI"h #;` #** 9KCD !B !ci3ca6.*$`i7FFFOi71+(.MIT hF(T . 0F"RCIF00FHF 9IBF@3)F:I F @FAFFFPF 0=+C+I"F(F2FOQ FFF(0FP(FLDZTT HT`T T F@!Op%T .IZ0WCL\>,I" F8 IZ(IZ(VFI|U|d|s||}D|Zu|||pmOc FF!-CF2F)F0 h F` mp F PpF F&A I"F(FXB qC ha`! ` h" p|d FIzd@ M%OcF)FF-CF*FF;F0F F F-<` M FIedAh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp" pO3 0pGo 0pGpLk, ыk+#p+##, ыk+$#+Ѵ23"+БBK+ U#`.МBт##"M#~p+ F!j +Ah#hhhkGb0#h hh[kGbhlbbkZeke$*!аP#N!B٩)V!XB)тB3 !F1") p!!!"Oq" ~Kk+ ыk+#pG+ ##+ + г ++#3###jF Fh *!ac#hchhkGb0#h hh[kGbhlbbkZeke  :*K"ac~# 00pGhp!-OFh!FF&Op hhBؠh!q#h`hc`"KhOh1FlGch$#B$Сh ZEPEъl2  kѾJmE jBp"8Fc6p73%'-OFNk FO YE ܵ0+ۙBݪiRbԽiO  h)Q.AQ+IB +IB*IBв *E  &JBjh+ѫi;DhCE!p ih;D"kQZ"ZJB0F(Ѣlm#e#hhaihhnG(hJERE IBѼ3JBѻ Y -7  a 2 h-OjFNFF3h 0`p#h^D3k/ճk3,ѓKh#n\hniB8$FOpFIJFCF@0F-i(hI 0B C#S1/chBұkK hhlG(*hvKPBѪi 0ѡhYD k@CS  gK h#:Ff#:F HFQF\ FCF ~ :F  OA L9a p2 VhF[Dm +tqh+m$03Op>x0 qp0 @0BFx;Fh[DkOp"BFx;F h#0hmFKho3BFYDkDdFkG8FR)K B,ٝpI x)  ##Ii-B?#d(F3 4  p iIBxL-#F  ' I #- K & '~$&~~~-CFLFF0+@@OO 0BOp0B@v0BOph0BOpZ0BG M0BH @0BI 3z0BJ &l0B@^0BOp P0B@B0B+hhhZjBE'030iS-/kk+rh]IB$\IB!\IB[IB ieCdj X0B/[/Y5D () Op0 BI)@@=KhIi-ll;Ii-ll8Ii-ll_5Ii-ll2Ii-ll/Ii-ll,Ii-llZ)Ii-ll%IiC#JBѫl30h P!+FS+hhd:FiiG+h "WChhjYMF& . '  7:AHQXdltyY -C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"0Űh F!F0GO1#OpC#"(h!Fh0G E0𵋰Fl$"(F1# S"#FO1}Kh#F)F+Zpl4'x'I F먹#+vlm# e 20 R, F FF// /#+vl"!F0lmC"!F p F&Kl J !(F"O1 #OpS3F$(F`dl`dXf0Fp7-C% F!!HF(pOp9N8%` `@/a a@)#b b$-!+#Y#/+Q`7 5!Op #Q F3"+@O$-D `K@! #"2 !JM 3"2#%"1#!FAF(F F!b ! ~Kk-C+Fc+++г +[! F(W.O`FW !5(aE ˅Op `@ a@ bOpzK"!F0#M 2J3"2# "#31F (F F!k+1F ~Q E -O F h%`h+Fp&(B-πh!O lNO  (#3!8Fid#h!h, !@FiT-@P"F0F6#hhh0P"F0F#h9h#hhFXhF@@+FJF!xA @ B ?L ! P "h#"(h"#"h0G?F/(h"QF"hlGO8 6dFė#$" % G ;B2G # F9Fng  SS D@ D8S(D D()hS D< D D2 O@F  $i-AF F+bhhmG+hih W?Si+OzBzABN(;khp!h `+h1`i h wF (D1F~@q  E0#sK`ca3c# FA R :31DXc;(ѽg% -Oϰ FF"!(PPph/! WET0+ + # #3WEO3 Rj FHKh O#F@ =P heFžžŞ @T0+ + <žŞ pWEO# 0*F~HYj#B%FWE80HFlG(B@F `32 05HF0 0 lGF h FO1h ##" 0IFG(F #!###"#hFhkG"eOp "JF$ X @żŜO % #S=KAFF ;K7#<## F@F QXFL+h"WE h 8Xc";m#;e h*Fh0G"ckH(h hhlG"hbZe Fed!F0Fhp+FG(BCc RC#%'  H؀Z+WEh ghp3D  i RDDs;sch;c`O0x$JF,rWE?p3m h :Fh0G _h 3_kB@5 x #i@#p2h[B2p"ch[(DZC)DJ i RDD>s F;s#hh[ ch;c`!F0FmP% B5-A FIhp&Fha * +h`hkhp `Dhp"!@Di1  F(x 0DDAFPK FH 0ca3bckh3k`#f)F F F)F O0! -OFӰFFF±?5YF" "< :_< :O<:):: `!" &O E$#2F'(#@F DDG)F0FG FS*[F J! wOK 68F^K"D|$,D<8FH #F aORO3Oq#-A F aklO@Zkeh9FBu9FOOzsCCBu#XCBuOS FA@ZOCOC@Ch-OF+@ A"hAF Fl GrW AF Y I hBh:E"h Fl G(r#Rmi kKB{ ۾B{  EBVByP+L#(FIF"h 8 #FF8FQF00 FF 7 XP!J'h#0FYF:F:F#F F FF JP!vT,f ,!H \1yOy 'L@'-OFh FFhmG+hh F*Q O h!DD@FFb(uFH#B8тH"P X22S1"`"03@`vJ 3C,@uC,"#,rJC,[#$oKo~@lq?,.IB:OQ!1B5+IBє *#ۨXX $$ #+`,"HR!IFF F&(c]b/+FKB KBEEL#3`EEZ #+`#3` L LX&&[&~T8 T' 8T,&-OFFFx+O0F "]FF#;p"+xc+8M+.C+2G+++/#;pkx+ FQFS+* !m+s+g+*BFKFO@!X5"*BFKFO*YF-OMhF! #m25(FJI (#h FlG &h  Kh#BsF F F# *F0Gh+޲`Ҳ F@ FJ!h-@ a6J_+D!۲ [FVOpO E@KR h!#hF>S !F=T !FU !F.N-C<SlI3F:F8FH0FE(FB@F?`K%h5 + s+FYK h#ZJ!-'*x*#TI*F#O1& "F#BB)F(9kx+@)x`)@ B#h0a9 F*FlG(062!F"###h F0GWk;CFF3 DCv@F1FfEv jBAFVF2CCEFA߀8 Ja#I\& a6J!_[FN( I\#F '@' 2eI cKh#F F_I16ZKG0h#F F&UISKVh#F F8FOI&7KK!hObFF,ж0@;U#0(Ѷ0OrU#0 a Op(Ѷ0 OrU#0ap K"`5X T&-CðF F"!0FX CoFO99F i{h+ ѵ0OrT#0 aC5+I JAFHJI (IJI 3x#I2F !@M0@;T#0('3'Pa'Op8F F o0J T#0ha8.'R!0pFihbiF0F]#FIF(Fp@ӆ8F F XI d0T#0 Ora 8Or߆8 F0F Q#10I T#0i@00OrT#0a 8 @@@I)߆-GOr-F!p,vi(rjK`@5!( F(b`0hq8]J1F _3hc]YJ1FF T ,8TJAF ISK PFNIRFFHFHFFHF9Os@=d'FAJKFAF h@9#aOs8L%8N'F---o4Kh{b54-1JP1I 1HE*L&ch++ h65GKE<4%($K%Lh;"F h=N h+ h;#@K2JF&!JF"!o2F F FT: '>'܇ '.'''3''' F E -AF2HFo1I.M0OF(;M+h# ' (`0& 5FB 6I hB[+@{)\6 h-D5-<)( O1jxj D"[xK@ p"5D%0h3`2KEr ۳ b 20F-)-ѷYFB#1#F4'8FM+h'(`# IBs IBs ڣh"#r#8Ob@"4'@8-OOfq-FF$M PTF%Oc)Ft (CF F $M^I0( F0FO1QEFu RF F\Fy!`  X4%F'F+O+  e``` Fo0CE&0F>IP A(qд *)#XPBB+Y37B܏0 *?h2`+:+>+,1+01#1#0F# @Fx"HF 0HFBFs C( 2Br ڄ5  #[b2 F<edA-OFVFE Ofq F({OX"t 3+ #O0!dFF 3+#O0!TFPF`cf#fSCf$VcaV`` FH"bYt#0 F9sh3`#0FmFFF; Kg!s"m3Kh!C"n3Ki!*"Cn3Kj!"pn;Kopk!}C;aOȿOu  =Vn-OFFD0F#Kh O#*F+p#IF[m0FFSFG0{- 8F #Bh8DQF{U3h5j[hDF3;T0̎8' 'ю-C h7h+hFXh+hFh(`#FYN:F!@3h (X# lOJ!8F3h# \GJ! FkhOp7`!F F;I;HYx:HF@I2h!5JFOp=2h!/JF8F@1,J!p'*H+hiB'I"%H!I"P#HY1!Hxj S7J!XH"N,6 #D 04-#FE#73pN,4;@'Y' '+0̎& 'h-AFmFGhF/D<,D! F(O F!OBЌE0/Oq`!YFJ`"Z]3@M`J`1"a"R@ub"Z03JC,Դ#K@y14N $1F"B@qa"Z J 3C,F4`Y'f _ 3l En sFN F(F~cap8' hph FjG!0F:I# FB%K "!F#2 #2F #AF)F#A00F@ FO0 p3Pm ` -O F- h)F 4 @F( =hh1 Y(h&P-z`C ,9 1 3 5 7 : &+h(FlG:+FFv$ !`(PЇOCEl )FKh+ŀ3 O0  !O3:PFF(ZI 3FSE-O Os@u!D 0#2@QJ2A"#!RF#!F8,7&7 F:+@F~3P+hQF(FlG8F  :SE؊O4O S8Ih0PFlG+h (F0FG(D (F)h"# b 2"0Gh# (F #"+h0GhC(CF+h (FlG" !#F3I2FKF FZF1Ff /#95b -C 'PŰk FhhoCj;D[h3;+ En*FkGOd*FkG#h"O1hj#hYi hk*Fho3FGpFkKĕ#####0h p0hhlG(pFkK-lFĕ#0h0hho#G$bBBOq1 p0hjFhlG(𵑰%F F.F hB-E-9+6G#h0#iF FG`#hh#hFXh*F!FOp6#h1F FlG h* 5* ڛA####6#h09F FG%#hh#hFXh*F!F@ FQF(F𵉰F l"FF )YBF9< FO , B FPBH3F3!"A8O1= F 3#1F:F!-CD" FF! ! #@cF(}TLFŔ 4@Ŕ@F0lGHKPhTxO3FFC     h[kF FG7Kh Th#Bs *F#F#"0 G(J # 1F###Os""K"K6#2O3"#AF0Fp # F0Fe0[ h0G0 8Fhh;3O0## d-' '=` _  Fk#K hh0G@@0 -C Fǰ(1 h8hkGFHiYh"0FOO #h"O1h#hh43xs#h0F9FhlG(0pFa G-GF FD"! #!00h[j HF9F(?:IP"60P7HYj"F#B55Mĕ 0E0QF@FlG Os"(K1F'K6#2#JF#AF 0F `32 F0Fsp0s hB h@ G q(8F o O0h[ [ Ai =` _ -OF-FhF0G#h FlGWKhTx/xO7FFF@!hkVF[ Fx F2"0 G(FwP C C ## ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" VG(%(FO d-'K-OFh#(1+@݁ +hCK@ADzi.́Jh\(FOJ#O~OxO FqJ>F"(O2)}CF@=9$h 8 +hO @ OFXh 0h ph &J#!h PFdO@B#!hXFdqN AFOp2h 2 KFd3h$1hhY3h$1hXhQPO #C +h " $ & ( * 0+H"WHOq`!Y`@aSHYaRHh(Y22PI b@b#@u3133o O3GF AKb0F0F(+++z&7F,(FG(##z03K" O4 F-+h9F(FlGp2C !#h;+67hB~@- 98Kh)H(FF @+h0+!(FG\B\Ad-'ŏ '8'5b c ̎08_ _ 4'_ ez_ '+?!(FAhO#hh0Kh@!Cb@!$ 0F+OE&O$!(F(?(zaR hR4 Ch(FQ$4 YhB0FNd 844B$$(d-'-O KհFOz !hO2 F @! FF@ uO HFU! F (@8FdKhS+ + 0BY+Nі(1+bPb,AR#d `E"qUO ".JKCS!B FcFOpBFIOFNFG% * PJ` 5C0+0G(  rKh[E-؅$[BO6 @BLFPOEFFPF:x6FOp1(1D!O !HF ! Fcd@od!SFPFXFHFT 0FP #D 3DFQFFX PFO >! IFFXHF0 1F  X0Fm FB s s @Qn F# "32*F33#O3AFrFB6 O R#EѸ F08F- * 's?0FDFZ 4'4'̎!_ -GmF FtH!/# 0oIOb F xx[gJOaF FO!O /! Fz8B!F8Bx/* F.(ں4h(FOb1F FZoӺ$?#&F0F9FFpC O'ѸѺ >#`*@20F9F(;x/+ 99JOaF FHOb9F FO0F(*Ob1F8F oOa Fn(#x/+;x fx&v  FF8F3CDDoFIOb FoOb9F Fzo}(F( ںh(F`/(F F mRTZ_Op! FP( .  O F! "iF| ( F?@ B-GFFFvF(=иO&(FwF0(Fu8Fc+ 4I" F\F(I#FJFD0H73FIPF!O7aTes-AJmHg"F@‚H(lH(g(@ۀHQObF((F($I( (@(F(хI(ObF `I( bIF }I(ObF `yI( btIF oI(rIF F(@oI(lIF(FF(@iHObF ``I(]I bF(F{F(@RHObF `QI(!F `TIF(NIF(FYF(kNHObLF ``GI(xFX; `EJOa ct `06I b;F -5 -$!@+b0F Jm(($1I(EObF `" `FX)I(3I b$F(F$HPObF( I( `JH?I(F F$J c(?炐"/3CQTʐԐ$ `pG# `pG# `pG# `pG# `pG0ii,!F@BdDKh#RJ!(FK,h6 7 T!P"FFH F 0 '@'P'-O@F# h 2C 2XbhC#k:գk3#%kd 2S+큺KjJO FF J!Vd %[8hkh0G8- %Op O3c{hBپh fk3 ! 0BO1c50@FlG(#EE1cmpCBCA _KO h#\JF2!+@O3 QKh O FFMKO # |JK"O10 ##(+ "XX>KFFx*b >@X%*Ye(qO #;08hhlGFF2YC^Cf3I2.D FKFBFPF1Ff#kD##c;0+ǀP 2XchBA߀BqFFO |O3 x3)O " '@') gK ;hdKh,!<1FF(N#*s##Y =+;TI@F(5.FBE:,p!BE قk2^!hBEѣh hb NB`2h[hB2k,D#;0.3-vp#2I 00 (h 3  k"cE#kC#cUEFNFPA#k 2XchP!cC#mBfF 28FPf`BO Op Y ?oHFQFoY ?hHFQFO 'd-'.3-CFFjShBgp&h~C#0!k(q ےYdhjJAhhJ!:hR\h[mM,?_JdD &!4$h4Dj+H@gWJ(!FO h3DkQ񔀛kZ=# # KI&2(F## AJ &!7KHF!Fh#l9J#k r5J(!"~b#m4 @a,J#F  УnOp\hT&J#F`kh[o3h3DBh3Dm\@9J(!KF F@O *!hFkkJИG(+#p@#n '5=LhD"QYa) Fveh#p&FFB9(G+Q+ F, P!&J#F >#HK* !.HA- JF!hJF&. J!:H)hkԉk?C2 ++ P"F , w~@'Q'Bh!-A2Fjj5 ;NO FB=9HO@P"Z5"a3Ja@b2Jb1"c1Jc#hg2g hhCE$#OpE0 Fgj(ۡji j /k2p50L"BlhjFAFlGHFGkX IhgFF3i~  -OF4FFFO p' E6ѹlp'q^(a0IF:F30 FLi1 x#"kih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  fK-Oh FF8F$(th! XFiF(ZI #[E$5FOsO H0t@uO5"AF@GKA#2ZF##S@FKEiqhj1 F(`qhOp b  h0z(Psh` DAFVrh!F  LPZFIF FH T # #ccaFf8Ff3hcc0F[ 0sh3s`,O03PY8F8F d-'͂ -GF FOp 0@W"O1+O / #3V0 /+ "9F/#0ehOEE?ij F(ahOph(bhP`!bsaBFE O5F"h9FFBcc"b ""Vlch F3c`(Fh9F 0xxOp"!`Fb(F{ 'P-OFF# FFC  %`  2Br ڶ iqI BB{ [b B p!```0KhO O(rIbhqӧh#Op B qj(Hm3%'ؒ  K'hhO333E򘁫j+@&O WFh+hRE l(FGp&E٠h0Dk3ўO2)w ,qB2I#+:*@!3+#h ˱E@p XC:k3;XQh3;PAQ`13A1{/ۻYE{(E@ PB<a L#p#GSCFPC`DP 1`E#Y FE@فp!ACxyX@hYB Fh"E@ҁ:E7!(q1p#hSD S 0 _C9i 8FIFi B{ F}Ik C p Z`chB7c;B7APQ#GrFPC2 DBBq򆁫Brڧh YQBhFF {W Y0yhAE{ :kG@E{? d-' 'xbhB>B@`p" a +FHDI0A`q )s!#IC`##;k#;ckCc##p#hO3BDjUccPQmA+hmkGhhCDb!hhjCDBZm**kB cj+HhXhAPQCQ`h , *chB:F7* tIFȱrIFH S)r T R"T "X *7jhBh 9FlG(h+++# 9Fj#Fd'l QF(FGh+ 2Br  [ BB{ #FQF(F<  g#E803Y02CP АBA歺Q0GE-p p"BBлk3 0S9khF2p7F FzPB4 a D#p"ITC"FLDFhCDI``I3.-O%-FLhF(Fp& #B%-w(Dp!F(ppFO p70E$ӤDPԨK$\CBVЦK@]Q0A.03nJk՛k35Sh0pBp" Fznc#k)գk3&ѧpO p4 p" Fbn.lhS8IhhlG0##W<[hEp4  p7`0!6 @uKh;Oj&hlG BBO3 H$F0BpBG5p'e[e+X u T B2E # F)FeJ 2+r JBrv[H0br` %Op 0Bu (`+ sO3 3.@ O 0E- 'Opp#sCk?0F6 XkJ[:FL(XFhlG0DkX2jFF-z ;B2]J #(FQFBj -H ,F607?H0m۶%' pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504P3h0FlG FFA#0BNp"0k3t+kqjhY+rj 1h b0F2"0G(R##ihY#BqF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c#WG3J2GSFBF(F9Fd g 043t2[ BB sîp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   bhX b2"0G(9,FĖ##)F"h0GFHH*FhlG#d D ;B2D #0F!F d ' hRB   o" dhDXB2"0G(  05bhX+r h     b2"0G(:##ahX#BqF F#0jhkGacmam+bmkb#nbcnbcmha+?]j+?Y#mC"e"~*?QC#eLo h    [B3 fhDXC#"0G(wk3=#k9щXbh)r3  +/hhBkjGacmam+bmkb#nbcnbhah0+")FGBFu7050B#p!O0 B$Op 0B p%O@2h[b2#CE@p!0FF08"O0'hp3B'Op E@,F' GE$p'0Bрe;l1F.G6i.BB0BB*F1FhlG0cccm+?|j+?x#mC"e"~*?pC#ek`)FFGb "3ch0.!FXFlG(2!`.| Bk5Q)Qhq EwEicd4@300XHhCЊk263F2Cp C`|O kCKkB k  +hB Pp"7g ^3O20`#DFF$O<RqOA L 5@ a382+- ` O@uOC4O @- 2D+F*F#3O3?FO0 M87@Fe:hB S K(IF F@? iAm%IF#n+#J!iOp@A i,cnFn+J!|i@B n+J!pi@C #o+ J!diOp@E icoF @JVZdhpFOpFF"FhF.2%3?KD`T 4#0V(`0+J :@F(h!F" Jp4#"CO1#O pj(@5% J! F#"O1(FC# F4( F00`j,@6%#k0@7%##`O0X hpAMO3 F FkjX @u! "!("0hb0 +^!BHNTZ.K"hj!FZ` p)K" +cb@ ! -#i@& J! F#"O10FC# F( F(`ciOvi@&i@&#j @&##`O0X 'h-OF$K%FhF (  +F \J!XF#"O1@F+F-0HF5##3F:F(q YC0D1@' '0pİ +&(06Cpdjv|1#"@F O1#?K1h#,!<@G O0 k[ c DpKk[ Kc81#"Op#O1mX@I&'J!(F:#"O10FS#(F((F `m\@J& n`@K&Kn[ KfnhOvnl@M& o[ȿ# gKo[ Kg d-'h0p Fİ +K/7MUa #"SO1#OpG#{/+ ")FPJ!(F(F8 D{/+#s Dp1[ 11+AJt@! h,!<O01[ 11+ 1[ 1 1+1+$1u@"&(J! Fp#"O10FC# F ( F(` 1+1+(1u@#& 1+1+,1uO v 1+?~1+y01u@%&# `n d-'h-OmNFF(FkIFTO [ EF ` $?Qh{@ himB 4F*FTI8F# Ophi1mBFC '1cIJDh^GJ!(Fh@ idBd"FF@ hiZ1mBF+ Q3F1[ 1s E2J!F(Fh@ idB 1K13$1!'J(FhOpidB 1K13(1!J(Frh@ idB 1K13,1!J(F^h@ idB 1K1301! J(FLh@ idB'8 '?ph-O#-FFװ  0!J03`NO4hF#RF#hYF(F3`l#Kh[#NRF3hYF(F#`]Pi@0A P3L`OtA PK`Kh+3W'%'D2' L.'ThD'.' I D''PJ`k;+إhݱ1{#.3OpH T(^#10K`0Kh0I*0k#:*  ,0=!F t 0!F $J $I2h2"K#J#K*"J "I2h2 K J K F{J I2h2KJKK JIcih#KKo'd-''E' q D'Q D' կ c# 7b$ 0#c# `O02:BOFD"0 F!K""`!cb&3accOschh#h##o)hG)F Fp@"pXF$FFFhjFlG$1*F1F hkGP$jF9Feh@#G pG0F-P!L#hhF $ iFFPPhFT#h$P@a!&O00#h"|!d-'k+hF F#c#J3!`h8h0G#c`$1- - JI "O10F$ +@h#!h3#1#o!hGJ~p OF0%$&h6&6#oG I wFx1S%x1C%`1+Ŀ31 pě8F*I" Fn퀹(I"F P(C+h;l!:!X` I" FXPI"F 9h+h4I" FF`I"F (+h+ }I" F4@*hrI2#F  I"F (8o(֛-OOR-FN!PL] `8l+ЊO\;h+@OL;hCOq 8`O4;h+@({O0+@xK"O O`O1XaO|a `mK  1Ox a`fK`H X`1acIXa`;hJw 3Ha`PYI`S03ap0"`d a*FF'L@sEK1FR"DKDKK#2#OpAF1`h(8 @B ]Oa (@8`=H! (L8`IJq 8`(KG`"02 a0F0Fh+Kh$1+Kh+Г|!jOp1 0(!Fd1X '.'2'.'D'E'D'E'D'FO8lG!\2B!F$$"(F$whB/YFFG/K@QJ#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB BBѶ?>F7hBs!2O2F(F1J#|1`'O6,G'-O}FFFFJFcF(hI2F cH(  eI@F&ZF`F(F(F_I*F@F0Ѵdh+ZHIFO0 }k6j`j`+k#akkcakakka@0#bB0cbklbO/}GI:F@FV0vBI*F@FN0;AIJF c@IMpQF8"F F"F;I0FFb9I0FF 7I0FF5I0FF3I0FFh"F1I0FB,?F/I00FF"!8FZ1FHF0' 0B vBOЪ# (5D*#*#0 "F ]( #d@edAzd@QΜל-B-CDM$OcFF!FF CFO4 F DM"FF;FHFF(F,0 12O`pG-OFFE ,# uT:E; C "FPF+FYF$ k E{RF[F"F+FkBs7\bEsbFFx!Oii@1l a!ZEs B +k#1kEA@ F a9Ex#71 H C,ubF8"FE9 C +F@FIFi EyBFKF"F+F J EEIBADrEs 6Bs:EAZA,u8E9C "F@F+FIFPi EyBFKF"F+FZEsiO Fj EzFFؐe0%##"#U#( (F)F 0k#pGB3D0 D0pG0pG0%k#F B05hEjB %jjCX@Bl"d 0#lB C##d@, pG& L<'Bp##`36hhehb'pF@K@abk=`hM Fp@H0[`h;`(F65F瘝FBh I F@pFk%O5(FpD1F( 1F(@5CFVK@A iF  H! bF(K`8FX0+V #8#c3#dff# c`VD0`` F8 FkF# B@3hXjB jBCXD`"D 8-OF1LFFcB[[EF# 9B3hXjB jBCXG"hFP9FhFiFD1*F Fl @B1*F hh*F-#p@B l   *FFFh-A'F:FJ EkkEkBLktڸ \k ekBuF70@;0 h EkkEkB\kt0*`p -G FFFFĕeF#0 0F ##"###;P%@(`O0hkB-@{ ! EtFF{F -K+`00*FC!F0 H ;i h3`2[b 20C03k+УB " 0 F-AFkFF#FB#+i-A; BBM! Fй*Kh;` @3B0#0!"!F04:F#AF0#(0C02[b!a F!)F2 BBL0%'pFhV#kFB ОB % K` p(F3P-0й#c04#)Fv(h;`2[B 20(F[Fh  " FF(-OFd]RF ЎK@ PKhCKo`Oq P I\F(@ȀKhw J)F (@H! -F(zIP 4DsI P (MFNFF'`p kI,عV +CfIB(Is J <0k@08Px+П,;F F "!P0FCF,$/ "!P"F7/ "!P (ѝ`0DI""@I8 j;I0s J y +?v4I "츱! F + sTXF d] kD0`"9FcPcE0 j[[  (EP#C0@ 03 0)@.'ɣ'ۣա &5$ 0 !X0  0 0$050#D0OcX0WFF׹0sxs+sxl+%+O& "8F\(K(G"3Yi*F FbC- K'F " D `J##i?0)FJ F >0=0<0;0:0 V*F F*Bѯ73/Ѫ67.<-G 2 FFx۹P#E "`, . #r 10cr20 00 7(I*F 6 5  3 1  . d ( ѝ0 00***PONF9Fꀹ#c˅ #`,0.0〝00  O0mpFL&{@!J 6 {c{#{zzcz#z#h 4G. p<-OF0z8CEx'O`.{("ЦVBVADD EjcEa`DBa~FFEB,S `` &.(J{O O `~ .gD afDBмдE(FcEDcE 6FE CCF dE(dF  O0 dE(dF.7/zy y pG;hhB4O0 pGO0pG2-A4;OB22rF`F$1CrE,-%+#h3`1-+rEO1QA\B|  47,"*ѽlV(؃( C +ER@   pG8(4  pG(  pG pG pG pG-G$xFF#F ʱB 4uD$G4-*8""3+ y%.= оСB v#D+F45-"(r` pGFJ y)+0@ pG pGJ#m 2J]% Lvy,4фx?@uF82 Bт+h1F8acaq4FB!Fع22V+h43B(2+ѐCF4i+?dJ``F-O,m FO!!FOc$O4 F ,mlI n0s@"!2 Or!FBs2[1C^K@!+" v"hZ1psppqsqq26*JU#&2*F ^O[#0FYF W *F8FkM(zB,8FFT6+P6+PFP&@;SCF2FF.E(FO )? pp1?A pPDF8FFE(FO )? 1pq?A q(F(F0F*F8FMFEBh Or0D*F1F8FMpF0FOsE]EO4d@FRMKop@ A)FnFFjCK@A;  Bq#0`4+F@ @0DjFFi$MB4D5O4Whh G/ܴ Jh` qi ``B xc ppE'%'-OFFFFFΟŖ40PI "B%2D1"uF u]eEy2.-8R-R1)K;`'8F")*!&~ F2FO   мFNEF62*- ؍B /@8`FRn*F@ #0FQFhjBp3F +F~&O  >  мJE26.R F  B}!)*8"O*2 O (F  2Ɓ" "B<Fi0r/?K5KGO qO  9 $)"ВDƑD N E~ ̀ A Ey  "OOQ\ ) K@Ta" V!Bpn/?OppE'qȮFD SE s(;3q;F)DMF(?12k @B0 # E# 6E&0 B1E Kp"! F2EO3"\( )2*K@la@rs#D !I DBEOr ڨ/?R@M -OF FFFĖi#0jiBK@4O3Ov]#ah6R-C kh0G8u6vUB`h Fp@Fk Mh0G#!Oc`hCFЧh!8FKF8F:F(F 0F(F F M-OFhFF0+kOp0P!4JtP# F xCF>+0P!*J`P# FxCF+"KO2h#RZEs FF"FQFXF*FkCEE@30BFFF@13h0F`!"d!*Fp#FGP@d-'-GFKFFFO2h#R0ABs FFo4!*81?+ Cb#x@3"BF?#F<` 03h@ 5 p F!FLCF !F*F:F0FrBѯ7#`O4 FppF F@aF0CF)F2FF FT,F Fp FiFC# #&-CFFO4h,:=h ! F*FFF*F Fx"F=`xF2 + ++ +#+;+#F!x\*33 "*с#*)p FFMHiFeC0 MCFFFRlF !F 2Cѣh+"1F FB,-%(Fp-AF FFI" FCFj"! F/OcpK/FЭJ#h!J+F0F LM J  L %F#FL%F"F0³ƳسųFpFCBCAGF NF  F0 FR O4 1F0X2ù! F\0ж ! p 4"-" FX"F 08F$`(F0ѯh8O08 F8F1h2[Z`bh`eiUi F8@&h!+h jhZ`jh`hh(F+h jhZ`jh`hh(F-AmF FFO#xS4=-Ѹ1'I5 *F! FX`R!I#` mݯBI7#`#,CFK *F",#h3`BF9F60 Hjh+Яh#+8FdFm@2FiFhCF HG FKO0 m( FiF| 6@#BpFF F4Ip@2LՈJeih1hIE#!R""H0ѯh + Яh9+I Fp2#Z`jh`#+`#jk``ci%b{h"KhQ0 I Գ Fp@Ҿa Fo0Jz/ pF$ FFF#FaB?aFB?`1bC``p+pFF FF&IO Fj#CF4!"A.@! Fz0&"! FrB@! Fj0F!F(F"h K0IWpHRc FZ/ F" F"sOsFF FB,F"K0I$"Os)F2F FCF" K0I$p0 0 8FMO5O3p10%J(F8FO3! 1CF FFCF  F0 FO4 F)-OFM FF$ݯN7#`O0 MX&XFB o YF>6TFB"FiF $F&FFFF: #`O0i$;! FhhBҲBFh2Z`bh`hs`h1Fk0h F*bB2F9Fh*ihca##`i&a2c``aKh/ FH!@X̴L1pFSo@E+P(A#P1T1So@E+X%3#X1d1So@E+h"%#h1tRu\R->p+DP#L1;L1+DP# T1;T1+DP#d1;d1(F,5x2;x2xb.ttb(F,5`2;`2`b.\\b7F# FFFF(AH1F! FD1<1@3S,B@C,8! FBS,B2C,8!)FBS,BBC,0+3D&0` HF(F5FIF(F^/AFijp+% p032dUs+CC+C M` O(8  pNesBC% px1hs4˹k RC F &v%UsBCdh F F ! ! 81CC8181sZF,)x1h F%( 2K pp@(Fm%( )K  !pp@mh<1V H!p@-#FJ!81E.C"C+C F,", #0 H,O3,1p̴9< 8FHN2x1h5!8@޻+j+I(FmhC F818@[0;32a3 Pjh?!qbCa I<1x1h)@0 IhCoF FsOrQ@!0 H5#0  h+F9FF@H*F9FO0𽥱@")FH*F9F h`% P h2F9FH1D1- F¶׶-OFF vF`X! F 2"bFF SFIF h0 F329C2C2U0#EB HIF I F M#j+0329C2C2*Fo2oChQ-AF7U< 8-H AJU#a CБ&FV !F #!@F}1FFH-#hx1h0(#j+% F ' FA B+js33S<0"AFmhH 1F41IU-AF FFnF F0d$F33S<@ FW(`#j+/0 3`޹ F)FEH F h1FAI FAF#h<1_;H)F:I F89I F `030+[cj"! F F0Ѯ^h++H-C"A! FA.9#j+ "HeP0۱foQhF)F2FB FHboBiF(FP@#j3 FI F #j"# FI F FAӾ Hq*ӷiFQ ;Fxbjl F@lp+hF=03P=Cj4"!E81 033S<ݱcj030; Fv0 H"A! F 0H Fp@d%F Fb F@-OF-hFFO 8̻V(HFEUEШE-#j+,70 F%I32#2F)F F033S<BFKF F Fd F F dhE#2F#b)F Fo-1F(F gPHu#| Fg+F".𵅰N6 F]G!(FW,D - #"0DI<(8 ((<(D=H)F;(U(:JL@04H3J% N#QCS<13 CA)F'J5F $J5F'  J * FXD!\1)FH1xJ; x"!O0ft(܂:F3F Fc(z9͸ŸS{F F%I@", hAFH!ȹ<1I,P,O3,1( I#)u<1H!FQjFa!b#j3 F F@ ?-CFFF)xFF0#`O4j; KH F2S`h F`$ FxJ`<1O2iFF:H!FvFO4#`8h(U8F4iF0F xIF\Fj# 'Hcjkb> > *** jF9F0Fb+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH] F"# F2+`h`Yz`f} "F+FAOq0KIn#+`)h%HHuOb50OzqF(FhF?H)FE7ѭh7+Эh +7H)F4W# F=F(/H7  x1h%oh 50F)F(*FO1 F=F2[`h x`FK"!5h-0FLxx Fx Fr`x1h`Zh``*Z`+j+"#(FEK:F#@ A ) FFIDP F0ѭvh7+ F@1lh +ЭfhV+ Эbh+н@H8-AFFFFFFmx-٭F'I7# `A%"B#j+H ;FN'>Em**F1FB0#jñ<#AF* 9FFH1)F<#0Fv9FF H&>PF**F1FAJe-OFhFIFF(F.8I"PF OI(F"H00A F!FBI(FF(𷀥I(F (g0C0 V(5DE(F +F(݀FOEKۓMOIFH FHFF  1F8FKJLABO-h81FCC81#x1h/` "D(@x1h/s81#C81%OV(F*F=XFtDO  ;k(N("4("6(O U(KKp( x( n(CK K[CSOO FF;j +FCEۨE V#XFD3(JF9F EB!Dh{;j; +FEܨE h}V#XF"3(JF9FPF#081#C81O0 0խ#`  SCvЯBѹ<1ZF FCS<1(IF0x1?׮ : FGEϺٺ xV( F(@4RK1C PBй PF!PFBI 'Ȁ0ЯBxVvV%xj 85Be F3Fx:F{Y8F> F*F[# [c KDc`> F*> FD8p1pFFcIJF(p1tAt&p@J!! Vh+8I. <(4H$p>00H 3hx1hll1+*H"1FF>0 dh#H &Fl11F+""n#FF(C  "!,jDF IOr(F0Il1+?y<h F.Ф'dt &e"FB@k&` faFBO%b3nHC #,$gG F-%FE@k'&` va,FFp FF(:33Ԁh h k0F#FC`i` h `0F#FC aa#r0k k h O(F#FC0kcc h D(F#FC8cp8FndD@hn? ӴoӭT#`O08$ ( -AF FFDllOD@?Ӵo ӭvT#`O4 FO F(+F2F%!S˃BB@B BXB4B("F8n#1FF0F ipG-AFKFFF@#Bѭ2#`O0h,6li,:2+4Z`bh`h#`+6\`+FCOc`+i3+a`'#2F!F(F #a( _2Z`bh`##`ic``a#q0hB $ha nF(ѳ`'`0LFѭ#`O0#0h#hB$h砊#$"# "2 `a! !`#3(n0*O3`+i q;+aFFF.`''`kg`<`c4Foc#fp0pGpO3F Ff)F FjM F0 Хh&] O f0O0ph3-h窊)F F0F" FFFFC2F)F FVee0O0 F&$DDklB HiF 0O0 p+lS$0;>+٬#`4Z R CB<Fx! nC2`n h F@ cx! FH  Z0 F Q$ F"F#B?O`"FB?a"FB0?bc"FB8?#cfB f0 F F0#!FhFIC+ٽ0ZH@H@pH@pH@`]-MF'oJO #p0p0Sr r0qp%k#in Fh#*h),2cZ`jh`0G#+`kk``cbcq0ӱh hh1 YhjQ`Yh `i`Y` `aF#h`q0"nFcn nJAF4enF@5ѣnB FV#oU<<+ ѣmmU@ G8@5瓱+!U8<HAq[U(PE#C0<#y F H >  FF(є> *h F SdhhpGh F dh#DFB +:*#+ ,F$p FF#/x+F" F( "1F(F(:!(FF(\oB0# !# ",c;`O0p3p")F!Kh.F;#Z1 R4#oB# "0F# c3px.+i+#oB0#! "`cO3cc O3c:+} 0 FF1$hd0#`(Fe0$E l( F0i+dh-AhF FOh۱ah(FhSx+ai2 ich01i *F0F! ]$hh(#` iB@hx1hpGCj@hF"!hF< "hF hI#jFC$~i-OٰF F#!Or OC 'F8H'8FY#0 Fs0іH8F  0[x+gF(_ 0DJ81%JB(F30"HQF~++ѹHQF+$$ # #(FI(d(FjizsdD(F0#P0lcd,b(F#k`{h`d`5}`@H-AFF - i#\x!hD#` FRzh* - -*FhF( "052i%BD!DB,D#iBdh04 5!F1Q% 3B۲ 5D#0 1A%Q#"bA#^#3"bA# "B####2#*0FF F.F(H(FI~0F H F 1h"(F1]0HH F 8F 3hFZ2`@#pT[F FF x+#;`+` /!F|F! " F# # ";H!F`O0 %)F (9F0Fr.H1F/#<-8h )(`^o-GFFFFF"3x"+ <"+@Ѐ?6@΀0x #; #0B%ӹ0E ##p1F KF(hѫ7#`O0 (FEE1F F4 E,2F;\+@sxx+m+0+[b+ +{ n *Q"3f e e e ;f e Cf e e e Kf #;PF.F, #, #, ##0(KhxY2 Ս0xY2 J050!,"8 6#0+FxF30 سBF0{"!,( ;FF?4 6 XFxF2 + +pG+FpGPx; + +pG?FpG-OFFF(BHO=!$FX=IBF (FO K$pg(FFF[{Ϲ(F :@FnF(С"HF]@$P#c``=!8FB:F)F8F렻s@FFFH8F @8F6F0FF8F ( #U4JF1F D\0CDZp4LFpFh% i#jBi% fjUjB `j # 3p, `5, `5-OF1;FFF+?g= = q= }= = = = = = = = = = v9= %= R= = = = = = = +[n>Go= y= = = 3  &    = e o y =   5 4'-?(FF{ *F!H([" 1]V(N7 Z' @# 0FwFh$h,? 4-#40C0 )-40HKhB !#*FFEFG #1HgO0 (!F#*F(A0#x+I FN( F #1@@-0"p)F 450C#0*Fp#!EѐI!(.*ьH4T<"##Dp40C#Cc0)lQI(F.#l1I(F&#l1I(Fй#l1z5CFJ)F8FJF(?fp H\)Fp8tT40C0K-41# 2DI(F(4# 29I(F(4 # 2.I(F(ФI(F 4 H)F'40#040CS0 m0*F #!bFFѐH"40 S#cC#040CS040#0ٻ40#c0ϻ40C30Ż-<1?3vO:041F8FBFKFZL(0BF1FKF8FZ>(֬#P4S-<1?3xO 04gAF08FJF3FZ(JFAF3F8FZ (PO:JF3FAF8FZ(p43FJFAFZ-B=!(F4H03I "F(FF4O0p#0)0 :F3(F0#sC0I "(FF4p:F(?$I"(FpF4p:FOTX]e|I"(FH퐱I"(FB`I"(F<0I"(F6([w4!p")F8FFH O  :FF 0 #0 RFIF0 #0F0F(? 4  82F9Fc(?epJF)F]I"(F(Bw4!6p")FF :F!U0?h0FmF(?a O( 4 82F9F(?pBF)F~tI"(F(rI"(F/?? D"##" F8FI@ 4+?cH9FbI "(F^`H)F빷0p)FR >ӹ *F(/!(FjO3 4"1\(?ݩ7 @#  'C` *F(ȩ/!(F<O3 4" 1\(? 7 @#  'C`y-o40?oX*FpBXd40CS0Z40# C0NHʹ40C0A40#072;JO^k40C 040# 0 2_@@!00##C0# 2RORC `C GsP0#S0#T0O3V0OS^0׸4#0и-ƀ<1?Ȩ2#4S470'](?h+H)F-4$ {(F$(H-81 33S<ԱH?" F(F  H [`40C30j#*F!( (Or(rcrH)F^40CC0H40#C0>40#0440C0*40#0 40C042#B"Cc2# -rHQF40#C04{t#``-к$H4{t4{t4{tXHN-hUHF$ (4(FFQH)Fǿ?"p F (F H FFH)FpF0(FF#;:!(F4Fб" +o@!HF FH F1H0H=!(FF,I(F F00FFF0&HۿFF'"I(F F(E0FGWFF(8HI(F Fh0FFF(O7'X-J]}nI(F Fp0FGYFHFHtI(F F`0FGwDF3FH_I(F Fp0FGG1F FHLI(F sXGЃH)F@O dI(F bGG}I(F ZGwTzI(F RGWwI(F JGtI(F BGgqI(F :(oI(F 4GlI(F ,GiI(F $GfI(F G cI(F G@`I(F G7]I(F G' OXKBXH'w9ոTH.SѺgQH)FDPI(F GMI(F GGgII(F GpFI(F GGCI(F G'I@I(F G'A=I(F Gg:I(F GW7I(F G)4H)F0FCF2#p/I(F Fp(FF(>@#OP'HKGW$>HSZ^clrw~@ ;\e!h1,"\H0F E+hBGkh+D  ,5EFO %h#j"`,"3 37'@F(FٹHAF$"FAF0F0!ܪ >#`(FFк~` -?H4P7#P740CC040#3040C#C 0ؼ40##0μ-?Ĭ(F@X2+~}H)FʼhX240C040##0-?(FF(#;FiI(F&8WIHdI(F cI(FDeGY.>{^I0F 0\I0F(~oIC2Si$e40Cs0\40#c0R42#BCs2#F40CS0<-?20# 0*F!C:HT4 &40C040#040C@0-??" F(F 4 H> +>H)F-??" F(F 4 H +>Ы H)Fػ &-??" F(F 4 H +>H)F ` @-O LFF${&FOY 0@6n.<1H  (7+Ѻ HOLD'BF07(F8OnTgX-OF FFF+I&K"`Q33S,S<zIOO <10FLZF:FKH|BF# ""J)F@Fh"F-(Fm22 p!A@ A 2 FF # x'-C$FF%FB< FDOEܱK@1>3#Y%4J5DY("F8F,B(F %(FCE(pBDK@1<$h-AF F)4 1+X1+bx166+]1F"8F)  I E$ A0g47+Y0 78g<7+Y8 -@gD7+Y@ #HgL7+YH ( (FA   1Y6(F & 1Y6(F &"F0FhF(Km T"0F,647;470F,6<7;<70F,6D7;D70F,6L7;L7-O=FF I F(H^O 7O IU#BCcE##"-/#0O3`P7CP7hN#[BU0CD F F5I+U4I|.FT D h#"!0F2CFJF 08DT+٨P#`4Y  Q@,CA@+٨8#`7Y  Q@,CA@<3FRCFO4 F0@pG)F {0pF FFbV?  I*F FCpXFF F&B <ñK!?/ +*ѣB x:K!$j6 1B q"Z(wz<FC{B"`)C+^-O {FAFF,@TqpHF(h3h81Y@F;I:F F^0V08FIР(N8FFP 8FF8FF8FF-8FFp58FF8q8F%+@I3h81ZZ FI8X<[LJJ0l)aK )FI F0進l F~I0ဖP F{I0؀rj FxI0Ѐ0FtIF F0ŀP0soOr!Q0jI F0𮀖0+@3h8!PA_If3hx1@ ZI F0ZFYFgF(@F?!FXF{`0wNI8F(@X<I>O:FHI Fk0cFI:F Fd0\0F0%(F@90hT%(F@:6B:I FL0D-@𗀺0+@<0+ F.I2F0) F*I3!A0s F{D$Hf #M>(F*F F0 VFF F0HO4e3%^F\` I  F0T!*?}I F0-?r; 1+@Ѐ Fn FZCF@ȀmHlJlI F0ᮈ 0XFF(?|cBs"FfE T FYI 20?c"YFUJ F0WRI8F(?OI8F(?ޮMI8F(?׮JI8F(?ЮHI8F(?ɮEI8F`DI8FP-Ѻ0>Oz>Oz=I F03hx1hW%*?6I F08F%(Fh F.I2Fd0? F)I3! 0-71I F50?ٮ 1ZY*/%CFHF(?Ʈ F'f`  !)M1;(8X8F h(FCF F8@8FFF *lKK$)Fm1F(FO40$O FJ$*O0+Zi*Кl*E1F(F0O44)18FE0F (ѧV#`O0@((яBѧ"#|Qjx C   B)F+* FBDPHE٧j7# F#jO. 9D ;B@BE٧P#O [FFFD,B ",+F+##p-OF FFF  CPJF'OKE)Kͱ.ا7#`O0D(FA>lpF7 #է#`-k.O+pcAFPFB(]ъ o!h 0@_h 0Ao7\,  h 0Ao)/, ,%ѧ\,OKJ`-.(FK獱.\ (p >00hp0004p5L7n-.?t>K7e8Fr| -C,]FFFLFHFCF!(FG0PЎIJF(F0V)F= z(0 (FG=h(FI0,`zh#FIBF@AD(RyhI(uII(FQ"FAF(F ,]"FAF(F8kKCѧV#`O0gK@KICFOa0Ѭ`I(F(7$&1(ј XI(F@`0<)F z0 (0(И0#A)FzDFBDE {h"xEI(F80?i4)F z0_X"x:I 9I"R(F0?O4"1IR /I"h(F 0?;4Y"h'I hJIF[02*P!FF"C I.# },(?II(F0? #x+4cx+P%(F I0V#`   -AF{FFF< Fhf F$**Ч*#`O0P0-# 0ko Ob!Q I@F . F9F\ 0-OFFCFFbh#jùjw"FV#[0lrJ1F#h O h"i 2"a FiIm0 # eH N F dIm +O #jSE'أj+8-6$OFjCEp S XFGF$O jSEv2DD)F@F+?F1F0@J'#h  x01F04JS#h0 h BFF0 1F0$J}#h   ,KD~#h 0 # FXFG  , r B0 CFXF73F  ,k +  pFi%a#jBfj%jBp, `5, `5FFFFFFFFмF0MF FObiFBF$ F M0o iF EF(,(`(iF: D8%@ЊBا#`O08C% xLx1Fp@xLy"F1hFd xiFlF(Fpy.x1hB#>0B*2F!FV(mh !FEi!F(F(ѧ$` /#@ K@! 9K@!9/@ x-AFh FFԦ#`O0Fx+Ё)F#1x+x:D0А"! FLh FcgAFhZ#h{x+ѻyoC@ghX+kgx`eȱ h89Fh0FL9FAFx+Ц#IxJ`e(-AFxFvuE5lp2E hAFhp29FD:xFbF.8x2F!Dl2 +Dl2%O0PF F !F"D   C"9F ZI D@@= ,٦7#`O4 F/ "F(Fi pG pG pGpF1NUY]  pxFO0p"'I" 6F3#OBOq#`0^p#@"Oq#L0I  #""!<0 H"! (`0 I308FQ(hC(F#h18@8-AF>pưFB ЦtO6#`0FFOr!hF  "hFOC:F1F@DOSp0V+hjFIOshf> *F@DB+hIjFOshRiiF``LT  f( (A KOqKh++P@B O0HCjFlCXBXApGQ Fh scgD#Q00PF" FhFM    jF IB + ")F FqCXBXA 0 8i(0PFT ["!C C "!FI +0 :i-OF<]%FAK@! Km;KO2q ъK@!Ob)F8 F#pXF1p31caso`#`/FA,hB`hC`FXF:xsmXihC`hC `hC`hCso`oDCc`2#j"cC#b#cchP 1F_ P!PXh}XC5xX`smB .B *FFF-c=E5DhչZоFOSF; 5hY1F(FJFW 9I  MDh OS;F 5h 1F(FXo2F꾳>F65D*"!F^0O0 <]Cg%YFOJFF(Fl 9I  MDO O &cw-C&FF"#Fb!#6"!0bD0F F/.F!F0FF(PF!0 Ѧh +(FO0,F.DBxB Ҧ#`(FO0##DBӣh@/ "F8FF H) "IF@FebEHF"#D5Fp FIiPF"hFQ kM     h-Os000h "i 0 I@#jF0Fp-Ii@ih l2F CC#0C l2""!h2-Gm6FOb!FvA  ("BЦN#`O0x+x++̀++w*٣i+"F0F.0@ꀦ*hV8O0+)*+hաx#F(" $ h> :SFc0x+!ij"8Ff "8F lI:F 0нX0jj(FlB Kx+++xKh0#Zx* [h#  0#Zx* [h#P 5" C )FF     OsX0;hBI0wѦh+Цh1+:Ix)("ci0Fy+F*;+ O1 !0Fh m*xhF(?{:(d(F5hF(Frx(?箣h@/"i%i^Bx+Ү xF,Byy(F D)#Jx)ѽii@ KF#!3 F+  pG+#`$`V#` F+ F#` F$`V#`FF+I"UO0pG-A%FF )FF"*! F(7#``1I2H``0+F/J !+I5``0Ѧh+`hB&IjF0 нP-ѽ0c H`hC F $' " I`h 0I`h0AF FG(I`hx0 a`( F.@qB@lBpBfB@h-OFFFO#`eiU`hBCF+Fh SFh3SsEF*Fh(`bi cDB.ؽBD*F h(:FQFF%hJFCQF0F`5i]D%DciaB!hC`?HF #O9!jFI]gBh-AFذF+("L5FŔ x"hш4(O3jF!8F,I#6#`O0X4("O31F,#8F"0B0h%-O5P*PI iF @$P#"@h, 0! FF@hh F@Ҽ!Fw0O0! Fn0I`hN0O0 ~B FVű.ئ#`  `(Fmx` hB٦"#(F#;`BhhB9`3,1@pGpGʱh!NDFBD`@@CF5{;D-OFF *إ#DKB ХV#`O@F$F#F&F"FB  `+dAFFF˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAFTFDZF+2Fѥ:#`cSc FFF0\8+x #pO0 FFF0F8+h #`O0 FFF00H+h ` O0@mShYhm#e@!nK h n*O3#f03F$ F@}8F0P33S< Ր>0+ D&0ke#hx1h"80heB0YmkmBRh033S<Ք>0+ H8@ 2عpF F OqFw0`X+ha K0#h+0#pOpp@B0 0cSc-OFŰFFЀF|F3 =H O0E 5HOs~ ; S<VOq%F(d0 `ñ*/h( B " JBјh ћh`#+p(0> kpS+ *p #@h#k vq"K?qI((6cSc+T sh`p@5pJ.D $(DB/ /d9h0щhB2#0#0$00#$DB/{<0c3+@"6##p#cp<04D</@3+8##p#cpoKS BB 4(1x23B=#;( F x2J(1x3DOs@@񛀙W0 8 232Bց<#; " 1 F 12& 23D/081ԙ0ՙZ0 2*@"FP!cpFJF! ; 2F+{(t!02BQ#`p#pf 2 Cpa#p#qv@F /S`6pX(p**(1Zp(> 0>! A}jF*@# FHHO0 *>]p# `FFi0/H.KBBABF!ѥh+&Hi '8F ] i H"Fm(hBC!F(FJ  (h81E[ 5# #F0P F0`H"F>HP _u8#VFHxhF4F Fp*F!F#sU,FF-OɰFFRF\I8FFH(m(hZF1FF(uУ6O   PFnF@OH-HFIOnOrKFQFHFd  6#2FIF(h[F 5 4#2F[FFU 0# p,0+FкF xܠS @#0JOqXF,gH ;F*F @FI0ihHNF(HIOǻ$H ';F*FJ @F) FNh0tHI;F*F`@FVF NH I;F*F`@-GF"M FFUtb FO, ,6x2B$%B&F, ѽH6 V,XB3BѱFV ,Y,H$FHF95,6#T ,5T,HF0F(*-CFFؤ#`% FB1F x0 B O #DBҤ"#1F x0O0*O!FJFLDH ICFF0F0T H IF0F0*pFmؤ#` $ xV+ѳ(ьhHIF(F0.)F x0J3F@A0O0 mp I(F;0P#` x0> 31]aS0[#hY +)D(8D 0-O F+Wh@`_0Ֆo0ZFAF(h#'FK ZFAF(hy#F(ИK+Aؤ#`T0@$P0RZFAF(h#F(GC "E=(FF(V;  89Fo(4$SDSE66V<0h0  kHV  Z, *(F@FO4 BB BO2! !"zg*@AO(`A@O& C 0 8F  89F(4@Bo@Op F5-OF}0 'F&F`F*F4#AF hd0`.i.\h.Yѕl0+@𽀕,0+@Ҁ#h&O,tr#hpx2B݀0&O,30w0p347B̀#h&O,\r#hp`"BÀtr 0O ,73 hx2KE 0 '80g47B 0FHIZFFPF0O0 } ( #*F0IF# h0'p8F  IZFFPF0 , #*FIF h0(i8@HftIZFFPF0_0F'FHTlIZFFPF0ѱfHFfIZFFPF0Ѣ0?>#Or@! lZI ZFPF0*0?)TJ@#@! ,mPI ZFPF0o66#60W,<&P @>0g4bE;ј)FFx0ZFQFc4K,  haW,<}+*0h!FbN6QFS0ZF$K  hB  ,71hB2,63h PB)F hTh0ZFQF Kc  h7,6>asO@ 8FP5 F#d8p"$IF :CF&#2FOqf0 F0O4 Fp"! FV0OBOq FJ0PC #0OC0 +h" F .00FhFP812:033S<C/iCiii iBղ$ Fhn0CF(fH F@," K%0I @ -O&@Fh$ hdciciai#bhca#ifa8# IF(F 5Z<$`jHF0ZF1FFH9O3#cKd81@񜀙I(Fd!OsC `jHj1FFHO3#cK@0 Kd#kZ `j 3HT1FFH+؅H"1F##ckj :g{' {{zck#k:{{ z#h+;cn+8`jhB4єh00H#k1FFlHB iH:1Fg{' {{*zkB#k1F_H:{{* z`jG#k1FFSH^li+NДh Iaii iBBk+?#h+`5n h#F"1Fh0 $7S : h1FKc2 r Gt1FF H F@sHC1FJJO 8 PFHhl# F3d8@J!&M 8FP+h;+h#F J!/hjG$ FH# F+`# Fd8@8Y J! PFN9FPk*k`9F hJ#!+`#F#c Fd032!a"2@M J!% FP`6h# 3F F(E1H a#h81V-I Fd@6 F2F9FX#h812 !H@v9F Fp!2F9F 2F9F(a F`@K@! P  #hf+` x(ah F1 F#$ F@Gy !h0Ch0"*-CF` F hhiBrjBX0F(h3Y {ȀG$IFF&H hiі@0 F)F" FF!%^#F"!I FdEN2#C"#[ [C#h!(F h"!K%y 0Fh812>#F!Phih" F# F+`#A Fq 0iZ#+`i FQG FH7 F 0@8F0P3 FUFȹ HI Fd8@ l(aH F8@ 28Gy8 PF H Flh0 FCh0#d8@J!u -GFp7X<@hN233C|23 FF|ѹHGԿ"KB0ѱI{`<1 23ѭI" 0(F0ѧH G@ &qdhfXc(FG7v2C(FG޽33CE (Fh a+;i2F(F8yhFHEXq1C+@$#i(F1F#@0ci1F((FVFPF~`a(JhRF#i!ffah0Ch0(hh0KE@X<#k3(hiF(@ۀ}?? "k arEvQH hA#3cbFH#cckDcckDc 0KE@0@,#h+p##`7dX<C (F8/H GXl?v3C `jG F#Hv0+ch+`0KEb`jG FHa(F(h+F2F!cX<2C%Д@ K(h !s(FGa. 0:He}= cSc(hK+iHEX<F#3h+Q(FG) 8 0FP33S<H h0Ch0# Fd8@H FI hi@Ա#hñ10sdnDhB#I]Kw]KpG-OF#FjFPF+@ 9 S<r3C3x+@phmkmBCF:F1F F'O> **j(7 cE85# 2F h;F0;#0 @0"Fx;33FII e" ^"\" B2BFz FHQ#Rh B3S<ՓH 'O+h+яI3F"Fx '+ыI3F"Fx#O L  pB:F h1F@|I3F"Fx O3+ѹQњ60Y6#2F h;F0oI3F"Fx3FlI"F x1F h:FdF@F eH0F+h +#h81_I Fa hi h!ZK*m+m##+e'[<+<##F  0B"1F:F h{06+7#3+њ0l#2F h;F)@*h*@@ ѹ@O !2J0 #:F1F hP#(-I3F"Fx#B<0F FH'Oy V m  #5Fc-AFBBBF hF "FAF Ho O . ((F""DA-OF FFFB EI +F OX-! F*F\-i'x@*dbz*a`B[.VBR T' $ RF½((B0DB?ӽ& O:h1F F"H2T'½0KhP #i"POS 0ʊ !PF(FFXFXF F H !DHF:< p)`]F FmI h#`hBBiF F%AF3hK I z(FP ]phiF(F/`.m,&-OFHhFAFZ ; FFx1hF B0ӱh±[mBє> **XF2XH QFKFBF)F F}dhO-A"hh F AH=uh- xhF\ *FAF H<0+1h;*FAm+1h;*FAr!]P eFdO PFX` `c C    La` X`$` Ba`O0YaIo0n "FC H !] |dh`0Fv FFh F!7FP50d000>3)S,&B"C,"* *S,BRB"C,S!DBC,a C F0@p)B"BbO`z  F Hgjz S0+ hK*F!W0zD 8FP#Fh!J`Eh0+ h!8@ܼ8 -GFMi@̱!h(cnB  gH(F#(FdIcf(F0F(ѳiZY)h˱ihBF FWH033S<w/(F7*hN23C bjhBєh#(Fffh03 *0r"#h ++(F (F033S<s;C(F(&Cici acia+?}kj$'O F/'BD  Bbi0i2Fx)њ2@*٢ #`7/ K!(hdl(FIYx1 DpqpG B F*pF٢#`O0p&F`!=dB*F<"@rBU0F( @CO `@@O o@  OpXhHh hBhhB0hJI Fh@Bhx1h F" F(dhx1h F h[h hhb@h"Bhx1h F h[h hib@h"BhHh0+@n8 pG pG@ 2O0 ciPiӱ(Дhh *ñ( J0B O0( *XBXAFcScx1-GhFO   3#jpbj юI`*F)F0FaRF(@ـdhh0{nCKOq nI`{nh FF znoCg2@{nh#)F90l"F00a ("F00`F(Ycj%00 FF(#yn81ynX1)F+ FF"F`F(?e)FaoxXyn\Cgh01BoCgn)F0F`B+(F8( hF(?b")F&!FHF3IF|")F}!F0FLkx+ (F8 PFFF0F`dFxBQF8F^8< $B")F+  ЙB"9FvhBC,PF<" F=H FF(?Co<CCgiFO3iF8# FQdg11X"!0F`FHIF0F`:IFGME9F0FA"!`F(9F`$YА0`j3S,ՑhBC,PF<"u FH|#c\pF@,K@! yAi 'H 1*)F YCFѢh1+Тh+Тh+ Тh+iiJ 1(Nki hܱhhB#hhhBaiPah{Y`bh F`|5knB#h0kf0FpQ`F %8F@L TF H F8#0G-GFFFFF8AH$ F10 hHh;hhB!b F"9F(FF(Q4 F(;hEa`#a#a 0`0#a8hE!FF!J PFkjM /FE;FRFIF[!F 0ѢNh+ <i Fi#i##`shc``t`kxaF@aiQ0OP33S,S<RSBBДh0;`n(h!l(F&0F(h!$"gn1FHرhjBijB  "H1F"(F3FH .k(1F(F#k, (h+п0"Xfh ?hcjBF8Fy#!h0ff(h#h+ѡl(F`(h0 hpGiBa-O FFFFJx0|#`;F(Fl#"AF8F-F-(2hhB!*ZQ`ch`3h+KѹL0#ai#a0;3!F(F[F- FO4 F(HOl Ga`2h`"a` B``3h`E|!F0hF J VhBѯx0-GFh O Աi'h.hx! RF4CF0F;Ht0 ##`  !@FPꐹ`hCh;C`+ڏJ (0hZ`x +-IhFs(-&1F (&IhFs$I,hFs( "s(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+'''K[h;"FFg(HJ( ''F>K8G' 8%L`h%`e`8'F" "F! 2K87F ,H''8+FO*` Ȅ ,`8 F !F" K87F ,H''-OFFFFȿ`O̿OO8m0@F4`hBh [(QF$(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-CF-FSOFF;h8SPzhHFtX@ #;`  !HF萹xhCh;C`+ڏ (0hZ`x +#F;I hF s `-&1F(1IhFs/I``hFs( "s(x+Ѡ`E$IhFst( "s(x+`hFIsda(IhFs\(IhFsV(IhFsNa(?| IhFsF b(?t IhFs>`b(?l:!h(e l0'#L`h#`t I``8 0' K[h L"OcFF0$80( 0'h'F KFFF[h["+FFFgH %`(  `0'FK8D0' 8%L`h%`Ze`80'-AF FFF #F*F! gK84F P @0'JOc0] h'-AF FFFF #F)F" gK84F P @0'JOc0] h'8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8F0hhpGHiSipGpG-O FFAFG@?F@D&WKOz hZhFAFDCA9FCD QӢB ӴOغ_=#cC ?XFiFFFl'FFFF9FF T0F1FF L(F)FF D F!F@F O30F FA Cc"BFܱB)F"0Ѡ<@"h^KhKGKz #F0ě ;l'-AFNh3б3i( @3iwi@FB8GD8F6B` TF0 i"FD$!FF(Dl'8? M$?i*j#DBiDa8 F( l'-CYM$0+WLWK&hXFFGTK&hA"+GQK&%p 3(zF/rF(9F&hUG*) ;F73(;F?:F'?&h9F?8FGjiF&hc F3#FnGiF &hT#FuG(kiF&hG#FGhkiF&h:#FGhiiF&h-FFG`hiF%h!FG$hFFGl'ě |^iFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OIMD+lD(#XC00F(tCI0_.h$4 FO ,@kBO( O k ( B%O( O D+l ( DB/@FHF-II_j 1F04 ( F 4"I_Tk+k 01F4F30F 4I_<sik 0F"D4@1FzF Kh KFG+z 8kll'8Hě |p$NjulB(hpU$0RE$4l'K[lhpGl'-OMLHP-@"#!O NF#,#;`;FUM0#b*(3a `O3dHObC#T 8?+@  Ѡ$0oH*lM!&h2@feB`F`c@clc#c:"dZe@Yjh#e@iY!a#af"fca1)B!f2f@c`'0C#QH "9F3`NI&NH^H JIg`JH^< Ej`{F`d(@ M@H^&F (?z`tPqA9*%,9BMoz")0?Fhw~&rK##rH&`E#&0A%`>#%0:lkh2B5;k`1kh+?.3$`(#$0$h+!;`lh:B3l'ě }U ؕ''h+;`lh:B3'`#'0(`#(0)`#)0*`#*0;p~p^ K:FGj1F(`(?7#H0 2KH0h pGl'K h pGl'F2LFoB40B0 0BѪBpB0BhBр`"1F(F'BF(`ciaH^ciD1F(F0Ѡ.@"iFh]~KhKjFG#z ciBF(ci`aH@l''ě ;-GF9OFF=il @#i@"#aO3D  0 0&0"LnB 030Da`{nBO jHiDaVaciiB !F@F^ji!F@Fca^6iB#ia{h!F0^X&0K,yi#,@yi FGl'0$BKlD0v44l'KpiB lC@.j& DBЛ@ DhXipi@l^.il'Jpil  @@@"iuBeO4 D0Da bTiDap2l'-AF_O:iB lh@% DB{Х@Dh!BFZ! Fh2{j2Ѹ%FKD1@*iC !P+a@i Caki3kaiB-:hB##;`i)F0FAO1K#13 ,KO42CCX AF+8)F^\+9hB=`BKi+8^8)FAP@*FZ!*F!Fl^VFFl^*%0#"iZ!h0@#`l'0-AFki+;!F(F5ji:jaF+fЖ%)oBF!FF\ #B7J Ӱm;hD!(D(#t04Fh F*kO4DD< "FHF^tF(FHF^%`i8FF`#O0!jBi3 O1!E# #+aika3B `#FiD!AFF* *BFl'ě O;iC 6FH FUF80`3`%(F1Fl^*%)"F!(F*0+"Fl'KF[hBb!F@@l'FNH(0+%(FF)@TKh K:qFGPZ #`'0C H "#5 Fpl'ě |-O FF(@8N-ؖ)0+KhK1FG/(0+@ 'DkBGEȀ4hE٥B shE AFF~ѵi%" B,##𤀫EqhKBxl%!FFF(1i < l Ѫ@3E cBD@HF2ZK%*F!2C66   * E  "HFGK HFl$F3*0+*FPF$:K'0K;H "#7 F tiE(F_3iEK(DDFH FF0P+` K)0óKhKN1F 9 Ѥ  D )FH^% BF^*0+?BFF$FF $l'ě |ؕ'𵅰FFn0N(V=FeCі(0,9/7Ж)@,J)Kh(K1FGDo+9F(FBshB)F_F(*F!2'0CH "#5$ F%(FF(Ж%)oB0B*F% #`l'ě |-OF0 F(0^%'0C "H t(F $/ր8F0BF_\ B0ҐB FD (0FO38Z (O33BI!FF(𦀴B"F9F88F 40BؐBӘBVKXhbs"#@@B #B*0 B=F!tPBo cBS@  ј%0+дB28Z!7 )|0B0B!  J2H]FF/H^`0q" 8FSF*CF&HIF^J FF@0B?~2F~ IFH^8%0[B Ҫ(Z!-! *0+дB٢! h)P} KhF KlqFGv FF| #`ě ؕ'|l'F K'0CH "#3, F@8l'޹pGpGpGHpGԛ HpGԛ K0h3pG K0h3pG K0h3ppG K0h3pG K0h3pG K0h3pG K0h3pG K0h3`pG K0h3 pG K0h3@pG K0h3pG K0h3ppG 9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpG >㾋hF;+`ڌiB (]K h\ `p]KpGipFN$V4(F Fp4 , `K +K[hG pG`F0 S pG0pG(h9!HBpGXK0h30o O0 pG @FFR;BpGFpG#BQ#@@#@3K0h3pG K0h3pG 7Fx M+=h'I+F"FH.0L%F (9 xH+ pG pGHpG KF33(FFpG, ;+A,A 3۲, 2ҲBГBO0 B+F-OhF:VF,FF:V1OϽK@ --+hC@`.@TMF;F$s4,Of@ 1F_-F`":`=F`3J=+hCV`.TF&"!hF ihB X( I"<LBFA "FiFPF&DD-A&K ` E.-$`O0"KFXhB+6`3.-$++$07"l8FJE(JF&l{$`/?yEv #`.i`#^CY!k8 KhBKhS HpG s KhBKhS HpG  pGpG pG F HR I FpHrh IFHI r,@H R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBО#` I)F`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: ( 'FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00Z4]h;iP!0xCC@! pGh`K3pG'8FCi FB "iPF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:D#iQUiFFAi)DlXi#ii+Da8FF FFFhi.ݶ##/ݷ!! D+>n{9Fa2+FROA F;F" FiOA FR2i)F FR"OA F&i" F9"OA F@V+FrOA F?ZiOA FR i)F FR"OA Fi" F9"OA Fi2F F`&Fz2OAR+F F+iOAR)F FL>?Fe)F FD>F^ F!@F(N FF3h+#OsB3#@\ CTkCK52hh*"Or30B#@b\CcTK2hh*"Or30B#@b\CcTj"j1Ph 8F !@[jbZb P礳   -AF`2FBSBLB Tx], O ,0xF+`!(F+ "F1F@Fx8@FB8y7!, 1BFZB "`xh #`KZc`x[)Yx.)3`2Bӣh #`K3YBx.*Zx]*3#`'JKh20')`) pG pG -AFZSBF FSA'0ip0iF FG2BҔtu(J)8YB;x\*GZx|*D0iF FGhKiBѣh #`t0+ZДu!bh#hpB5 bE1ٓ\,ѓ|'31#`x|*xBoiF FG3)YBxB[xBBғ|3Q)ѝɱB! F6+  FiR"iOA FDc Fi DOA3OAi F*i FSRi"OA F3@'pFN$V4)FX4 p , )KS<GFpGF)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6礳   -OFhBh'kB"I(FFPOA F#h3#`"I(FFO A#j@"hh1PR( ! FOD#j@"h`i`!(F#jiD#c2Bx^)3!B#`c x]*3)F F#`t-*nNB x]*HB@-*@Kx]+@ `)F FW2B@h+\K3=1!`Bأh #`1Ff x-+]+ѣh #`1Ff FcEFҙ 320 ԩ ! F2Bȁh #`fh #`f#`JF   O F(F FQF)F F  0+#OsBij"(j1P !kj(bZjb 1!`Bأh #`1Ff x-+]+ѣh #`f=! F)FF F2BJh #`fh+#X_'  x-*@*ZB@&Yx])""`-( F FEKh*7Eݢh "`fh*"OrJEEZF)F F  UK3#`E߮ik"(k1P !kk(c #3kcQFHF(ݣh #`yK3O YFHF( QFXF()F F  ѣZ"`x]+h+Qk;#jiBkxCkp|OFF0+"OrE5.j+ckk+`kj+]k+Zѫjp{U9F F#jjg+(k'@>(j#7D@"!(FB "jh;`#`i+#OsE O\ AkX@PkQF(Fñs(6WF6.K  (Fh3c(*K(Fh3Z#jO@Q FhOA-* ! F[*Jx:*?"=*? F1BFҮJF)F F[YBx=*Zx]* YB:x:*6Zx]*23#`夳 '  j FpFi(KI h1!I h10Be F#`]#0#0 c` =e pIOQ F p@Ź   h-A^`Fxi\-[-zChBӃh #`Nf`s#`2x@)BuB@&!O*-.-MУh+@#hՠo( FL}-ܵ"ڵXt<+|Т0O`Q F2FiXXt, F12FOA F[#j"Zd""OA FK@{B ! F(ji;` C`_Kh0BF*)H"`;FiOA F2jiOA FiOA F2;FZiOA F O Q"O Ah #`=K3! F i+?Wh #`5K3N!B\\)ZZx{*W3 F#`1BF0x,*-Z"`B+(J[xh320Z# FBFݢh "`J"*F9F F<2B"YBx\) Yx})3#`+FOs#`B3B\)x}) ! Fj~h+ #`$XBXAt'^ ] ڮ"jOA Fl^d .2Fb^2B YBx\*[x)+)"\! Ff .OA Fid2F?2B>YB:x\*6Zx)*23#`h^`Fxi?) ء$ڲ * +#^)׀ [) \) h+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! F .OA Fid2F2Bӣh+~ЈK3Z"`x)+ 2Bx*.?){)^B |NZx6hW6`v,*Уh #`tKc`3#`0h #`oK3?)ހi*)+FOA F@iOA FRkiOA+F2 FRiOAR F[1BXx*(?*{*NZBJPJ[xh320[A ! F;#`}! F"OQ-#j jBbZj2Zbs"OQ#jjBbj2bd !ji Gh` C`1KlgPO Q FJaGChBӃh #`$Nf`s#`1x<) >) РoX F/"OA"O A!iOARpi+FOA F2RiOA FRi)F FR"OA Fi" F9"OAJ' ^ ] F2BF(x,*%Z"`J[xh320Z FBFݢh "`I2F)F F2B x})3#`3FOs#`BF x3}) ! FAh+ #` '+-OFFFN ІhBGvL F KB #FvF&!V%0( F)FP" 7D(uO&a H)FI+FH%KuPO5"" " R""tpOahF!+Da`#B #~K32BJ"OahF"KaaaO``@ #qK3c`@chIFMFF OF0XFPkxB@_->ز_!زo𖀲_kB)GFc#k!cO1ZhFx*F)FhF_tв _kB@)c#kGF D)F#c)1OزOزOуFOOвOOI;زOFXF&xFhxBO7вO4вO#jC#bk-@怹@!@&`c(r!(FF({Ѡc`k(΀#cc0O pF OвOnkB+)GFc#k!c[)F#co$kEO3#c8Oв@OTUUmA K5 D !5 '-F5F{))DGF!c%s))D_hIbcW+xF_+B%u#CUAFrC_Bjk@!0;|!(Fc0F%zk;9FBA?3+F*F<WB9`:`B2V# B+ "F,0Bj \E;bFP#B@#@# V#09h3EGGB7ӝB0F*@ehFF5UxAO.бO-бo#jC#bME##`#ld @0Oe#0#j[ #K3PFOBV" k+?3B8F; * 'F)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6礳   8FK Fh+) \k AX@8k˱ K4(Fh3(K(Fh3y8 8@q礳   -OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𵁱O𷁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5_,9a  +a*ѝШb~ -OFFFFB0F;hO YhQ% xCOгO]гO FOrس@_Qس_г _|4F&FUF"xHOD JFO +F1F8F8JFSFFF8F-E[b#xCDQ(0xBO JFO+F1F8FJFSFFF8FEbbFOJFO +F1F8FJFSFFF8FE*bOiгOгOѹh"xBh QP`t5"F1F8F+F(?v+F"F1FkF%"F1F8FBF2FYF8F(WF:hk=ORhR "xBD"F1F8FXB:hiRhR!P%xE DR% xBO=h"xBh!-OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𵁱O𷁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5Fi++h  h  EJj)bk*8k?_DEw;xR#0+e=   BZљB! @~(!DD#DFX7#k+E8F' RFYF(瀸cl+? ' RFF(83HFF |D [\#0R B,?qEP[FSEF8x3 xBkB8F  (ѺE~3Fzcl+B H l0 (?O 0l#B\ blcC\ ZFعFYEh 2 F([Fw (и?| ¸Oq1Or2?i $@E( 6  =F(EM3lX#3 ZFs+0u( >F(& &&pGpG pG |L pGpG pGpG8#MF`+x %`8Oq(FW( '7FM+xD 0(%`'Fhx[@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!H}HH' (  pG pG$P0/ 2#0/%O-,MP@P`TpX0$p`R0*$0S$00e 0Z 0000\00 00S Q^A 3 # Z20# TP@PY*   T0 B2@TPT00#03R0S0 YR00J 0S1\0S# 0, Q 0S Y0Sr 00C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S  S0#3RQ  PR# 0 B0 0Y00S  000C 0S00 0S  AX 00S 00J 0S 0 SEH S0 0{0 C R9S+ ^0 [ 0 0M @H! $PD$0S,$0C[0Sm  00,Ѝ 00R3ZXr0  H$00CR20% L &O1000S 0!03S 00C 0B\\00S SC @PTP>: 0; ( $ 20fX4@-QM@00(,4` P#U `A0``o "0# R0o,.\U-00ĵЍpFW`&,- M {Ѝ@-QM@00(,  P#U` `A0``o "0# R0o.,^VU-00ĵЍpFW`&O-M0p`@0W PV P'Z P2Y PyX PV P:$ P ,SWr  &S   SV1  S SZ   S SY;X% h RT 4RhЍZY!X3  R ,R  R <RBЍ R $RXVZ  PЍO" ܗl<$ܖĖ\DO-@QMP00R㈤ `00x$ 0 p 0ᯱP R nRk a BR  $   ,b PQ D bPL Ѝ3 00bP~Y U000T0003 00$bPNY U070T070H ubPY} U000T000 PcbPY U000T000YW U080T080 oR 0EbPT000U000v ~0 X2bP 0 4,bP 0 `&bPjYL U080T080U0 tbPz 0 bP 0 | bPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t aPYv Y0 haP 0 aP l|ؔ@dA-P`M_NP 0@H@>SJM+; D 8"` `P!0 P3 P0 Zp+ 0p @fp@ -fp@  Gp@@@dIf *fCfAf 0P4:fP`Ѝ5f00@ŸO- 1M MP (@`PD0\ "( 1p -FDpp^> ;@D@ 0h@p 0Ss pءp 1 0` 0 0`00p@, -0)@t0p )0~ cPaP 0S Re001ݍ Ѝe0S 0F\ R  Pp @`0!@DD4 [@ 0 0 0V   0+ 0p,R gH'1ݍ Ѝ'pHď0@-M 0P Mp Ip@ P ' Ѝ00 0Ѝ0@A-@@0s- PP0P 0/p` ``z0`0HeppoX`p >e``c0`02e 00 p@-@PCM0 /SUP2 @@3pP? ` &@e00>t0 5 @0F F 0 @P@Y0S VS00 SCލpx@@0Sd@`00P@0  P@1:d?00@d00 Tp@-MQM@P4SZ TF /TPC QP0s+ _P OQa P0`pP @ @0XZqpG D p? ۍЍp/0si/%@@00p +O`d@0P@0  P@1:ud?00@&p 04hd0#S6p@ _d00[d@Xd@tDH@-tP`O-$(X,p1S`@P.Wz00Sg [0 0HP:%"K Y2$> 4"0x""2"2BS"2"2@0*rW00Sd [0 0H P :!; B@T"#.P@P@Pt0 {0Qu w{a H P :%"; Y# [0 0HP:u' 00{S( w{T n 0rHP: ): B@T#P@P@P[0 0YH P :Kz'Pw{ 0IHPv: )JP= =MS= =O0j2 T$>0 0 Pw{M *H P W:5# B"2"2BS"2"2@0K"20S$. 0 0 @P`= =MS= =O0L7"""""""@-DM@ P- j jBp m>BR/ p=QZ p>m>BR? [P08 P00 DsSp 4Q0  ?]P  pp0S0|0S Q ,]P0.S0000S0\r\pf~Q ]P  N0S 8]P B q p*}Q \Pqpp!Q \Pp\[@0sS< lqp }\P pQ0S0`0 a`m\P1 `Q .S0 0SQ0 ``fn\P `QAppp!~\P pQs00  \n |L4KLKJJ4JIIA-@PU 7UP7UP!A`FFqP ``P 0!Eq1pP 02PO-M򈀍P $ *H & 0`匠 0`p H?@P 004?p@000@(S#WQ00@0S 0q!S00>S 0q!S1p!R 0SGW= $x87.Q  `OT dႁT.0C 3S 00 F  P .IAF P?PYp00W'` W P$0SP Ѝq Z`F*0I 1@0S, R!0p1 S 0@ Sh00`dl00 ( C`%0匠 000pH < `0 8W  PQ0 =S] }1 .Rx, 0^ 0Y*`<p`01P=@ qR( !pP8WX00PT\00 (@ C0匠吐 00@0pP| KA00p1S! 0Y 1:00(匠吐0`0匠吐 00 0p 4`0\8WPQ=1S Lp 0,^0B <P0=  0=R, 7, @D%0h0 ` 000 F< $xpPSp F"x  RQF#0 SF P\0sF `0d   0 Q0*0^* V r0sP  T80< $0 h0  0S 000000 00 0$Q0SP """"BR""""@ : " R Ό0 0 0x"0$00$0}0S <P X \  LR@0Dhg 0R{AP  $hX (0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X0\ 00 00,00,0,P0L dSl0 F`00d F0FF 0 ` (00(0 $0S"xF0000 V  F! 0 ! 0 0S(0S 2/0 S * c 0,0XE28 S0000) < (\/H4 , #:0L6QS00R0">! 0# 0E<4 L , 080$2#0 0D <0@00,!ςC!, \0 R0.*,&R 0 04.>Â0!2c,0\<8,"΃0,!/#148448 000S, P00 T 'V00~||{d{tz0zܙyyx@2/0, S *P0~ 0<Ry$0c h0,0000V)L40E(\/H280S<0,0,#:Q 6S00\0,>! 0Î>c80 <8,0P<4?!̀?0 0"!/C1 ͌8 , 0< R00 P0#0  0C0  BQ $0h0  0dR,0  ^ 000 S04000Q4` , PTd 80<  \0 Q00000SPT8< 200/, S *($^0<P04 0=R4%0c @Dh00000,U, E)L280S<08\?H40000#:Q6S00R0">! 0# >c80 <80,<P4?!̀?0 0"!/C1 ͌8 0 0< R,0 P0#<,0 RQ  \QE% 8<&& P:#R4dP0(00 6 :Ϡ6S P00Q$0! !>0%!E!2c 8P, \?H/)L0 1!̀/0,0S400#0S > , 00 4  .1A0H L h000,00 C00 00S ^< 0 h0 BQ0 D00@ h0 C0000S \ 00 $0h0+;  +; ]sp; 0 - -MR- -O O-Mp`4=[K@008[0W0 V& 0< 㨀L   ?0PP o 0PP@v> 0`0?d000P0?T0 00 4`80?<00: <0 1:0K2[4+04@000  000T :0x0PQ 0TP dPB PC 4`P~0S{ Rx R t R p 0 0E 0`@Sd ?@$ #@TET0}N0`@d0Z0@pPD0 v^DP PEI0H0|00 0G 0X0lx0000P0S0 Cp P p p($ P\,P'   "4@SR0S S00x@0U0Y0Z0W|0 Rx0 R{t̠ ZZ<8P0>C0: :J0p0t 0@`P Vw x0S FZptp0H00@@D x0@0P 6 ?O 2 0SXv 0 !"0#/!! p . /J㨀l B p0S!w0'0S00#0S>0 Av.@ B Q PS000S Q0Y004qpp I 0qp ` VP@ 0 ?oR20SY0 0ߍ!Y0x0X!qp@7 Q"0 00R@,NS) x0 P0,P[000 `0  ZR 0`S 00@ Y0 0x@vY0S 0 0V0ZS dx ` ?PxT0 ?8x<0 ?@xD0 ?HxL04`X\VZP O`1YT00.Y0S'@T9)P L@(|r@"bW02/:"  @b"R0(Y0S0 \TP'jLPP⨀& @@ ߍdT0/ 0%)$B@C "!!b0C0 ,U0U @p0!0S 8! B^ 9  0  F_qp3  @8pcX#00X0S@̠+x00@ ̠Z% ZZ ʳ!{X!Q  s!P nXT00kX0Sd @0!_X00X< 0 "2#@TÿRXT004O<܁@-@ aBp630T^L00P 0 0R/P/ /<n|n  DP 0 H Sp@-`P P 0@ #  TQp Pp/mmH  P/j.0 0# /P/@x000@-PP Lo>O@ 0" P0 0A-@P @`pP0% P @PPA-`X@@P jNpP0& P @PPA-`X@@DP H@pP0& P @PPO- M` pP9 `젟$ PP P oN & P @P0S  Ѝ{ ,/@ W P _=0p0SkA-PpQ `@Q IP@D 0DB(000S  t@- M`ppPP) V  y00S@ V0"S# 0p000S0 07/ ЍV0"S1Ds`0pX000S @ Ѝ1Ds( 4>$ ts@-@ @O-MP@`U  PP2S_PS PW Pp B ` Ta@` L`P) 0nS: P= FP 00Q Q P  IPB"0 S 000P Ѝt0 0 0S Ѝ0oSP  r|qO-BMM@p*V0d `0 0 LP:KFPP  8LPq00OP C JP@P`"  0PP?p 0P0  0PP1p te@P% 0z40D0 t0 dQ`k`V`pP  `pu 0 PP~ ?@PP0 PpL tP P U 00BލЍP/U ` P p8U0SL  @P @0 PPHp=  _@sUX 0 0@PH! 0 0 0`UX 0 0s@0P`SU  x 0 00utPtV00):U 0 0L@P0Uh0 P0@   @@x$U@ 0 07@PoqTqqpon8nnm-M 0  HPЍ -M 0  2PЍ >-M  0  PЍ ?-M00 0 CPЍl--( 0P    0/ 00H8p@-P?U@pT,0,? 0`0  6/p0lp@-P{?U@pT000? 0`40  6/pk@-@P 000l3/,xk@-@P 000l3/4kp@-PU?o@20Sp 0 003/jp@-P`UV00P00@Sp$ 0P5/djp@-PU?o@20Sp 0 003/jp@-`P3@PpT000 00@p@/lip@-P>@P p$0 00B3/p Xi-@- M  mp@,0(00G3/ Ѝ@ Ѝ/i@-mp@ 000G3/dhG-`-P@ M 0 0uH0Sp ЍS80 00MP@:/hG-`-P@ M 0 0~0Sp ЍqS80 00aP@:/`g@20!P (///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ /////iihhhhhhhh|hlh\hLh$0( 0C\ 0 C$ R*0#$00S$0 537$ $050;B,0!PpO-DM0PfXp0 0 0 R0   Ca > R R%3j?F$0P$ 0 @X Q< `@@ QQ3 Q0 S0A1@ 8,0Q k S40 5,37,050,00 00 Q, P0Ç0,  0, 0 Q_@Q8,0P ^ S 5>37 ,05 5Q0,0U 0 CQ * 0C,Q*0#  ,0 0,0S 537,,05 50S; 5A7,05 50,0SER0#0C R800C 2%3j8G$0nS 5<37,058`0,0 ?R0@SKQ 00,0S 5#37 5,050,0 QS 57,05 50,0S R0#0C R00CP,@DЍQ| P`0 pFQ)Q* AR  bQZ fQ ?R0@SP  b@S8 B;; C#, 0c0#80 S ,0 S40 5,37 5,050,0FQ0 0 ,0R S5 7 ,050,0 5RS@fp 5=37 ,05 0,0 0[p`0G%:u0@$0?Q` R]  a2! A,0!p  @`+ 8 Q,Q 5<37 5,5,8Q,  P,  , Q0@/p`0``` VRQPW   P [P=Q,0 S 57 5,050,000 R,0 Q  ,00,0 R`0W  R S`` 0P`0S 5<37,05 50,00809Q4 5,37,5 5,@p`0p 0: S \0 080Fp IލЍpNO00@IލЍpN00(X-M 0  PЍ P 80Q 0 08080//p@-@P P`P  PP u Q@P  p@*PPp-404-0 M  0 ЍЍ/,P --M  Ѝ Ѝ// -@-M"O<@@P 00  0Ѝ@Ѝ/T,0-@- M@0OP  Ѝ@Ѝ/O-`Pq,Mp;  RP$ Ppp @P$PX P@ @ 0 PX N ,Ѝ000:Q!0P00,Ѝ8p@-(M0P `& (Ѝp0 0 `,p@-@`PNpp p@808 0p@-(M0P `& (Ѝp,Hp@-P@0 @  0`Npp p@n,0@-,MP@Np  y&8 ^,Ѝ0Xp@-PP0 (M@ 0`sNp  a& F(Ѝp(,C-PP@,M@/ `  p`FV`R V `@0@ bT ?NA ,Ѝ00 0:200,Ѝ8p@-(M0P `& (Ѝp0 0 ,p@-@`PNpp p@808 0p@-(M0P `% (ЍpL,Hp@-P@0 @  0`Mpp p@z,0@-,MP@Mp  %8 j,Ѝ0Xp@-PP0 (M@ 0`Mp  % R(Ѝpd, P $ Q80 8@-M80@08 Ѝ880/LL0000 0< R 80880Ѝ/hP/p@-@0@00S 000 Xr x PP d00B/P00pDCP0j0,NNO-@PM3 00 P:E `C7 ?O0]0PSppp0 0CV Y 1AUU V00- Y^ 1AUU1 0`Fs R30< ppp0 0C5 U 0U4 [ 2 0000i`K L 0Rs L 0 0 B0SH Lu0a Ѝ V00 0 `L 0 v0pHX20S) 0 Bh P 0 B`F`  BLuZ 0 BQ  BL 0 G Ld 0 :0S B 01 0 ,wЍ0S \EPE U_* 0 [L!X 0 0 0,p@-@PHLpp p@0RS00 /H0H0p@-@  @P+Lpp p@,40 Q00 0R00 /,p@-`@P LpT T   p@php@-P X @ 00`KpTT  p@p,O-P!M o 1D`00 S,0H?@@Q^ L  10$+10[CPp `u,  PPDEQ|0Bp5 q@[0 S8 0?# R R!R@[u`  ,0 0 L00NC1000P,0@Ѝ h 0 00z ,D0D 0@-00 @T /AP80@080 @-@P !AP80@080-M0 Ѝ-M0 ЍO-PiMOȡ@̑Ёرt Qp`P P?`K͌V P`?K͌U P ?F͌(Z P>F͌(Y P6>C͌ X PT>JB͌81S P$ >̌[ P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@Pp@pP@P@P@P(@P@PP@(P@Px@PP( @Q80 <0x100C00S000C(0h0P 0@pDP@ 0ApP? ,  ` 0Z`! 0j1 W40 0 0 0 ` V  ,0 `V,0Z 0 ``dqYh  0 [ aPiߍ, 0!`0 1S ,00 0 ఑1S D 0|0 0?p00m(,P࠳0A Q Q(`80 0@$4 [$  B `R6     @T  @T,0[  @,匠$ Z!@p,0P p W  `,0R4 @80\ 00 0 0R-@pP@ 1L00PPX1P PP00P0001T00P1 X000`P`(, A$48`@@D 0P0A 0HZMH0Uj0 @, P  X 0h1T1 P0 ` 0V0p00 `V0X,00 P `ܰA[@` @PdP ` V @ T 0PZPD0U |Z 0$4,8`@@U 0 (P!  AA8@@$,4 Y-Tp0 p,`0 @@DH \V 0f1`Z1 @0 p P0U000 PU0V ,00 @ P尡XP 0@P P U `Z@@ DH @\p>\ ``,   , HH0X p0尡D0| 0 e>p[`p 00  0 ^ p 0 p`  0V  0` P  0U ` 0 P   0Z0^ύ P   0[0Jύ P   0X0̍ P   0Y0q΍ Pp   0W0( 0 $ B4U,8`@@ p`0, `$@  ,P0UH@少FʗD|=pTpYP$, `48@UpD0 0 0Rz 0St 0 P,00 8UK e 0PSa 0L000 @T @LT0 ,000 @(0P$ ` pC,U48@0 @,0@10 ,P0U 0H !Aʓ D  |:=p0 0Q1B?pPp@`P P @T  `Pp0(0S](0 00C00,Pp` V% 000 B!0 SB  0 T00 @T P@T0 ,P000 @0,,0Q0@ 0@1.0`` PPp@#P @T  p` P`p0SK 00  P,01U e!0PS:  P0 0 0 @ T @uT0 ,00 0 @T!0R1VP@P0Px @U  0P0 0$4,8`@@0`$@(0 SX(0 @00C00, [$ 0 0 B 0!0@SC  0 X 0 0< P U  PU0,00 0 P0|,0Q0P Pa}@~0P  T  0 @5 0 0R}080000Sx$ `,48@f@dO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 {0S  1s0S N x8@-M@ @ 04@P$( ,Ѝ,@-M@ @ 04@P$( ,eЍx,d0d 0 R/DHQ @Q$00?H/4,x$X0P0/ D D  R #@ R 00?H/x$0P09 A-D   R'P?HU0`@S@T:,p10 0D C   S(  @T #@ R 00/Lx$0 00<,tP h H ?30 R - D#@ DR<0@ 0D//x$O-P␲*!f><^vyhx<x0l 0 S/wG-MTФPpk @+(@V($p T0CS0St3`PL$L :k{K[+; @0H`80@ &p % % % %!<%8!%,!#`!#"%("$%P"4%x",%"%" #~ $@!#!#!d""e"#-fh@#`"jlh# nkp{#rKt[v+x;z |:p R 0S (@0800S \ЍQ <2 0 0)D$'l J p@@\  0(PU(00Ѝ>A@J@ < ^v#x:}'z#w0# 0sH#pp-m-j`_g|doap^r[yXzU{R@|Oh}Lu +,-.`afghijklmnopqrstuvwxyz{|}Lyxvv<t vA-'^X`` p@  @0\(`V(PLtO-MP6 p6006006000Jҭ`∂0 0S00 U0SpC0px @v   $ `00 4S 0 0 40 s0 0bR$ 4S4 0%00 Ѝ$0 s 00bR4S 0㋰ ?;21 R R2 $Ad r  `R$ $ Q 00%0  0U0pS0p @   $ `00 4S| 4 0 0  ;0V $Q B q/ 0 ; 0Gpl4 S S04X0Sb 4 000r0  cR$HU v p p P pop P 44 $0$ s 00bR4d3 0 0gS D3051E `F pS 3051E `7 p2 0 C0  ; 0ۿ p [K40q0cR 4S0\20$0$ 0Cr?o  aR2$0 p 0G+ p 0$  0 s0 0bR40 ;0⚿p P< pI 40 s0 0bR4 4$R{ 4 00 0q0cR 40 s0 0bR41E00#?c pF0E00#?c p:`000! 00, 4 00 40 s0 0bR 440`00ćx   0  ;  0@āC/ጀO-@PSDM3P0 8 `$Qq  :Q#R3Z 300S 8Q+P@P@P@p@-@pQP;6P 66P 4P10S. ,P:  p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S000@Sp0@S mS 0C ;S P  0@S;C o  O-P0MHvSp`8f` `JP S0ʍ ` 0rr H"R` (0$00 03S1PK T$1P  0XSl%$ `%T 0T5"00D4S03P00S7 p0S4 4S. 4S 0t/、 @W㌑T2p" 0Pr 00@p2Z& LQU# P P EP }zoH5S4S 4S0?o2 gY=t3@x2 PvX  45PZ<3@x2  *5Px2?;~0x2W  5Px28x2X>3@|2 PT 00@|2fЍ0 hD $@$ <% p 0$0(0DXe 4P~ Y 4P Z# 4Pp2?;~0p2x20P90l 0rr G"R`p2Z3@B|2yZZ#ZWW-  4P(x28x2>3@|2_Y>0@p2}Z% ?C>3@|2&P QX+W  ^4Px2.#@|"8x2D>3@|2P 9>3@|28dx0 00X00- $ Tx Xl l  \pT 0t 0x|" Q|dr804  P X0 0//O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-M娑\ QЍⰏ |pPl0@P QR00  IP7 _ /0M CR0200ЍⰏpP00  " P"  # 0P ;ర#+$;`帰 就帱0 HHhL]T W|@0 <00(r A-@P1Pp Pp@p `EPE`0 t2U @0 g 2@ p@-\`P@T 0S1 RT0S@@10S,p@ڥG-l@`pS0 ST0S"Q0S 0ST0A-0M`@@xP, _ /0@M CSpj0 p 0p@R~"  2 0QU 91 P*#" ^@WۍL◺㼿mtDmX - LM  R  ʂ0   Ѝ(X0 Q0L 00S P:@- %m/Ŀ0 0p@-P0S$ :@#RA# #p `0:#P#c BU0:#!BA##p\T0 P-0M 00S ʃ0  6 Ѝ䌾804  P T0 0//,p@-Pỷ|``p@0@ 60SP0P0:3S 8 L40 00 :#pܽO- Mtpp3 hS0dP`0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S t2051E `dpx  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y  ` 0  S (q 1lR Q   Ѝ3p   B/oq"`Rm0E00#?c Ѝ 0X0 T0R0>&!4  8ii|i(i0h0g5p  , j,Ѝ00@-,MP ! _,Ѝ0-M 0  ЍT0P 0@-M0  0@, !  Ѝ蘲,t0t00@-@ P M@4p , 0 00 00P  eЍ0<,0@-M@P4p , 0 00 00P  LЍ0-M0 0,0 0  ;Ѝ000 00:3S '/O-J03\ 4P"Xapp`'P 0pp'P=o6τ p_ͭ dc0 0#d#l`m0 F?2?Y 0pw2w ?0b2P`(0$ 300 0謰`p@-D@D0@Ppp$ $0l m 0 p@`p@-@0@P:#Rx  ^d - # 0ppAP`p-:p$dp@-@0@P :QpÓ\\p- #ppP`p :0$dp@-@0@P:#Rx Ó \ "R-- , #ppP`p:p舭$0@p@-S@PP @p (0008 <@%8 ppج,L0L 0@-@0:#R#R"#0:ꄬl0l 0@-@ :QQ- :(0 0@-@ :QQ σ #ppvPb :謫0 0@-@ :QQ σ #ppNP: : 0 0p@-@P :QQ t Ã#pp Pp  :fpl0 0@-@ :QQ σ #ppP` :Q贩p@-@0@P:#R  Pp @8 %8 "R--  #ppP`p:pp8 : $,@-<@<0@00:3S 0 0 $ @-8@80@00:3S00|Ч 0 0@-@:#R#R /` ppb`B" `"# dP`P:#Rp@-@0@P:#R#R! /@ ppb@Bh @  #/P`p:#Rp dp@-PPP. 0@` :QQ! “Tlƒt l pp#P`p :Qppإd0 00,0 00Ф,@-@Z Mqm"pQ* c0 0 `00050 508003 Ѝ0 < 503 ЍL L0 0`0` Vj#cP`꘤< 0 000:P/x 0 0@-00嬰HT0T 00:3S 0 @-ppc$P`/X0X 00 :3S 0- @-ppAP`/ᴢ$0$ 000:#Rs/L$0$ 000:#Ru/00, 000:#Rs30/(0( 000:#Ru30/ᤡ 0 000:/dp@-MP@0 PhD`000ss?p 0Sx000 SC q R0 :#Ѝp R 00(00 3/Ѝp(MA-MQAP@0Sq QP 0S `\ 1 hDP00pp10p Q41 1`p0V0S  \100V0S  034pp~# 03, ppm/%ЍP  QÁP 0:Pl  ` A   0.0 0<.00MHL,L@-,@@0S.00J@-$@@0St.00J@-MP@@ 0S ЍP400   C.0 0Ѝ`J8@-Md@@ 0SЍ . 0R  (00 Ѝ . II@-$M @00! 0@ @00@ #TP0 { p @` 寬P @PE0S 0  `PЍ` D OP 00 C40Ѝ @0 ꀋP0  0 /8,( 400 000S :P /L0 H0 0S :-P /᠉400 000S :P /DL0 H0 0S :-P /400 000S :P /ᤈH@- @@\ ʌP 0 @}d0 0@-0@T J 3$S B0pQ d7@.P < @ 804 000S :P V/xX PT 00 R0S *P@04//0000 000S :P a/̆L0L 000S :P @-Pp @,/ጆ0 0A-0`V* Z 3$SP! #Rp@4Sopp3@Tw A7B0tQ 6A.0,0@- @  @^P000 000S :P F/00O-` MX$ p P 0 Wp @PP  0 PKp@ 0 #@ Ī Ѝ@؄P  P /p@-JP 3S P`4`0P⤪3V埪  0s3 S00 0ʩP 2 $R 0X0S H03 20X #$04p03pp%Dp@-jP @3S @P4P0@`3Sp@ A-`Pe JSU>sW; 3$@PS2 SW)N0, S0s0 `SWP3PSSpP4Sbpp3PUp,0\4000?0C00401C0010L10|1spp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `ႪP LTL VW PT VW  H000S8 0g0 0 xxO-(\ ?p9P`6PPP0 C CC/2P'P@@V (P P0` @ CP0 @ CX0埘!0`0SZ03@8 00&`x0@-?0p   0 0X( `@B$ pP`@U  0000X~8A-@PQP% pW0!  0S0,000 R   R   R  P 4`T `TX *P Q Sp QW02ߨ}p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S -03@0SpX@ (@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S H000080S@08@0p4p\zD0D 0 0S P@ ?# Q@080//x,$0Q 00/x,$0Q 00y/dx,L0L0p@-PR ` ?@gpp8x,d0Q` 000S X@ (@ 8Q@@//w,0 00dw,0 001@w,p@-P`0`0@T X0:20T1S@0?;@0M8000080S@08@0pw,P Q@0?30R@080//Rm/R/p@-@S `P?[ppRP X @0*8"@0 8 R #@( @ //P@/p: x0 0F  Q SC$ 0R U E(p$ 0*$` P0`00BTP @T 80@Tp` 0UM,A-PP0P`00@Q0 0S: $0P pT00pW  0T8KP, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 Q0@ B( `p0,0,0CA`1@ L0S( X8: 0@-BE? 080 P R00 8$P R  R0 00S00!R0$R0 R d1S0800800080$O-`QMRDp0[{PPv ሰ P,s ᚚP@0b W4) H0X?@S < ``@ `F0+; 008+;B H0|0$T`7 P \ l0 @8*BCЍfP4, 㡙P& :"R- 0 RH0SI 0p V0 0 @@  ʨOЍ  PЍA-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,@PP D00cD0C 0R p$`!b00P@0RЍPЍD@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI 㽚L1D00S*Y p$`(D0@p`0S00,0U00 D0@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @Bx$0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ0A,H@- @  0M0 KЍp@P-00 Q08SM$ 03Ѝ?P8 /-M 0  0N NLN ЍO-QPDM0@hlp0PtPx` RK TNP@[ B^@D࠳UEPpApWAA^@PU0EP pCpW[[3AP!p lp0@,00@0@0*l@ 0 @V 0 000@ X@* p0 Y DЍ  P Qp X@* 0Q0 00C0C8?O-, 0(0\ ,0!0s0 S ^LPNP0 (00S@P0 R] (0S&,(Ο 0L XΟP LT R8  , !B$  Q$  \(  r Q  , R(  0 ,!$ 4  R 80X@D0|c00 }p 0SL01H@804 0,0000q,04 0Y 0Y 00S0` S0F0R8040,00p0y'09!IAYڸ@LH\R\ 0YpH0@\0S0000P P 00 SPR P)!R00S 00P ɟ`V0 0CS SppK 0 0S0 p @S P0P ` P R  0R  `T:,00Se@ Q0C0] 0 S00( 0S(00000 0 S(00 R0 000:3s T  T R 0` (`  R r@  t@T,0Q0@t@T80]P000S_8, 0@000h0S(00S80t00S. 80m 9m8, 0`V 00PP0 0C<0S HD D0L  LL l<0L\oɟ`V?A80\V 0TD@00 R 0 R PPZx !YR   oY $Rd  0E0 0p\   0E  @000$R , 6@  c@000!Rp{ :w5 8000Vs00C000C0P6, 00S>0 5# X0:h2 , 06@He0` 08 0  4P, pu'00S  @Gp 1P11qW\5r0  @00 00S 0 5# X0:h280V @ 03@0S 0S4, 0Q0A 00C0|tp0 SPP 11 1R@pY{ RRQ^ 0    V#, R R   p6#`FpPC30`P@ !?3 pGWaFP `?0@0p00L0H0P 0P0P00` `0zP0T0<^L P0 R3(080 y 800  P, 020 1p`lЍyP0080 80@080B- R d1SlЍ( 0 0=pw \P1, p0, Q0A0`Ӈ8`! ,\PY @@PY 7P0@, QaJ   8@,@ APX@T `P `p)x_`P$hPT` P0 @ ` p, P@APUEDP P " Y   @@T`Q 0B0CPcP P8p0 CQQ @0p  0@4$<0S  P 0,0[1,01`w @@`[o P  XPj0$00S 0$ p0@X4<PLPA\P0(0 0S(0,0 ` p, Jz @W0,  \B `}80-0 @00C(@ 0 080 b00C{ 0PXx  0Q04`000CP0 X0H080 0DP# @ \ 80@ 开J U0L J D |pPg d1Sd , 4@  TP:X X0P@ Z@DT 0H H00HE@L00: 80 0R,`0A0X0000C 0@P `040 0E00մ P0U U R R  X R RR)0SE 0 R@H$@ ` `)0,0 000 0S 0 PC@08 U0 00P$b pQ_ R$R $Ry X  QCH5S@ ` 9, @ 0  `n@ 00p0 `a00P w 0@`P 0 B00j 0 PD0 0p 0 P8+ 40U( R X R$R`V_ 0 0 0 t:, `@p@0` 0UH%RPR p RO $R $R X  Q R; L5S>  $;, `@ u0  `@ 00ph0 `00P  X0@`P 0 B00 K0 v  Q@  0`000 @000P  T P$ , |<@ !0   @000P" , <0 0  0 A R! U =p, @@0 0p1S U d=, @`@0 0PL5S 0 0RU =p, @@0 0Lp0 0 0 7@000N, 0>@ 0  `C0` !@000tW 5  0 U@`; 0 0LP2Pj @00p U xʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0` 0HRUnH50S0X0S*  0 0 00, @p@0` 0H6U~0 0 0 @000jP$pPb9hp@-@P`M`/ 0P0 R    80x  t000 000P 0  Ѝp80 @0 @'b000c``DЍp0 00,G-0M@PP  ",TX " \A` JPlppPg80 T0@000cp;`P`+``D0Ѝ0Ѝ@-@P @TO-PP ! 7 1D00S0H``?c`S., p !@G'T :#| 0cp @W0 S 8 0? P PP0 S  0 00l, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $0`U VP `ɊVp`<0P 0@PUpT` @届T @pp!` A!@-@P@圊T R/0A-p,SP` @T @冊T0`PS RQ A0@ ", "Q//@-`Q'pP@0D "! "T "! "U ^ 0N "! "\^pPV@@-@@@0S (0P0C(0itO-M|:|z|*0p(P܂ pP L*40\b S @ s!@nRXl HR@ @i`80IS0c0@T ^OoB@TP AA  RR0)\ 4  |  bR\ P)` R&@) R! CP'I@0 8R S[80S  5( 0P00B(0X @C0 8R CPf S ^\ `( 00Q @800 808,0RJ0H 0@0( (P)0S700S00l0S# 0 S 0 80R#0l 0 P0S  0P(0@P(H70 RЍ07 0, w(,04 SBG@ `a & ,04 S5(&0CP ,00xP0S (0P0C(0Il&@ : \&0 0@,@ R 50$600 80RpfF`@000 (P0 80@P0,@Sf 40 CRbڨ%% pp|% p%@ 4p,`Y | `nR`F`V,00P0S   ( 0P00B(0X``!R  @ Q[Q $ 0,@  B0 00C S[ p@40084 0,0104#0zd4`000P ^% (@(#P@ ,@i4 Rv 0[, q  P+ p# l d# ,@(@?QW, 0 #\ (6 ,@  P Q0,@( R $@ P  @ lP " 1 200  0 m80 S -] *(D2 0( ܀(B@0S  \( 0P00B(0܀( 00P0 ! 뼱 40,`V7ڨA@ 10,`4 V0`Fx!,`0 xP0S %( 0P00B(00@'A@0S  ( 0P00B(0 0@ `d(Px PL8$`Dг$XԱdx,(pO-hs Md3p`C@4 P t8040800c`,0P Zn38@3`0T'#0CS 802PL좟 a0@DS,00S0 0l0S R "0 0A 208@0P0T0hP \RP4 @P 0, 0CS NP 20 0 P1084 0, Ѝ04S00h0S40~1 0T4 9 @ P0P@1,`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, p0  8@0SRC0PE@DP8@K 00SL008PP|<d$hԪĪ`(@- 8 40,0(@- 8 40,0Щ1!0O- @ M *BT8 h!O T!0 pR( X+ 0S#,PK U`0   R    PU0 PU0P0U0 S @T ЍpW,0P q`W0 P`00P0 [SV 040 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/O- M똅P2 5` 80s5 t SD Pr T@R!1S<50 (5p0 P\`崦 50 00P 40 0400:@ p0 @ l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SO\Q*SvVrE Q SV_~V= Q SVWV5 Q SV@, Q SV# Q SV Q SVWV Q@S  ![=0Y2 0 C S@p"0TP!pR t0S8"R ,ŸU0 8@=0A00+ 1OaLOp`PU 0S 100S H0Z 0H0 , 0Q  ZTPU ЍZ 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sr Sp Sn Sl Sj Sh SWehУTxh1P0S\ PNPN D QG\E,@- 00ʃlœ\ 1:t“ '^ tƒ'΃r 'tƒr A\ B\ r^tƒ    //<**1P0? 00` P9ʀ: l2'΀S00r200 /@ P 0000CS0 00000000000000000/X())p@-P@M@(\\" rf Ptf vf0 P P 00 (000 0Ѝp(hPd-X\\ rtv /\0 0 t 00S `0008=0!@00 R/@- L($$1 @-00*l"R @!@ R  (1:'.r"tB00 R @R   AR  4@\%%0 000:h/p@-`@M0@P0*l"R R &Ѝp   P 00 00@ 0 @ &Ѝp`   P H00 040@ 0 @ &ЍphT@2C-08R M0@PS "03@ @  "0S 1hp0&R  l"R R- ! f#@ @080@0 Ѝ1:'.QPs23Ml120l T10 0R0!Q:20h1:'.Q"s23020 00 010!Q:20t 00 0!0h0:0!Q 40-0!Q Hh0 000/D|0| 0p@-00@00C0S S p0 S P007pPp0 0p@-0CS@0 S p0 S P00pPp0000 0p@-00P@p$p@-P@p0 0 0S JQ R@-\,AQ /,0P JP\@-\,AP /P/0S/ p@-b@ w$ x' ` B A x' +7JP@T`,PTa@@@PA w Rp03O-0`Pp$MCP@ W 叁P 0l#0C S-0 00$ЍT0 S80  2 0@  B@DT p`$ЍIɟ,0P @I%!R1 Q0@Sf000(00^0Ŝ@$ @D DP[Z :0J@D U0 $0$0Z㰁? p@0`@`Pp ~P, P U   P`X0(P I0EXUP(E 0(0C\00C_$ЍY TPP  D0|0:p H0@D002 T `V ` V `` P|,0 00,p@-@Pppp@D0D0p@-@  @Pppp@,O-@P-\60lM,0 j Q 0pu`Pa P:~0P0[ W0  <0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0>  ,500`0Pp0 @R  <0T R8 2 0<00800C?800P`FPY`00 , t480 pP p~K 0 `800`p8ppP P8 E0<,PpR%4\ Qձ(X  <R! p@p G"RX : HpG U  $ $ < S8 8 `<@(Pp4$0 ,0 1 D400pH0@0@0 0PU<$0 (Q0 0C0 St 0( 0C04 Q00SPz 80 0? n,0"8 P 0PI08p0 00i8 0k80pG0C?80J0P0C00S`FQ@0pP0000C00P0 0PS8 0B! We 0 0pGH0㴢01 WD0|0pa~lЍ#`Ꮗ& 0<0叇T R0<0 zPp 08G~lЍ`{{:~d,0 0 W,p@-@`Ppp p@I G0 0 0?,p@-@Ppp p@2Hp@-P@0 @  0`pp p@0,H0H0p@-@  @Ppp p@,00@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` O-SMԑD@ HP 0U p` @ 0Z C 4/  Z: $Z <RH!  R! ".Q   R>H P   @0 0|00  GPr 00 R0S0 0?P4/ZXЍ G\r 00 R0S@0p0pP4/pWxHQ# @-@M R ! R "R pP^  0 0@`Ѝ/@-0QM   S S PpP$@8R @ 6Ѝ40@- M@ @#ЍH0DD @-M@ @Ѝp@-0@R P\RP ^R3 @%` ,R'R{ LR @Qa0 L !a}0 p  % <{ R`VA 0 FR8h!@P`  Q ^0@! {cRE0'  p @m%X {m\R:R `O-$M`E Xz@PP 0@%pp 0 ;S p< @`\p,S0 T 0@ @0 C00  S  Qu%S+0@GS0  iP%@0@@0 `fv` 00S1.Q0*Q  0S@0 SH^0 @0%0dP% @ 00@  d 0 S-`30 @0|0 0BB   0 0p<@0D0@00 S_/{ 00P$Ѝ0 S0^0@%  0 @  %#  0 S^0p0p0 %0 0[0@%+@%#F0 0@`0 S00 @s0p 00pp  00 p   0000!010 @0r 0 p       Tp0 S\R W' I00 S{0$, l/ 0 s0`f  Sv` 0S0\S 0 S]00 C00 d,p@-@PM0P`0S SP!  0 00Pl 0 Q00Q H  < x0 Ѝp/0zzhzl(zO-M0@DS@!00@0p0S= Q0 N[AK `  8 g=M%㕞R ᫱nੑ)bP P  02#cQ0P pW$P@PW 0fSPЍЍ 0ЍG-M0@HSD!00@0p0SD CP40 ` ,k@ 3㞜>C l.b  ! ƒ120BQ0P pW$P@PT 0nSPЍ0"ЍЍPO-M0PS!0 0  0000SW @har*sE 0 `Ə⊡ - ?D%ᜲ✳B.b CĠ C,ᜁa b ! 2ਁሂBPH @G$SX t(0  n(0-( ?,D*Ec,`% f`Co1c,A ,0$0b  0Ã#3#cQP $0tS 0cS0SPP^EPE P@` P0H P[w00z H X A-pP`0\ %\0@pS sS lS P0\UUW W000@1CP0PCV`1E !F00O-PQsM<00 P` 00S040 P t@   AH Y 1   RSI X P  4  PX %X%X ,  R:@vP 400@, %0404@p;l[` @0P`@ p0 :XBX HQ  0H  P0 P`500>X A0Hs =R* =S00 C?Q^` V`1 PQ -^. 0XXC cHqQ  ^`z PA0H^l ` Y PA0Ha0Hs Rm11OSpo00sߍxI@[-&uP 00040uP, 000!^` P`1l X   QU PEQQ$Q V! 3`,  RP*P  0Y~p 40P040 P PP`1  ]1S@ 0C11$1S= X! H0 Cr 2 'X POQ0$S'St! 0S'S'SX AT 0D1S1$a @D`7&HAq0 $VX฀ `OTb 011$a t!AT @DAA$Aa0Hs RA0HS3HAڕ0     00C2"0OQ60}SS$! t! 0S}S}SP1SZ !0C1pqWu +#P1`,Q*P  0}pb 40040k10Hs Rf1tx1OS!P$!01tWAT @DA`1$P OT1a$010$1A0St00t00S|00|050S%   ?R ;R P0S %S0 01S. 0C11$AT+ #,Q,*P  4 @ , 40, P 0P`1GA0HS30H1OS!0$t100@1@`tPz 400`,Vp p2tPo 400p,000S   ?R ;RO eRQg P0S %S0 0AT @DA1 $OTC0 $01@At!`V ```&``VP``P``ù`@oobP``V ?``@Q AIQ AAT6 @D!XA1 $oV 2 tP 400,PV\`00V`00R 1&H 0 GX @pqD00@00y<!Ho0㨂00400)/000uV@p``P`V@p`K@`fpG@opC`@p?oo@pb:<  k - - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/LA-PQMp@ 0S XD NsP /P`! v00+ V T 00 PPT00k 00ЍT ↬\ 0 0 R T wT\pP0S T`D _ hD_p 0S R s0r (0 000ST00P Z  p0(0P Z  p00\"TD,4`|JlX0R@-M  ?@P Ѝ0A-pP2P U) @T`0DV 0PS |%@PV  {P soA-PR pQ 00 @`R P0 C C0CP wP (&q0 ES  jrP  0 000Q 0  R0 R   Q PAuPP0V Q \`Q  0S  0 S o W0C s0 _S0S  0 S  RQV0C s0SPUD P 0$XFPF " X$@ 9 02 0nP; sPG fPV P00?oR20S   qQ :%qP N@!qPJ9qPL2$ PP Hr$PDr yqP$!W P P  ?o2?    0SP V PC-@|QMx!pP `0y P 000S8 @ЍPP pY 0 p R 0S 0P@ P@ @/Ѝ 0 P LP+P P *[PP004XY $XWO-M Mp0:S(0S:S@ 0PS:S``!E PXP  O0 ` jP 0P:S  ۍ Ѝ@ ۍ ЍC-M4ŸM0P @p`tP8 0/SG P Q\qY PI qp4nP 0 ۍЍCDc0P L  yP"L0 \ۍЍCsO0P 0S/S ApP  qX0 ۍЍC0  PۍЍ p 0p XW L0H 0 ( $ۍЍ,0, 0  $V( < T8 T G-p`@P  ZPpU  QP `P@PP @ PT   0!G꼈p-@- M@]00 Ѝ@ Ѝ/; Ѝ@ Ѝ/@-@ppp@pp p0p@4\ 0p@-PS@:pS oP!pn @-Q @TnR  sR' fR Q P R\  Q  0 ^Q  R Q A- @X p`fS@X P0@P0@nS sS@X@@ 0 0S00@PA-P% Ppp R,R    0S,S@BJgn`P   `00ppp@G-@Xr`pP P4pWV*nU< sUZ fUH0D Y+R. @ "oP" H0D@p H0@0H0^H0nUp@0 H PL sU: fU% L00L0@ [P @P m 0S0000Y 00H0@ H00 (,00H0@, ( H0@0H0H0, 0H0 @ QH0 $H00H0$PH00H0DO-M Y pP pX` }`0( 8H0 m0P@^ P  Yp  X`   R , R < R! L R* JЍ`P    , R `P    < R `P 0   wL R `P 0@0 j 1!00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00ēA-`0p @PPUR mP!0 V0 00pp   0  0 0PlO-P@0 $M 0&P `'n`Z4 p p t m0P   0 n `| @P  Z@mm0P m $Ѝ 0 mm,` $0V p C, # @ 0 S00rPb `V X  @R`V  @R`V @TRmL`0D V@@0BL07 pfS&p @P" `V!  @0nS sSpXpp@@ p07 0 vm $Ѝ(TSHS@nh T A-P0p @``VR! lPA0 `0 00P 000f[`FPk0A-P p@`WR lP0 ` 00P 00 0PkO-LM<0< 0*0, 0, RpP ||@P00`P 00_HPtT BP>?PsPlPP p pP V 0T 0,P`4 0 ` 10#s0$090400S% $ .S  ROS> =pP 00p`v= <00P5 P 00 R,P `lLЍ#l@P= pp`v ,0 S Q0S Q0TS 0 000 00 0( P-Z80j80 R(MlPLЍ@0@SC p@t`00 000 000f0YPYi (@[  [0pP ;  )\[  R-Y %\^[\= @[0P00GS,v  0P (Z0 KrQ40E K/RN  [@ [P&,0  @ 00@&,0  H pt00 DRD00S $P Ph 0 d 0ST v 0e 0  00 0000n0g p( j807` Q  Q 0S00   p    <00  ?[/v 0 S00P0@ P  0BP,  0  80t Y80 [!0@B PT@@p, 0 0 000s0-P (g@p@tkp@t< ,0 Sg Q0S ` QL_9PeT` 2PD0  x#(00  F(.ݐP00lPp@t0t <00QK Q 0F R 0  dSM0 0\P<,0  M;0 0 0S00P& $pj0  <  `0 000P pP1,`8  t H 0 P/$P0 00 // A-M`0 KpH gMM%P| 1N;A\㓌al1#b 0 0#@B4d!PЍx P0`0>// @-MPN0 C`CNCFk,'@`0|0~Pl n "020#AB@C1dPЍ 1P00&>//, A-M@0 sb*cEQ  - ?D0垂|垃B p@LLD&$b@C >c 000@d$C4d1nPЍ p@-0M`P02u@P 0Ѝp[0 0  B0S Q20Ѝpd1!0G-@Pq0P04 0 `4 `S002,0PP00|``Q  VPe`EȄQ  V|0`0ȇ`H00@~:lT:@-@P iii i$i,ii,00!R  !(9 001/8 001P/ P/8P@--`@@7 X0@00s@ H PJI HH @|Lp@- @-C@3(M@0 `PR  U a  m!00 (ЍpP^ P L300U   U0U!00 PD ~P 200U # 0"P 0S :!00 cP00pʐ2000U 0: P 0S !00 cP00g,200U 0S?"7D7L"P  cP00100U 0 0"P 0S` !00 cP00p100U 0 pPU  mcP00(100U 0 !"?7D"wJWPP  TcP00=000U 0 EcP00<ʐ000U 0,"?7L"4P 20S0 !00 *L|LHX ll   ,  h   D   $ X80cP00 l000U 0"?7L"P 0S Y!00 cP00*000U 0"?7L"P 0S >!00 cP00+<100U 0 0"P 0S $!00 cP00oʠ10I? 00 ?G?OU" P  cP00\10E?0U 0 P 0SP !00 cP00\20A?0U 0" tP r0S  !00 jcP00J200U 09"?7L"YP W0Sz !00 OcP00(30t0U 0 "?7D">P2  ;cP00t30l0U 0"?7L"*P (0S !00 cP003000U 0"?7D"P  cP00(4000U 0  P 0S b!00 cP00fʈ400U 0  P 0S  J!00 cP0040W?U 0"?7L"P 0Sx /!00 cP00L500uU 0l P^  cP000ʐ50S?U 0"?7D"P 0S !00 cP0050\0U 0"?7L"P 0S !00 xcP00`60P0U 0w"?7D"gPy  dcP00ʬ60@0U 0"?7D"SP[  PcP0060O?U 00" @P >0S  "00 6cP00J\70M?U 00" &P $0S "00 cP0070I?*0 0Ra U   P   cP00)ʘ30l0U 0"?7L"P 0Sq Z!00 cP00C030d0U 02"?7L"P 0S` ?!00 cP00t20\0U 0c"?7L"P 0S $!00 cP00`20S?U 0"?7D"P  cP0020Q?U 00"5 P 0S "00 cP00/ʰ10d0U 00" wP u0S "00 mcP00;L10E?0U 0!   ]P [0S !00 ScP0000t0U 0"?7D"BP @0S !00 8cP00 x00 00U 0 'P %0SY !00  p,t 0l  L | l \  ` P   | @ 0 L  x < ,  x <  T  cP0000W?U 0"?7L"P 0SA 4!00 cP00D10P0U 0T P  cP00|ʌ10\0U 00"7 P 0S "00 cP00}10d0U 0l"?7L"P 0S !00 }cP00X20l0U 00" mP k0S "00 c`P ^0S !00 V2000?G?OU ""00 E 300,30K?830G?U 0?G""00 .p30|0|300 U 0?O""00 300U 0?G"{"00 30800U5m!00 40Y?%,400<U 0?G"Z"00 d40T0up40N?U 0?O"G!00 40p0U 0?G"&8"00 40U?40R?&U 0?O"5%!00 $50`0%050=dU 0?O"!00 h50h0t50050C?U 0?O"c!00 50p0S500U 0?G"!00 y50U?U 0?G""00 j460H0@60K?LU 0?O"!00 Wx60`060h0U 0?O"v"00 D60Y?fU 0?G"!00 560|070`0 70G?70T0f$70(0U 0?O"!00 \70h0h7000Us!00 700U 0?O"d"00 7000U^V!00 800O800e 0?G"ZI I 0 ?O"Us8"00 x800^0U*!00 8000U!00 80p02"00 "00 900 900A |: PI S @ "00 "00 !00 ~!00 y!00 r"00 m"00 h!00 c"00 ^"00 Y"00 T!00 O!00 H"00 C@P  =H 0?G"|P !H H 0 ?O"0Sc!00 ! 200'2009"00 ~"00 y"00 t"00 o"00 j"00 e"00 `"00 ["00 V"00 Q"00 I I "?7L"~p1 00zH1 0k0G 1 @@I  0z*0 p0!0p0 @@1 < 0b -DT! @ \ 4 <  ` 8  x P ( x P ( x P (  0 0u02I80 0z0('`0 0/00 020!00 L0 $00|0 H0 0?1 l00<1 00Sd1 001 @@  01 @@  01 @00$2 d00L2 00)t2 @@d  0i2 0[02 0e02 (0k0w$3 L0 0m'L3 p00ct3 @@$  0U3 00K3 00A3 0u07$4 40 0-L4 X00#t4 x0%0!00 R -Q*Ϡ?B0CSS*/ @RR#  S Q0 +C 0` 03S S 0A.B0 B33200P10+SQnD {ȠȠ 00+C w{0 +S0+C < / /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! 8V @D8 1,0400G*,0 4 00( @(4/P8,0S0Q 400 @-P00>  4O R 0 S. o+7N<$PI@'Np LA 0P R $ R  R S /0?0P  ,AA40q@aR 4 8S1R  .PA-@ 0` S ($ R +3/PP P4?p@8p0P$0(3/p8  $ ,  (0 0/T0 P 0S $0S 0S P? @4@P/Q Q@ \@!< < /<0C//?O- 0>$0SW$ 0  0p6?@0U 0PEt@T$0Sp0  0@7?p0U 0PEt@T$0Sw  '$   0   0s 0 8$ @pRp=?0Ur 0PEt@T7p0pp@>?00S0 G??0000CSV0S; 0@7sN?0 QP?0G(0 S@p0(00 ;?O35?0U0 0PEt@Tw0pS T<000Q?0LQjD0*;J?0\0T  0T :-0PEt@ 0S#U0P`0,P 0U 0@@00Q?0 Q 0SU 0PEt@T 0S 60> 00Q?0U 0PEt@T:D*0@D17q0D0 dh0l[X0 P #U 0PEt@ 0S\7s@D0l0[  Q?RY ?0Sx50>00Q?0MD[T U01[![d  PE}0 ` C 0 0 0D0 0CD00j`l PGT %UE 0PEt@0Rl @Dq00/ T 0 $ R4,0000 u??00U  PEt@T  v !Rs $40d0U 0PEt@ T:H0* @D7|0H0; 0;  0$ R D :/ $ R D ;/ $ R$UR?0\ \ ^qPEt@^kU@pk $0Ë 0P}( $, 0PEt@< 0QlU(|+D?q@D0D 0B  @'8w<#0#[ |20 <0X G/S3q@D0x0P0TA R K?HL0X0DSB?0 @p ~ h30`3q@D0>07s0D@C s PKl0~90r0\l^PEt@^U ,( 粰* @D7p0R !B0$ S 0l0S>/0p0P0X0Xt  0p0P 20> -@ 10>0Q?0 7?Rc0@p0~0 0p10800Q?0E?l 0f^gPEt@Ta*U 0@0Sa 0 000)QO?0 0S 0@p0,> \, PEt@ 0\LUԂp7s0D@Cq7 l  \  x I?L07O?00 s0P7s@De 0@D'q'0@ph0dlF?0 0`P 000 00Q?0)~10>0 s&SR:@ 3 @0|0L??@0ep \T d \ h P 20>v@p0SG?0hNp@-@QPP80S $ (2/$0(3/00pPA-@`9PP@p0 QR 408 B4 08@V000PA-P@Pp` 0R>/ S  "P00S  7 40S R?0P 0S $0S 0S P ?,B4 BR/  $0 /,#,3 C- M0P000@P`^0@\ S?R 0 <032   A0Q#4<0M0@0 Q Q0c  B\Q~ S Qt 0 S?Rt @0 <0@\32<0p0l0^ppWo H Q0c  R#2Q S Q0 S R*0Q  R*0Q  R:0l00p0C0l0pSp1x 000 0:P,0C4p??0 0 0 0 30 Ѝ0SypSpl0Spp l0@@@ |074P 0S $0S 0S P?,A4 BR/A/Q /@o/A-Xy@ 0(+p3/PPv 8`VG (0 ( 03/`P0 0d @ 0T   + P 45R*p 0 B0p0(0 8#8`Po RS> B0V P T  B T p  B0p0`0 0@ 0T   +P 45R:o Rp 0` B0p0$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|MP  80 @ 0 C 0T0X0ps\pW0- p p0 |Ѝ0`^`V0P@0t;JUS1@Z0@P05ᲀ0 Ts00R 0x@S0BSC@ RUP!U0!01P 0020# P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00(0S2( 0 0@0$0 0( $0,0  00 B0 4 p@ 0RPRN ࠃ0`PPҗ$ <: 80C1 ( RP@00F#3 0S# Br #RVE  ` R*  ^ F C 0 Z( V F( *FQ* BR  ( Q  Rf, %Q  R`0!LAS4 @@  0010,0!(0 , 0 $0`$ O-04M0C000 C BP [P1: cp Wۄ2  B37Rp @grq`36 B p`Wn B37`@^`pNV*jkV`H$Vc `\``\pWL\`pNWNWN\ \  ?8QPK@ U2E@ AaPA0% 2@  `"<0@ 4Ѝ`p 0D  Q2W ۅ >`V7*pG(p\ p`$p`p`p($p$p@ V(`$p PI:`~@`L\p``^`@`^`@\) \!$\```_$(@$,$ V,(`@M Qk$(@$,$ V`G(0L`$`0``$0P\(0`@&6 L LD, -0qR0Cs\@0qR0CsPO-,P$Ml0AOEx@D8SAO<@0@D000@^0| 0S`"!!Pt0@p^4! 0TT* RR 0 P ^ ^ ^YY 0 PU<PU=PU>PU?PU@PUA0PUAPR@oPP 0C 02#03/0@SPn Pf Wo0S S00\0 00#400 03 0  0#400  0 c0S0c0?o20 Ѝ0Sy<00000! S *SL0Sq00Q R0@SP Wg Wu10S0(0 Ѝ0 0S&+Bql0S0 B8@ B0 #22c0# 0l0Sb q000 R09S ES IS [SD gS0, q0S0+W  2R-C0Q` ! 0P B X:G PE [ P ! X8*H 0 ,0 SR B000SS@ ӇS  00 # #8 00#"0  0 ,  Q R I   R&   0P P0S00  P,0SQ:_ R,0, R  R [  $ R  $ 0P P0S00  P,0SQ:3 R0 c0 0t0 0  R ,00SP0^01$ ^U0 R1 200 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  P20 u0 B00>0 B00cR5 0 00c,0S+  Rg00 0 B000, g00R  0Qu RC00 00#400q00]0S+Zt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SW :W㴖s 6S \0l S B8 0 l0\000S\ R8 C0r l0\000S0Zt0(l 8`R B  ^E 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S3t0 SW S Sl 8`0 Z W 0S0^0 B000R ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs0,!ƅ0 0!1001  &6`Rt0l 0C` t0l x\0S B80 l0\0:00S;#  #800#"0  0 0 0 0 0 S0 S 00R01 q00  R000 000**W6: &R \ R80l0 C  B0 00BL0D!C0C  wt0S*l0\06~\0l S B8 0 l0\000S20k\ R80l0 C   A-`pPSq@PB Q00V0SH0S: (0sU Q P10 00000 |0 `hp' 0S)t l00\ R#6S S L0D C0 C060P@0 05 1# 0Rppp@-@0PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO-M`pH0S@DL 08Q1S00PP 0 0S $0Sx wpVoV`F0HSx0FSRt WrZpFYo᫲[iV @(& `4/@Pn * *J@0`PA,*` 4`L  L   ` B (6/ `, 8(6/ `L @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0ЍOxv `fh00$0X(0 xЍ",0  000! -M 0 @ЍA-P?Un`0 0@ 0Q@   & 0(3/@PR &@z 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C&006 0&;> 0$0;/ O-Q$M R0 x 0S!q"$!`Lß@P p`0+0*) `@$z0`&@!y0v0 qp0Pt0A1:SuPPQ "9SuPQ(6SuPQp'P5S>3uPs01+@$ "@QP`0.(Ÿ  "rQ"$ Ÿ! ! q R!   "  "rQ"$  ++ { R+! @$ $rQ"$ S4XP `QPE@QU`&Qv`a"$&@$t@a @Q"d& Q p& "r a Q d& Q@$t@A&D$ pa Q$d& "r A&D$ p!$$"C0S 0!^q"$!$Ѝ LÁ!`Q1c0@pu꼒 ` 4  ܐ x C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0   C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0    @-PP |p CMNp`P`  1!Ē"Q C 0  P`D @-PP |p CMNp`P`  1!Ē"Q C 0  P`谌 0@-1 S]N,^@C 0   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C=@L   0R `R 0PR`RP0`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0RP0 00@  0C 00 Q q00H 'ᑒi7n00R#@-qHp@#/ǠCPQ- ONւp0S P40@0P401pB RP$R&ʵςvp X`^0 `1`P$[0ఐ`G6f0C6R`0p   _pWPQ=000?10 J`P02  `;JTt`;!G XTT;岰!0 X0P0~p&0v00 0`k`$ZP`+G 0p 0⳾ `L 0L0 F0 < pR@ 0 q0CR =Y> 0 BV0 00000C00 `FR 0@N @0 0P000SQ R 0@B0 R 00QDЍP  =p`w\ / !02NX1@[ @೰6:#6\Y I0 0O-@Ⲁ MAX``PPR ಐs@D+~@ p+0  RlX+ Y|   ^  DT0V `P \( RP|\ P`PP8 TA ` 0P X 7  Rʰ ^ T0. `P\ T0$  ^ T0 `P ^T0 `P T 0 P XР Ѝ  O-$MⲰ[PPR|1Z@+8+00+0`0* X [Pv S ~:|:0nSWuPT0N`PppPP`pp.pn\Πv|P::0lSWuP0L`PppPP0`pp#40060c^~P H\xƂ0̅|PP0PP#4 0ƒ0lLXxP0QPƃ9 Q0T pQ `k^⧎P p@6a pA S#0r 0   0#406 c0TBt `V 6 pW @0S p`W0\  P`Q U0p XF+=00c^0~ P0CppP .pp 0n\Π| S6`FPQ3ps00p00Ppp#406c 0CVn`6D0Th pW `k007PlUs0PL 0pp00P #4pp0060c^~0 \ƂR `FPQ̃6p|pPpp,Ġƒl LVn`Ƃ 0T# pQ(0 S P `a\uP p 0\0 `W5 p 0 S$Ѝ0pvH Qx066㳀 H Qx6Ƃ峀v P `'0 S P `0 S  P`0@\ 0V p` 0 @`NʀO-M6S 3k^P003`0030 0300300A @b9 Ts0@ Bp000@p#406 0c^&6S6 ⼖@ `0$0 p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಀphY>s0H000#4060cWsw0 p0@sW hD B@gTr >s0=pG@000@#406p0cR#6 SveF&0PnR2s0 NP0``00 @#4PP0&0b Qq0&0Ѝ 0&;p0v7 H 8 ,  0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4j>0C&&0A-@ s0`P Q!r  pp "$  a AS2s 6 u u0U0U$0Q  00  0  000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@T, R 0p#&]P+}(+z0O p ! R<AQ j  &!R*\ R3 "[(&0 Z)p:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0ßk>0 NΌ⼦  Z*r   "$ 缦 j JPp Q ἦ ? <  K O  \ P+R +R ,RE R  Q ,P3 "[Z6 Sap3 s0000 #406 c 0CPp P66 O.V G.0 0S0 0xS0  0LS4j>X0C&&  Ѝ &]R3 "[jP ЍOb Pj 0 r :s0q#0r Ȃ p ~ :Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  | 0S A-@P p0 C`9%VUV `%P $/@- M`@p(PP PO  7% `p 9 @P Ѝ藷 @@ Ѝ葷@@ꍷ@9T  Ѝp@-P(@P @!000px 00p@-@(0P 0000g 00dp@-MP`(@P P @ 00$p 9PЍpIP9U CPЍp0A-S ` @p0 CP$U, 0 $y1r1FPPO$0A-S ` @p0 CP|$U 0 $t3i4FPP+$0S A- p@P0 C`X$V `/0S A- `@p0 CP>$U $y1r1FPPö#/0S A- `@p0 CP$U x$t3i4FPP塶#/0@- M@ %$p  P Ѝ0艶 Ѝ0腶0 Ѝ00@- M@ $p y!r!F P Ѝ0o Ѝ0k0 Ѝ00@- M@ #p t#i$F P Ѝ0U Ѝ0Q0 Ѝ0- M Ѝ- MtiF Ѝp@-@P $t3i4FPPpp@-@P#l?o2FP p00pp@-P`f@PP  PD#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@" @-@@? @-@@X @-@@q @-@~@ @-@x@ @-@r@ @-@l@ @-@f@ @-@`@ @-@Z@@-@T@'@-@N@>@-@H@U@-@B@mp@-P`x @PP  P"pp@-P`f @PP  yP"pp@-P`T @PP  gP"pp@-P`B @PP  UP"pp@-P`0P. @PP  APp"pp@-P` @PP  /P^"pp@-P` @PP  PL"pp@-P` @PP   P:"pp@-P` @PP  P("pp@-P`0P @PP  P"pp@-P` @PP  P"pp@-P` @PP  P!pp@-P` @PP  P!pp@-P` @PP  P!pp@-P`0P @PP  P!pp@-P`z @PP  wP!pp@-P`h @PP  eP!pp@-P`V @PP  SP!pp@-P`D @PP  APp!pp@-P`0P0 @PP  -P\!pp@-P@!g>t3GP p%0P 0pp@-P`@PP   P9!pp@-P`@PP  P(!pp@-`P@!aaFP pP U pp@-P`t@PP  P pp@-P`@PP  P pA-P\@!g>t3GP pj4`P  P `5p@-P>@e!g>t3GP p0P 0pp@-P`'@PP  |P pp@-P`@PP  kP pp@-@RP aP pp@-@{P'!l?o2FP p00pp@-P`@PP  Pn pp@-P@PP P_ p@-@J@ @-@D@ @-@>@ @-@8@ @-@2@- @-@,@= @-@&@Z @-@ @s @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@* @-@@B @-@@Y @-@@p @-@@ p@-P`@PP  Pp0p@-P@PP Ppp@-P`p@PP  Pp0p@-P^@PP Ppp@-P`M@PP  Pp0p@-P;@PP P~pp@-P`*@PP  Plp0p@-P@PP P[pp@-P`0P@PP  _PGpp@-P0P@PP P5pp@-P`@PP  ;P#p0p@-P@PP kPpp@-P`@PP  Pp0p@-P@PP HPpp@-P`@PP  Pp0p@-P@PP %Ppp@-P`x@PP  Pp0p@-Pf@PP Ppp@-P`0PS@PP  Ppp@-P0P@@PP Ppp@-P`E@PP  Pqp p@-P3@PP P`pp@-P`"@PP  fPNp p@-P@PP P=pp@-P`@PP  CP+p p@-P@PP sPpp@-P`@PP   Pp p@-P@PP PPpp@-P`0P@PP  Ppp@-P0P@PP *Ppp@-P`@PP  Pp p@-P@PP Ppp@-P`p@PP  Pp p@-P^@PP Ppp@-P`M@PP  Pyp p@-P;@PP Phpp@-P`*@PP  nPVp p@-P@PP PEpp@-P`0P@PP  IP1pp@-P0P@PP xPpp@-P @g>t3GP p0P 0pp@-P`x@PP  Ppp@-Ph@PP FPpp@-P`^@PP  Ppp@-PN@PP &Ppp@-`P@caaFP pP U xpp@-P`@PP  Ppp@-P`(@PP  Ppp@-P @PP Ppp@-P @PP PopA-PZ@g>t3GP -p/`P  DP `g1p@-P<@g>t3GP p0P 0pp@-P`@PP  FP.pp@-P@PP xPpp@-P`@PP  &Ppp@-P@PP XPpp@-@QP NPpp@-@RP Ppp@-@0 P 00p@PP=!0S 8!pv1!0Y@- @@!u\Y P 0R @-P Q o//a ` P ኩt@-0, H-` @-P Q @x0ft0 Hg0 H` d` 0S p@- X@P`@@PpGP p@< p؈A-P`p! .@P  5P` pp KP` ( U @C0 :070=DDWp@-P @`PpP p@@- .@P $ 0 0 0 0A-pP .@P  0 0 0 VPr.`P  ᮬ` P(/0 Hp@] @-@P 8@ l}0E/HZx] -A-M `V $P 0P7@P9.pP  0P7 GЍAЍ/ЍAЍ/U>Q/H,\ 00\ @-@P @ '}0E/Hd\ p@-@P x0 0 0R0 P-0P Q >" p@Npp[ p@-@P `0 0 0R P-0P Q " p@pTL[ P/0 0 0R /܃P/<0 0 0R0/P///ᰃZ @-P d0o0 0QP  00SQ !PLZ P/0 0 0R/܂@-@P \0 0 0R  j-0P Q !00ꨂY P/00 0 0RP///4dY A-PPM 0/o0" 0P R Ѝ R0 0 p(-`P 0 S  R H  Y/6 P` .  00X pX dX A-@PM 0 0 0R ЍQP 0 ѥ 0p,`P 0S \ P Y/H6`P a.(00 ;[?-HݩW W W P H0-0/o 0"^ R  R5/P/D0 0 0R /@-P oV P/D0 0 0R /@-P oH\V P t0/o0" 0\ R RP Q Ӧ$Q˦f O/~U U P 80 0 0RP ඦf O/\~U (0A-SM`.P@U Ѝ0 PP 6,pP 0 0 0P+ S(P0S0"Q004 ,@P \ q0 0 0 @Ѝ, gP -4}HT P 00#0 0 P 0S S R/P/ R0/  @-@d0|KdK0p@-S(M/ @ ! S   P 5` `P P (ЍpX  (ЍpD P   4$0\ x⚨T {`T "SF [Sl2 0 @3/P 0`0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SS `,`0 S S0p p S ;S 0 S S0GU0 RP0/S8 0(00>S; SB 0S p@03  0Bs0SR  0 S S5 S3 .S 0 S S+/S >S S`FVw0St `Vo0(00>Spi0   $ 00 8ѡ S =SB0"SP0SM   0"R "R R@C$ >R;09 C-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Pm \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R\ BR   ;R@<{  @d0 8"R /R  0nP 0 +r  R:Y Yy)     SP R0i* \Rf  uRb A P\ +r PX*6I0 r 0 P P#*-"-  P P* --  &0     ) 7 6 O--@ M@  0Ds0S<aQQQ  0>S 0 T  @P (0SP  R @$ ЍT" T& @~P0 S00yP @P P mP[0S  0S4 2 BG-P-MD`"@PL ,pC pF 0F fpppS>0 P Pu&  `0  p `UH$Ѝ000 p``3 $`Ѝ ` #Ao/A-PP +#P`p @f"@P#@@^"@P p40,p0P4080<0V%  @-@ `%@-$@@ W@%,V⊜⇜@-@w@tO-4@T ,p tP @Dp@Ѥ@T `P煑Q800 0 PZ PZ P/  @-R 0P< P 4Q ,  4)`0 0ߞ0 0؞UP/ 4/ p@-M@4 00R1SP,0S@R 1`V, P` 0 0P 40, 0C40P" `ЍpS" R##ЍpЍphZ<.0╞Pyj?.0⎞8co?.0⇞ iN?.0„(. . - - A-P`,p&"@P W 0 !᠟,@0`",@0`C-`0M@SPpF  P" 00Ѝ!0 .P ,0SV !0 v/P ,0S(0S0 0 0wP 0S?0S0"Sm0:S d0}S "S000"S vjP  dP \ @@ 0DP \"$w?{/0ܝ, , +  D+ 0p@-S T  Q @PPp`0!.0⼝pP* 0S ,0 00 @-?%.0⪝P|* 40@-S , 0C40P @ 0'>/0╝o?/0⎝(* * 80O-M@ Ѝ@p` MPP @ ` @Ѝ訒   +~PP0 #004QY  4 ,R\ 牱 0Qv  ᛚ P 0YIV  B B!ᗅ,0 P 04 `<0 4 0<0 P,UM<U7U+ Y& x t@ g QP  *PP( ^ 0,S<SS8 u!|PW @<0 P`04 <0y<! C,0P RYP  |,\0202.0͜HW?/0Ɯ0?/0⿜t M' & & p@-@PP0S D  Q<0  0p@`0/0⛜K@& p@-@P 0`0V? PP h d0 0 0@S<0  0pPp `0/0q|K<% 0O-S M@PT p}`40SP p `UP@ Ѝ8P P 00 0Sr  A> 008PW 0 S/ @0R+  P$ []  P 0 cP 0S P( HqpT4` ЍO~ 6 P 0  03/P  40R1# P P6>/0ߛS 00C 0 P h`@yP?/0ț8+? 0J$ (J$ PIP# |H" " @-X@Ἐ0,S<SS ?/0➛L" PG-W pP0`WTW@7 404 S @  S4 F000!,0 000,00$ 00,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<!-B> 06 7-F> 0.F G-PS @- Y`' T 0p 0R  y w 004 00R$ {P f 0S 0 GqX1G>I.00D0,S <2.0E X [ZA-@P-& 0 0R!p4LP 40S P,0aP0#   8 ,0040U:8 408 D0P 0  Q@-P80080/Cp@-P@80080p@p@-@P 80 0R@ pP4@pPCp@-@P \0 0R@ p`P00S@#:p@Cp@-P@@pA-PP 0 0R4p`40S @40@S ,0P{ `t\BA-@P 0`0VpPe0S P @T <+? 0@@KA A-`P /o0P0"Q@@T @0R p2 @P @T '@+? 0љA 0P T@- ^ 400\@2/ <2.0⶙X@ 0P @-op@ T\ @\400\@/ <2.0⒙? @-PP M 81 0R Ѝ`@80  Ѝ@ JP 4 0R S *,\$1 B!p@400C40<00<0`uK.'> 0MDvK.M> 0E(wN>K.0 0<T?    P/4?o 2 R0S/0@ S/=0P D- ?o2 ^0S 0 S /=P/0 0@0R/\=P/0 0@0R/0= P H0-0/o@0"^ R  RV /= 0S /A-`@PUpP (0Sp 0P  pAb$`,< `<O-0S@9 0@S7  ` P. X6qPp@ P  P  P HPX0UUUB#1 !0@<  ?,By PO 0s0L djX% X@0Pp#r 1 d0  G-@` QP p 20 Q0 GPY @P Y7V W'*000p@ Q<Q =Q R YD Y<RT O  <R R B^0 QY 0UpS 0Y V W*V0 X " pV0 X ! p<R@ O 0BSP=R   <R R  A-`P[@P h0U 0 0 JpP  ᆘp P@47QPp@-  R`PP`0@P 0`0 Pp6PQp@-PP @`PP  U`@P $j0P0 `Pp6QPp@-  R`PP`@P P0`0 Pp5@-@P X0 00R 00S ?P000d5P/0 00R /4P/0 00R/40P h@-o  QP  \Q\ ޗ/4Pp@- 0 00R@U T `P  ė@pT @N?.d⅖@p>.d{ 4   P/0 00R/l3 P H0-0/o0"^ R  R/@3P/@-H@T ?o 2^0Suo20S A-@(`MVPP !0 f/P $0S7Ѝ/ 0P `pP 0 0 0 P5 0S2  qqP* V6 @P. F0p0 `@ ` p` 0$ 0R0"S x>k/dԕJЍ0"S@@<@Pp  x1\ /P/< ?o 2\0S /0SP/0p@-4P4@P@ 00pP00S   00/@-@<<' T (@@@@ @lD,@-@P (0 0Rp/P/0 0R/4/P/0 0R/ /0P D- ?o2 ^0S 0 S/.0S /(0p@-S@ `P0` P 0P dd`@ @ @g@p<<<@ @0p \ xA-PP P`p @@Pb@@@P p<``0` 0,p0P4080<0-@-@ @  @-R 0P< P 4Q  ,  00Q0L t⪔V0L t⣔-,  PG-? pP0`W<W@ 404 S P S -000P,0 10,0$ 10P : 404 SSP P00 tS0 tL p@-M@#S,RP, R4S 1CaV' P` 0 0P 400C40`ЍpR Sh ЍpЍpLkE?M/t4|n?M/t lR?M/t A-P`,p@P W 0 !#,@0`d,@0`00p@-P4Q8 @Q ,4 ,<040Q<0pPpoE?s/t⿓ @- MpW3 0P`@S$  P 00 Ѝ 0 /P ,0S p @0 @P  Ѝ0]SRw?}/t~ 8 p@-@P 0`0V!PP d `0 0 0@S<0  0pPp0w0/tT't 0G-S@PK Up40SG |  9P@P P 00 0S=P6 0 03/P/  40R 1#P& E`P 00C 0P  B@t A`G lL?).t_(?).t'&h %4  40S 0C40/@- =/t͒ 0p@-S P  Q @PPp0i0/.tⲒ$%L p@-@P |0`0VP0S R <0  0p@,00/t␒0w0/t⊒$  SG- p)W@ `V 0P 0R 00 ` V 0S  G83>/tR0,S# KJA-PP 0 0R4=pP 40S @,0a, 40a@T:8 408 lp #@-P80080p@-@P 80 0R@ pPQ0@NpP"p@-@P 80 0R@ pP=4@:p"p@-@P \0 0R@ p`P(00S@#:"p@!p@-P@N@pp@-P@ 80080p@p@-P@8@@@pp@-@P x0 0R`P40S ,0AT p@p@an?/t⊑  A-@P 0P 0R@ p`8040S ,0X ,0Q<00<0@@u@4?/tQ?/tJ  p@-@P H0 0R@ p`PP@{pA-PP0 0R`@l4P%80,0!qW# P P ,0P < 0@400<0IA_AC4?;.tn?;.tT 8 0P D- ?o2 ^0S 0 SF/0S /p@-`P@P (0S p p@    0 //@-kRP0p0 ➐ O-IMP  @T `p0 R 2/0ZRX P Y  9/0  p PP @TL0P m003/Y@ 9/T RT T @T@" 000Q 1/0R# P/0S% 03/P& Y 9/Q@TL0p -d0P &Iߍd0p h0p Y 9/Z 0 03/(0p   l P0/O-MM(p@ HT 000 000R+`P$  T%0 `jP4  0@ 4/@P`P@003/0 @OPMߍT0 00P $ 0R000 Mߍ(#0 ╏ R00 0/0/@-@@A-pPM`P1 @T. J0@0W  WS 0A/R 0CW /RW  W0 0 B/Q 0C#@T @! @00 .00 0 R* 0 0ap@  OU \P@UPۍP?00@ۍ S0ep Pp p 3P\@T  p@-R 0@S PR:   Pp0P  ,0 T90( Dڎ<:p0( Dӎ$;0( D̎p p@-@Q PPpQp0C-S M~@; PArbp`Q <Q$ >Q &Q ĐQ P ЍP Q Ѝ輐&Q P괐&Q xPPU a/U`U"0E'S0 rP\bP ]P PU /U\U fPnPtPbPUt 0  PO/QQ 8P(0F/D-  h 0S p@-P@ Pp 0@Sp/p@-@QP Q  PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@#0Q/D⾍d 0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@Q0Y/D↍ 0p@-SG@`PU Q Q sP<nPp PU Q bP QPU Q UP QpPQ HP Q/@P >p@:c0-D24 A-PP` 0Q`pp XpWV@PR  PK O 0VC p` 8/PP`<`nQ P P 0S 1P P PP` \ /P P 0 EP p  p@-P@PP  5P`+`p xw011/@-@$Mp`PP P1S"80 02P m C$ЍzP 800p`P10  @,0A0 4tB`0 4m p @-@^ P ^%QRS  T00QNRS"  TŒ 00Z0 43 G-@R(MP00Q P 0 ` p Pl `V0T?o20S00(Ѝp`0 0 0000000 0 00Q0/0 0000000 0 00P0/-0 2/   \-0 2/    \p@-@P(MP`/ 0S, R00v$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  U P0V00(Ѝp@ R 0S V00 PQ0 @0/@-@p00T0008@-@T @-@T000 000S/@-Ap000 000S/@-1p000 000S/@-!p000 000S/@-Pp000 000S/@-p000 000S/@-p000 000S/@-p000 000S/@-ьPp000 000S/@-p000 000S/@-㱌p @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#l0 02#/0 00#/0 02# /0S@-@1/00/T0T0p@-@ P`0S cPpgp; p/000 000S-/@-)-p@-000 000S/@-dpAo//p0@-@ MP  vHP Ѝ00;0   p@-@M  wDP pЍ0;0  p0@-P M@ T T T  0 Ѝ0 H@{ Ѝ00:0 4 p@-@ ^B @g080 Љ( p@-@PP [$@Dp070 ⿉ p@-@PP (Pp070 Ⰹ$ p@-@PP $Pp070 ⡉, @-@PM  +,Y>,0 m DЍ0;0 ⅉ @-@P (070 x( @-@P $070 j$ R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@᳉ P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P=8U5U5E03#0@3#C#!@11@  /  p@-PQ@p : Sf G Sd0 ] Sp0  S?0c0 !-0r-w0-0 R00G >Rx  -   r -  w -  Q  1 &Qx-2r-@w- TT Tt T-x 00p Ss0  Sw0 S?0l0Q s! R0s  SS   S?0b0A0a0-0090  O-P,A@:  pP? 9P?  kpP% 00` 0@T% P0=S AP` AT BX ! <0>0 ⼇ 귉00@  `2PC-MTB0 @P@0DH LPPg PppX`\0  CXlPypk  rp` `n o   zp[ p0 0S4P8P ǯ  0m 0 m P +  Ϡ@00Ds Pa0DSW0DA0DS"70DWu X : \R SP P"0 00T; W0 0 p 0 U00S 0 rS 0F0 Ѝ0S U @0` 0ꊈ000S   Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR `@H0?0 `TWp prW  0M0 00Ѝ7|4O-PMp 0GW"S00` 0v@P-TPg +T@`0> ǯ  0l 0 l P +  Ϡ@00Ds Pa0DSW0DA0DS"70DWu X : \R SP P"0 00T; W0 0 p 0 U00S 0 rS 0F0 Ѝ0S U @0` 0꿇000S   Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR `@H0?0 $╅TWp prW  0M0 00Ѝ7P4O-M`P8@@{0 DzZ7l_0 ;z/P!0 W/60/$0S㈀\}! 0 -P6 0 0 W?.@{6 YJb|\($dEU(Ի X ܺ d @  t L 0  @-PH!`PD1M @00008  pzT TU00P @@P@ 0 0 0 30&Ѝ{/00U000000zP 0?s00D]?a/ y{P{P#p @-@P  @~]?f/ ry O-IMMP䲟"" 2 <,0040480 <0S $0S (0S ,0S} p0P  D A@0=pK D2Hp@" @0Pz?40,2 `0 0 0200}?03H0 Kp! F HPG{00S" {0=SPXPUPVPU Pb` @{0#S: 0v^@T@ H00CH0z눀 0 04  6~P%z00;@4 P#~P 0  0!`n00$ze4$e , 8  D t \ <  ̯ l P 80SH00CH0  0L0pP ㄐHp` /0"t k@t0T0`6`@6hPnz0 0yPھ6 D0@C [800Sf Sd $Ps 8(Ps 1,Ps * DPL R2@'!1 0 4 30IލЍ@z4"4"0 I@ d L@80H0L0 S  P HpW 80@ 0    L`5}P\ PX P<*$L0. wyh0. w(0Sl0. wdi?. w<0ST0. wLy0S %#<0(Hp@)!G-`!p1PM PPp@0t0L00B VI WP XW tA, @Ͽ/|0 x0P 00 C0 ZPDQ ,A,@K@bd@0 @+ 0 0 L0 30-PЍ0-. +wV0-. "wW|0-. wX\0-. wP .Z@5!@Ȯ 4ܭ p -MnЍO-`D"p@2\M @P‐0焰0T00X V_ Wf Ym 4P x0 /?s000P0 0 0 C0 džPZ0Q Q,P\PcPhQP/~P 0S 0 3@历!1 0 T0 309\Ѝo0 h@i0/ vVj0/ yvWk0/ pvY`l0/ gv@D@ . |  8  ̪ -MWЍO-MX5pP% D 002000SmW1 [8 0S$ Go0 0-0fP KhPf 1 S S   $@ $ S^  000 S SR S0 R R R R @ RQ  B RQS 0S1 @+S6 -SYQU @U0S 0S 0  t00_o`R0+S4 -SF rPPUpxP XPL1 Pp S 0QUL @UH0S 0Sc 0  ?000+S_oR0S] @S=0 -PP zP P0S @S 0 0`SPrPPU@!1 0 2 30oߍ 0+S3 -S0S  B`P{0+S$ -Sz0S 0+S& -S P kp0S P S!@#0Si 0S s ro 90S P{00 0x?/ u\?/ t[<1?/ t@4 ؿ0  O-P#M@3 M P 0080s Ty [ 2U 0&M N.0A 0 ;PX0SU `r +pa+aI0 o0 0ePP` H`P2P0: SN 19~0v`0 LM!1 0 8 30cލ ЍPP  0 @&`P% 0X100S`@10v010/ YtT?/ Pt[~?/ Gtv0m{P d0S   S 00v00vP0 p0p 0 /&  0 @`I븽~ }\ ^\| p L {{t{ A-@P0M`p3 V: W' P 0@ B  P @T@T 0 pPP ̃0Ѝ @ƃP`^?A. sD;A. sV$]?A. s p P , -$M0l L` !Π@ 0 (0 0 0 30$Ѝ-$Ml0L ` !ΠA 20 (0 0 0 30$Ѝ`(G-` @PP  Bt0000 C Ra CREp0pY)00 C Ra CRA CRS:Y 00Cx QaCQWC@00Cq PTaCQWCPACQ7CLS  0GSRQY / S U*@G0 TT-@A CRS` p A BRGZ00V0SZ  Z?0V*Y 00As Pa0ASW0AA0AS70AQ @ 0 r0 0Cq P0@p W:aCQW0CACQ70CS }h0 r000GACQ 7Cz`0C0 r FpbS~ @]$`@0 rĠ < O- l1@0`@? ` R<T !4*4.0q0 ,p( ??p?0 SP#20Q *00\*0V0 R* Q *0V000?0R*00t?RPp1?p# Ks R ? Q*:  T: 0{zzz,  @z$z@-PL@ MH0`@p400 03@ Ѝd@-@PM 0 00T0@ 0@ 8 +Ѝ030 qHy @-@P(M# $0 0 0 p 0 0 ;P \0 $0 $(, (Ѝ BX0d qꠝ |x p@-`P0M@P& T- U3 ,0 0(0 0 $000P;P)0 04(8, $< 00Ѝpx0 qTX00 qU<0 {qys 0 꼜 8  "2 O-P0TM`0L00s Vj 80  00A 0@ 0 {PPP @p 0 pk@P< 0+S+0S((P,0(0 $0 00P0 $a,$h,0Sc|- 0 0 L0 30%TЍ0  FP OP`-r00L0Y0 p4X0 pL  ș !1 O-IM0p010wlWX PPO l@`  0 `@P; 0+S+0S(MP  0   `P   0S, 0 0 1 30Iߍ P mP,|r00,00.rp뼭4  ̗ 0/rx"x2 0@-@P0\MP0T00 U @⤊ 42_.p@ 080@ JMK 0 1 2@3@K4 5@6@K7 8@9@K: ;@<@K = >@?@ !" #$% &'( )*+ , -.0/0+ ; Eh \0 0 T0 30\Ѝ0!PPv(040 olԫ` T ! 1 @-@PFM0 Mp0d40. `ᧉ!PPd@!᳉+ P q@q R@,\ T0 0 d4 30 Fލ Ѝ(NL0\ ~o@0 @-P pP0dM `00\00 @^ qP H0 0 \0 30 dЍ(hh0t Oo| t 77@-M8@ 4@V\0 ЍTn 0P1Spp// 0 0@-PP0M@000& T  MP0 ^#2 @@0L00(0h \0 0 0 30Ѝ0)@P(0F0 n X G-p!@1M ࠐ0 U040$eiPF0Q W0Cp +@P1  nPUo0 ;u0 U@ @P  [U0PUo0p@p@  t 0 0 4 30܍pPpTP  04fQ pxP|`Х- M 0 Ѝ@-P pP0dM `00\00    *P H0 0 \0 30 dЍ(T0` Bnoԣؐ 8 80 O-@Q0M000 0S (`@@P  @0\0`h: >b@`'9:E`<  `&-H@` 'd@ l "D`4O 8!  -falP,(5_͌b! @ppp& 7x!t 9l '8*. p" pp' p|`@$;`,P%` ( `&}`am8 )  " gq-9* $@!@@$ @fa01.' +)$Mb!.p &7 dA(, 4" P%͌9n `* ! o `P%(( *_ᘀ!L$` PlP .8  "**!+P.$_p'+**뿠0ꯠ p' p',``篠pp@ p-$ 7@$"4 *O)+ꯠ"뿠( `)4` *"`/L)뿠 * 韠 / `, ( ( *( $`菠 $p'af! p' 杉 p'  `(`& `&珠`&p! pio ` `"``&p',` p͌$P%P%nP%0(_,PP) 0 P0 P%4@$ &` Pl " `@$(P "@$oO .0@ ` "P, ;>FP%@-@ (@P,a.P .P%Mb!  P % P! ,P%,dA쟠 *$ P͌ 0P P௠" nP] (p$! p'l+ p.+ p'  eQ @ p!-@$,p +@$p, @$p'`뿠O4@@@@@pM'p%.p'.b! p '0p,p ,pϠ P,$pPdA],4p,,p"p'nϠ  (p͌ p  p$p'eQ$$ p  "p " "p. p'l/ (   (@ ,p-@$p@$@$ p%p'`O @ @@@ @p.M ..p,p'b! ,,P0pP%4pP%pP%p p'dA_$PP`& PP `& ] `&0`"`&0 ` n `͌ `$`&eQ( ( `($ `@( . ")l`) %@0 "@0菠4P@, * !( "!, "m`!⏠ ,M "fa00d=@, /H@ ) +@韠 +@ + @믠$%c1 P ͌aA࿠ %0P!`!_4PP PlP(P&`. .`Q 0&,`0# 0#0 a00 @0&4@ ` =O@nA  & `, , c1$P&0P`,P, `PϠ`PP&P !$`! ]  n(&`  eaO @ ,@PPp'4@0p'p'(P0@0 0@ @n@ 0% P 0#M 0#`Q,$p?ppp, } dA ` 0͌))$`)`g`pp`` (`( p( pm菠(0pl P(fqP%P% _,P P ` P`PP4@P* @]*@@ @n@(`*+ M ( (ePoP4菠  P 佋P* p,$,p' P%  P%  p' $! b*LdA`$`8`00͌`8`0`) `&k0_00`=.`.0`. `$ `& l `(`&`& P+柂`P%@@ P4`((c1P`& P`&p,Mo ``, ` n`pp0#m0#dA ,0.=.faP@$@$c1 @`&M`&n`0#,Pm0#dA0.=.fa$@$@$c1,@0P`&M`&n`P0#m0#dAP0.=.fa@$ @$c1 4@`&M`&n P`0#m,0#8dA0 .=.ψfa@$ @$@p <-`XTDc1H@0#0#\0͌x P   C`00 0 30Ѝ@X0 ziO$00 siB|$~ ~ @-@P +;0   *DC0d0t Zi#EgܺvT2} G-PPp`5 W+ 100.!؁0% "0 0%0?S@@h  :j 0hS@H"p ` *0V@@p`F  G#j80 id0 i| || !1 p@-PP0M@0 00? TF  0K@a+ ;`GdiDithTh&$  0~? S ` 0~? S  U E "0 0R1<30 |0 0 0 30Ѝp`0 hT@d0 hp| l${ { 0 0@-PP0M@000& T MP0 ^#2 HH0L00(0h \0 0 0 30Ѝ0)8@P(0F0 lhЌ({ Hz G-p!M@1M ࠐ0 (U050,ecPG0R W0DA +P@P2  gPUo0 ;u0 UB =@P  TU0PUo0!j@Jj@  s 0 0 5 30 ܍Ѝ jP5jTP  0_Q%PppP|`$뼋- M 0  Ѝ@-P pP0lM `00d00    'P H0 0 d0 30 lЍ(\0h g븉pw   13L @0+/ #EgܺvT2O-MH@@P  @0\;\ 0EHp  @P` , ` $  p(l̆  L "芆 P Pp%p'd+@pePgyPP @@!lˠ(@H)P P@PTh@P%阀b+Pl@' @$Z`@``Xg{`&dJ`) \ai Pid e[, $.dKtȂn  fk " `p ((` 茉 Xplp lˠ!p.p'n p|{ PPb+P% Ph@()\h隀`@@``a`&`@' @$g{@l p,I) te[l̂i` h|  fk " $.dKL* lˠ!xp (a` h ppxp PPb+P%Pp.p'n peY|@T0`` 0`&a `fʌ`(`&h`'`@g{k )e[+$1 MR0 00//f@-Mp @```PW0D P>S 0!3100 0`Ѝ>SH 0!3100`00`00xf/-p@-M`@P@U0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, (  e0U 0U 0A-@PP`p< =U( X0ES  S0 +0E0VP00VP&2!0` `000+W -W =W00V-0`0=+00+000@00$0]0 Y^00T `T p@-PP@D ,a `0RuSpWS4X0CS0 pP0R Q PSPQPQ  0   I0 0+S -Sp0b40D ^S S O-TM0wSp _@@0`   0(0_ @( _@T%T7(P00p00000G, @ 0 @8$a0GS00 _00_@_@PTЍ+W = W0 -S0000 0` X B R  = GS/o"!"   ( P:0,P_ ,_ R, "( @0偑@P(  ( 0S# (p W:,Pe_p ,]_0S,0"@(p剑pGPp(pW X0[0p0 0I00(ppW ,Wp`uS(`! Y0`,P4_ ,Z-_ Rn, "0@(`剑`FP`(`  v`(=W +0G?oR20S$ Y,P _ `,/_0SC,0""(` @႑`FP`(`V 0[` 0I00X00F0(` 0 V:,P^ `, ^0S,0""(` @႑`FP`(`0X 00&0($ KR; I?I00 KR<I ^$ 0@4$00S`^0"SA  V*(@ T:,P^ @,^0S,@(00CP@(@Tx - ? 0+ 0 `0TЍ'p  001]0 m\1]0 f\p1Fs^^00(0UpJ 0Xp+`-@ +B XR R  0+B -R +R XR 0 -R  X@P`QpH0]0  \00o0P \0bQ Q L L 0K K 0@-@PMP  0 @ 3p`Ѝ00:0 [ J 0P P C C C//o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`M+PMU PU  0  &P>@P PPr^P \0003p@4000^]PX]PI DI I 0p@-0P`@T u@T0rS mPp4p@ecP0+Spp@%#U*0@-$M0P0 200o 0St ~0P 0O 1 00S%BVp@3 P" WV0rSC w0 0P't1 h!00 P @00S5$Ѝ00@P0T X\4t\@#V0 00S  \@PZ30 0PpM 0P$Ѝ0T 0 Z8@0 ZVpP) G L@F F 0@-$MP !e 0Sj 0P0A 1 00S=p@' P 0rS; 0 0PT1H!00 P @00S-$Ѝ0xO\0 00S@ pnA\@P0 0PZl0P$Ѝ0P 0d Z4@0d ZTp '8(D C @-PPPA M@I D1p0S+41@T4 `0`S@' 0SV0V0, 0S%P[0S  =p & Ѝ!m0@T0S hc[00P\D  08l0x YhRpt%$pTp$|B G-`PHMP6 p00 0p@  Vp@ HЍ P 0 p @p@ HЍw[0S @X@0>0 jY<0P R@A O-P4M@P\p WzX0S; `00 S 6/040 00!S5+0$0 00!WnW0j Yh X00U7:GS> G1@000`"  0 P(0@`0s,5`0D0$0XT 0S=0`jW A,` 0lTVW ,@P(05#K 0T`X2@ 0 $ $Q T  S #.E!b)L@T(\/H0#"A $1?"!":  # 0 `V4Ѝ3+00 00!k3/00 00!cl30$0H\/Ld0L``00|2pST , P` @!`SP 0V @ P ,Pu P[$:6S T00U$0%%>!E!2c(\/H)L0TP%"1 #1O"QX0 "0 0 0$00?S%D P@_`S8 5HT1>O0 0` 0 0T &.60S 0 0 @0P(0P10X00`d(0@t0P`d(0 ZS  R0@< > > L= < ; ; ; O-PP M@`o Tu V| p0?T:R P- [ P2 * P*Pm@pQ @T*RP [ P * P R 0Q[ SQ Ѝ? P @ @0!0\; ] \ @ -p R@]p\ p W R:\#Yp 00 >WTp80 5WVPD0 ,Wzp]@ \,: : 9 p@-@PP U p@GHT0`  WU(Eh0` Wp@Gd9 @9 G-P@V T] Pp 0ppS1q W00SaP: P] 0S\ 0 R0C`000PP 0 X= V  0s00S0 00Q 0 01 00S-*_oRe`VlP" U ! ZWxt0 VTX0 V<G0 VX00P7 x7 X7 C-P!M1@P M`0040$ Q? U5  0s00S 0@ $03/!1 0 4 30<ۍ ЍQpCp0 AVV U G0 6VE0 .VlD0 &V0 D V8E0 VE DCD6 6 5 5 5 O-MMMpT&P0H6 @0 TD040e^ XA 0SH VO 㰰WU[0*U@@ R R0 0C?o2 000$0RU0 S@0E0`0S0000SgV ,0+0FB 0@ 03/[o 0@ 0000,00G(00 3/ P    0S00 * y 0.S Z~0S0 Wx:0S 0S , P80: S $ P (0J Q 1/030J1000@P}000$0 000S 0 P)80: S%V 00S 0 0 0s00S P@T  0s00S0W4/P/ 0,0" $2 MލЍ  0.S0Sn 0.S}j0S  0@0L  2/0S0>  000.SQ ` 3P J0 @}P@ @g  2/0F(100+$0  0`0P0`/0C/Tr0V R0 D00 T0S0 TV0 T0 T0$ /QRV0/ 0 0 @ 0 3/0| C C0uXBHB4 >80 / / / / O-PX#`T3KM MPp0ؔܤ040; WB VI YP \U /\@ 0@ 0\/\ U'"2 0 4 30KލЍRZ/\3/00`/\U\% p80G/TWm0G/ TVn0G/TYo0G/S@p` `rP 0   R  O 0T/S 0: S+ S 0 00 0 `X! +0s00S 0@ (03/0S0: ST/0305:n R0l`S`0I/ S0 G SU/0 0R;(;- d- @- - + O-M$M5P`P % 0000: UJ @0~S<     pH 0S/S;RR B00 4ZS *0H 0;P4S 00C PR3 IR*0S0;R) 0X @H p S  ! ?*OO **S1 @s000S ?S! [S!^H QM00@ S000XS 0H , R @ 0Ა@< 0 0R  R QU Რ@ P +r@PX <#,3 0 0 30ۍ$Ѝ@\0D  SS 0]S!^[0?O0p -0O]S  s000-S]Q q0 ]S 0@< 0]0?O0r  0BW 0R S0BW 0R S@a 0 Qx  0A0 10B0Y!^[00  @B p /L K0P  H * ;P 70!0?O0Q@@Kp0 1RU M/0*R0K/"Rt0M/R0 RM/0R@3@19485L& & % % O-`QM@Mp R W T  DI R^ @P@\ [\ {\P }\U PE0]\\ \8(BPPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S008( @0 SV 0F 0C0  ~R0 0 @ ]RR ]RR yd0R/`QX Wg<FU?R/UQ] 0R/MQS" " l" p@-@PM`P( V/ 0  0S0 0/0{S 0\ {\ 0 P& Ѝp0}S0S Ѝp@T0.QV40. QS 0 ! `! A-MMPp@PP` G; 00000 00< 0 ; S \00  ލЍ @R0B \ 0 \\ \0@\96ލЍ0[/P p@-`P Pp@0T@D1 0CPP @T*000p0]/Px 0S$ - *S ?0Cs\S0 P0S Q 0S 0 0/  p@- 0@TpP"TC ^ (a` DR'   @T7 "T-  P0\T "R @T& @ 0 BQ R 00p@T "T P0 # p P@.0T\00p @-PaQM `1 M0P050  0 0 5 30,Qލ Ѝp @p,0   p @EO 0P@0  0P0x@**L  5O-0eM$`P 500S E p@#S!Q0 pìP$ 0S 4%P @ 0SQ0SЍt ` p @0S pG4 0  0Sy t唤唔p ,p<0fS0fS 00S3R0 <$ 0000@SS 0oS 0oS0nS 00S3R0 # 000  A0$00 0峻p P2O<000S[  JNUY p'd7 0 0 30 Ѝ`s?0l0` 㰘pp  tPWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S% I BqQ #S( H BqQ #S' G BqQ #S@ L BqQ #SU M BqQ #SK N BqQ #SA O BqQ #S: D BqQ #S E BqQ #S F BqQ #R 0S:U 0p0S8 Rg BD{ P 0`000  00  h$   H40000   $$   40000S0 @  # 00   ㅺpW p[ pN00峺@N@W 0X ~N000S vN 00nNZ 0 [ eN00卺@_N@00h@@@h,0 pC5 (@(x| X5[  Pk0S[|+ L |_0 +LM)N00M P pb 0(@ 00>pa Tpr0`00S0`0 0SCL HqpLp Z*0p0X0 M0SY00K pi0S0- `00C0%  L⽹p6pMpJpG[: 1p@kp+pk=!!t      L   p   - M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF.pP BP ЍpG-Pp= A@0S%@@Q0)耟lPPR @@ P fp0  T*  Up0 Lp0 $0<0 -KhT40 p@-p`pP`Pế@T T0T0 R@@pP00᣿@ ȹA-`pP@p@ᕿ0S x@@F R"@\K@ẹP00L@u\@-鍹 00 @-`AMP@1DpP 0SA|0@@V ! @p UpЍ  .0P  R 0QTG B&R  8A@4ޘP٘RS' S@p S'@z@ @S@u@@S 4⺘@q0@@q@4@⮘64q㨘@0P@q@4 @➘;t H ,  | 8  @PO-BM4u M0%,p((5 00 0 $$  G C 0000+0`P @ 40 47P (`P,@\ P 0S x400#S \ P 0S @D@4@08@\ P 0S D 4@08@\ P 0S 30 B\ 0P 0S Gl30\ s0P 0S :ll30d3@F`S `\0P+ < 6 @P\ W@P 0S BEPPU PU FP20P0xS~ "t2 0 $4 30Bލ ЍP@\ )P{ 0S `200#SJ \ P 0S (B(2@0@\  Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  A1@0@ \ 0P 0S k\10\ 0P 0S k,10 1P0P!0 $ 0 ]0xS}0S y00  00 0000@FP  d t< < `T d0  P< p@-`@@0S P Dp

p 0 p  a  R ] 0@sq[  1-)%!p     (p    p 1`Iq0@0p0\p⾒2#8"0  !@@t@p005T0AW5 V2H@00s|!0 0 40 30)<Ѝ D10p!   ePP)>PX00X0hH0X @8$\\<  t L <  8 xT 4    tT D$    $p p@-@P? 0S0 a<0@0T;  T06 0R/Q T:\& 0 \/RT0C$/QT 0C: B0PU0P!Tx00ph@@@P\ A0@@@@0/S (@@@@@  l \ A-MP` <,A@0P; !0Cp0 0 0    0 b0C S'0 pJB0 0}0S@P 0S 0S8B0"S D5#@0Ѝ T1r0:'B00  8@-@P6 0S/ ;@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 0@  Q B3@T@!@@4@0/S@\ -DM0  000xp 800S DЍp@-P`&p P@Vp U V p=@pdVT ⥭pP ᄮၮ~Uᮭ Q?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 05D0c 11P!  "0P;:0 /0 @- / 005D 0-0+CP0SD 0@0KE0 0/0E 005D 0-1+CP0SD q@1KE0 p0 Q/ 0E/ !0PQoo A-@@`T?`(@T# T `Pp`6@6&p`376U8`1010S00#!Q00;:00 /0 @- /003D  0+C 0/ A0C0+03D  Q1+C p0 Q/A0C J@ @-p A J@ @-p Jj@ @-gp J_@ @-\pPP `⠬@-@00p@-@PP  p@苬010 q> ?0/R//R/?0S/R/P/R/p@-MPP`V @T x00F?Ѝp :   b&p@`$ ƭ 00 R ⍭@,@-R@00 0S@ꈮ51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BP`X9 @5P PXY  P (@-P  1M@`00\ |p\ 00S30#^0#02S000R@0 t d0 0 2 30ߍpP @@ @U(@0$0O-P 00YP(<Ѝ0 0P( 00 0U 00S# SM 0 @$`Ph08P `Cp @8 P4P p W R0 0 @$`P0 `Cp @f8 P4P pW R0 (000@ 000@(Y(P(PzW0 GS (  !+S -S0 P000P児ಐ5P:U X P( .! @S \0cP$00 0(0v,50 P(]U0W,00h0p0070 P?4P+ p7P 54PP 0(P 00 S7, Y2# 0@ /Y- 0X 0 0H; 00P(/,c0 ,>0dS,0v>C 0C,0P(  E Ϡl b0,0 Y0 00 000 7 ,l,,0 Yv>C 0C0P( 00 0,50 P(0P(PY%S 0,,  ,00C0P( 00 0Yp 0 0 S0P( 0 0 0Y 0d 0 0P9 00ZP(YzY9 0 0HP(=0 P( Y0 0P( n1,,  Y,00C0P(k 00 0w0 0P(] 00 0i,0 z,0$I"I/A!b!b0C 0P( D 0 Br0 Sj0(0N0Y067 00P(=c0 ,N0S,0P(I  E /"bd2#,0 0 0 0 000Y 6 00P(Y0 ;0kP 00 S 00Y((P/0 0P($(P000,c0 P( 00 000  R 0s @` 0 @00v 0PPII0K1c ` @aa B 0 0 B  005 %!E!/#bb K/) P L@!(,"@aR 3 : ' @aR4 # 3!0 P b4t$ 0  Q0 00 00 0)0 51E2?3c#cK?)P( L%@#"(<2@bS3: 7 0@bS#3  0#0 00 0#!00 0C0 0 0@HP' R0PR008P,0YP @$`p(P 00 00YP @$`p(P 00 0 %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 \"  !1 00 B00DSd0,0ջ0 40(00N~0 S&0̜ ̌ ̜Ľ@@Y_pO OO @D G@Tn 0 40N~ Q@(p0wP^ 0(P0 0(PP @ ACLCq| \^JS S  0 0S3P0 z G/o("PzWq (PUSG ZSP @ P@0 0B(0$p  X ,sd0PE ,S#P ( P( P%!E"ad2c;S,0<2#TQ(P 厀Ḁ@CP(wMP P(P @{ @C>0P( $(0  @Y 0 @SYP(  00 0ebYP(  00 00@P0SM 00@I0S 0@B 8,00 0 0P , P(01(000C.$0s,a20a\Mc^ P#   0P , P(00(000C.$00 0M,#   0P , P d# (0(00c$060M0 00Ѝ1A-0Q M@PHP PQ Q'|10h01 Q%dG@@ Qp ʵ. R$!  v` PbU" Ѝ0 Q0  $ g&f&FP`B` b  ?U:T 0 Ѝ\ H 0 01900` ` T H ꌫ@-0M@ ⁿ0P |00Ѝ@-0M@⪿0P o00Ѝ@-mP@cp@-PH!pD10M `@00,00? U5    P00Q Q Q ,H2 0 0 ,0 30"0Ѝp ,H" ,H9 0 D;@0 }7(0:0 v7T h p@-@PP U 0DPp P @p8070 Y7U880 P7@ G-pP`' X- Y @2VP0PES  R D PEb0V R  RS0@0D@ 80H0 7XI@0 7 h R@- 0BAs @ Q0C@R 7@O-PP∡ Mp T WC  1@PH (2PH  Z1p`J }2$101S Y2 Ѝ0(10P@1P* 0 0P 00 0  70=   7`D<0 60800(0C0 61 @-RQM @PЍTT |8@Ѝ0Ѝs8 00G-`-p!p1@ MP0M050F ?PO ypG @\@^ X0p00tѪ0 O 00 TV3qύ@0ˠЍ (, @P ) P t0 0 5 30ݍЍP0D0 6800@ 8004 00- $  M  Ѝ4--M  Ѝ Ѝ/ -- M0 0Y ЍЍ/O-@P|Mp ` X X00?+i)00P @ P 00 00P ! !  EX\3?OPC )VP WQ V[XpPVppPW` ? `f0`0 MpPP `B48  0 z5W`00 0 00d+ Ѝ屹C0 P P00R+ Ѝ 0 Q5`pPP V pPP `,0?0 95g ܽ @-@ M+(0S2 (0 (0p p1/qpP`0)  0 0 PUoR <0PUo* ЍPPT` 0S  0CPo*600P`*@-P M*(0S: (0 "(0p p1/qp@`0/  0 0 @ToR <0@To*1`V ЍP@T` 0S  0C@o6T00*600*p@-PPD 0eBS5 @Tp E2 Rp00P0 ϸ P 0S PcP0ø 00(忸 00 廸0 S,P 4P 8P p@X@M@0 W40Sp0K0 M4꨺ | p@-P$@@ިWQp@ר^@- @@ШTQ@ʨ^p@-,PPè iR@ἨpT^@-pPQMPE 1 @ 0`00S P 0 XRp0pPPS6  5'  U80C0GS0S0\^(:ЍU  !P\^#Q.S(p 0A a 0C ƒ0F0 3! ^#QN^^ N0 Qs0@ꬺԸ 4  R  *4 8/T 0X\S 040:8 R РS /LdxB@-Pp`Z5L@L0@H@ఀ U   L᣽, @-P`@_50 .A-pP␆`@P( T.  r0 SSSDv S00 S 00600000050 #3T40 3%00  00l50000  @ 70Ls0 20-V00 ^V00;\ 40000 0K/l R000C000LS0 100C0 0?V` 000 00000 \ \ 00y 840000  70Ls0 0 h", 3010CP;\ cP3`b0D001~dPk R SXd0\Q|3 01K00 M \; =\M \7 00C00L S e0 D100C07"000 0  T 00Ls0a" 0W0Cs0Z2 F0nR  U50#\V00S003%V00S00&0F?o24 00=`Foob%d 00!00   00Ls0! 0W0Cs0 0 #\ 00 0P0f00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP;cP"dP700Ls000Ls0 0<00pP 00kꔷ  ` h \ O-RM@p 8 0S? XPF D P 0 0`0 @F/P? T@D 00X `R%R%V @F 00o300ЍU 00?7.^10S\?7.T1 R @T 0E00ЍG300* p H 0  00  "ꜹ A-@R`PPm /.#C=1"#BbQqU> 0S$ RT 10 R RO 2/!1U 0000' 1/0P p $@0001003/0P!p0  $@V00 00 R (㜳000P3/0P U  R  SV  0S=7P00U RtQQ ȏ(QPA-@R`P Pm / "H0#BbQqU> 0S$ RT 10 R RO 2/!1U 0 000' 1/0P p $@00010 03/0P!p0  $@傼V00 00 R ( 00 0P3/0P U   R  SV  0S㨳P 00U ĎpO8OXOH NNA-@P{ P+`Pw rpPg  00Rc</.#C="#2caqV8 X p-PXU $00|1p00S X1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(nP` p  0000S=P0000@0003/P 0x܋0MLP8L܊KA-@P{ P+`Pw rp Pg  00Rc</ "H#2caqV8 X p},PXU $00|1p00S ^X1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(ױP` p  000$0SㄲP 0$000@0003/P 0J$J܈DJISR: G-P0p`00S 3/0Y @IOP  T0 0 0 0 Y @IOP  TT0 0 H H0 0p`P   /8Ip`$HSR; G-P0p`00S 3/00 Y @IP β T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /HP@pGO-PPM M Q \ /\I  [P )P>/\0p Pp 2 `I `\q @` /RR.\*  B R` `F D/00/0 0珝pf 0: S%  S/ L/o" R/\ @ DQ8 .PQ [0   YI/R W00Z0`# uP.T  z)   RV .0/\p0#0 @ /R0 [ 0/ލ Ѝ@  ލ Ѝ.00/ [? 0/    VP B/00/>00/00/00z/?00u/00A-@P Q P`\Pp@P sP`V X/0"S ᜱP/00@p@- PHaM`=  (4QP00 P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P J<0 0  . 0 @\xpp@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 , 00 , p 00/@p@-@PP" U( PE0R R:Q|Q00Q0SP0@|R  :RRp@00D z,U$P0D q,p O-M MP ($ 0 p800D40x 0S 0S 0S t4!S S8h`P PP8  pP 00S RD P 0PD#P ` P@U"0 S* Z :S `\S S S 0T:H@DįP U@p+ P `P0 SZl[0@0#QQ BP6@P00S0 6 p0,P0040(000= P 0:R p0Rt4@<0 0 G 0(O<4`PD pP? :00`00 [00S  ` P  ȷ 0 ` P㦙Pv0Sԯ00aY@D*0 S :S ``[ ` @d `` 0:R& P0R 0E`F00S:S:00`0H F[0 D0 @   ᚯ0Cx `! pP 0H@D IpGP @ p ,P pU Z XD0A0$0p#3 0 D4 30ݍ ЍP ͮPpW - 00%@ ʭpP @$3@00S0,P`U9 <`P0U3S; ,@/,@0080` *0SBh0` *0Sx\ t0` *0Sq8 P0` *i  0@0S> 00 $# !0A`0`0S0 SP; 0P0C0S 0000`0S00]P 0S0 00停0S0`000 0 &0P P0C0 S8P 0`^00S`0`0Sʶ00S0Sp!p3`0 S ` 0دP 0P `0 0000Z `pG00Ph0W0S`J0000P0`0S 00e{00S 0`0[RP0000*  0 P$P!+P  P00Sz0`050停0SUPQ E!p,0^W000`p000`(0j#W, ,0&0P$0$ 0 ` @0-S ]S `' S! p`0!0S40Sp!p3P 0 090X00 XPpG0SW ` BP `0C l# 0 p P p XPpG 8`Fp0V-` 0 m㼈.pC1W, p!pH 0+0AMS00 Ym0H000C0SY000pWH R0XS 00 0,  0        H 00 0,0 B0P006 0B SA*n ,`IX047,` 040 7 0800F<0@PDPBQ + E P]  AQP Q ` 00ERS P 0 000 0XR\ 000S P 00 040pW W!80P $QWWp5m00A)Up $ _U$ oQ <`F@P 0Sp1*V V0`  ,0pVc  0,H  Vj 00 400S H0S} 0 0 0P(UpoNQpiAQpd+ E" NU[ V0Ul IU~ X@ @`h  ,000Rl300YYl  m( $$( P; < 0@P P& 0 0#S5 Px 0 0PRS 0Sl  P H iU nU' D0U 0 SP? X 00 0 0=>0>,00S-P) V  0@00 BH DH s p , 0tw 00 @i 00 ;00C00S0 S0p0dX0  R{ `  R+ p V0 B0 # R7P0 `pHp  R\ 0H  R  X B   H 00 0SP HW pA 0 `0 000HpQ1zz ܇ 0  U@} ,y ODv t XL`P 0 p(` 0<00X0$0 ΤP7 p0C $  0 嘤p# P p1 ᓤp Ꭴ0S (0PS0`0C00S 0S p㖤P0 0@00BP (pY X 00 0y0SP W( V'0]Yy Qw P Pm0@(p04`0@p T t``P `P$00 @0P, @0P,`4` pGP BPi =P 8P 3P .P 0 $G00C7 00|W( pw Wy1,0R?0BH0R9 W `-p0S0`0 Y1 0 P 0` S0 B 00 RP  <YPL`p 0` 0d40X0  R?o20S,Y/ `pHp0 H0PX B   H  0SP H0 ` H00CP9P ኣP p0CA > ,0 0Rp0 P s zPY0`P pp0C00SjP WW ,0z/,0ZA-@P`pc0 PPd@-` MHP@pP<0P 0009PM ЍcA-@Q0R`Pv v 200S8 .0P1S010p F00v`0P$ pW@0PD ߡPP\ 0 "00P0 0 C `C0000 Q  Q*RQ/ #@0000 B`0P#00P0s0 㤠P +00 #B0L0`0  B0 `xc q p@-@P {Pp0@-P$L M`T 0S pW 0 7/@P Ѝ@ Ѝ0804 H0pp 0M 00 0ЍX`0A-P$LM`pT 0S $X  0 8/@P Ѝa@ Ѝ p0 HV0$o 0M0 00Ѝ_0A-P$LM`pT 0S (X  0 8/@P Ѝ,@ Ѝ y0 H!0(o 0M0 00Ѝ^0A-P$LM`pT 0S 4X  0 8/@P Ѝ@ Ѝ >R/H04s/H{0`$}>[/^ql l xl Pl (@- @MЍ[0@-P$L M`T 0S 8pW 0 7/@P ЍE@ Ѝ ?/H:08ptk 0M 00 0Ѝ[@-Pp`x@x0@t @  PU  ှ0 fἡ$  =AZm dm 0O-$M`03H0 0 0P0t 3ʿ0 00Pp! B b07<  @ BU^PE @ 0Q4BL3@0 MTT MT   ^DP!q!@2 Q   "  R  R  \00T3`00 01@000@0@PU*$Ѝ@2 0M  00P- S@0^^?0 0`0  P 0J ZS0 | 0J ZSx R @ \X1 0000 $Ѝ6 F5 F4 F3 F01 00CFs0S`0`C' F& F% F$ F0够0Ps 0 Dr Ro0\  @`~ \v\f\r\s\0\a\b\t\n$Zl  QA-@Pp`" ᎟P=0D! D?o2]R0S p0T"@=0 !14 40 0 V V 0 P0 ADi i A-P@p`'P.T T ! DI632 0 A_T @0T"@%0 !1x x0 (0D,TSTh O-`(p8SM PP 0p0D1070$0t1 0x10 ?o2V0S 0S W w@0P0  0P0 [00 #0@ S PT- U T 0  1 #P00?z PPc@T`P @  TP 0@T0P00IC1S@1@! 0<0`⩝pP; 0  00S V <0 G0CPa  5* 0=  R  5' 0f?  R 00 00 00 "00@\0000M L JP@T`P$> @VI?  KP( YzS?  sTP[0 "x0  0S!TE? 8 T# `@T 0 p9/P00ϝ͝˝ɝ#3 0 D1 30 Sߍ@@^ 0S`(O 0S,0  VR U 0 0@04p 0`0 p0 $  A aɠ4ʌP p  !PPPPU@ $P,P U\*   0@2!p*>) `. 00 0< ۝p a D (0~s(@  20,0T0 0S0"7000PJHF{00, 0 R00(00S(0 00 00P4p 0S 0SV WTy? 4p00J(1$ @``,P u 0[P Y4*  (0@0S(0 EQ ZP U @I 00P0p0TTe e e d d dd Dd d $@o(v0S nP ,,0 00Lp( 505x.``*`(S&`#0 5$ 0 5$ H H F ,E D Pp@-@P T UUp 0 p4"0 00 C C A-PP`G L'p@,0 $5 S: S@T @"T V,0``<,0L0S00/S , @ 00 ~pp@ o00P ~ 010 ~B ,B p@-@PPP 0P0S 0`0^0SΔp@~((((”0B0 r,p|B $1$0A-P (M`@P @Ppp 0 00@ P& 00C S&0  p0 0 0 S0;1:(Ѝ 00?G0?G+ "00(Ѝ0+dB $B B 0M 00 0Ѝ*p@-@PP P PpPp0*0 A p@-@PP U p@ D0B0 U(C<0 p@ A @ p@-@PP U p@ D0B0 U(C<0 p@ @ h@ O-PMp 0GW"S00` 0v@h P-TPg +T@`0> ǯ  0[ 0 S P +  Ϡ@00Ds Pa0DSW0DA0DS"70DWu X : \R SP gP"0 00T; W0 0 p 0 U00S 0 rS 0F0 Ѝ0S U @0` 07000S   Ѝ 㙉 㙙 p噉I㙙A p XR 0AA B PR `@H0?0 $ TWp prW = 0M0 00Ѝ70&4@-LMpP`@$0  00P LЍ`0 LЍC-P!M1M `0p0猑0<0㋑ @PW p1 0S ~P(2 @  }P* n6s0@R P $PPP) 0 0 < 30*ލЍ u>i?F㨀R 0 P P0nSP0S  ǒ@ĒzPwPuP( (帒ꜸlP%d%p$p@-``@@s|p@  P@P pS`||O`p@-@P @$F 0 (>@: @-M@ }p 0: S  M|p  KЍ!00ЍO-P-$@3,M00@ P0pST1p{U00Sy00x Pe0P$0@P`0 U  0 * 0 @Pw `FP@` 0  }p P@PE0S7 PUR0  Y*0Pp R  U T 0G U@pPP @Vh 0`0D00@ @$0,Ѝ0 ݑ00 0?$00S$0p0GP O 000 { {p q p @ 00 0g01[ 0 p0 0 0 S 0S[ t P p 0 S [ ቑD00 $9  @PP p0"(7 p@-P p @T @jT0 0pp@-@PP U  p@ 6 80:0  U;<0  6 6 /O-pP M@`0& X, @T fP @W P51 5*P @ 8/P  00 UWK:P PU@ Ѝ80r0  Xs@0  5 5 O-PLMp@< [ TW< <000$0D iP [ <0Sw 0WPD0`p00< 0G 000p 0 `;/PppYb* 0 h @( `P  R P`p,004P`Z ;/P R ,0V\P5P1@1*`Ip ;/P R <0  W@I 0@@ 0Y:W0@  Y:p I 0;/0P  <0  0I00 p' R` P0S <p00PZ0 ` P@000SCv 0 0` F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ P W 0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p, 04P8`0S"*$Q R0B 0C0 0W00|@D 0pS+ 0Pi< 0 {`<0 <S  ẏLЍ <` UE W 0L0 0 Y ( 0  S``V 0`S`jp @@pPꊠ@ W[` ;/ PP @ pT00 510 *pp `;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 0EU0C"030 00c   S &0 @PCUP00p 0;/0 P0UpJDp a%;/ P`pZ P000 JU0 0EU0C"030 00c   R 0Q$ @0JS 0J 0Q $0S 0 Q 0A A $0` S 0JQ 0  A<0SD  `00 P`( <0  0Ip'0 0W  dPh `R^'t0l  txL0\  [cTy@0\  [8&@0l  c 00T+ 4+ + * - M009 Ѝp@-@ PU 00S  RQ Qp㝌0P 0  P  pD0D 000Sp@-@(^~P(Y~p|pp@-PPM`% @T@T T0 Q 0QP ``P0`P 0 RЍp0i0 $ |) p@-MP@ PUP`0S$00500 00#  xP& p" PQ! 0 00CR 000S 0S$0ЍpG 00B `$0L0L 000Sp@-@(}P(}p,pA-p`@ PP 0 00S (}P   (} 0S  tP    0S `(} 0S  00p0@-@PMP ! P  0Pp@ @Ѝ0 0 S P 0<0  |& ``1@- (M0R0$00< 0SQR@ 0RSA!0 0 $0 305(Ѝ@P0@ C  (00 $\0R0$0L0S 0S ( !0$ R0 @P <0 0 $0 30(Ѝ@ꉲ  & % 0PX@- D  R4 [  2  $ h0P@-X  S H@ D >0( @$   H4T$ A-`PpP@p U T 0F0 P U 000Q A@0?0 U$@\0   # # 000S x0m.!D900 /P0  \0\ 0 /ጭ 0 0A-p`W$_ QNHO@A0?H8c` P@RX0X 0 0`a` P@@U `! lp@-PD@@ |0S,000P p@ |Ы1A-0@Qp`P`FP t {0dS AA0U0FU0!0, p000 0 {?UU @P P0p0p@ e  B0B10U  ?ࠃࠓPL0Y0 4` {L,̫H| 1A-0@PppG: `< 000  B BG!`|l@p@-@P P8"PpU0 =Sp=Spp p@-@P LPP@Ppp@u0 $  p@-Pn@P 0 P0@p耥p@-@PP DPp P3#p0D $Pd 10O- MZo @Tn p `P P0=S\ @PT[] A@ZP0Z03 S@@@S*Z2 81  0  K `qD0S9a @ D!0 0  Ѝ0Z   RS@ `D0S a1S  Ѝ PPPt p@- @u,PPp 000pp,A-PPh`` p\.@P 0=S Tp (0@00 ,@-y@P0@,@-y@P0@踡,@-y@P0@耡0Q!-!0!1100 000000 0#0, 0# 00!R0Q0  00R00p@-P@`%1S 0p 1" R  ! R    Rp@P@`%1S 1 S  \  1   p@Q Q      p00 0/A- Up `QU @ @E7/P@G-Tp `AT P PD7/PX PPHPG-Tp `AT P PD7/PX PPHPO-`P@UpW 1S @P@E  7/P?@P@0@@@ģXB !Q   . @J000 00Y000 @0@S00 PT!R1S D o 000J@@0@@@򐫁 @@BJQ0 @-@"P 0 PCQ0 0 R QP @/ p@-P`@T0P \ 6 R6  0 T00"P ^[0000000000000`001T\pp@pR* /o" T 000 2 01T  p`^`  T V00pp@HQ `T ` R0\00 G-@ MpP! PX0PD@T$l``PX I|0@XPZOv(O6w(0yTV  800 C0?O 0LD.00@-},@@0@P0S@蔝A-`@P吀@_}-P(p0@aaZOv0XPOv(0TTaV0( $0 00\0p@-05S PwP0SZ sX@ 0CR\wp@T P XP@v( ܖ/p@-@P $PP $P p@q0M0 $ p@-PP@ T  $0 !0p@/800H $T\0H $ p@-@PM# $`0.  P6 vP  qP `lO00S 3/Ѝp0 03/0Z0l $q C-DM$` 0RP 0(p00@0$ NPP  0(0G,00S 3/DЍ p0(0,003/ 0PP A-PPM@) T/ 0S Ѝ $@0 P c00 `pP nЍ00p800 $T0 $ O-p`"`\2}M 0(010a, PP~ Z@Pq 200ku10 RE du1$@ 0 01 0 p 4p\p8`D` 0( .,0p@_4Xh0T $0W0T $l L p@-PP@" T( Pp ^P 0S S[]P p@U]p0p@/80w0t $Tx0t $ l p@-@PP U  p@^80g0 $Uh0 $ 0@-PP M@ T ]P Ѝ0^P 0S\0 0_<00 $|T 0 $sP 0 p@-PP@! T' . `F0S p\P l^P \P \P p@\@00 $CT$0 $:l L G-PP@D T  R! R `V" V  0` Hq%p$, 0 R R- 0 00 `V00!`V . 00 F0R!  ! I0,$K/ 0  ` 00 00 0000 0` @-h/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 `0:0 Y C-@!P1pP M`0030L TB A< VP8 `Y M0S \!T1 0 3 30Lߍ(#@+ R? R/ ! T ? p0Sp % 0 0 D0 00  T   RP0 RL O-IM,M`d$@PPJ X4 I 0$000 pW W0 $I4$ 0 0 30Iݍ,Ѝ0SJ=0 0SX 0l ? J=000h0y #K0 T ?s0氇 &J- 0S VU0  SU S RMJ=0002嚏 0 0d000H0:0,0RP @,VU  W3 0S`0S  0S0s S0S RJ=0  J=00YWI O<  UP] 0SH :ig03?Q #< J=P0h 0 K<0K0X\ K K K K C0Po J- 0SJ= 0 rS SwJ͍0 ($" 00SbLP P P J=00W0  UPJ͍^P `l  O-`0$@,4M QP@p0DH0000#0C S0 #3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWX` X0 ? s0搆pPT0S0SI # ?s0qDzPT8VT00QWX000S RY  Rf R4ZP 0SP"0 T NT@@O 00QWX00VT<~! 0 T 2 X: Zpp 0P 0ȐpZ@D 0   T00? ,!0 piT 1i #Z9䐟PP p0Ȑp  P030#?pW@D 0 DօP^T[pEL  ȅxʣ4 |P P  X p G-`!p1FM 0010% P@mp P  RW P Wv`ov` 0@Sp0 0 0 1 302Fߍ0 0000?1D 0 0 0~P Z /r RX 0S P 0 KdA-@ 0P`p'0 | 0P p@-MP`uP@@P@T 0S  R0S @PPЍpPPЍpp@-@P ppPPp0@0  0S/ 0CAA. q.S .R Q P-S Q P_S /@-0 S?RN0\L 0RF @PTN 0S`U DDpWe U_ ^" DPD`VQ S`. @@@0T)\ R /  R 0 0 0R0C?o20SJR 0\ 0R 006 S0 S 0R U. ^2 D0D@T 0U& ^ D`DPVS` D@D0T^U ^ D`DPVS 0R`V^0Sp@- Md0@0."'  P 0R0 0S  R la  haR 0Sd .P 00 Ѝp 0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0PdD@0S0S 0S  Ѝ00n0 n @-pQM @`PQ Q Ѝ0SSp P*pV0S# S!  0`S Ѝ Ѝ00S SD<0 <P 00@ p@-@PP` U V 0poPp`D0P U@`0P V l0P  O-M H 1 #C 01p $0p8 `. P0 0 000 0008o P 3[ 00 140030.؍<Ѝ  0?sQ , s0,0 0(0PU,(Q Z Z Z[ \x0 >dkZ00Z00Z00@  @-`0!p,1AM @PMP00 402 U 0PP  < P-@  0 0 4 30$AލЍ0SP @0.Sd P0@  D x0 Z00 T d @-`d$M`!0 S  ? S1  0 V% p,0< S7*@ \ 0S PUS  \Rp`V0 Sh `0 0 0 30$ЍP800  C 0 C ꧟G-@P`p W"  xPP  @   @!Z<D0 MW0 DD O-@-Q'g M`4M$07,0000&<<000  $0S 0S &pC80 @:0 0XP00  03/P 0&,@&<808 0 SS0040R0SW g R@p$pvQB :p00(,P Tp*0   C 0XPPf00  0 3/P] PTY@QYNYZ `M40S?&<800S !T? `=Y :Y7Yz_4 0 0D{X@P200  @ P) ,w`P% $|0 D0R 4 4StZ 4So 000`0 T &<800Sf 0D'TS @pW0(pX,PG Zx 80pH ZCPK黟 h@`I rxZ2 0 00E   FP $8Pr /r P0S S000 p0S?xZWy 80LE0S5 X00X0020 0&<800S3@ }@PV 0 8(5$%0 5s (0SP #0SxsX00@ $0R TA TTeT @ }@PV\(0S `<0dPC80D\H X<0 C,0P? 0P,0(00(040@.XOt00S000a@0z_4 0 0hW@P00  03/P X00`S  @d@ 0(`0\ d <  80.$PRCP@G4&<80DD0/0$0%x0,$0SC?, 0SD0,80.PRCP@G@0/%xP U@0& JWPs0000S 0R $RZ $R 0`O-SMP$0@4 00D10u`P {upP P$0X` 0   C8000pS0  PO 000 VPK @@PX 0  EPvv@|#t3 0 D1 30SߍY 00o&W00 Q0 0 .Q0Q RS% d! St*+ 0 &Pvv @S Rd! Sf*.[ 0 PD < Pdo 0 DDQ0000 0000 Px0=S V0S# S S Q 0 Pc0s70SQ0S V000000  Q000S0000 P=ʖV00 0 P3ʌV.[00 0 0sx V00tx0/I0 PoV000 DDQdV00W֛u]V00TX< O-`MZp 80 SP @P> P\0P0 < A C0 BS L= S S*04T 0 P00|0PPp @ C d1S PЍ 4 PXPU| V00VP P P4 pQP |QPxAp0PP@ୟT@_ ` `  " $ & (    C @0 R!  0 (P  0  PP00++  @40<0 C0+/0PAu U@d1 `S lPUY  0 0S  ! ̢@ O-p"`20020& 0P ؀x@☰0" $ `* ,  H D K   W 0S0S  ` 0 - "2 Gߍ0 P 00 RS S 0 0 0:`P  =`$@0 0,0`(p@ p$Y i:92 I52 0Y00 S   S  R  R Q\  ^ \Q/o" S R0S  0 PQ +0 0S Q0S %b0P$0 哙P@ $ 00 B  `L0PJY! $00X $8!  0`V 0 \ 9 00^ Q  P V \  R R  0 0 p! Y ` P 0S   0?S C" 0c6#PY w ^h \S㜐Q^@$T(p0S 0` @(p ,p$ T d:42 D52H 0SE0 S > S PR  PJ @0 X0 0`P`&0Xp'p 0?fρ/Z @\]D' 0@S0 `X@T $PP@P VrTrT$PX@T@(pT q W 0-0`P0`pPVUV lq0P 0P dX0  `:`PP` 0TsPXP? r0S8 Z r` 0@?3.QRSP㜐  P   P \?oR20S e R㜐H FP\AR POV `$p,0PX0000StX@T0 4$p0,0PpP S 000 P@T 0S00S`>`< 0 `xP Y 0\P-h[0 P R 00S R00X  P4 0 PZ 00S!S㜐R0S f =6. 00q4@$8(00P0p$ `d  p  ԤĒ V 0堰@UPn @kP^댠 `VK|p  tp 0 $$0( \`hp !n[P /ZP30KL L,0N[PpK),+P|,0[ SS S0 ^0Q0  p 2 P Q 0QV0: Y @`4P 100$ 0F&0 0S  00oP@P P0U 0PoP0U o0$p`,0PK n.I> ☾ I L[P1x00x0 oꦕ@`p@$P P`0V00T0`oP`O-PTMd Yk P0Q@p CP1=^ 0=> 0 r`PpPF 0p R R R0 T@0P p R 00 00  P0 0 V  X [ 00  [XV,@TЍTDk?/Y$lD0/8 ( G-XM`@}P pPP@0 E0    j 0wP 40S0. XЍ UP nN  0YP n8<8 3P 4PPAO 0 O-"M2M `Q0<000 Z 0Sq pr@ lp =~<  A. *8PPh 0#S( P$ 0=0P P @ PR R R UPP CtP4 @ R0 @P5tP $K$ (0K$ KP0(X PPU 00   P 0@PAwP0 t0< 0 0 30ݍЍTD0/i8x0/_0 x X 0PA-0(M@p`P D  w 1P @PP $0S0(Ѝ @-@ mP t0  @0O-p"|2M 0020) `@1rp! P PX PPQ P QPp!1 0 2 30`ߍ0@PSX 0@SZp00 0P6 10 0 0k P ZY0 Y  0 0P Y:[ 0 0 X  R  XR P 0 xA-pP`P@ 0 I 0P 00 $p 0A-L R@.Ġ@@@O- - 0P aTM <  ,x4 j7Ma0%408j*C>*<* 9j=2+X |z j| J3**?J0VA$Kr~A$16zA$0*4*({4~!"r%kz!"1j5r!"7j5 Jva&)C*0V7 8N(̅0  0! B 0%a0,@0#@,0 L 7@ @$௏@|O!dE #.2* ㇇Dta& ,80Jlʎ$ !0 FO8 0.00#,0H IFc5p 8` *pa& 6@@!GDKHꬃ@ @  .x)HOLn # @*,$x \Hǎ @: @$"@F .dE! , 㘽O   * $yJj  .$ !!㴹D  ,bE (FOlŎ@@ . !@C @@L@ @,@` @$ @Q^BK !  `. ધ 㶩Nn $ , ]/MlƎ  .! SD@ @,@ @$ @㡨MK ! . ȫӧNn $ , BlƎ  .,! ֧7L j@,@ @$ @դOK ! . ZDn $ , JlƎ  .!  O @,@ @$*H @٢oF K !  . n$ * BOj  , qHlΊ @. @$ `@"FJ *.( Ojn ,! D㾤J  $* Dj `@. @$ @`O J !,p KlȄ* .8`B  $*$Nj@, !@DM@ @.@$ @@ dH*. 9 M !,, ۦN lΎ$ *Aꪌ @. @$@eLdH ,!D)O   " *Db-  . Jl˂@ @@$9@ LO@@p !I[EF@ 00@0#0 @, /H Jc= , }Ob+ . HȂ !OF<@00 0#0,Oc=   " Jjb+ ,DȂ !SO`00 0#0c=@5:K0   " 4b+L B ,0Ȃ 0 P0## +N ` H` 0UDP  DTЍ@-@P  0 'C D(00  #EgܺvT2p G-PPp`3 W) 0!ӑ00@@i00"V>0: 0iS@I"p ` *0V@@p`F G4\0P 00P x X ! 1 p@-`P0M@0 00' T. P  !7R8 bx b   x0 0 0 30X Ѝp@5Lh0t uT,00t mꚏܦ hd @ C-, M($2$"0 P00p  ` 0R @  0XS @@0 T $. 0N `!P1 0 0 30 ЍT  0 s0Aa0C80BS.R ^V* 002RP 0FS0 S S^*0X >s000@^0 8< 4^*0 8<~- MgP ЍDD!@- 0(M S $ A \/o"S R9 S Q R L 0 0 $0 30)(Ѝ@P @ B  (  0$\ S $ L R \0  R ( $Q C ꤎX}| \ A-P!|1`P rMp00109 U? @^X0pA00tAX0OY2?O 000TAV gP2  0 TwpP# 0@gP 0 0 1 30rߍt0<0 "UX=@0 P ]h00P 00;{ {ܡ 00- $  M  ЍTz -- M0 0 ЍЍ/-8 8- M0 0   nЍ Ѝ/yp@- MPx|@`x0@t P`       @X@GPU  ЍpyȠ P L1! @-`0M000Sp P@ T  L#Sp Q@ 0 0 0 30'ЍQPpW @@T PU 0SP@[TV`00@ꊍxpx 0p@-P0@ 0 p0g`(0P`g(P,Pg 00PP 0P 00 0p}pP 00 0pp輞 0@-@ 0 0 0  0 0 u 0 0 00@-P M @0Kg 00P 0 %@?o 0 2c Ѝ01 00 0p@-@P 0U0 0pp@-@P!g0PPg(0Pg(P,PpO-p0Pk `,nPc @000 S S0 S S t0\PQ 00*P Upp7 ,P,H@P! 0P0,0S S S@ 0AS A.Q@P$  P0S0Q0000*fP  ePPb@^@PP꬜ d  O- M`p@,0(Sx: H(T] TppU 00SQ 0 RK@D @TPF 00SB0@D S@D P+ T0V  0@D !0@T0PG 00S#0A S0偠0 $0S000  0S% p@%f0pp!f(0pf(p,p@ ЍeP  (,@(0  Ѝ0 00@- M@P   p P  Ѝ00 0 $$ 0 P Ѝ09p 0$ $2 Ѝ0O-PTMf E,Pp@0@@ ppfPc,4d`P_ 0 ppfPT,PPU 0@Q QG QR QB pp0U00S dP- p 00 0@ ` R  R2 R[ R 0 @U ` 0 ae 0JX0M 0 TЍ   @ QA@0U P 0`   A 0  ` p0C0&.SI 000@000@ 0pp@xqE0Cp2Sp X 2S 000 @ @  @0 `00hUQ2p``0pE?h02l0B?X020`020d0X&hH0@C0DH0SGT0Ა S?Os t@. Y hh`0 I I h T`0  0 1\  0HH00 .)Td0 A0 ꈡ0  䰊 Y 0 l@p` 0 tp pH H gT0  tp0\  0HH00 .[)Tʻt!`00 0g@Ꙅh[,[` (P l  ON8 d $] \ W VX (   ~ } | O-tM@@  `WPPtP0 0 PpR 0 0 G`1弴4Sᾤ,0    t6< 0lV 1PM_80X6< 0B>PU  0R40$8 0U01g`1S   ;`1SU0 Pa@0 0 P[0 0 PGP P P30 0 P0 0 P 0 0 P0 0 P0 0 P`1S|Y~ 8 < Pip0pW  0R 0fWpW 0pW  0R 0ofCpWj 0pWe  0Rh ,0o}f/pWIpWF 0 PS  00ojf`1S   0 ` 0 `@0 `0 `, 000 0O tЍ   YP _D2P 0 t0%2p 0 t0 1p 0 t0  1p 0 t0 q1p0 t0Ru^hO etЍ tЍ80 k &0 j0 i0 0 g 0f0 e0 HSDl{ G{ z Ex x Dx w Cw v v v \v 0v u u u u pu Pu 0u  @-p0AM M`@0 $0 40 0 R<PP0S c@ 80 0 4 30AލЍ.bKHK0,@- M@ p  Pp'<`PP 0S <0030 Ѝ00S.S 0S Ѝ|s 4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30AލpHJJp@-P@`Q  @Q aPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_40P 0t0`W00 Ѝq p@-@MP`0S 0 @S 0S@V00ЍpO40@ 0t0PV00Ѝp q p@-M@PX0@08@0@T  0UЍp\`` t0PUrO"*00 P@wЍpp h=p @LQp@-`M |00<@$P 0PU  0VЍp_80P 0t0`PЍp @@<o 4<p@-M@P0@0<@=@T  0UЍp``` t0P)UN"*40 P@Ѝppo <$o J0@- MP U{  U U= 2 E0R8   U@ &@Um U.A@O4U]  U:  Uc  U A@O&U+ UH UpA@'NU\A@O U HA@OU4A@)N 3N$1@( 0?P Ѝ0@@O@@&N@@O@@O@@}O@@O@@yO@@O@@wO@@O@@ Mt@@Oh@@O\@@ Mnn Xn n m m m m m hm Xm Hm 8m (m m m l l l l l l l p@-@,YS( `P$p  (0 /[bk 0@- Mx@Pp0@0MOB>@T  0U Ѝ0O00@ 0t0P; Ѝ0k P8pk Mp@-@MLP 0 Q@0P0<00 0 `. 0+>T @D L000X L0 0 <0 30 @Ѝp@Ѝ/ `T.0 .0HBj AO-MP`@PP f p0 Q ЍSp SRPP 0-S  0  +S 0XP 00C<,0d .S 0 @QT.‖ 㘐@@✒)  S #3Q#@ " 0!   R#S # 2R 0T#+<'(0+8 +)(0'<0'4 0)< p 0)4 000Rp 0T Q#@ "  S #3Q#@ " 0!   R#S # 2R 0T 0T  P#@ "  S #3P#@ " 0    R#S # 2R 0Tp0 0T 0N 00 000J00 0AHAO-@Q dM0 R  @2/R>03?1~\gO^mnb`AS N P _.((H<S0c&sf~e~rHpl W E T -b AE#D((H'ᒾ  L>c@L<@<0d0c@02gࢲ"X ;kD~ @~<~ZX 0K Y N XQ ,0@00H(0L04 $0\0H p 0T0`0<00P00D07@Z XY |XX xXdЍ\ @A@R@0@d ό 0 0dЍL0Y0  =8X $ e Xd c ?c Pc 8c $c @-@P 0D .R S0@*ST .P@Q QA.@P@@? -lb @-$MPpPpo@[ d  /0w# x'w000 000 0z0;7_Ps$Ѝlb C-p@ MP`@PO < 0(0=D0@ 00=<000 0 jPe 00S@? PH 8 gp= 0@ 0 Mp 0,00Hk= 0P=40 h@PU *( >0 =  08/0`$PEHk= 0HP=00PP]d P0 I!` p , 0&p =000S#=000S* -=0 0  BR   =@ 00 p  R 0S .S 0S 0S00S.Sl\P=P<0=<00SDl``@ C+A0X 10"3! 01;A0001;A020 1;A====C;+A0X 1 00=-1;A>A C0==C;t(4(_ _ ^ \ ] d] L] \ P[ "Z HZ ,Z Y PY X XX W V PV V U T T 4S `R Q lQ P O N pN M =<00S"0 S00 =<00S 82d  0RO0007 `P0  p 0pd  00D$ 0  p  0 d  0  p 2 0DR  pP/* *J@1$#00DK0Z;h!op=<00S} =S<0PP80 C0>PsS0 Ppj jDK`f/Dk d 0 0  pU `T/Dk 0d  0  qpC ?/` p 0DK 0CYG P f80 C0P0Dk 0PCU?ڸQ@kp@T3 1 W2 0d  > 0  p=<00S0 H[= 0@ 0V#T` *( l:0 p:  07/=P 0@D`d @0 H[0:0> ! p 0DY3*{`@p]0p PYD V[0 p `0d  @ 0  pq `F@P 0Y !Zp^=<00S< LT-@0d  D;R? `p0  qpC 804PC0 0 ` pP50 \p. 0  `pP%H+n! |Pe=]<0PPt=@ <0 =<00So 0d  0d=0$0]?^ ! &p `V\PD1 0RSP@ ` ,  D-HK  0j"YP *( >0 p00$07/,0IV = 00H+D 0 S#@P0 p @P$0d  0>0w? ! p ,@,@8p( O@0Y00D> `P0 p =<00CV5U5E !?C0 SDo0 pm=<00S d,Pa,@^,PP0@@2 D;?0U? `p0 wpI 80 C`0p P@H+=<00SW 0 Ct_ PP=<00SK80 C0P!0D 0 Se C* *J 1#00 Sx!o9pT 0 Hk= 0P 0!U@ *( >0 px>  07/0- `PEHkPD<! p0 Hk= 0P 0a!U@ *( =0 p=  07/0- `PEHkPD=]<0PP-00 R=<00S=D]<0PP0] 0P CP] 0P CPPp$0 PD[ 0U:=<0-p<  b@PTT l``ЁpP 0UG 0 0pf 00e0PE0T6 0 pW ld  `P?! wpI W PpzoTDK 0d  00 0 _p0p  `PPVVm @ЁpP 0UG 0 0Dp 00e0PE0Vc 0 6p0 H= 0@ 0 TP *:0(p* @  4/ 5!p0 H= 0@ 0h TP*:0 !pY 0P CP!p* 0 `Dp A?d `  0 ` p  0 p B 0 p *` 0 DPp =H{ 0` PP~V *( 80 8  08/= 0`Fp` `H{ 0p_ X 0 EpV U* 0 D PxpJ =H{ 0` PP@V *( 70 000:/= 0`Fp` `H{ 0op" h 0 Gp * 0 D P;p =H{ 0` [PPV *( 60 000:/= 0`Fp` `H{ 02p xV0 PpKp @)0 DK `p =H{ 0` @PV *( 50 0008/= 0p`FU``PH{Np0 p 0 `p O0 pp@e!`p  P$ 0DK kP%!p~ $0T@0P_DK@`0 pm 80 C@0`/Pd0DK 0Sp @[)pj_DKd 0  0 upG @F)DK0d  P  0  ap3 /)0d  D;R?0  Pp" 80 CP0PD p :B P@PIT $c``pP 0UG 0 0*p 00e0PE0T̿ 0 p (0d  D20R?>! pTT!Np 82d 0 b?%!  p!p `$@0@D 0Y:Vڴ!Np!p @vp  {@P[TpT Ha``pP 0UG 0 0p 00e0PE0TUP 0 poP`Tڸ`!`p_ ` 0PCP@ ? > > = = l= T= < H< : H: 4: : 8 h8 t7 6 5 D5 4 t4 $3 2 D2 2 1 41 0 0 / / p/ H/ / ![p- `"TrD|mTlXv``!`Fp `=`<0`P`u+J  X0X! ##00 !+J X  !+J XX" !" !+J XX  # !+J XR! !+J XX! " !+J X 01;J!p PUD @- MRA X  ,@0 4@(@@0 0404040040H Ѝ . M-(040 1Ѝ03/@A-PS`+p@ W@0 V :0?s00@PU &P@(00T0T@D0T0S$0l0 (P@T/ G-0`AV0:@p0T?0)0 ?0 0@T0T?0P0S P UT0 $P" P @b(00QA-Mzp$0P@S` 0(01$0,0v(`Vi0Se(0S$P1,  0(0, V.400:&PV, 0,0\Q U/  , / , 4TP(0T0(0 SP$PQ0(00,0Ѝ0F 5P', (` , Q!:0,0 ?0, s0Q:$( ,00(0 SP$PU 0"00(00QA-M{`$0P@Sp 0(01$0,0w(pWj0Sf(0S$P1,  0(0, W/<0<00)PU, 0,0\P U/r ! , /r !,(0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P', (p , Q!:0 ,0?s010, Q:!( ,00(0 SP$PU 0"U00P(00G-PP@`pg V] Tj́ H THH H0  ^P^0^P0"!, < @D#Ì?0  0PT T 0 00 "!#2<W 0:T  0H@H 0@ 0H =  =00P*PP000 h80 L00 TW P@* () ( ( ( O-PR@pP Tv 0S7 x" `lRPHP [B T Wa@ Z 0 00@=ZB ʲPM [ [T WE 0@0 0Z 0[9Y^ T W0 0@ 1 0Yp 7:P$T W 0@ 2 0Yp 7:P[0% [ S 0S 00@ 80 B00 ;wT W 0S S0S @=S0,Z0 T ' 0& & % P 00/ꤕ|X00P @/4/,/ //& % % % % @-`MP plR@\ ( P0  < @,MK}E $ l% @% % A-`PhQ@pPO TE 00S>00XS: 0ST.C+SQ/+` 0000`  0C` ^7ࠃ0ࠓV0Cs 00000  0C Q700C20@?D0 o$0>0 hD  $ # A-Pp@FU`, T08 @W``W 0 PE.pVp P7000 2000 S70Q00 V00gD0T &" / o////@-DM` @p0 0 < 2 *0 RP600000C0< ,0 0 <0 30DЍih " O-hhH Mz zJ0 - @P<%94BP B,@h3"f'*g* J 1`JH*ZOWVnX= 0@Y$* 0 Sp: [ @B0?R0SJ  Ѝ  0 H|p# V0X[0S   000 00000S 0WYp@ D 0 Mp WV  0 MAp X 8e0$ 4G Ѝ d   A-`pP۹0S- @4T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 $0p@- M@P00 80p k$`p Go0 (0 0 8 30ލph8 0-@-@R M00  IPP * Ѝ@Ѝ/ ) Ѝ@Ѝ/gPRp@- `@ P\PVP0 ?p@,D꛿00pPRp@- `@P:P4P0 ?p@,"y00pp@-@Q `PPP0 ?p@,Y00pp@-P@,P  p@ p@p@-@P 0PS <0S P 00p-00pQP@- 0R R  00p@-PP Q@ @Q Q Q AR00A32 00pP @p{P Qp@-@P PlP | U J @ W T 0?G0jS*k&0B:PV + T ??GRP0s  p H5s3s1s/srPP    !ᅻ d\uPH s@P{ \ Qd00`C00A`R AQ6`s (  w~ 0 S1 pB01` ZD0 0D 0B XSXD8@   D 0@ XX - pR  ! pQQPP?Q  Ӓ.0p@D0@ [q (@ D0p@0@@ T(@HX~b @TpgnP s@P H[sP,x Hr,H'tPP8PlsPP AP: AqT cVP0S]\0S ^ ^NNH^G GZ Q 4 jZ  R  {:S03V:gH H 0 Qk& B AP{{ {0 /G  RP {P0Q00 `8 ZH8)r'r%r #r!rO K (ꭋ p V HH0S 0ES 0SB c 5lŸd 0  0d0D 0H0p L m0@ SZ  0Su  P  `  }NoqK`aD@` pP D0$0CD0pR PD00D0N   P5LT  G{ {{ R??GQp 0  ^ ER   D0B @   㒳#  {g ` $ 00S0S:0:g `A5??  `@hP@, j@<@H  `c NWp 0 S0 0` Z1 D00pW 0!0D 9@@0@# J   S\8 0%H \PR 5oHqL P05T@ @BP+@  3 < ^ TPUJkd^ ^4^PK@d7TTTP @P@ 0ES0P008S0S0SK VkHppp pp<0S  0?G[ * 0S8@} 0%Qd 0fkP&46% }TV (0@8P Q SP0 <P p @`/VP0!S]T0S RY/G 00jR0SI:k60C:P H 5?55??P9P080T R0S?G0kS0S0SzqPx rPTp<0S0?G0L kSJ7SHppp pphqP qPc<0S T0 /G jRQ2PQ S*? <P p@  6P@P<PQ! GjQ!`kn\ S [6C#::T00P0 SP0 I |??GP G0TP0 8  @  0M 00 0Ѝ<, 9A-@PU `ጲ0Sp @ P 0S U@Dp@-P@QPMP0 S :pSSp 0R:pp,0e0$ @⁶fh0$ @z  p@-@P#` V+P. P1 `PVp 0P P   $$P V0 P pTC0 @<<D0 @5$E0 @.p  d 0 0ద@-@PDQO-^ 4A`@Pp  0S 00CS 0 \V0 S  RYWppXpQpW\`\\U0 SP\p Q@-P-r-0w00-0x000ڷ 00շ000S wS -S rS 0S /xS /  @-P@20 0訷 0 P P//0S/ S S/0S/0S/@-@/0@0T S R RT//PP/PQ/?SQ 0p@-0 03/x ?SS 0p@-0 0$/< ?S S S`/Q/AQ/Q Q/?0 @0p@-0 0Q/?S0?/0?/ QP00 / /@- 0  p@-7P 0 @C`  P.^0SpPA9P` @-@P M` P0E S a Ѝ ޶ p^׶0S 0Z0 Ǵh p@-@PpP Q 0S PP80S8p@$A-@Pp X P@PE@X `±P`008 ⏴` O- M` V" p@IV P៱ @P0SV F!`F0 `1 Ѝ Ѝ 8` -\  @010C. * @ @    RA-P(M`p |@ 0 @0@0 PP00>` P@ 0 (Ѝ  0?G0 5CS  A/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0p80L0 ɳTMP0  O-PM`p 0FV"S00 0^ Pf@P-UP +UP0+ $pŰ"<,@P00Es Qa0ESW0EA0ES70EVt \SQ w@0U2 V+ y yA ` 0T00S0 Sl 0J0 ЍS T P0 0M00 0S  Ѝr `00XS 00AA0C PSVr `Pr `0?0 g 0M0 00ЍWꬶ TO-PMp 0GW"S`@ ῭P-TPr +T [ ?0 0a0 [00D  @Pp P 8Q P  S  R/ !"  P 00Bs ^ a0Bs0SW0BA0Bs0S(70BS%| [Y Q P  S  R!"  ꟴ"00꘴"00 0S \0F0 Ѝ[@`C ?0  0 00b 000Dn000S  Ѝ[@`h0Te W9 p̜ ̌  ̜Ľ@00D l0T00XS1 Wtp0 0 0[0T8 W  430p3C3O p 0`@> p PP1?0 #p 00D> 4@00D A Bs QR 3p `> 00XS W pp p00XS W& p0 0> 0 00BA0C QSWpP pYW 0@ p pp0@ pp 0M0 00ЍP  r  Q0?0S @-[-- Mo ЍЍ/G-P`pP WV ᆧ00`F !R !V6  ጥP 0PE (膲`V PUU@@QnPP X1 00a   @@PE Pc00Q W000@00FH0B0 GW,C40 >1 A-P`H@H0@D@p _>U  S A  p@-@P00C0S S u P 0` Pp>`u@-@P  0`00@060  - M?  Ѝp@-PP@ T 0 DA 0p80M0 İTND0 ⻰T 4 A-`P@p' T. W5 0S 0SP`4 0FS0 0 0 0 R G``0Q00h6P0\ ℰTHap0\ {W(b|0\ rX 4  O-p#@3OM PPd0 h`0410`10 V Vy Z.` zP 30 00 [ Q!.PQP\.Q a :!U!PZ [ 00:[.[<##O[0Q.SI Yg0IS00`0 0IZ 00 0W 0 P00 `` ᒫ0 0C SB: 0  `  0 "+00ױ/00H!81 0 41 30EOߍ:[ 0( @$000,a 0 0 `00P  P00 ZU00失00B0 ⚯@4 < PPF U.R|  :ᷡP pYܫ ȫ  l O-`PM@p  W0p0 W0_( 0,2P= $P  000 00@ppP 00 0 "qP > Q Q0 `@V 0H`V:`F0V:\`FX @p% p W`FG R\30 0 00@ߍ Q Q0 S S `  ⥜ pPx ` Q PG PC  T:  @D 2P  0@RP- #[z0dpp mY  `FƯ[ ~ Kq꽯 `FW \ R  Z Vv P `p 䠊 ` RU R R RM T* 7PG p(?2@D Pk @P`V0 ឫP& !T9: `P  卫P  T014@1:w^0 V0 02C0 @0 @`k22 0@0@0 P0 `@P ( ll1@-pP0LM@0D00G DP`0S- @.0 eP( V( QPP0 0墩 0 EP  :2 0 0 0 D0 30LЍEPlPPP Z@ 2T8C?F/ ȭWȢ H 0 h C-`PM@8 pPU* Y @@NO00L  0XEP 1 0 Ѝx@@JO @1T Ѝ*EP P$ C?R/ y  , O-UMMjPp, `|*0x: xU0爕0L50|5 0 ,0S 0 S00 (:0$0(00P00  0p @?s0`P WS#O 010)09 0 L5 30XUލЍ5  00/`P0 $03/P  W: !2320<0l ᷨP 0PP`P t00S  X ŝ` H R/@ DT L8\ [d*`P 0 C0@PY0 $03/PQ @ p W/ ( [4" R;< 0R S 0 S0S S 06P 0( 0S! 0S H0S 0PEP( 0P`U*\0L0Q*@䓭H0`P0L@H0X8HQ 00 d PL0 W0Q0C?o20SO pZOp [XPH `BP0 0 00PY ! R soQ \ V Spp0PX 50$0W  H0SX0 B@Gq 0SPSP B^Pb B@Tp `0S 0 00`@D @PC0@P0C`@S:Dp `@ P0L0X` C0 0CS:0S40 @0 @Pd0 w (0S@@刧Y 00@SV@ 4@`@,PK0 S 0B'RSB@SP PP 0Pa%10V?Z/ ⴫,0SU]?Z/ ⪫M,0P08D000_R4 0  0P0 : (0 ST00 D00R;*00P 0)P @ `@"0 CR00PS 0800@PPp 0`P CR00@Sw@P`@:$0 3/P ` 2T0(D 0T0@B/0Pw  D00 0D0D/=0 ,C5PI0 1P0 F (0 S}H0S 0P T D001Q=*00P00ᶦ0SL@ P| 0% 0x p Nύ 0 00M@1sJh  0P `P@ 000]0P %0UPS U00(D@C 0T0.0P D00 8 0 <  T A-@PMPF 0 S`06 S10p 0r-PP 0  1 P9 80 0P勺P! 0 `.ᷬV 00S S Ѝ0p.ᣬЍ0C?. n. 0 3O-PPBM0 M@0$40 0 00S01 S 0 "2 0 $4 30Bލ Ѝ ` p @vG 0 , Y6P@T*X$  P 0!  /<6,@PG #pPB 8 0 0@;PGp 000 00000 0`:.V> 0@ @IP 00S 0  0@T-  `- F 0  {. 0 tC?/ ⺩_. 0 d٫ 00S S[ YϫS ԓ h 0 G-M`0pᨫ@P0P0 V 0   0 pP᧫Ѝ 0 PP 0/ i A-M`pPw@P , 0P (   P|Ѝ, P00ЍA-@P MPp@`Q UX'0S9 0S0S9 P8 (1(0 0<00! P 0? p`WP 00 ЍU U* / 0 0 Ѝ0S  0 00S000s S 04 @P,?/ 0̉ 8 O-DM@P L$0h @400<00 (p+ P dP`` -0 PP dP ,00 P0å RR RR00  S S$0 S S H < @P (` 0 00S S S@ 0Yi*@ !@P 0S 00Q 0 0A@BA Y  9:I S4 $[ 0 I0 Y$:  K TIr 0FD@@ P`   H8  Y>`ΣPU P`m,k,! 0  0`!L1 0 <0 30GDЍ(+I P ` 'P: P0 0 0 0 0D` P`@ 000/,-,  0 !, 0000ѩ00 `Q`Pꤍ P \ p@-M`@Ps 804 00  ɠdЍp 8@-M@] (9$  Ѝȗ@-MP`J @ᦩpP0P0 D0) 8 00 @  PᥩЍXl0@- M|@@PU l@P@@ D T 9 P Ѝ0qPU 00 C-@PaMP`T UZ !0    ` p 0S  =  0C ^0".SDW 0@  Ѝ0 XR   9S '@ pG W0 QU 4 8<03?0T0m0 U8n<0  @S l  p O-Px#@Qt3,M `00$00 UK Pe PS`P:V Jk Vm #0 @ HP@`0 ܘP \ PUW @ ZpWP `$pVH氐0S V0F@ S0 s\b 0 rJp<0t wV VQ r/ 0 !1 0 $0 30h,Ѝ!1 0 $0 30],ЍO`:V@ `p xP :Z9U0 0S 0$ SPᰐ`qIpt 0-U V V 0"YT 0<0 J0S@f$ps `.V@ `$pVPd*PVqꔅ ȃ , @-`!@P1,M P00$00' U- 0p0H 00000001P*  0 0 $0 30,Ѝ 0 L0h0 ⵥU0i<0 ⬥O l <  O-tM`<%0Q45 @00l00 V P P* / 0 $4 0 l0 30/tЍTIPp<0T wTr T 0S` 0kt<0` d P 0  C$ ,  B pP R@ LTT pRU P Q  R @R 0Px Ru00 Y0S @\Tj<00@:0T0p0 0B Zk 0Sk* 0CR00d:w"2 0 l0 30  tЍOP@PUJ*0: T00SH`"H0 l 1P00[0S3@Tp 0Z00S RZ  @pT0zu YPn R 0S0 P @j P]0SA: 0 Y Y Y@0/Q 0 H P *t8 @R0PHPpT 0wV Tp T` 0lu@@0[' + ᵗP"p 0;/qp 00P @ P G(00  0 0 0Ѝ诡p pt P0 Q+ L WY  0pp`P 00 0 SM  0 00;/qp 00PP^ <PU;Q0 z0p ;/qpP0 q 00 0PUßR <0PUß`X0p] Ri0.0dX0P\OS  00QZ <P800CPU0&Z "   RNLP0Pe? P ;/qpA 0000 P @ P '00 0Z 00 `P*0 S': PE u ?J 0C0&<PPT 0S  0CPß(1G0 APU0 Z 0CJP %JPP @0P G'0000 00|P0 0ߘ00ؘ080 ٢0L{ @ @ O-P,M`p@PP T 000S000Z00ᤘ$0` 0PPW 000@P $ 0R00SQR+XP `  R& 0P 0啣0  UPP`| [XhV,Ѝ C$ R_oR  B0 S $ PRPPU8 0B Q: `PP$ RPPURP%X00S PD00P \[ TP|[  0P \ `PdPU[ @Tp [H S$0 ` Pd z BP 0S   00S S0S S ^ S@@T0Q00S00叝i0\#00& ^@ [ @@ S@ S80h0 ͡0志&0Dx p@-@PP` U 00 FG p 00pt060 ⩡UX7<0 ⠡0 @p藣0TS00$  -M0 3/Ѝ/0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04P0 V00 O(  0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04h0\ 00\ L , p@-@PP U 0S S S 0p@0/p0p@0/p40t 00t ꔳ t p@-@PP U 0S S S 0p@0/p0p@0/p40 à00 ⼠ܲ 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ040 ⌠00 Ⅰ 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04&0 U0%0 N$  0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04F0 0E0 H ( 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04e>,0Y0,l L 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04K?G/Ⱏ0a0G/⩟ꐮ p 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04iS?O/y00O/r괭 0@-PP M@ T 00P00 Ѝ0800.WTq[?.N(  0@-PP M@ T 00P00 Ѝ0800^/3T[?^/*꘬ x 0@-@P MP, U" 0S S S Ѝ00 0S0003/ Ѝ0003/P 00S00 Ѝ04>a/00a/ꨫ 0@-@P MP( U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ04 j?g/⿞00g/⸞̪ A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 pA0/Co<0*0m/r$#[?m/j p x A-PPMp@`2 W8 T&  P R P P P @ЍPX "00@R X ЍA}&w?q/,0^0q/%W_>q/ ! P` Z0SP@R"q{cꀨ ` @ ԧ p@-PP@ T  ;p@800,T?,x X A-PPp`@, X2 V9 T P  R 0 R 0\A/W 0A/| =/⬝`00/⥝XD?/✝V$?/ⓝꀦ ` @  A-@PM0P` 0J U@ 0pS S .P R`V V V ЍW  0SP!00Ѝ W` 0SPV!l>%.<P0/0%.5  Pp%{ h p@-@PP U (#p@80?0/U >/  0@-@P MP0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0  003/P 003/ Ѝ080W0/ʜU?/ Ԣ 0@-@P MP0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0  003/P 003/ Ѝ080{0/ₜU?/yԡ p@-@PP U p@eD00/fU(?/]p@Rd D p@-@PP U p@D00/GU(?/>p@{ Ƞ p@-@PP U p@'D00/(U(?/p@l L p@-@PP U p@PD00/ U(?/p@= П @-M@P0.S00Ѝ%@-M@Vp  B0?R0S Ѝ 00 0ӛ0CЍ 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S 0.0 R0/0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 /TW H0 0 /4W 4p/0/ 40/0/0O-PMPw 쓟@% !E  0L \l 0S Xg@.  ^` @^e X[@\AP0SI <  cSB!  S   XGS`P @p@P pG W`W0P@W ` FR@y P0S R*S@BT00S8$0@ P⧚S 1.34:(00@ЍAR R !!  X@\ P\dp `!S" Cr ;"*  X 0@Q 0;S@S \S ! C]R X @D#!2br   D"2c  Ds0#100DX0@FRP T R Sp ڄpg 0'`10epgL '0 " $`0W$00d $ O-@p$M|WP dd ``XY @ppW P\W, .W 0E0CI XG0 R S.R@ pW0 C B5 X3R XPń, PEU)0S0P'pW [W# P @d0Q P @ 0Qp' P @pWڬ(00$Ѝ] ҋPX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00   0 ]R' @R " XWSQ   Y I b"r RyA  RC .R p@WLd@K@H00Q   Y  x " ^  @WX  P0R P@WX(@[p58:dX00P Å0\S X ńW PEUT0SPS0WXR , ܗ 0G-PDAQ@H*p`0S$ R? @R0 0, 0U6 0  Р 000 P00 p pS00@N0?V0Sp$0^/P⮘AS 0S!0ɑ 00U@(00M  ȕ O-`V MP3P#VP30 U0p\ @ U @RF R R2 w(00 ЍW@ Ġ[? A @ GRP@R\ 40S4  0@0[A[V[ b?i/PF Y*@T*0P<0 A\ R!"ɑ 40S4 00( - M ЍO-pS$MP Y p 0 pS 0S0@^q @^` \kS0YH `  B@  p p@T @0S @SW pZ P٘T @`T00 S Sh*p 0A>S] B PY^p0K X Q= (00H0S 0Q* 0F S0S 0 `  0AS"`!0}@T`00\ڌ(00@$ЍAT}0S@"@A@pZZ {@0Ġ?  0^q0A>Sp0pS_000^ 0AA^ AN[ ^& SQ0SP; Zp ?0.40@B0?Q0SJw?~/P&Yp 0000@G0?Q0Shjw?~/P| V*p/Y P LP n?u/PBꨏ , p@-P0 M `00 1000Ip !@p < 40 0 1 30ލp@@E E A- `0M P@(q0 0 100p 0 p0 (0 0 1 30ލ@@E D Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ o(000 R!  Q @-A?S SAQ  0SLBH00C(00N/G-p@`0TS%V WTP @0TS P?Y 00(000QSp@-P@` P`VP@  0R p/pA-APUQ?UU@A`pp W ڀ1APϗ(00ʗ00Ɨ?00Q A@-?S SBR 0@S A諗00覗(00/-- Md ЍЍ/@-M@ p TЍR/0-S0 \ S 0^C00O-P MPp 0EU"S~ `@P-TR +T} Y ?p]00D`" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+0S \0J0 ЍY@0Tf UH4cp3cO P 00 AA0C RSlUPP\`^?pa00Dޖ00 0S   ЍY @~0T, U$l 00Dl@ Pp}0T00XS"@00D AAs PQ0Pp>ci p>cP0?0 ⦔A00DPp>cY00XS UPpb 0M00XS UpbPPp>c 0>U0@PP/@ p>cP꬇ 0M0 00Ѝ< A-`!1PP rMp0010+ V1 @^X0pA00tA0O 0 ??O 0TA0V PPV'0t @ d00 1 30rߍH0F0 .V,G<0 %R>; <; (  00- $  M  Ѝ:  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/@: O-@SM ^ YXb 0pS000!R !3  ևPP E``#Q9\*Q30A 0#1#2#4#8 t P8   ᴔ0U A 00 pQPP 0@pQ 0S  Ѝ葕T000@0000@0 ℓꂕ0000ȃ A-@`Pp`0 }Pa$0M 000Ѝ7 P0 0p@-00Sh@@@pXPXXP@P@P P D7 p|x p@-P@. p@G-Pp`t@t0@p @  O U  50 e   G; 6 `    A-P p@` F  {000 @P p@-@PPpp@O-M8b8B`4R@Pf 7pu r@0pD Q00l 1PZ 0S` P U [0@Y P 0@[P  0` PV:Z 4aP`0pS PP @T P 0S 3/0S 0P@U:W @0@00剬N Q|00p@@oЍTЍ0<0 0ࣂ 4 |5 ( $ !P@-BM1M `PFA0@040 E <Pe ! R q@0 p  @ PpA0@ P; P1 0b8!1 0 4 30>BލЍ P (@P  4/P Q Q 0 0;0 00P 0 0 @ P 0S 3/ D000P ; 3 2 `~ ́H2 $ 0@-@P$MP U!  0P% 0 0   0P $Ѝ0X~<0H X∑U8|0H XC\(| | O-@PU  RM `100Xqp0S@ @尀<P8 $)A0PS,0a0000S 000  000 000 000O k@0004<0 X{ { p{ l{ d{ z pz \z A-`P8  0S@P$ 0P @S0pP0S PU @P 3@0U-00 yT@ 0@ P (<0B/Xɐ}|,y O-lMR0  4 吀0 R X #`000Sa# 0S00 #34  04 0P Yڀs@|Px3p 00V^ p p @QS  QN P0 Sh @p $ 3/0  0P@Yr@RPs00SS" 00C0T@lЍxB@@@0d20\ 0 00SN  R02( ,0 (@ ,0 @p T0TP 0S 0 @@00D0000P 0 S PW @@(0XS, @ , 0 R1 1S@X 1( 0 (@ ,0y6&>I/X֏0S XbQ?I/Xʏ@lЍaE?I/X⿏@^( ( ,0P,- p<|T |{{ 0 z zXz (yT `u 0u u @ŸC-`82 M08@00051E@PrgQndea?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0(DHd,T$@VR gR 0` `\0@ S 0WS0 `0R CL W`H tO 0@ `90 IISQ0C 0 B@20<000/0PA!b   JW0 `0R C W 0II Q B@ 0/C!b; 0000P(W0 `0R C SL0 @`$;Q 0@000P W0 `0R C S0 @`y:Q 0@000P W0 `0R C W[0* *BQ@#/ b 2b:000R0P   W0 `0R C S:9Q 0@000P Wv0 `0R Co W!L0 @ F`a0 l@`X9Q 0@00 0P tWH0 `0R CA S: :B Q@0?0c cS00d800PD0SW'0 `0R C S8Q 0@0P D0 :W0 `0R C S7Q 0@0P X0  W0 `0R C SUPUP87Q 0@0P D0 W0 `0R C W~6Q 0@000P W0 `0R C We0X*c @Pc 0+; x0+D& W0 `0R C SD 0@J0@ S0ŘW0 `0R C{ S-W@u0 `0R Ck S0051E@!2 Cd0bSӢ Rcӣ? ?"?C04P 00nWB0 `0R C; S 0@X   pXX0 S0R05`#0P @04400BW0 `0R C S0 @`0P S@00300W0 `0R C SW@d0 `0R C S40 @` 0@SX @ Eqp qp 0@SRx" R-Q RLL0c((HQW3( < 200l0",= R$ ` QBP Ww0 `0R Cp S"0 @G`b0@S !WZG0`0QCQ P`MUyP 0@SE/  P   P W 0W `0QCP-0l @p`$H& (& r % pp o xo Lo n n ,n m `m m |l $l k 8k j Hj i h ,h g g Lg g (f e de b b b b a a a ` 0@ S4 1hW0 `0R C W0@S 1W0 `0R C W 0@ u  j  0LII< @P(D?HA1cd,0T$@D%!E_d2dN`Re0eϠl 0 bSӢd Rcӣ? 1PR0 b0  W0 `0R Cz W,0Q02 0000PWj0 `0R Cc W``+o ! P% i4 pEA-MPp@`)40@0 p00@00pT p`0FЍ"00Ѝ(@- @MЍh O- M`p@P&댠 P0 X X0 0p00 @ Ѝ֋@ Ѝ O- M`p@P눠 P0 T00 0p~@ Ѝ訋@ Ѝ\ p@-0L| ^ࠓ P0L|@ T.^ڏT00p^p膋00pp@-@0M-S` +S`P0 P' 0.00:S V00c0Ѝp;0 P 0< 2#00:S0 P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <00 0 0P 0.S 0 |P 0.S 0 0m1o@0 e@- )P8 L5@0#(@c\3i*0Sn SW @: :B PT@ғ5?0c ScEPPgVfVF0rc?E1c_`GedP0pfV0@1 0II0CL``S0DB\BP< P`>#P@P Q\1 0\QTP@n 0@N@  ^0#@;\00L 0 @c\0#3S0@ 0[ |[ 404 0@-M(@0@0Ѝ0 P[0 0A-00S`P`0S@P ,0E  Pp@ P  p4[[l 190@-mL0l6\|@N<@h0P Q 0-S 0#-L ! b4 0-S0P0S00S0S08 ,ZO-PS;N0Q8 5@0\?5O0(<2@ 0>;N$00ESSSKP@"0 cbG$d/'b2c /B/`0`01>a` 51E0"&.b`_:T P P DO  c 0(: 6(QS X00[$0/!+>0 _Â!P2c0Xÿ0+" ?00 #2>PV[ c 0Ă(: 6S X00[$0/!+>0 (a o!2c0Xÿ0+" ?00 #2>[?PEG'` @Gpm1%0P:#0  ό"!/ U n13:$  p C0!".#2R> ' @0 2 30 #1d0TX04? B4sppp00/S [js0c (Q  _W(: 6S X00[$0 +>P!2cX0;#0(PV[Pp`vc 0&  1&: 6S V00Z$0 *>Â!2c`V0:#i0&bnu8?O0P PcR` PU0$I"IVY Ba!kC(1 ? c 000(: 6S X00Y$0! )>0%!EÂ!2c0)XLß8\?H)" ?00 #2>r?D$0CI"I 00/A!b,!b S`0 B@ 3 1I!` 50.c((H`" <2c0 4S/  0` p0a8\?H)LN*" Q @ \ uO (@ό"! W/ }:&*V &R Z$/!* %!E!`& V 0#0 0 C2 Ό 02!>`V0`000 `000T@DPP0S`@( 0 @ 0$ <Ѝ& vc )1 ?0050):6S Y00X$0%(>!E!2c(\/H)L0Y("1 #2>D<0@004P<`pc' 0 P<0@004PꎇT 0 O-@P`Mp 0S,  U 0'[? P`O  # ≑0 ]P 0U000 S?S00SX 00PN<h0(0s ?S00Y`̬ M0@- MH@P@00P UNLh@(@ Ѝ0 @@l@XK O-P0M`@<SZ0PSЍ0S >S@0HSh0P0 T00g 0S0Ӄ!1 000Z@zhphp@ 0 Z Jh :h0 0 0 01@T$ <T=0pS0S >S@p<S*S0S -S0 C R@0H9h  b@N h&hlF pFtF0 0 @1@@0 @0*T@T -T00D S0@0JSi0S,S  ;S  RYh .Bl SP ,S;SW0 0PP 0,SM@PG 0SDh lpbu( `,)l6叒Lw60p&(,h"@t600 |1Od0 @{,DP.OܠP$ ' 00 @<4 . /O8 Z Pp ^  R? N   cR$ 5:4 cR0 0#031d 80?0cX <@DP$ )<(,2L"@ ,!@0 ' @8 ! @< D ΝP @ DHP@ p@ P4 L` G F E dC PP 0" 0bS005:80bS4 0#031< d0? 0 cR` c sP R 10L`1c00@^DHP000Lp0X0=1@40)<2L80P8 5@<0(<2@@0<1@T0 7 0@\010@`00PP0@ P$@DHGp @R * Z / c ^,  \ _ $/ጱ c$e  [$.࠳^B Q ! !c 0 p?0 c@RP@0Y<( , 0 40#9#@ cRT05:\ cRX 0#031` d0X plP 0X  X. 0SDHLPP0%d0g.f>0 0N 0h 0o@ 0@h @F<@DP$ 0DHLPP0I1Y1ð1O-M<00 S0 $ D / `P@L(H Ha<0/aQ(#x "xH q~~N`AN0S/"w ?'P P00 #1?B! 0/@Z0S< @# J"p J㩀A0S'"̃ ?,P P0 0 1>!0 , Z0S , * *B%/ b Rl\ Q S k'.+N Q( %@ \/%O (,"@ .+N0 ' @4 *)|\H rL$   mR @@@P%"PP"gף  pC @)n$A[ O@:0@` & Ό"" \4. $ 3 #!d_  0Q S@o!S \ )|rLR(\/H .+N Q( %@ \/%O (,"@$ .+N4 ' @8 H) 0   PHPmA H b"`%@g׳ pC@  P* nA%Q R$ _P:4 @`  & Ό"" \8. 0 3 #!d@Ϡ0So! @ S <@ 0 !Rc0@D Sg !*Q &@RQ ^ !.. ERP b) L PQ\H/b"`  ,Ϡ n kN,όB! Pp Ppᇒढ़ p  Qs  ` p}C&R ^, ΌU W P@v `3`#p\ 0 @D S  P \(/O 000c^:S8(;Q00@`<@P`Pq%WU XV V0Q%`? 00?0S PPTpV P0TP`T 0 4/P t0Yp Ql Qh, Q|d@ Qx`( QtD0@S QD! @Q!SH R0S `Vi 0SfJ1$F|epHh@AKqX 0 S0PSJ#=p 0 A0 S6 00 0-S 0P\T ?? 00cS !0 <( D O- @-FMMPPF  0 1 0:S0P/S S  S .S0.S S 0S0/S jP`? d̟H p0\ P0~00@@PU = 0H0& 0+P*`00@ [*[:[4[$ [4*[4 FRo$*[ #[1 "*[$![$ ! *[[ *[$[*[ *[$[*[[ *[$[T*[QZ U2PW}ZU [*[$ [ ^K SI QF"@%"  ."  ,Q9\H 0NC0:0@  0`S/@0Z00S@T )F9 0 0 30aFۍߍ0/S 40BQ 0R/S  0P ?LYPPC00\ `2VO US URH ZD @Z  <* )-K R IL  }p 3 @(@$P,00p4V< pQ0  P4"<Q$1T* pDQqPW@RPPPZ!0(,0$P NP\v Q@0Q Q0$0Q4 Q$!?8:[ S\0J08*S RW RW p8zC PJ 0L@ 0x<S00P@CE+E. 0共a S`Nhp@@W yPW @0PS a煱0`@f`nyP|  \yP0/SH0/SEP!0/Sh <F̉ h RQRQ  R R@R@RDR Q R hNB PhN$0 @}$0  Q(z@ `Php $0(P0 ^0  4"<Q$ 1 UZ  Q\ @p ZP0^ ^0$0^4 ^$!? L\ U /Bl pdh0 S0PS@0SV 0 00S.0h! /O0 BS s P Pp p@w " 0 00P/D p,0, 000S  G/ p P/ <관 @-\F<l0hN 0Q S \P | 0 \ F<h0 0Q\p/@-{ 0 P/@-@@ @@ O-M`@VW 302080SM@TzQp0 pPZ  @PU" Q 2`0l0V;B 4 m``@ vp=D0C0C P S\@0d@D/  @D^Pt!!10E?o 2@U0c0c80Ѝ1弁0000@00r10P kfPpP80S vP @T Y @QP PywPz ЍYv 0 WP0 /S0/S S:S  8f Pp000;4B @1z00gh` `iTW9hY z !   l~ }  l A- @p`00S* PPV0080S 0 dU@ o 0@ z@PPp p$| H| { /|0| 00Q p@-dPP P@P  0Tpp@z@p 0l p,{ |0| 00P p@-dPP P@P  0Tpp@z@p 0 pz p@-PCP  @`PPprzP`p@-@lzPhzPp0 0 0A-P00S@@@ ADt`tt`0S@PPp@ P  pt t,kP0 0np@-@P<P80 0D 0 p@"t j@0 @- *c4M$@Dc`0*M$ 0 `n` 0\  0Sp` 4Ѝ4t ! L3/L2S @00P2S T? #3T #QP0P0@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2SH@4$`0ܳd A-\!`X1M @P00100P0Q0S0 V6 T<p `0xq80|q8O8T@D1@V  @@TAPϠPOP"0@ 0 0 1 30ލ`0P0 (sVDQL0 (suT 0 < h 0- 0 M Ѝ̹  -<0< -0M$0 0 0ЍЍ/ᄹ 0--M0 sЍЍ/0 0p@-P@Xi`00C`0Sp S u P X0` X PXipXJ`u \0 X0`00C`0SppSr P X0X /X+l -404-0 M  X ЍЍ/ -4 4- M00 XЍ Ѝ/᰷ G-@SpP] 0S:X( (S Y" WH $i0` V V,* .tp0J000PM`uT000@00 `pp`/P,0`VpC0 00 h t0 0SJ 0 00hQ40 rp0=0 rIgoPD@0 r0 0Ch IUo   --M  .Ѝ Ѝ/ -- M0 0= ЍЍ/@-PPa$M@`< .pP* p@P' !0P/S0p@0 0 0 0 00   $Ѝt0000@$Ѝ 0i$Ѝ(0>0 ir 0P @-@P Ih 0SCNh0;0 Or  R{Z@-}p@-@QPI 00!R ! 00! \ uP 0A` / Q R'  R0  B  P R 0 U00Sp$fP eP `eP0PW40 q00A(0<0 qs 00  RC-` $P(@ R0 ,°00` 0  a0R00SL PAD\`6 pgfF0V `1!p  w0S<0V `1!pr  w0S  p w0SB0V `1!pT w0S,0V `1!pEOMw0S0V `1!p4 >   w0S pT 0V `1!p@@@"   00B S0 ## 0B \00C$R w0S p% V0`1 !p0 *R# 0B@ Q 00B S i  w0S  up q  w0S dp  ;  w0SV0V `1!pw0S Gp 0V `1!pwX0S0V `1!pw0S0V `1!p~wM0S0V `1!pqw0S  pw/0S0V `1!pXw0S0V `1!pK pu pn pgs R  0 0pZ  V@ `1, pJ pC  w0S p6 0V `1!p  w0S0V `1!p I w0S p J w0S0V `1!p rpD kppT . _p$ Xp QpI Jp)_ w0S0V `1!p] w0S0V `1!p , wt0S p 0V `1!poE w0S  p$R_0@' p7 w10S py 0V `1!p@w0Sj0V `1!p3w0S pXw[0S pL@ w>0S p? 0V `1!p  w 0S p* 0V `1!p pP U pC p xpD qpP 4 0B Q^@   0B \0@$R8 w" R 0O0p V@P P P P P P P P p0 S p  0V@`1!rP $R@00P P P }Pz xPu sPp nPk iPf dPa _P\ ZPW UPR PPM KPH FPC AP> {<P9 v7P4 q2P/ l- " P( e&P# `!w0S p 0V `1!pP H P CP >P 9P 4O-M M@PL %T05 X0070 L0S 0X00!R !00(0l00 S 0SP   RV 0L $0<00800tCM?@h00(0004P0p d $ PU" p%U PU `GV$0J 0Q```v00$U `0P 051,0 4 0FZS00 P}`P   R00s L0S Pf?Rp1RpO p.LQR_T m;H1 0@EL X\,lD̍ @@PH`P$``P`$`0@ 0@00500F@ p`4$00F S$V7 ,@[3 V zV` 8@D^0DCP(00{0$0<0S <E0唠0@0S$00$00ZZ 7!1 0 7 30J$܍ ЍVX ^0D \k?VW af`P P`\@H5$0\, Q00D0S0@0AZLP\ \M0004fPEU 00p`Q ,pAWSD0$0~P00(0U00Sx 80C^sȝ  hhPTp8 7 p7 6 aV <X0P H 51 00 S0 00 @S1 T0 00 T00 pP 0BP00?W0Ty r 5!S <0S w0P<0 00S-000s@0 `dV P0V`0   \0@0H0S P0 0H0@ 810R0bB+ S- C S9!/ BL CcS`1d00`FBQ000@*N B0/i   BP \005\ Qh0004T_,AZ[Z+ ڸxP8@PJZ R  ^ DhZ DBPJZ(xP 0\p 00rPEUUnڰ8@PEU R ^ D(Z DBPPEU( 0\d0P0  HQQr<P`@PFUPU ڤ00QpP@UIY5d@Zp  l0f_Q0P `FV`V ڤ00Qp`\ pVpGWW0^`P8@(PpGW@ 0R`0 S DY0DCP08@DY0DCPw QP@f_lP PP0 0pL0 S 8@D ]Y0D CP(0 P@`LVp^00N)S0 8@D =Y0D CP0< (0,pAWW lP8@`(pGW 0R`P0 S DY0DCPpGW0Pl+0 p0 S D0$0Z0G 8P @JZ R ^ EX EBPDJZ(G 0\| 00Q5QvS(50 d0W| P0`0V S(0 P(P0p0C0<0Q0  0l0Q?PU P <`P0p0SpN?00(/S0 8@D CX0D CP(0 P0\H00 @# R Rf_d  dp0! , 00g 0d`0`F- 0bS0d`pNd`00`F`Fp00BS0 8H W0H CPk0S 000Q8Hx WHA0PT( 5 x :<00NS] `Vj60(p 0`P0`P\P@PS 8Hx WHA0P0(  x )H0S@0S` 0`SPPV&FP8p@(@`FV 0R@0 S GW0GCP`FV0 ^0`0 %@  R 00P 0P0S5a< 0  ST00 T0Ϡ 0Sq-00 0S@ P7\` 5 P\` 8 P PH@`[pUQ UPEJK00Q R@@@T@T ڤ0p@Q0P T`A`VV20@p P`FV Q@\ EV EBPT`FV(   0PpH^0`0_ S0 IV0ICP0( 0S-0( YLRP8@PPIY- R ^ DV DBP(IV IB0P( u0D \cl380D \c P100pSa0( 1 \0p0:R 00P& ST00  !00T 

T0000 T0;8@D T0DCPP0(0C p0d0S# @  B0S0S S0d`@ \`P

0D \^ BP 0?W0D ~ z@ ST000 T0$00 L00,p 0ST0 , T0}T0 RpT0T0 RϠT0 PFX8@D@ PDA0P2( P @ NT0 RpT0 P(T0 RϠT0 0ST0T0T0PϠT0o<Q;T0PpT0"; 0@00`00F SX@ 4$00A S$Q0-S9 1 0`i0`0\00S `0@__ 0 $ 0 m ST000 T0$00# L00pTS0T010  00 T04 L00tp> 0ST0  T0 0@)@ܻdD$@-` MHP@pxS<0P 000PuS Ѝl` A-@P`p_S0 P`SO--0p@j/ @30P    O (jY: 3D-@"M @Ϡ#90c 0jЍ0@-@PMP  0  Pp`Ѝ0 0;0 3U   p@-0@Q r P p0 S!P00p\ PP    !V @0O-M`pD @0DQ00P-5X# @0S Sl @   b 0P1 P  0 T@@  0  WS`b ЍW Qy @0Q AX00@P00  @ 0`00QA@`VRTQap0 0 `bz V 0 XT@P@0Q>W 000! @TQ 0P@020W  000TV"000@000 @@ 0Sd0T 02avPP @ 0"0! #000 @lb`@Pr 0Q/ R  B /A-`0@bSP'`B0@AS* R@D@D p  pTV W@0@0  `f2& @0@AS:~ * PPO-` -p̟ M0 % iO,0 l0x00Pt0-Q 000Q0 0u 00A S040w @ (0Ht@00A S TT"0 B 0S`Ѝ 0S0 EQn 0l0S $@(,S^ ?o280$0Q0$0吊Tg `` T`ڐ*L; g01S5YTө(0S (0SE( %0dS:l  80(00dA1! 0 ` `` `@P|000XS) PtP0Q Q0 0|x Qt000Sl00l0R  x lЍ 0@$t`0t00+S -S(3 0C ^0Stpt00S 1C\,e0Q> $ R4iSl vISi NS-@t@ m P% t 0000(S0l0e 0x 00Q Q \ $ EQ0 0w0x t`l0(0|`D`V0`S9 T(V 1  @0p Px |0p0|0 `LV |0 p0|0  A< RF Q0 `CV  `x Vp`v0p000400 S|  <00S%00<00 00 $˷00 (0 ,STp?@080Jp,0S$0L0HH@ 0P0b    !DSx0 `PW x0   !8Sp@| D0P0G X$ 0 @,0@0@PPC0D,@Q @D0C@P@T00S0S@DPEH,0SDQ"(0SUX; 0P0  @P 0S0S P Pi L0PX 800 S p#\ Z<00 S0l0 $Px U;0 PEU6Q [ Zl0P0L 0p$ 0#[00S|0D0bI hd PP dQXxy  ! x6 Px 0S < : WD0Zp |00 0C?o20S Kx i`+Z 0S     %&2S`#`HoC 0CS*R*/B B*  * ʐ:* 0R*/B B`H   0 0Tt0t0Skt00S n1CQ 0ES@ 0l t`,)H } `f ` 2V01 @p &2S`!HC 0CS*R*/B B*  * ʐ:* 0R*/B B`H J :  0 C! `P P000t0QE P$000(00t000@,@t00C QuQt0t00C QQ 0 \   $T@TP$P@MT Ӝ"V瞯<9 0Ct00C [P ,t>.00C Q0N,L\,@(Q,a,|nS x Px p00p0s 008 ,  J1 l000! ` `VP $**%Qj&oF*8!`FH 0@@,Pu  PZ 0pP0Im LPxD  B\  0S4 p $0 p 0R0 0} 0P0. u P*  `C 0P0@ 0P0x5 Px <0| 0C<0 B|  x"0 0pjZ   Z80{S相I8 80S0P00P0P0吪00cP0相pa PP B\Q<00 Sp  Bp 0, q '$Tpl0P0l0 0S |0 0<:8H64 |0R! 00S S  SD x& 0x000 0l  "!@Q*)P00  0c230 0x S9 40S"0Sl0000l0, @0l0UQ"00% PBx Pxf |0p0C|0G=70 0x0  0l09Q "000000S0 EQ  R7 !0l0 0P0I]0(0G0080NXKX Rp0t 000x0zPl 0x St` 0`0$@0c(80,}AP|zx<0| 0<0 |  W $TppPIU8 x_ Px |00C|0.Z{80S相I8 80S 0P0  0l0,S$@ A0@(/00c8000 0=80H 0l000P\ k$PU PE _P$Tpx <0p0C|0 yPxQt@PP t00Ct0 Pt00t00000x l0; !\ \  XXQʽtP0C@0 㑸( 0ES00@$01x0000 00P0^, 0H pP0o0HpP0iQ @St 0 $ @U pG:|( S3010 0;: &|  0 `0#5S00 8(! l  刋 H P 0@$$$0Af$Tp7 08P0 0P0  05 `Z$Tpv 0S p x0  ~\ 0    B!0p| l0Z$Tpl[!0l0 00 P<0SPU@P P P00000P0l0S$Tp!00l00S90S5 Am  000x l:**%Qj&oF*D&`FH i$0Tpx 00000|0P0l0[!07 l0 00# Y00Sfx 00 Z[ 0l00" Rx   l Px>  pP1PePWPp00p0!0l0s$Tp<00 lS |0x 0Cp|0~x0! l  R_0S40040Y :|0 x 0Cp|00l0Px]CA@-00LvG-` 0Q`$@PH PpPa0s #8z *8 "80 V# F0V B E 3  ^ pG0s#8)80ᴐ^#Y 0U 1 PP `P    !M.@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X  \50QR i T0#03\0SWe* G0V*0F@S F3 BS   3L0WQ 06S OW*@DPD@ Q0A Q0Q l l> U00XS Q0X j00Q )Q 0Ѝ<^0 n 2>000 )ARoᩒY 0v Q>0?0l 1 c0R:jL O-MpD0 J:@`00S 000S 0P 0S EA R[* @E  \  P 0PS9 Y@@@Ѝ@0 R[Y Q 0APS10Z ^@0D0CSڣ0S}P [ FT p 0 pTD [@J S0T0 @  Tp BB! B;P DR0 SO@T]@DTDZ ` `Q ߰ AP[@100+S -SU  PV PT0 0@B\ @~s#,000 0L@BT @R0lYE^bP 0S 0 S S@0S 000 b@0 0L"00Fe0 PV 0SP00S PE 9000PY@ ^@ %@B+`P D` 212 Qa`]000 0S@0T@DUQVD`` 2  PE1: A @0T0- T@ T@00'@0PS YPEP RH 0 R Q 00PS00; 0@0@EMP 0 C0 Rb@Rp@DU 0S S SUU~ EPyKP@"00Ѝ^0E0 00`Sp Sj S6 `Pb@0@00 00V@ !|J`T0 Pe 0S500@ 0faF PeP\ 0  SSHK@"00ЍP20PS0 @_@0 Ѝ@0S@V 0S S S@@0S000L#@0S@0S a@00c@0@0S `-T0J  RP!@J0@0A0 R@S 0 R S@߰ P[ B@10Q@0S80@0H R( Y0`'^ E  000@05@0S 0  BR "@q5P `@0S Y ^ 0`q0PS @ "P1 5@ 8  P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPV 0 BP @` pTp  0 BP0U`@-`-p M @KU0  B00C2S*Z* QKEB A Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ H0"S1 1  !2R / 3RS/00 0 c Rda ` 0 ` R<A 80 ` R/c,Tc$cA-R\0000 A1 !0T pa2!"`'  T2!L0R L,! T TL L\LR 0@-@MS: P @  0Q P@ЍA-P$aM 1`p0S3 U10AT !0S 000, Q@T  0S 0CЍ 0 @0D1S@0000S 000 pD p@-@P00p R pPQ`00App@@D `ܻ80 0QApp@л pD0  +0#10/sQ#8sQ#4  00/sQ #2#01  //1A-`P@100("@Up0p 0S1pP@P$pP    !Gl`hP081#3S412ss /"r3J / R//@-@P0@0O-0 MZ  @SpP; PaU* F B  3G ^!*0I X0C0 0ZP`V 0600Y0ZP`T@T 06S @ ЍG-0PpR%Q@X A@iV&10SP`P\ 1q0i000S l1⹺ @P4 P1 p@T `P@T10SgP@$ 000S 0⏺0⊺@T 0C  pP@d0wiV0S 80l (0R0i H pp,DZG-P`塢0`@Tڃ0TP$ Zp  p aF0  i )  S2!:R0L0C`\0030 `0pG \ `&-0P1 0^$23\ *G-`@P0@DT1  0\E*32Q G*@@P`Pp @!Pq@0 0S 0S W 0G`WL3 PP`R@H0 0S03# R B B  02NS dP 0!0P` A-`@ApDP; P 0`0V @ *\ l0D1V 56 501 P56 +CV `C5<5#11C<C- MkWP@P WW0Y`6V0 Y 0 CII50c0 Ѝ {0P c2# RY C>C0C01` Ѝ0S0/0 R /@-p`aM@P`D ?P7PP5 ᘲpP/0 S Q6 p! 0: S/PBP 0uPP@0 000  0 0 m ЍEF00Ѝ\PH0E0 6D4F000FO00P 0T㋳p@-@P  :00C0S0 P :pP0=0 DpT@-@P 00C0S0 @0I04 CTp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SE 0 p`0>0 CS$Sp@-@P: 0S> 9P00 P! !) 0S 3/PP೼000P @ P 00 0000 !!c9 0?OB 0p7P(080 WCUEP 00DR@-@P 00!R !#P 0C 0;0 8CR@-@P 0 0 S @60;0 $CQp@-@PQPU 100SD 0  XV ;000S% 0'$0 3/0:s00P7p00P @ P 700< R 8000S70 0PI@t6P00s0`0J08 B 0@0 00 pD 000@00 pXP-Ѝ/A Q@-@S S S 6@@0 @ 6@@0 @'dD 0  6@@0 @0 0 0; B0/0P@- 0At @gD41S C-P !EM `E2/A/ @`DPP4!dhĀlH`d`h0&lL`nVfT!dRAbPa` lF`!@VfT!dRAbPa`AF`` Ab` *cF0` J&Jc `` + ;k{k{톶pc APMOmpX@Q 0pjPS`Q 0piPHQ 0piP> Q 0piP4Q 0piP*Q 0piP Q 0piP@Q 0piP YEߍCOppC,Eߍ/aNQ@-P @41S  P +P0CA-4!@ `PP/1S 0L1P@PPPU!RMPP !PRp V MC`_oRHC`EC``p@-@P PpPA-@`P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V BPDBPSSO-P M1 S|$aV IG SSp A`TT X`F (0Pʀ 0S `(q\ 0P@ A Ѝ C$oB/갰[$ (xp 0\ Q x@^`PP ^@ pF p(VJ ( A$!T0$1$( [ 0 `( A^% \ :0  P@P?B, 0 S$1J(!r5 V(* T$H0 '@( [$5((~ 0Q0 0 $@$!@` A(a$T 0 $?(P` 0 `qoP]$X 8FEEO-,M  R0 1 p3/,0 (Q0 Px @P``^$`P 0BZB @P UpWW 0 `PP @R㲀) PUJ[Jp p,Ѝ 0 mPPu3  $`n$`P  0 `P& @R㲀/P  P^ ^2 ^"  1fP 0 5iP 0`00,Ѝ0  $i0 P0ᰰ[P U pLp  fP(A DR 1V(Q`0  @@mP 0@-@ 0! \ @"A,@00,1S@-@0 @ @00,1R@-@1  0@@,@ ,!O-P0`SiM: `wpF@P [a   p @0S 0  %p0 Ÿ4 o+p; npD*I ` S?PB 5 7  G9 ; = ? P P MU  P0Z4Q S!3Y@ Y Y@4p:P3*0 De+W $pfP J@p K[WW'̠ K[@`ZZ*| `dhl`R\@YxY)lRQJ `VxV& PBBYhY)|^岠RZBB~ 0ASa@ P  IRl  a6/@pP OP<W ?Piߍ 0( 01P 0  pD!N`B6ḡ !Uv Q[0 P P$4Q$囿Ph @ℕ% Eu` 0 (0$`,K [UJH 0!iߍ>>Q>Z3  CkD{44B; 0j7 `D aR=P 5 7 9  B; = ? >pp~OpW pڃ>>@Pl|>Pi w>t>P_{0Ql>`h>`Y  O-@(P0P!0`5R5s`(P4QؑοP, Ag ( ,0XD D S 1"1 O'gꁡ P ر X$ J< jؑ@-@ 13/, (Q0@-@Q -00 2= 0 O-SMf` $ ZpW `0p! Q0A R  ' Y'PL 10CSp'*w0 p0C 0P$0 0Rᴀ  '`崀X 00p10CS`5*v0W 0b0 $50 R `崀 `'V '`崀 0R 'P 00,0b0 $5 x'O-pP,M`Q i'00 VV 06J  (0x7`F0V` 0FSU700@,Ѝ(0VO ,0`1vY+ 0-` 10`1 I0ⴐC 1*' &@P a`FV`:b $ 0 5a 0`F `Vv6:v` 0b ` 5밑1I0Yِ`1: 0 b41,0@1s0S 0 @0& O&@P 10CS0:\5b0 $4 @ ⴒ@P 0 00(0 @ 0⸑0`(0r?H= 2  @^  &Z 0 p@N 0S>  00& &@P= VS V1 VO (0{aV@ y&T@  %@P$ 10CS`*0Fs @崒0S 0S 0 U@T  @崒(0KaVO, @b 1G& %@P 0VSa V0F 6&@(0+1ḑ0CS㣠y7*z0YV9 ` &V %@P  &  & @I y洒=긑0 @(0崒6`FvVv @: 0 b3 @1b0 $3, @崒{0Y1a V0F 1% M%@P 1ᴐV0CS㣰y:P1b0 $31崐ቐ  1! 0@% *%@Pd ` ` A0Cs 0 ; 0Fs6 10  崐C @1% %@P@ 10CS`:D0b0 $3,0b0 $3 hP<,p@-@`PP 0 00(0`0Q0(0pO-p@`&P6LM 0Q0D00 N%00 2[V  K500%5 0 D0 30\LЍw0 R*R* p 0 0S0800$00 P<080 0Vk 1S6  $P䑄/  {00! 0Ⱐ0 B0Rἠ:1S 0ZS000 0P 0 ἐ00000S !$  P 0崐V` S0!1  BR,*0 z P 20 2r(k iw0 Qx $`P_ 0 p $R0CS㣰*{0Y* C 0@1! 0C s0! 11 00(0  0RK 1S RQ  RYF  V$ 20 2AQ00i*10CZh PbJV0`尐0 2 i Sf 0$ p 0 0S0000,00(p4000(01 S0"1!{/010CSP*u00C S {?尐!0b0 $1c0`y0弐ᰐ300D0b0 $1,0b0 $1ķ \ DO-(0Mp I @aP0`f0yPP P FPJ1ZpuP01a@0  Q1R@@10CS㣰N* 0Ks0S0Cs00  VrS10C1(0  0R/ Ѝ @Q! R b0(0 `p) 0     9PQ pp 0 0 fp1 S0C1ȁ3b0 $O1T> Y3 0I 1pP(00(0U QPEUP*0EY* 0p1kPs YQEQPEUP|*uP0EY Vp崑 (00(0D10CS0I*S @```0 `p崑P Q i"PP  @PA-PV(00 (0"0!0!0 N"PPo PJZ㪠7* Jⴡ P(00  "0b0 $0 0p1P(00(00b0 $0u00C StQPEUP:P0b0 $0{80b0 $0 "s  P   p@-@PQQp !P 0 0q"Q !P 0 0d"ppO-,Pa V0Fg 1!@P! `Vp0ഀ0 0 Vpp 10CS0*s0S0SQ PP 1b0 $.00p 0 HxU1FV㴠0pp1  0 S001Rpp10CS㣰5*0Ks0S  Cr 0 Sq060W10C1 ! R bP 1 ! 1 P ! !0b0 $/PO-pP$M@Q !00 2tT T 100$Ѝ(  @d P00 $00  `PM  R Kt@ Y*P0 PcA 2@D @bT㴐:b 0 {/Aᴐ@DT@* 0t@S @D0COo0B 0 p= 0S0C@0  P 10CS0N*s0SQP@ pP 10CS0*s0SC 1 Y10CS0@*s0S!P !o !jTq*t@TtP` 20 2$Ѝ4b0 $ /T  4b0 $. T`  00 P3  RB @4 @`0 0R8 `V  q, W@ t@ @DXE  q Wm 0G 1* P AᴀW@DT@: 0b $.d3b0 $.    pP\+Pz 2b0 $.02b0 $.F@W1 @0t@@C 1p 1 0@10@pC1d  @P Iy0  T P u@T 6C T0F000` 5  I P ,` 0R pW ! 뼁V@B 뼁0V# @0H 1P_ X R  B1T@Dr 0ⴠC 1 #!@D0Its0ⴠ1 加  10 ^P6 10CS㣐:\0b0 $-   HP(0@-@PM 0  0 P Ѝ050 -O-p"P2JM @P M`0040h VW00?$G?7O0S 0SNIPIT/ P /00H"@2 0 4 30Jލ Ѝ >X@00 0UXS 0 I0;s0, T:)[' PK0/S  0œ00P0: S K/000S0I SA/?00 1X0 8-QP@PV$ 4- @p"(/0SY 0C \0 RK Y AP/00W |p y{P .@on' d R Q0P:Q0Q:-@-@-@@x $ @ L p@-@P#V)P$  p@3YL d @- M@0 @ P 0S  Ѝ9K O-@lMeppF P 0` (t$ F 0<@ DnH C2 bG   p (,048`$ PpT@ p@LPP , .PnlȠ P% `p'eX "gx0#@$b* c: dJ ,n P%l̠ e\p'` ```g|@$ L " ,0# ,lȠ.% P< P PPa`PPP p'PP Pgx`@$P0#.Pc:dJ " p'nZb*! ,g| `0a< l̠` 0```0P% "0#,@$ <PL vLP@P, X pPp0 p0004 d 8<`T@@``$` (`\D` +;H`P p0 $(, `048< DlЍ expand 32-byte k@- Rp 0\M PP@0`0T00 E"P  00   ,@ < P H0 0 T0 30 \Ѝ(7 0, <f+반  @h1O-`0X!`0M@ p 8`P  u 000 0 yp. R+e X _ d h   0 0 < 40 0 0 30Ѝ4~\ @-`lQMhPDqf0S6 \@P P/UЍ Ѝf0S! p #_'p0 00 p@  ;p  Tp@@ePU  @O P P@  F  D C 0AP0O-PE@dMZ@"0!42 `D ?&cp0$V0\00 IW Te:Z0F0#Z(VG @`p @ p@p@P V@P0[ Z]!|1 0 \0 30VdЍ\0 <R*@  M+V; @ @A S 0 p :+@ [ @0ph0 <$* T:Z0F0Z l0 <*Z0F0ZV[p0@2뀔 ̓ 8C-P-2PK[M0@@ `P000  F D  Dx"+;  Q a!$a"jbHd(b@Z Z%:S :"  0 \ P 5[pjk Nhiߪ p    %PF *D 3Z0 0 F P  P @@☞ P0f000d 0 0 0 30Ѝ0 0e @?>=  lXL> \> ؏ `> 00@- 4MP00,00+ @T d 0T T H0 0 ,0 304Ѝ0$ ꩝< = (! Q$1 A-HM0@P0D00 p `SV( 0V p `BV 0V  : h X0 0 D0 30 HЍ$ $ Y\ < < 0 C-P04M`0,00%`@ pW:T p 0T %T H0 0 ,0 304Ѝ$ H h; 0 0@-,M0 P0$00o @ T ` 0T P D0 0 $0 30,Ѝ0$ , : Ћ 0 @-pQ0,MP0$00 `> @T 0T p d0 0 $0 30,ЍHV?Z/<"($ 굜Ht 9 0A-@p0P A`q080P0P0 00S   L| P#00 0 00 0S$1   @p P@  0  8P 0 0 06YO-ء@pJZn*z0  P( aPz`F`0 VF*vP P Cx  P岁ᶁPa`F` V>*vPP0 0 000 0O}Vv`4*V 0  rPP:Vv` *V  00sPP:1bL0d p^'|bL0d pV'1\bL0d pM'@bL0d pE'$00 $>'O-14MP0C0SX0ᰐ*1 0CS  0 0*0S $4  0@p`  (P,$0Y P P0ES 00 01  PPPYg00CV 0 @P`pUv`b*P0u@S0SZ 000pVwp:@(P,@T*t@1@A(0  0R 1 S0"s0&1!V0C 01ő 0YX0 pX p0Ӂ0C00V*R p@PpP V@ Bt@Q 0Y100!00Sa*00CV] YPU:$0 $ 0{&01  P0P P Pt01  P PP j\P    r` @v`@pVt@@pTA*t0 Y!0s00s014Ѝ   r    rpG(P,wp@@TQ:0 $&I0|0 $&`bL0d p&D0 $%`@p,sWC-Mp`@P& PP! 0!0 0r 0000 00!! 0 04000000@PЍЍO-$M@HpPPP 0؁00岁S000 00 001 1ᰀ0CS`I*v0X< ؁`PH  0岁0Q !  F P 0 0sL0 009!q&V@P$Ѝ᫩$Ѝ000100@P,bL0d pM% AO-\M`>0pᄀ@ P30$ SD0 (0 r@T X'*#1 0Cs011 " r S 0 G 0B 0@SD@ a,00Sp  (8 008,000F 1ePR `V 0` 00Cv`cS00 p㰑1 0CS*0pS 00"@ `V@ 00 0 00CS00 !1  S0 pp  "VQ  IY㩐*y H≐ Pⲑ T PLH3/ 00W p0 01 , p pp 0#S10C s011   00000 0@00DpS, 0S 2 0  P La0S @ P 3@,0p0q 0 S@Dp  . * &\Ѝ3@S00 01040封HX㨀*00x4 1pC0wp0qqpఁHX㨀*0x03@S00 01040封HX؀*X 0 0 sP:400岁 H0x 岁ᴁqpGWp*W 0 0 sP:0 0_ @ IY㩐a*y0V* C`` F 1`0100pN   @  g`V@Dp00 0 000  0 P} 0 0 0n 각HX㨀b*x戀1040G각HX㨀O*x戀1040abL0d pW# 2 0+ @Y@ \0 0,bL0d p<#0bL0d p4#=bL0d p,#RbL0d p$# p~bL0d p# 0 1kbL0d p #hbL0d p#Lq0 $"DpPsTL\hH(O-Mصp@ ,0 弁 NPPG aP`FV`;*V3 P P@`F` `tPV @ t@@ PP 0)00 10@@P [ @Kt@ 0r0@0b $"PЍ 00Ѝ 2 P [0Q[P0A@DT@*t@U0Q 00PЍ P @  ᴡ `P~ O뼡0 X0 mt0 0C[q`=뼡 X 0J 10P0 0崰ZA@DT@:2b0 $+" 2P  P P A@DT@d*@DA@  N PP" a0 X0 "@VT{ a0XJ P0F 1`0P0W g1b0 $!g`  d0Z!0 s00B!@`Fv0A 1 010@C1 '0PA1b0 $!` 1PE@Du t@@! @ 10 `P 10CS@:h0b0 $!01U @D0`t@PE @C1$,R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/L P 0@-P`8@(P  0 0 E DH@ DX@ D+0/lO-p 4M(@,2P$0 ``0p  pP`@%0f#"3?0,"0  S00#0 %0  d! "d! 0 X!p p\  P`@ 0 `.@X!.b!!     !  " !)! $   c! c!,    $(`,!A+ ;K[k{(b a`+; A4Ѝ 0G-~q@P` @g(XS @v! 0刁@`F0 0$0(`0$0Np& ?V:@F(?@@ 0@ 0T  3 0< 0$00T$0?`@pV? @?V@F?@ 0$ @@< 00T$0?@@@?`V( $! 0$ a0 00$0A-@PP% p$a;V"P90) ` B  CI0 CX0C( 0`0$0d0W E03?R0h A  08R(@R )@ b (`P80 F CH0 CX0C)8 b (`R @-A/ @-P 0@-Pd8@(P  0 0 E DH@ DX@ D+0/R @-/z @-vp@-PP X0@0m@`\  0P 0 P p 5O-M(@`0 @H,@}0< @0@$(@4@$PP<4 ,@8@ ``@ P @08   0 ``(0,44$p@Y0&'(Ǡ)Ɍ0&97 "0(97,;40#  0, ( ,!)0 *   ! Ϡ 0 *0P) 0 . %̠ PÌ 40 !$$P #  ,0 0P0,P0( \P38 @0`~? `008 0<  PP @@  0  4 0p000 !1 !p壠#$ቯ ,)* /3(<ᩃ( *1笩ဦေ 0嬾ᇑ1>*1 96,à+͌ +%7% 9 ,0# $$ɠnj (ˠČ 0#ˠČ (  , 0  ,4  00!(p0 0,p/.!.!~rp'/!!(,#̠p' )Ì   ( " p , p ,8p 8$pp0 $ PR(,]< xp|`tdphPP l@\T @0LX+; k{(rK [p xb|+; B ЍTp@-@@DQU  0pRPQp bPPQo P0P0L0@H 0D0 0p@OR Q bsPPDp k@0G-q@P` gPX? @0D 0 @0D # H00H0L00L0`FPP`6VFppp @0D P;@0  S0D *H0L 0H00L0UPP`VP g@0D a0 @0D #H0L 0H00L0VFPp  PI@0D ;@0  S0D *H0L 0H00L0U`‐V PR @-t/A-@P` PF-8p@CU p@-PP X0@0k@`\  0P P pԿR @-;/vA-@P` PF(p@ U 03?0/0@-<PM00 P;@6@0;P6 zP DP6E@05P) 7P (7P 7P@ 000> P0H Сp H ߍ000 ߍ03P 3P  @ˠ  @0H 夡p H\ ߍ0     t@ 0      4\ 0H  j30pH         0 @ 0H@ 000Pl  s  p  {  x@ 0L>@ 0<@ 0.~  O}  L|  I{  Fz  Cy  @x  Kw  HH0P" (p  1H'P @ 0,@ 0|@ 0dO  N  M  L    EDCB <,+*)(&%RGF  <T__T4X0e  d  c   _  dΠ@W 0H Ϡ Ep{ hzI 0H  5pk D? ci@`^\Z̠X=@00S,POL  Tt@ 0(X@ 0     (ܻ.G-8M_(P` p $5@W@V@U@T4 0S  P4 0S3 Q!-VL W0`b U pp P\K 0 020  @ ܏8Ѝ0SZ Qp 0 00 od" P0w ! r R  #m:VW$ Upm P`10   0 0UU0  P R & U Pt\ P0 0VwW0 U p8 $1 P0`   } z00 R y0 P0SQ q0Sy Yb @aU^  PTh0P0 TP0P0  M \YD   HXX    ,  d H p@-20@T 03/@TPP 00@T 03/@T\pҝH00@T 03/@T$p ` d  @-M@@P Ѝ 0   풞p P(0A0 D  UضH-M% 0ЍO-@R MpУ ഁP  `A80 S 0SJ: L 0 Z 0!80S7  Q@0 8 0 0 Ѝ 2 Z   00  0 0 0P 00   |P00 2   ኜP   ꃜP  000 0@-RP M@PQ    s/r?  DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U 1!^ 0F BS @\ `fpUpG-`P @P0pS:ؑI Y `1`! p| @ PU  @PpP pPO-Mq  PpG 0 PU @P U `1`!  <[  0PU0  ЍЍA-0P @^ P 0 a`F T P @DpT  VP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp40``S#U!*`P840#U:њ080pO-@R"|M2P 00t00] 00S80S `\"T2 0 t0 30|Ѝ4P`0  P8} 0 1\  $`0 8 0 0ማ pW`; P'8Z> * *J1 '0` !  4^ 80P  P@R8P84`0PXP: A@8^080 0J* "@R: 0 S pP8JP8pᾘP 8 ` 03`P p800P8,P8n00`i@D C @ O-M@$ ) 0@ 9,0020D2S(0z pWt 0H"4SkSiT90Wl 000@0h00U0P . Sd e   Sh` F dPP! EX  00h00 0@0S000 R!@Q  :SQ 0S dc/ O c/K!U 0 0 X@ 0 S 0S$ R0L00H2S708 R000Q 4p`4∐\ 00400p40 0 ` hp< 0PW5:z zJ` 560'st6_U0PP48 W00S  0 \! YPPU P`?WY 00S 8  Q(( Q APS !SR1@T x00$0S  00@8Q 4Y ` [ TpJ 0S7 0 4 P 0到SnT1 c/00@ SE !SR@T :00$0S ,0S !4$0(0S (0@Tp 7 0到S dc/ a R  P!SRPU 00$0S  ]?00!SR@T 00$ R 00J"00#3 0 2 30ߍdc/ " 4 p 8Qf!SR@T 00$0S  00@Ndc/@0p@ &uX *` h(g"0`0S(X U`3(0*PUY``2{ 08` 6Hrp8p00 S (W(` `0ࠓࠃ\^\S44000080QS80  PQ`0@ gP!SR@TJ hN00E@ @h 7`[(0PP ` 8@P@ @ b W @ !SR @T 00$0S  #@ ꓽ xA t  X; ` L A-M`@P`@p`@00 0,00(000mPهЍ -0  “ ƒ%p@-P@Q 0P !  2!0 2pp@mp@-@P` VP#p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/R00 B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@t0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@9 73 2 2 /O-p?o,M2PP00# R00SGW=  0$00 R00    0SU 0SS0哨(g 0 00(S@C0 $P#  7/ P7/Pa 0S 0 00`PcPU0= E B R Q@F 呢"`B`FV `!VY*0SG* SG:P 0C0 0000S0  RR㢀@($ 0 P   P7/ 0P 0?  ` @U) 7/PX X0  0R0X 00  0 @# 0P0 0 XP  S0PqX 0 00Pe" Q0P0 S*S: "X  QX E ^@F 呢"`B`FV `!VD  B.7/P  7/P} 0 S 0SR0#! 0 R 0S0S㣀0哨( 0 0S@㔣$ X B`S 0  1 ` 007/ P 7/P0H 0`7/ Px7/Pڅ0 `DP7/ P^7/P 7/P^P$0@ " Q0 @  7/P @0@0St,Ѝ P 0  BP 0 C06-! ^@F 呢"`B`FV `!V  B&a`V|7/PJ 7/PPB7/P 7/P~7/Pl  7/P d 7/Pk  7/PT 0 0 0哢$ T P`c⃰@ @Z* @  Tz@ 7/PrU U   0 Y00 #0Q0 4mL0 (0l0 (긐- M00 ЍXR Q0P:Q0Q:"@-齹 4A-SMP@  $3/d0p  QP0 04P4S  $3/000ЍY00A-pd 4V:@T@T 0P0 S  00 S  0Ⳓ@P0`0dp@A @-MP` p~P)0: S"(㎒@P ˄TPKQ+;@bAl(b`ph`C@\ 0 tf dTЍ00@Ѝ $$4/p@-P$0r0" @`}Pp$U04  0B0 0 1R  0 p %  00$@%  0 @-SAN 00S 0ڒ4O-S M{@ApP`ᇁ0S*0S'  TP Z !P0 00 Q   0     ЍP? 0 QP2 00市$R P0(@p 00q000S0 0p  4 S  $3/ Ѝ 00 Ѝ 00 O000Q 000A/0@-S@  R   0 ;0S6p@-P@T @T 0 Tpp@T{P`p  0S S/P/O$(0c03?c00 R  0 0 3??oP//@-@ MRpP:Q !SV@ЍA0 0`y P F @vЍ{T000@00O-PPp W 0SL K 0SH a@-[0T B,B R`  0S7*V5* M000P<0@D0C0S T0@@T  T,0 1 !3/P0@D0C0S(PQQ  ;  DR !,0 3/`Pʼ@00 "R( T `10`!P0VQlRO,0 3/`PX R 0@D0C0S T@ 0T   P @V `! 0 0C0   B R @ZT `@ 0`V:b0P 00``F0``G  0X0C00 00dP   0 0C0  ` 000NP nX0G0 n W<H<0 e c00]_ 00Y@ p@-PP& 0 `V @`0@D0T0@T` ,0 3/Pʼ0@00pD0Spp@/0Z0 * xp@-PP00 @t@ p@ 00, P# ?@p pR0 q R/ S/p@-@PQP7 100S- 0 3   0 P @P 0 0$0 s0 00R 0   p0  0c0pz ]$0<0  p ā@-PPqM`@p) V/ T6 p p #{P0 :CRo  S L 0( 0R  ; 0 Ѝ;0d00 o VH<0 f T(L0 ]  4"2 A-@PRhM0P0d00< 0 C 00  P"D2 0 d0 30hЍ 0`0S# p0PO !W P00\0pS pp4PP0001|0`  0Sl$p@l 'ePA D10F L410/R  0 p 00 0   0SP ` 000p p00` ppd0`  xPߴ   < hX~p@-@0MP500Ta7V( H0T1S O0T1S:0`"00U TX!\!R Ѝp@\!'00Ѝp@00U\!X \!X0 000S/ p0 0p@-0PUp@0~00TQ0`U TQUP ~pX1P0X10T0`X1 ph0h 000S/@-@0~0 X10CX1S @~OT10 @~ p0 000S/g p0 0 0S/p@-@0P~U00 \A\Q X! BX!R p@~`00OT!~00p@z~\ p\ \0 -4M0 0,008 00 0 ,0 304Ѝ  p@-@QP  ,Dp@Iy090  zO-M`P8@@ p PP1?0 $]p 00D> 4@00D A Bs QR 3p `> 00XS W pp p00XS W& p0 0> 0 00BA0C QSWpP pYW 0@ p pp0@ ppr0M0 00Ѝ8 @-M0 @| x   tP 8 ,0 0 0 30ЍG8 r 0D S8 0 / 0@-0 \ q0 S 0,/0@-0(q0D S8 0 / 0@-04 0<)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGOܽ 0@-@P  000t / RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO| 0 ///Q R Q/U/Q0 R Q/00/Q@- S@ 0S@ \ 0 000S0Q0@- @P' TS0 C0 ^@DP \T0L^ Q^P 00PPQPS @R S Q0 S00  / 00/U/S 00RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P ST Q@DP  ST PUPQ P00S@Q R U// Q#/ C/ /s R PS  00/ 00/U/ 00/SR Q 0 / 0U0/ 00/0/R - /p@-@R`P R U  V  R 0 p00 (HlQRp@-`P@ 0S0 000 0R 0 0pP0l (kR0  S 0Q 00S00/ 00// Q#/Q- S$ PQ PP0C S00UPPQ- S0S P 0000S0| 0 @-M0@00000oo00o o4 ,0 0 0 30Ѝ` 4 -BMRM d @T   P  Pm1    iii0 @-@-`x@t"Mlr MP p $( rM TE <" `0b0R @$@`P  0u!1 0 $8 30kލ ЍB~p\ @0p ] m0 xaB^P.`d0a/ႅH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A@-0@0MP >S@ BP 0 !#00 8P0ЍL00@-0MP0@ >S  @ B"00!,3,0 P0Ѝ*00@-@m@m0 00/ ,0,0-M 0 000 0mЍ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/8 p@-@p@-0@ ,p!pPb0PpT@////// //1O-0,MPp`W y1P(0   B  @0 05/,Ѝ9@PK 0S HHH S0 S0S1*! 00S S& 'S000S  0S S * RpC 0QW 00(0 0 0000dT0 0X0D00 0P@ dPt`P`/Z/[/O-M-0= 00000P0Q0S/ Y% ZK00L= H-0040< !d0 0<  0 [04  (0D T,000CS0C  Z˄0S* 0S0 Z 0S 000S S0S 0  0R000d000S P     P@`  00CS0C Ÿ 0S }0  0000r00CS0C3  `@P  [00K0 #2 0 0 30Ѝ      +  0000D0@A 0 Z000 00 S*vp0``@ P 0`Ÿ  80@s0   00@. s0~0pA@ 00@s000@|0 000P|0D T(0D T  @    0 /0T0  0Cc ``_Y| pUT,T TA-Px@@ p0`pP@PU J0S 8/`PEX@upW0:0 P tS 0SS S  0R @- o/ 0R0@o/O-p$! 1CM M@`0Q0440qP k 0 0 44 30+Cލ Ѝ0`@ 4 @P ~t0 0@\zL+ o 0o/c0  DR$RG-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S& P# PY@ Q@0 0R!R  "R R R QO-0BMpMwpWH1 P`0 pW' 0 \P@P U|]y]0[P:PD <0 0 4 30BލЍĢ O-D!@1 P AMU M0@040O/ 0Y,:0p`x0(S3 0t@?s0T T. PU 1] .] 0 P @T $ 0  X\PL D0 0 4 30Aލ Ѝ0x0(Slt | O-mMMx /`0? |80060l [ !R & R/ ` 0  8 ?x@ X@0cx 0|  0 P   R: R20uo@P တ pR HP p Ḑ gP R!Rs 3P P@Z 0S~ 00 0[u `@PPP0S@ 0Sʰ00 9 S 0S)  4 < @l [g` 0d<0v?L00H0< 0h S1S H 300S S00\01H 021QU[0P0S|000x0D0<00SyATv H0CPu L0PPPxs 0;dD@0 P N @K0PFP H0 <0H 0<0L00L0 0S d0S P0S@0S '<00x  R  P RY ꔋxp|`@00*0 0 0 @5/P @+,; 0 6 30RmލЍ 00S 0 Q <@PL0Px !EfL0P0 |  8 : X0| %L0q<000SB0\0CH0`Sd0c  v`@pPV00 `G `?10$0(`  '9 D0,>X090Z?T000 04000F00dPP- U;00 0R0J `1  8 \9T0 X0@0Z@0   0@06($0 0 0SJ0@ , ᐀#/E)b,"UdP @0S < @90P { -0T 4 @0@0PH   R!  0 0D 0P^P`1  8 7X0 X0@000 0  1 01 0@0D`00@ cP$ 0 I P\ `1 r 8 60^ X0@0_O00 0 0\04PJ80&4H X0 >1Q0 U 0pK10} O `Wv@PQ@   W 0 0000QP O  vp01 000P v 8 <5@M X00PP@0 cP0|L Q @N0P ztR/00  (0l00@0z,K/0\8d@a`Wʧ" 0+S .0CS P0@t@ @ 0PdP41" Pg `1SC 0    P 0P0@0m  P@ P9`!!! Q5   38 @ X0  X 0P R) ' qW tR@*`Px 0|@7/P   0 @0j eg`V q8 ,2@~ X00`!8 1@XUŁOS0 d01SH 3h0h00S S`` ` `P16 *h0 cPh0 h0bP101Dp@PDw(YpP 0 Dpp00 0.bDp0Pr00 P 㸠D* pMtIL lHGxGEDlDDBDBA,@?p?L<;;X;:<:9D988877747 TP Br DR bP0l0P0@@ l06SGVE `v XXpj0P0x D0 P TP Br DR aP0l0@0P yyp 0P0S_00 0RV 0`1 z 8 10 XP0X0   Wg My 08d@ʀ8 $2 X@X0rZ0   4 PD 2P0Scu=00cy8 d0✀g0p} G0r 0R D0 P T Br DR  R,#ZaPʇHd0 A P @ 00bPhP 1011S1  008 30 X0j)<0l0l00<48 X@" cX@0XZ0   8 4 X0F00`j0+S .0CSP@0P xX 080' (0l00l0@0Px mxx 0 `0l0`h0x ) bd֜8 5@XJx%08 d} P0@t 4xH&H08X dg/ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@laP$Ѝ0 waP0/0$Ѝ000 $Ѝ00@-$MP@IaP$Ѝ0 TaP0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-D#@3CM M4S4p0@`d04401P$D 0 D2$0(0,P0000 (0 +~ 0p n P<QP0$d400H PJ00=  !8 S    ,0< d4 0;0 P 00 00; PPF P00 V l\104430NCލ ЍS# U 0?s0S0Q1 Q+ Q% U  @   `9   0/?r s0Ͽ|\|}UUU!H 65h 33<3\C-PT AM@M`p0 4$ R6 ]}!0@ ` | P-8ĝ0  0 0 4 30"AލЍRQ PP 0@ .R` @@ |@ %}UUܭ |2`24 11O-!1AM 堑M0  0 40P_pPLpA@PF }PPB @ t+0>P7 0S4 `  0S+ 00@ pL2P00@S 0S0S 00@ K@ @f @琬 ጬ@ ,0 0 4 30AލЍIT < 1ت O-p#3CM M`P0@X0,40\@T0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @( 4PPd!  T00 0 00P00S !  @D DR0$0 0s< (T80 uP0 1 00S|z0000   Rl@00S}0000 r 0s0S0S SvSU| O-p0\MP2@0`LT V0 DC  OU @ p0?00S:ƌ= 0 P& 0FS X0 F0 0RP0wpsSS0崠SUPPEPHUT@@T[ \Ѝ!0L 0  dG{0 `F 0S0  sSw}S ~S0svS0S 0 , 0PCUT@@P<0\Ѝ  B RX00 B 0RP MSJSKS CS뺠U ,$0@ Pg\Ѝ訦 D+)C-@0 Mp`(P,@D T@>)S?XpS뵐0 $ S  @ S U@D0 T ?R0s0?0  ЍXxK H$0 P Ѝ$; @(((G-@P p`㴒Ḃ- F0S@`=0WV!9 R@R, @`DV00W0S ?V0*v`DGR0?U0S X HA$0 P(=0 P`|'d'@'0O- M䑐P 0S2 s @䃟p$` S S0  P$ < P, X PB t P,0U 0  SR 0  SRS Ѝ d1P0d1 ,y0P Hy vP  pP060 0P dy ZP  TP090 | y000yu0:0 :P  4P090090x  $P010|  P020s B 0P0Yj @:?P1?# c0 2[E 0P0YR @"?P1?# hc0 (3C P= @K P0103 M P010*''%X%@-@HM[x?\\0 | % 00xZxHЍ#@-MAT  [0000 00\Ѝ@@ꬣ 00@- AtM0T0l00  [P 00#0W j@ 80 0 l0 30tЍ0@@y A-@PlZ1 !01n0SuOPpp \Zp0PSp@-@QU x3s|p ep01P _p01000p;Zc[Vx4ZP //(!P /W/!G-P@`>V$0QV@0\\"  p偣 ppQV@tp O-aM M848$@080T4 P0060rP0U =0H0D`gnp01%,Q d!0q d!n/ 0`115̠B.0oPP 0ʏ 4ß<  ~Wό d1 0d1uYP] `P `a`0H DPS_a \ S S00 PP`0S SR#3:0 0CQS0 0CQS0000(02wxP dmF pp0n!sUm%FaRG 0s/00r$GP$ o t)F, s%r&G4 / X  + 0L9P 2#S;S 00 S( 0 0S 0 0SV 0$ 0S  0, 0S0 o>R00sS2 S S 0 n/ 0 i>R2 S S(0S00 S S SS@@ `0 pQa<_A__P@4 ( H ` |h$04 0S? e2R20 S S<00R00S 0@0 S S00 P eP R Rf `P}_ g? B  B5 `X,0F aPMTP RIP 00TTP 00R@K20@500 `S @ 0d12d1c QWX|ᕦ1|Yp 0όp`0S V`0`HPDSH` .S`0SVPp.`F6VW0 RPeP /90"002 0 6 30%aލ Ѝ 0 l9s4GRb V V0 S0#0 Lk?@00 8k DpHp W Wp WW00;W0SpW 3@0` ;W  00@pW  PP  9P 0X @Qh!P ppW;W P$ 00@pW;W  PXh1QQ0l0p S0DpW 0 c8Rf2 S Sb(0SK00 S S SS@@@ `` _ _AtH P@`0D`S \ S S00 Q`0S R:0 SQ 0 SQ0p00k_ƓP.?P ``!0x3!|3`(|fDP` #DQ }ouQzp"P 0X Qh!h!2/R!RgP0p 8DpHLP@%`F2  zM 00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X $00 $Ѝ    00 ,0(@-  pmx \ p@-@@`V 0 CQpPa/gP P `FP @  pfP 0`0p A4 @-@00 R \\  $0!0D0 0@  ( $ T,@-@PL  0S  T0S@Sdg@S~P/0d 00 0Q,0/01P/0(00$ 0/d~p@-@P`T P (0S  1T  0C00`p }p@-`0Pe@P  PeP 00p  (( A- @0S  P p00   ($ 8PP(p`P0}||+O- 4M,0Su 0 j*`_ p  5. *`* ^ ^  @ 0 ~ς Y  ` @[ @:T8 Y :RVZ 9 0  Ii@9`P00<0 00 A4 S  !p$R> p`SE0 0,0Q0,90( RB 900 RA ) 0S  Q (0 (0$iHh@(pP 080 004 R Btȟ  B QPD8 pP0 0L,( ( ( X 0 8P`0 p 0 0J|g4Ѝ70PP AP 7@p0 00  t' 00D.0DS:P7B0P@7000GP p@0040 @ 0 0DQ0C$010,6P0$$ @(,TJ* QA([ A([ P` pP@M@ A(@T0@ @  T 0Q,P @P&E ``@P, p  dP ` BR \pA@OaPp `,  P01#S0  E0@P@( 徜 py Pg 1(0@ 0SA1 @P1$  @T(00^00<40$@ ^P` p5 $0P0000/3000C?00ꬰ( 0 Pd 0( 0P~ K ,P$gxC @(P0$0 1Q@30@P$ 1Q( @n!PL$00PQ0\@[ 20P$1Q,( I0B@0 (mP ? R';P( 01 (0 lPP$ P( 1QYP( $Q$JRy uK pP` p$ @@ p1p!0< ^ς~0S0 0@0P /000P ! 5.1:[0 [00  0 PZW4d|pt , {{zXzDz0zzyy<# Lyyx \0xxww0wv u ut*`00Q̱P@4p@ W0 [KPE `P$ 0̡1PE PU0 Y 2< 2Ѝ1PE P0 0Y Pt YЍЍC-1` MS.:rBW R* U"R  R00U00SR 0 # PpXB Ѝ 2< 2 Ѝ_P ЍG-pMZ Rb* U 0S @ R0  D P X‡Ѝ@ 2< 2ЍЍG-`pᴑ 0F PP IPuP?0@ @S1Z01a>:z0S0Cs0  0S001P@10CS㣐0*y0/ 0 @00CSÐy0S Cr   0Vq00R!2 B!0C2cpP00 (Q800 (J bP0h tBp@- @VP ` PP &p !Pp@-`P@Q 00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-`P4M@Q 00 Vv 2+ RJ 13/p* 0 00}" "0$ 0 004 p`0 9/P 9/P H0  ^ 4Ѝp$  0Lqp 0 lP 2: 24Ѝp`?(0 0,009/P I/R0@}>I/H$uI/D0@  0A-%> S0!`$P@  @00CQA$0@D3@N0qW T00@2!$!AxpPWQ?U/ O-? ptM@PWp0 0P(0^ 0  P0 V (wp0 000 00`0S5H@0@ p0 P H  yy0 0I0 0Აᴀ @ Rڴ R  H@D 囘0I Pq  0pH 0CwpL05봀(00@` @r PX 0,00 $408hNRI0F OK0Fbh*FFJK9hOF&2#`;h+>H0(`h=M;hOF#`O "Fkh;k`+(FAF *n(43 .0ѺxO 4+`4 .%  #HJFd0[PիZ !h$H#`#`d0[?EEz(FO 4 JHDvd0^ 4#$ S0 &0F+D  '  P  . .,4+^ %0I 02Fl4+. M 0- 0 s20^ 0?|.F@? +hY)`xP竉#`*8F&)-O$FhFFFI F%FTD#J1FK8FC[R(4G((;бf" 7h(_H8 (S       e O %x(e(X( d(#jKhO hI hB:V" -ђEђx ; `^Kh/,йи XI O %FO 5%ENOMO% |V#  PFFGIRF % F0AI"F&)F"XFF(^IEHmhpCOc")F\9IZ `^FhpCOTpCO*j)I1H! pCO1 س_𶀳_(F0!O🀳 Ol+Ё(F#j*?+ J)jH bhjPC'Ѻ)jH6")FfOCF n| 6X[|d%ѢkBHSco@"?KOq9;HLq@(!TpCOL#` ѣi{k-J;c+R# ,K@? !(*?}m"Hh&v)j!Hch+?Sgch+?J^@Fj Cch+?2C?U&IF0߭U& I t  &8-GF- FhI TJ!F(F&0ЩI KMh@8LP90NH3h+0_ԝI"PF(  l`k#cKdccH"mK@+iUj^00F! F#m@aOrdO@#F(c"m@`l@!OOrF[h`kG#kC#c(cbkqInH a<2PC`aвA2Cв#mCO "l`lSC3l!ik DG]M#m@\IL@r6BA88F8DLF(Рj8DC a(ы)FOHOI MI LHOSU`#`T@M3hZ2`+51DJB@#m1 BA`i!: ##2C Ok-@l(FiG0@h+ ,I9'm 2BBBAҺ  !0 [jGFPF,ф4AF x! 8! ! '!A?)B{ XHFO00"j6#GCKH#m6214B2223B2#mZ-2# #2c62h*OckDkE@؀e#k+`#kcccl*AFD t]O F "lU,ԢlU,ե &h"m@C bF@F&   ENEі@B*AF(Fa `Z"$(*@BF~ @AS8`~I.  @J#ccV(?kIF5h( (FFcm+1hqH0pCO(FF5hak(F;h 1(4l:h  (F228cm+ZH)FFlaX cm+TJ1h 6 XFPcm+LKZF1h*&ccqЖ8+m0EF_аhx23!C#23!C#23!C# 23 !C # 2 [B 22[B22[B22[B2F`L8hAF  ckKEة>[^vF@Esh*(,hDD#nm(p(O зDM(hF *h AI@:F0FRoZРF:I@FB8I8Fd5IF@F6O F 0)F (h F ( `!F#Hh#pBO#/# 0)F F 0VO,)F F b(1h0h)F p0u 'v-OFMhFXI RWM&WJAF FCTK , ~OI(a `i , qhX*i( f(h(зv(#k`a"###cE  =YFV% F(pCO V%@BPF(oF  )I K0+c?Kh+_ Z;Kh7K(`5K0S6Kh;=Kh;K``+ ,K60+6HC1H4K#L ` ^#1q zSKF0+$H#U#x+x+#M$U 4!5,єI @"05 x""p"Ȃ""|"8  z5l" 5t"^55-CFhrI RqNrK$`3h BX#mIHFFHFBiJAF(FB2h(,aI ja+R#     $TO!8h (:h PIF$$NI (KH KI z(HHHI p(EH ,У+h3=M#3hq+F(@6I9\ع*hh#x320[ FFF!F#3I" F* a0H!FuKI (H R` ```'`Bt @`ht@`t@` ```gtah ~ "-OFhFI QMV$FF&FFDx(`oSBSAk`K9FJ@FCєK иѤ+6TлMЊI 2R(%G((0H8 (S )))e))))O &h(d(f(#v(#nKh#O &O O #&FO33,FkhW)+=:!PFdKW)@#x;#+'UI FMK`"1F@FF(@NI .!PFL(HIPF0FCI F0PF F 0i%.0@F#5(F.%@FdMdHcKOa(F22BFXH2% F(Oq0F NJ(Fq/%OI(F (FLL #3# "E*F "  D>H=K>I(FF20F:F3hù9I h#+ " 3H2  .JFCF8FQ FB0F(" 6h.!I2>F H2b1FOrH (F_F(FZ^@F/F02 ^:r\  <"zgrrq"P rqrrrrr^H|^H ch;c`+ FF(F (0 % N->{#hZ"`xch;c`+ F#hZ"`x.@Fu0OS00OS0@HAF.5@F1X1+î1[4H]3HR(?d/J-Hq%*I)H.έ(I g(?@FF#.2`I@F(I #>.?T(F0FI*F HOrPKC $"!FFH(|r "<"rmd*ps"(Jh(KZ`#N$MV{H9FiF +n;+f+ I 4, mZe "p18pp"lP x -OF-PF'#FFF AFJ FAїJ ,9l-ѥrQBQAIH" N?F.ыJ  t(c(S(P(dE B n( t(#Fa({JF&-d-!d-C R- S-/Q-qI*F p-r-Dl-",=X*HF2F # X*"`IHF 0^I X*"ZIHF 0WIX*" TI HF 0RIFP X*"F   "YF,<PF@I"FX&WpE&6BE:I HF 07IDFB5JF(FLX* 1IXF$0IZF(FIF.J(FF(F)JIF (I, J$I|F"I ,@𒀉F&X*H4H!F0 FPv9爎 'ʏ~DD{DÎЎ|D(ߎ }D'5BUl(I F(Fx%KB.=s@3B0QF(FFPQEW(O 0~ IMFZFF*1F(F"PFFbF(FIRFHRFFOyara -OF-FL#M222423322O3 3 J9F0FC!ѨK"h42vc2CCCC2M+:*@Hz(R(3(`/(WaS8'(S  !""%   ""18( "$A8((S =!#kaQ###\ 4 "#IF2h0x ( II dCKXa/#d2+#42'#2##2#2#2;M$jh4U9H, c#2232#2.K/!@FF# ;0;<@FX02< ?߮/!HFF#;0; KXit6,?g!FH|a2C"Cu H)(HH!(H 5a"r0""-O]L  -#0%#FFC_Fca#FC_PT`1FJ8FȂ^ANiB@ aKh O OalZFY/!(F^F0FLPK `Oa f*XFFpXFvFH^E10FnF(*"hlOaYVF(@ـ}Il y(c(P(VT(_dwKSFvH  d+R#.-.-----I.-1.-9.'.--.-.-/'.iCa[iCaQFTH8iC iCiCJ?0+?9:!XF  F#;#i+?HBFYF?"hYFt AFKh#h 5I e*` x 1In)Qxo)2*`#-J`-I(F,FP*JH iC%J%HD#0"K"JFPF ]$iI F"(ZI F(TI F(NI2F " "- ""i ж"qp0'չ dOc)F0F"F[?F*I"F )J)I 찹XF(M F0F#Y+FXFEF?xIXF*F 0I"FXF F D<`BI"F a; !*I"F$R-"#F I Q"zd@"edAb-GFL FKN'KJ!F(FpC+G00DH'CKh ! "(>I 0;I O =@HFy(m(P(f(n +R#q1/110/1/1/1/1/1/11}1 #`#!3`1#"2p hT w"9Fg HTVT FFPF EF" 'KJ-OF F ` h8# # L&7F (#$f00`J)F@FC;F00#H&7FKh 0ch#0! R(КI L#hI FI BO EKh+ PF z(O(B(eF(P8*(S 42222422422222222333K42[4222222c44244222222444#0PXIXF A0DTIXF(@CQI# b 0 ##FKH*#II0XF#0DIXF#0AI #ZFc (!F 9 `P2BB+m $EUd O СL^L O I*@B[ CSR4B@20JF9F0FG0N IZF7&0FH  I HY H^KI3FS]e "-OS}8 F!O rHF P` OO8 D    ѳHp0&ѱI K%hʹ0&F 2P5Ŗ583-HD0ўIH=0ѝIH`.ZћK/OMI`H`e>FKMh J8F?FDѐK0O0+@^@Z5+@UO Bћ5 +=Ѹ+8  # 3` *FcKFi@hF(@TtJeQ TqhrH'6hz ܻ`ܻN~KܻAeлC XFB@Ӏ a#*Q"=><#<<#<#<#<<#<#<#<=#<#<#<#<#<#<=#<-=5===#<#<}=W o@! "!4J Pd+?@D7H:/JK06-JL02+JJ0.)J/MO0)&K"%$$JN0)KB?H;+JM0JH0Mo@! "5 !Z (d+h I JI0KUE UFF nL" L L" p  L( L L'KzOT?kܻLm ?S+=e;e;e;e;e;!=e;e;e;C>mMOlM&lM.m (뮛H0+殛I0+ᮛO0;ћ5+?L (?F2hHFe0VI3hs;"SCY@9FF OJ=F(F(FCF&0F0EJ!(F-AJ.x0Fi=J<4hC;K@*1P9F(FG"! FN4I(F X2I(F"F@(Fj B-I(F8+KOaF/*("#I"F(F0 Hj (K@i!" 0F&F Fh3SB2FFI"F(Fn0Is" p  LL4MPMFFJEinM~Mui Mm I 2HI]@Hx\H# I HG HL I HDK I3F?HR]V< P#EX#5 I H! H& I HK I3FH,]0 l#t#9LI K(, (0I8I@ IF08@#0 Y I -G (gHtfH(eHldH! (=hD4! ^H F!\H [J HOA(*F "v0 NH4HH! j0 JH* HK"HN !HH$O O O '3`CH#"!%#>H"!FHh|I8Ft#`BF.h6OaqJFWF(?d#3:F00F#FF`V'FV'FPF(XFF(]I@F4h[I@F.@ZI@F*V' WIQIHFx (V'(?eiv XF()F POb P/!hF0F00DB(r# P3p!CF.6J0F6I0F0А#3)F3HF0#FRho V<9 %I0F:F00F(F(D#EW| (ywIHFp#T4[qIHFx0pKpJ vT4+kIHFf(iK"a*"bKS#Bq  ]I۱a`[#KC3 F! D0@ځ[# OI#BF +CbA li FIF0GHAFOYIFOpMF(AIJF JF!&8JR2JC"D$*5HJF[FAFOu{M#-M0$$4T±+@)t$ERF{ FJFZC!I k{+F+O0$ܡ+Ob0$@Ȁ0ò$_CHOR="+#SWP #Ɲ#XJR Or 򇀰r 򄀰_rOR0$B+0} 4S$O0~( 44#0444 0+@4+ wJ#E#@4,4K$4 *Կ,4"F1F@F wNЦBI F kh+?  ,aXhF`=,@[J#Fd! la ,`(cTI ,bX OrObOb}!OS$4204$4{HHOb(T4+)p0FfЯ@HM :Jd!F F  5HV\480Hg*KS @"3FTHC0(RJWI"SH jQF( JOr4QF( 0CJ HI F C;`4+h4 BIIZK=Il ;K0J .N?*2I`0* $0Bq .Ih}4 $ (F0@# !I#2F+ai_t(F9F01FHOQ FL F`IRFphlY # #Я$~ܰ#$ t0w4+PHJF;F1FOsw5XFLJ $ 4*[+;F 4Y4+RFPF FAF*F0FIkB(F ERFw(FYFJFZB(I N gwIFOyExOc 4 $$IFOPgExOS+Х  0IFFOQExtIFOPDEx+o S-O|MFFh"! FJAF(FpC ѮKh=-@B@85(S cbccbbcbbcbbdbc%dbbb-dQebbbbbbbbbbbbAdUdidb}ddbddbdbdd ebb'e=eb5fpKqIhas#$0ojKh`khKjIhQcdKhv v]aHO2cK!h`0Ca`0MYKh#bIWKhbEUHOrXK!h;PHO2TK!h c1KHO2PK!h`c'FH"LK!h8AHOrHK!h`O^m~O RFQFHFT??FF|h+v RFYFHFEFFIJF 0x+^h+HOrK!hT6X#P/!(F2CKOaFF qh"F(F |M'-O&- FF2F! $MK@BڡI 2F! (!F0љHF0іI'.FO4>FJIFPFoHRJK x#  DI8 RS+ ?I"4x ( 7I< 7hCshCSh0I C@`-Kh@; hZChC{hCw8;C"xF ( IrOsBIhCUhCQ{Gz?`RMb@A$7 H!$!:Wu'hCC$ "`xF( yI#"xC+ qIKoIhoJCcoH`# hiIhkJC jH`# hbeK x+ ?m _IOe jXI-<;+`UI$GQ QK FY`R A0 8`( {:(; EIhHCCH2k<+D 02F=KhBoCB0FOs6KY  b5Hd rp@`OhCS`h_ cˌOs2a&K8$l`2,F6`&.`p@FK;t (6IBF ,ſFv`&&eA'\!$$x!$S8!$ x$hZ@K@ hFFK,@πBҀ +΀I1" 0 / . - ,+*)('&%$#d!#FFHBh ђHNxB 8;#"Oq0уH8;#"Oq0zH8;#"Oq~0pH8;#"Oqj0gHhՃ"x+"y+"z+d+{+"+"+;!'xy;#z;(#;+&QHRI0"!*(1JIc10?%GHB@+FI!23Bؿ#T@LT2D*h>H4DDE0KBFU6?+223LB@ph_p'_rAـK)!rH`aQUR !" "(I0K0k K& "!(Ih@# "!K(5I @@"$q}$"$!$@ {$`!$!$ H3 "t(Iܻd &PkhIFHAKOqZ(򵀻KAOq&LI Kk"k2F(1 k#kKf4aM'#f"%fn)F <;B󊀤I *K0@Lz A :!:۔I @TVz A 9!:I`"2BTڵO݂I` ~KiKhbyI` HL T@I2"oI O \0CkIgJSiSSa+?6fIaI 6*hPL^Kxp ` 8ؿ`08@țHI ; IF( {*F- Mh+HHF1?I##p+th++HF1H`1HH!'I ,t;$JxO  ENh  AFF Hd2"B+?h-C6?8~A@@x$3|* U$x!$h$h* !$sPH!$   #0+@2B`8‡BKd2C  d2h?𽀚@񢀨hh#OzsFXCH4 Kp @@  Ճ ݄8F!W"D3C3h2[陓2[EyH F2zF0F2Z+O(+Z; hSgHC;'+P ^KF;+Ch 32ZHh0QK/ h h3SsEbF”F[PC U0w;hC AH;AF@HL'h?ԇH FzF0Fp' Bh  *K  踹 ہ/ M HRK 0BE܇PH FjzF0F,J!hBDzHD 'hchB'h* $<@"$ !$q9ѝH7H;+Yd #2F9F(Fv(?ix): #%')+-/1357H HHHFH|1F(F#0'X|H|H|H|H|H|H|H|H|H|H|H|H#2F9F(F-(?wH#2F9F(F"(?ix) oH<(FmHmHmHmHmH,#2F9F(F(?FFcH#2F9F(F(?|^H #2F9F(F(?oXH#2F9F(F(?dix)RHqRHaRH_#2F9F(F(?Q)yMHa#2F9F(F(?EHH#2F9F(F(?:DH#2F9F(F(?/?H#2F9F(F(?$;H#2F9F(F(?6H#2F9F(F|(?2H#2F9F(Fq(?)x-Hh1F(F &K_w+=bp5Nd*0+b++𷀏'|H FzF0FXWH7+њ  ./ :* D KHD ܩ o O   3 FF   BF F/>+E*IJF@F@'H :"HJFAF 'HD ܪo SC  Hz / HpFO08ջb<!$DRW]-OFFIxF-+4 Fz(:ѩK$"`O FFJ1F(F|C7ѤKhBu'>3FS}[(FJFV)X/DDd0(Y KVIF $I F:(щK"@Z`d+ '*!$DtDOyKh vDdDD4D$D$O O XFG(FjlI(Ff%)F F:fI p.їBF(IcphXKhb "!THK[I2F K"YN[h "!+RHKUI2FQHK-;RI+F2F K PJKiMJ##K` !Fr! n! j! f! b! ^! f07I7I2F!O0Z0"h+1H,L!0hFF?%F0FKi*FF   & !O0(0h+H .H)F FH0F6!% y/<Rh(-OFMFtH~M((Ft whM(F+`;x-+04JF88F0J F! \V+8LFFO D+?S;pD>V?D;+Ѥ NFXJhi t+#kbI &(F I (F H" L(c~HR|K>$3`+~r+XR+i+G Ft+x+4 - O V)OblPFFЃ C#+d0<BF;F  E ki+ (j)JLr:HIIHHHy jAIDHCH"#0 j%I,Hf'H"#c!H+CH ez s O%ObV%+F FR35B  *  8EU* (-OFF.ݙL&9FJ(FAіK,#0*iАH"! d#l+vڌI vv(c(S(DT(JL(6 d+R#%Ń+ŃŃŃŃŃŃŃ;ŃŃAŃO_Ńg#cd#3#3#c#d# 3#$3#(3#,3c!" # #OBOq d 0THW(3+@_HFHF^)(H8 ( (S i/("63#"1F ! " J!  J!F J!F J! J! J!F Js к3#"I zW(0"`xg+ lF*DOgO9ch@gI]%H >qh x-+@ 1FF3*eIddXddyd=,,ao"d'd59dd2ORCd^ddddd[LFddU"##`K"`VFMF#"#`K# "#`K43343'g#83#<3@33@3G'GW'WGGGGG7Gw'wGg Fqh "  бh "  бh "  бh "  h  h F бh "  l3ds аh  Fh +h  +8JM#D#CD# C"mC"e#83"FX#k`(`D;+   #6M#5M#5M #4M@#4M#3M#3M#ch  F  sFFN$Iph(l3!J#8( أl3J"#qh " +xa*јIp@3l+ҁ Ied4 ]%^%^%^%^% ^%(^%]%`~G 3G 43 I F'`xOr9F`@FLa-c-g-#ehP"I0#0xH33PH30D3i0+!xpDB Y(dpch Zxxx12D D!BQx1 D 1BKch@U =x-I=E5H*F9Fk#$3+;zKDchx*7:BW:F(Fk#$3+)=DchXx*$:BW:F(Fk#$3+=Dch_Ox*:B2F(Fk)$)Dchx*:B2F(FjHIk($)D{hx*:B2F(FL9Ik($)׀DkPK$33{h @F+{l+@AF8l*FCF@h7+hLF!HVO5h3+@#h+xg+BУl+?IJ. FhFO0+ KYFp-@Kh+ ]%^%]%8^%XhXKFe~ IIIIIII( FO3Fr#p F @p%=I8F2a  h0@%1-?s FhFHmk(F#1FC(3CkC v"1F(FO^%-GFh FpL')FJ0FA ѵKhBv JIF ND(DРb++R#aэkэ{ээээээээээээKh 6#$6#(6#,6#064v#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rHr4&r<&ZnJ06C+F`U#PeI(FJH(ZcK #D#xh_Ix(-\MOjO W(@A #+p#kpUHQMP6jhCH`FMHZHHz(8h1!oF(f.@4VCF@&=HI +x++ .F0F35HpF(F !8B~]g*Jhkxh320ZR<#XCKZ`PBD2m 620 Ѹ:z(3x>"h"$+?K J`.j%' 4 qj% -CFFIFLFPLJ9F0FTCbeiݱK R.@3B-@M#j+@Ia((t(<єKi JhaJ9F0F*BяKMh6.,iTI F (I F( O 玱+i{ BF|I}H|IBFzHt(o@(A83(S ;;˚;;;;;;;;;;;;;;;;ך;;;;;;;;;;;;; ;;)-39I;Wcz(Fci+BOsci+;#caci+4#ci+.#ci+(#ci+"#ci+ ##c`#a#a#ci+ @####`#`##bKh`ci+Osci+##i+ KIh a(#cbY!o%! '`!U d! !!:chh+&i--iI0FXgI0F0fI0F( -c.--Ѯ=-?ͮS%ϜߜO-W)P h)F(MI*F B@-Ѐ-i#"jihp(cAF=HBi##"jihX(zshW)W)cj+?S eW)e`" D0&HP??!H6DOBbFH F*<KHѲ3 C "4#F-`j(? iI F(I F (AF HU !"!!!!1"-GMQLF F'PJ)F0FCNKhB$=O U/HF MR(f(O#4'U*OaR L#F"AJ0!\h00 0#</[P8FB ( #C(F (@hH&IF:F"Rq FHKT>O1 FH K"h(5Uq FH0K"T(X((Y0!F"aq F(,K"h(&$MiE%HZGIP 3J ZJ4D+R#ͥ5ͤ9 +[eפyK"(HFK"X(T(K",K"!FhK` #hx+?KIh NK,B,,2,K",|K"H(zKLzKhF FtK"L(sLObuH!how? $hHpI"FFhK"P(igKeLhjIp(]gK8X_Kh\K<(RZK"T("X(JXK "!Fh(RK( #hx+?:OKVIhKK"t(0KK "!FhEK( #hx+? BKJIhn@KhGL "  TA(F:KO h?IXFxx31KW@hr  E"PF0-H 5HK K",K"L(KhU#FK"`(d(K"L hK( "hI Kh?)H tMHKHhI*F8%LI'p< xI%II IIiEII' IJJL#H<<(x (@bFF(@𹀵K(*@߀)@HK L "$QFJ.Q "(F`*FFn(b( 9(*0(35J5H4I*F$c +R#ɮ3333333Ѯ3V(JH J08`J!F0F|CKhBKhh #Kh K"` K"Z`jF! n h tT?+7il^&>iCiIi biA i FV;ELH`#`"@#`}I##a zO `aD : *hmI#;`/kJ;hP+F- 3hx-*+*[xKf0cph lV{=[I8F(8FWHaxCTHaRKaRHaOKa!j!!NHF-ci (X V = F?Kh;?Kh#iC=H)=Mn  (+h+8K9Iht(5H! (hJ0(b?? *Kh#c*Kh+!(H^   e~F(N3h+o(5`Kh+c^&ii&iiiiiiii^&& jT&h 3j5jH&Р&Yj|&<&-GFuLFh'sI Gg`qJ1F(FC*oKbih:CV# 5I (h(=U(@lbK!h`H:(^I Du(`(G(DI(FE(;WIFFWH a+R#Dz)))Ͳ)))+)E)))))KhC`h#s8K/Jh+Fc`#`t##aqĠO J0QNF)I@FAFHFV$K 'hOhCsKJh+Fc`##H"F&(?:H5#a2# H"F(?*H@Bid`& X& = '-OFF I(ڡI nK,FĕL|K 0Fv HL3Fm(F%F)F(FJ*Fo vg'-O#mO%lLFOp;`FjK`jK`jK`jK`FNiKOr)FhM`2o rD&hֹeJ#eM$eH5dJ5dJ5#C(r`I`H Fh0BhF(F 4ahm(T D(@f(BC(EPIRH p(Hr(NJIF@FC(*JH LX pCO&+'s9BHF(;O F8{+ѸO8K"`4K5I\`##`̠.LO FO FH&I"O ,#L h_F h_#F`|(:IHy '[%' '''%''n 'D('%'[' ' [[-]8]N]<'%'[ 'a]'r]'D'e(e#GrH(qI oI nI h[d@jH@ # F#F@ FF-( V##`(`V0F T  TfWH # T  .I T  .JO@FFE~(FF FF XF@F GDH"!Fd #;`H@K`" C?K`ePy:Kh)[ 1\1d*5K" `13H P T !0FF!F( #XH#A#3B #2FAF #O3?F gXF!FXF.F|FF{U)FtT)Fp  s ']]%'@' '&]--OFͰhLF&O3FF `AFJ8FAFќKhB!ݹN"HFFHڕIJF hp-a-b=-   " 4z--6SIoB#H#" h#3K~IO2oC~H#" h#r  uKh`6OF[ ( 6 8F1F\HpC_(##&jJ#aX)FaeI0 ZRF(F>00P##bFF(vZI.л5ѹ2VIJFPF&TIFRI 2FOqF( " YF "IF0F(BIFd 0 HF(=I;I 9F!1F8F+J3FFv(?g'I PF($IT"IC)Fp!FX#IX# p') 4' ht@7BDcͱٱ>I dO06mIF8FP,O  BF("h+ 6Q-IBFh+ 6F)I 2DBr2VFFU F"h+FOqB ##`{нB EFh+B 6 ! HFF_PFXF>FF$ -O(-OFF/}  0LhI FHH /}I F0I$H O$r!% F TK!(FQ01K!h1O31y3l3,130(F7!F0 7! 0s OE7#FFKa <11F@FKTJZFZCYH32(F80B81C3819@90 FQ\!`1 яH03 4'0@#X  8F6 0фI09 F9x1+@ F)F;FGFC FPFLCF+4H99FF (h+ H9,` @^=л\ͻB   ( N#1C<13 C 0rIFV#68!1 130rV#613 њ;!!F60X81[ԨH92FAF F6(:ݤH9_N#RzC"<1!K80(ћIK@?cFH9[PF7jK2"!88(MI I"K80h+~I9S81B[?/ h+íxH9Nh+?N2h )?"81ԘJF FV0QFV#60ѢI N#V IV"LJJHLKK 8F80ѓI& !8F6 SOq=0ёH8"K8c0фI5`8\!*81Y\Cs81`1 F9x(>vIE V`!R#9B0@`!wHR#803\!xB0h *-<1lIL  88F681fHXj*`!dHR#  #j)[hx1Mx8F2F91F8F9?81Y8F6Jx1h.AN1ZԞG2 RP՞pLQCBI  88F6&)F8F;!x1h-?ŭ+j;"8K!8;mh 032FAFHF773j;0F60F8xJ vhx!h"RFj 2Rh*?!K82`h0F`8xh.E1xaٻB``Ի޻ӻG 9A 9< H8<1@C88z@EH|E<1(h?w  Q/0@-0 ph P ^0T@0 , 0 0106 tX/10!O-bMM b [ !b1  0 0 30^bݍЍnZ Ft \ ,Pp兓;0G(00+x(`0( G080Gp x8_S0嫚 @G0ચJ000 P00 0 0 ˏP x8`@##[* P0P l8 40GU P0P l840G<6 5 t/X0ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/@-M   Ѝ*l  \/\-M 0I p 0 S 0 /O0 Ѝ<-|,/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/~*/{*/x*/cu*/2r*/o*/l*/9i*/f*/c*/8`*/]*/Z*/W*/T*/ Q*/N*/K*/0H*/QE*/B*/)?*/{<*/|9*/#6*/)3*/=0*/-*/**/"'*/$*/!*/*/*/////^*/*/ */< */*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@O@*/*/xGxGwxG=txG瘚xGgsxGMxGnxGjXxGaxGőxGCxGxG΋xGtxGxGxGBxGrxGJ.xG6}xGrxGzxG 6xGQxG~xG=xGxrxGxG1xGxG篏xGV , xGK}xGZxG xG^xG?xG^xG~xG笐xGxGxGxG7xGxG4xG+xGu&xGxxG) xG+xGjxG!(xGTxG&xGxGxGxG[ xGTxG!'xGlxG箋xGNxG̩xGxxGxGxGOxGxG% xG%KxGxGxG矩xG]xGxGQps_strings missing ramdiskbinUsage: %s ..., where is one of: ]1 &-)-158m >M AM EY JOU[ek=rx,}025m:qA]CGLLLLL M#M=M=M[b+f0mz7mz<}D}MYS\Քeul՘t{!ũũ!!-mql %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcdstdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreferenceHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s   @@  @@  I   Y @@) Y @@ %s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdin8t, hH  files is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of input%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\invalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memoryusage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.%s: %s%u-%lld%llu%d%s: directory causes a cycle %s: %s: fts_readusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS/%s%s/%s ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdoutusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %s-n-ewrite error%s: : %s+ + +++++++++,,',;,EL,Z`,u,,,#, ,_,^,F,<,>,?,,error %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found HOME :]./%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier%lldnull or %s %.*s: parameter %snot set%d%zunot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes%ld [%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d %ld[%d] %ld /dev/nullCan't open %slpZ%smore than one -p unsupportednp:invalid name: -p '%s'%s readonly%dYou have stopped jobs. ${LINENO${#LINENO${#${"(()(...)$(...)">>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error -828t:8?8fF8K8dR8K8sX8?8ca8K8mh8K8lv8}8r 88p88n8K8v 88b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpectedR?^?f?j?n?s?x?|??????????????????????%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \???"?'?*?0?6?:?=?B?D?F?K?P?Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Pipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)C"C@(C-C6C fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error CC C CCCCCC%d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATIONԏ"0F,"1F"1F"8F"0F?"0G"0Gp"0GAX"0'G-PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad numberdHHH HH HHHHHHH HHH HH H HHHHHHHHH H!HHHHHH!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unset4O8:O8CO9EO%'JO#!OOTO[OdO9kOoOͥuOA:{OO=:Ocommandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexpP P PzPuPu"Pq'P+P/P9:5P-=PŇ@PBPJP!DOPlRPlZP{`PePjPpPwP{PPePPP=:PGP}PmP PMPl#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260325090945Z SMALL REJECT_NULSNETBSD_SHELLLINENOincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failedNVVV \V`VdViVoVtVyVVV VV VV V VV>VBVHVoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOPX]XX{X{X%XXwXY YAYYYY[%Y!,YA2Y6Y;Y%@YuEYKYillegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedtty]]]]]#]3]#]3^2^3^3^#^"^(^/^ 6^@<^@@^G^O^V^f]n]w]~]]]]] ]@]]]]]]]] \C$\C\C$\C\\\\\\\\\\] ]]@]@"] *] 3]8]?]F]@M]T] []`\g\o\t\z\\\\\ \@litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZowner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferenceDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %suuu@t@u@u@u@u@u@u@u@v@ v@ u @v@v@v@&v@uu-v2v8v?vGvMvyuSvZv`vgvqvyvvvvv@v@vvvvvvvuvvvvvvw wwww"w)w0wtt8w%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:or%s6sFswsssssss t(t;tFtftit%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=m7x;x@xHxMxRxXx^xdxkxwrxvxw|xwwwxxxx%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:?wFwKwUw_whwow~wwwmwwwwwwwwwwwwwwwwwwwxx#x3xt%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFOtttttttttttttttttu uuu u&u/u6u?uHuQuZueunuyu~uuuuuuuuu/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd%s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:D %,069?BHDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>!07=DLQY^cgp{с݁Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd# %s: ΅{ =!ÆɆ̆҆type: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u {Dž΅օۅ !'+37=AL[gw%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. }%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootableZ1Re  , W s ѩ֩Bg{ڪ !#$&12345368>9D9K:d;~<=@ëA׫BC?DfE|FGHJLĬMլNܬOPQR#S=TFUNVfW\acde f g3h3i3p:qstuPvwVxj#Ddկ%7Nj˰$DLYcj±ͱױ16IVhϲϲϲ&3K`}γ$8XsĴ#(;Pj͵$7Cf%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablerorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype(-37>EJT^gn}ȺͺҺֺں*:vfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUsage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entryffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblockXXXX        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:'sL @index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:{wT No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]zX AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]M|\ @@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),i r       KTUnrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functioneQ` Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:Cd @label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored:AESf{bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrgpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: ;((,l--.=03p44h;  Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*  (-26?JOTX\flpx|Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sl @Afp:sNo MBR in disk to convert/Bi   4 P rDXm !#$&12345 68 9! 9( :A ;[ <y = @ A B C!DC!EY!Fn!Gn!Hn!J!L!M!N!O!P!Q!R"S"T#"U+"VC"W]"\g"a"c"d"e"f"g#h#i#p#qstu-#vw3#xG#c#t######$!$A$]$}$$$$$%%+%G%_%|%%%%%%%%&!&)&\6&=&`&s&&&&&&&&' '')';'U'e''''''''((3(P(h(((((( )+)F)a)))))*#*=*]*p***** ++9+i+MBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sX-p @Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremoved-mt @ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]{.| @a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]05 @s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q]0  a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)en_GB.UTF-8 (active)UnusedExtended MBR%d - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s Could not find index %dDetails for index %d: StartSizeunknownType: %s (%s) Attributes: None()start %*ssize index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]%4 gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed 4 @ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l5ž  a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eC88SFU0eC88Hah!IdontNeedEFI88(s*K>;9 9|nQn- q+9!9|nQn- q+09:9|nQn- q+G9P9|nQn- q+a9l9|nQn- q+z9~9=rGy=iG}99;Mt?99mWC 3KOO99yD<#*=(99YbBRuoqr993Dh&99\ M}-:":@Mjy֬3:D:-чHU:Y:-чHn:r:ZIчH::IчH::IчH::2IчH::L6 %?a::S'@ )Ѹ::*1@ )Ѹ;;1x )Ѹ';2;ST.qBHo6֯iB;M;%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL; @UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-= o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin@i @Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeCCCifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s MMM linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroyOzix Oyialiasdeletetrailers-linkstrdescription-descr-descriptionOOO( }Ed OOO( G@ 4G D PMF D Om( E O( EH OH O( O( broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6"S-S8SDSPS \ShStS@SSSS S0S@SSSarpdebugunnumberedlink0link1link2WWW WW W@MMgetifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %d0^G;^0^F^M^T^l\[^, ;^T^ 0^T^``^h^@`^h^;^T^F^M^media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaopt\\|ZZ \\|ZZ |Z\|Z\ gZ\gZ\ \\UZ|Z PZ\PZ  no carrierno networkbackupmasteractivedownno ringinserted0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %dgU' ktunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnel`!( _h bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanifa ba .b b)6bVLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ΕՕߕ    (-9@AGgetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).zϟ?yҠ2Ov;cڢ6V{usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @BCF I9LCNPO|Sabceǻfٻh i,k8mFnWofrusu -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jd@@@h pp pp ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s {wsokCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood 8e}8X&P~%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/k4{]5]5]5]5]5]5q6 770]5?I]5\a9w)1)1Q+]5]5]5]5]5 :]5%]57?]5W^]5}]5]5]5]5]5?]5Z]5q]5;;]5]57//]5]5"]5']5regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s):  CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%cD#EEE421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)KMMMMMM ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forkaaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhfAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYwxY{xYpclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGSFGI%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. ]]]]h-']]']]%']]<']^ '^!^!'2^:^"'W^b^'^^'^^#'^]#'^]$'^]B''^^'^n '^^P '^] '^_$''_]'_#_'/_<_&'A_<_'R_[_'j_x_'__'__'_^'_]7'_]6'_[_D('_x_C)'`]B*' ``D',`^A+'8`]_+'D`]^,'r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eulabAkbmk%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5di6k;kftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalidspsssssssssssssssst tttt#t)t-t5t9t?tCtNt]tityta%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF nnn~sn/sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug9@EOYbixÂȂ͂тՂ߂ %5  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s a 2 -7  Y  & ' 1L e u %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errorƍՍ܍  %*.2<BFNRX\gv/dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijzJ R R T QQ T O L S M %O L L ] kQ MW UP N I N T Y [ I I \ M }M !M O M disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS %s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s%*s %s%llupartman%s/%sE'D'%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new - o Q 5  _ ] g  !  ) Q  out of memoryQ9,,448[ =H̤NSZ !-a dmt} ,gpt %s %s -b %llu %s29>ADINQU[_ejqv{¤Ƥ̤Ф٤%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eC쬥SFU0eC쬵Hah!IdontNeedEFIɨΨ(s*K>;بܨ|nQn- q+|nQn- q+ |nQn- q+"|nQn- q+3>|nQn- q+LP=rGy=iG}T_;Mt?jumWC 3KOOyD<#*=(YbBRuoqr3Dh&ȩЩ\ M}-@Mjy֬-чH'+-чH@DZIчH^bIчHuyIчH2IчHL6 %?aS'@ )ѸǪΪ*1@ )Ѹ1x )ѸST.qBHo6֯i%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/ȯ ϯ )9A>HPZjz %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new   i  a c     9 ]   ; E  M    ! %" %s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s F %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initsplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentbcdefghi jkl&m-no4p?qrEsLTtu\avgwnxszyABCDEFGH|IJKLMNOP QSTU(V2W<XFZU1]4f6oy|~}#'-4=EMWdn}'5Aoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLI I (null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deleted- - rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_delete sa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULL%.59CLW_dl - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s  protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s $3< %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %sHQW_g kBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- % % 1 1 : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc  VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory .a, y, , , , , ,  - !- 9- Q- i- alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  $ - 6<BHNTZ`f l@rx~|ASCIIcs_pathXp bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_max/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)fldrx~P<([:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d b  OV '!@4 f januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8b2Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!JgPMcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown  '++ 9L.DDҵ;15MS7) t:h%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,2~nnw9kUnA n64UOKGC>:8.,11)15-1$1TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>czLLLLLLLLLLLLLLLLLLLLLLLLLLLLLzLLLLLqLqLLL},v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %KCu8p9nW" =jSVgSZH(-Cu8p9nW" =jSVgSZH(-" acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C002G,.qzcq=qd -unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger/852array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist