ELF( 4/O4 ( """CC[!"\\@0 6QQ O @@( @0 fH!@P@Q?H3}Р -L/[de@c@kdmain() returnedlmd   ! X(@@T @@ 0/|odxodT (/// P-iN8d@c@-@PL00S @0080 0 0 0Q ЍX}cCCB>P/00S 000/X}c4DeA-@MpЀP @ލ0s PP ʰ0 00`V Ⴠ h{@  0R(0R uOoBB>edAB>\ 4S/0!8 00 (   !/@cddd@-닳oP|0 !!X0T0P0H000, !  !.C>6C>@cdddG-bM0SpPpP7P (ЍGV r@T P o  P tPP 00 B4R  04!@a0C0 vrT q@ frP@ grP P P P qP|PlPP P 8啴$ 0@ WeGC>C>WeB>QC>TC>WC>ZC>@-<@P$P@ 7cC>C>C>@-l00: ST 88S!~0Y㔺@ 00 @kd@B@-0@0PS@!@/ӽ 4Sʀ0! 0    !B? SOP,0 !! HD.<8夽0c4De-@cdddC>C> D>@BD> P00  /$@$0P  000/dPd<0 P0/S/0CQ/@kds@-A0S<`P`XP. SP, NP P0000 8fCPЍp@苵x7P`h@0: S P0RЍp@@P8P0Ѝpc,D>3D>:D>p@XcAD>@kd` @ @O-M,&pP{帶 ?WM家!7GR  E0~P00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0匸?6峁P L "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<$1)0C$1vn0!10C0PU0S 9#9S  @P :$1I)0C*$1,Yn1,!p1c001 1 @P :|5*$10C$1Dn 1 @P :$1Du*0C$16n0! 10C01 @ P:$1t*0C$1#n0! 10C01 @ P:$1t*0C$1n0! 10C01 @ P:$1lt*0C$1m0! 10C01 @ Ps:$1*0C$1m1! 10C11 @ Pa:$1)0C$1mP##Iq㰃 uIW#I#Ix#x Ip#p I$p`3`` \3!XT3 0C 0p 0 I! 0I 0I H": H": Ht: H\: H0p09 H 0p0 :HXp!I!p0 {H<]L$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xG3- 1I0II010! ,1,! (1(!h$)IH! 1"}F ЍGD>@\D> 0 DSBO@kd4Deᆳc,D>mdAiPc)i<c` AD>?l?e,wd`8E>OE>wd(odPododdodhld|ldldld@ldmdwde CBhmd clmd@vc(c $c @c` @- @0 vPЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ TTU   ,0PP<0P 008~@P`\  0<0 0^*0 00 \S 0 E>O-0`(Pp e@ nP ePPP00 ɆP 0 0tP PP0 0@ⳆPp  p@?P E>E>E>G- @3`Pd1.0\\$p0PfGpU' 0SI 00P(0P pW4 pGW=f/0 0<0 06003/&SP000( 0 0# eP  _P8S PFP f/$0僅P`  `ЍE>WEVE>E>A-` 0pd 0@h 0Pl0`S X, P I/ 0V 048<S Q PU nP0 R P  0`PU0 0 0` 04 8 <0K0(UPXá R  $  (3/O-@M`Pp @-k(0P  X0<0((S 2<0\0Q00 08@F>*F>@-@p,M `P`j(U@0(`S00,PP 00S00 0B!000CS,Ѝ [7 >@-90@-@A}P0 0 000@p@-0M`Py@ѱ2P00 0 0000 02`P 0Ѝp@~(P90(@400800@00D00H00L00P0@y0 00 0Pi00T0  0 0(00< ,00h0ЍpSF>eF>gF>       F> +,00 SP/o/@kdA-P0@Q`0p$ 7/0 V0`08$ A#8/p@-0@P0` 6/05`8 p@#8/p@-h0P@ TT0pH00 S /o" p@Sp4mdc@kd` s@-`P#y`0@0| qxPB 00,R P, 305/PP Ѝp@`0 SxP {\0@X0Ѝp@ @0R ЍpF>F>@F>@kd4mdc` @-@fP/o@"Shcp@-`PL f@Pp  E$00Spp p@:hcp@-P`e@PpIFU  ' p@"  hcL0 H0R/p@-P4e@Pp&U p@ @kd` hcp@-P<e@,eP  Tp p@hcp@-P<e@,eP Tp p@hc@-@eP @ hcP0 L0R/p@-P`8e@Pp /op@"@kd` hc80 40R/@-@ jeP @@kd` hc0 0R/A-WePP 003/X@  ` 08#8A/`` 0 8/R Ao0 0@kd` hcp@-!ePe@Pp0 0`6/,P0``6/0 0P5/,p0`p@/hc0 0R/p@-dPdU@ 0$ 0`6/3>$ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/@kd` hcp@-ddPTdU@ $ ``06/Tp0`$ p@/hc/p@-0 P T@``06/0 ``6/`0p@ /p@-P@3w@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` @kd) A-0PST@ Sq v 尭Bu 00 `0*b6/`P v  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@F>F>@cp@-P0 ` T@003/U U 0(  p 003/pG>ᐰ@-00  Ѝ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-0`@TP Vp V h̬00 3/P0T00 T0 `@4/A0T0 `@31G>|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~卬RG>@-@00 S @0 P@oЍ@kd@-0 00  0 0 0mЍA-PS@`p = P PA_W    P RUA<G>G>p@-P`uP0|P@0@}SPݬ`00 P0    0 0pG>cA-p`bPP 0S  W000V0000 @1 #W  R0 W00S 0$2V  R0 0#V00S0 AtHcc@-@eb0P Rl T0@0@000@0#3T  R0 0#T00S0 @@LHcc@-@=b0P Rh T0000  "!0"T00S0 T  R @%Hcc@-@b0P Rh T0 0 000 02 #T  R0 T00S0@ Hcc 0o/8md/0@-0M P@ 0_P 000 dЍ03 p@-0@Tp@t :/$0dP 5/0 dP5/00| 0p@x8mdG>A-(MPdt@D1P<\4彫0100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍA05p`WV xxp YPdޫ bd0 0@0 0g_(Ѝ8mdH>@kdcH>pAl6 H>3 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@;A-0@TANAr0P`dp 7/U UA UU U 0dP5/0dP 5/0 4P5/ 8md;H>p@-0@TxP\A.pPP0 4P5/ 0 4P5/Pî 忮8mdIH>C-1M@TiAЍpb0` dP5/ 0dP5/P 囮噮央㜱pPP p d09/0 49/ ㇱ0 49/ 0 49/PU ljh0 dP5/0?<#8mdVH>A-1@T P✪P0` dp7/ 0dp7/ 20;30dp 7/0 4P5/ "0 4P5/ 0 4P5/P 8mdhH>O-,1P@`(,040p,坭(嚭0嗭4唭 @P0 ٭ ް(խ ڰ(ޭ ְ[P0׭ ȭ (s ,p0m4jOTŭ8md0S@- S S@@XH>0 @o/@kd@-c@PЍG-@Ђ2PRp`0CRdh2R 3C7CR0 0 $ G貴,2RW 3C7CR008#8S800 0,D &(D004004 0(0L00P0  , Q  !% b ,R!X , % , h0l0& d  '!00 !11  0P008#8S308#8S0x`0 pC p(`8p<C00500``5008#8Ss308#8SmSW HdHdH>H> H>@-@`{qPh @廲`0`` 0X 0P0` P00`04 4PЍpH>cI>4n,cP@ l@ @-Tq+@-Mq@00: S/ @kdH>c00@o/@kd` @-\@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gy2RS 3C7CR008#8S800 0$C & C1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011,P008#8S308#8S0x`0 pB h(`8p<B151``5008#8Sy308#8SsSW HdHdVI> ^I>@-@`ypP@d `0`` 0X 0P0` P00_04 4PЍppI>cxI>4n,XcXD tD @-Rpv@-Kp@j0 0R/  Y@kd` pI>xcp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/4/-/-/-/-/-/-/A-PpX`0@ 2/ p 0S0@0 @0000@A-P M@`dŦ0 0 0  p7/0P   p*7/0P   Ѝ "( p7/ P\ 000 00@001 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd  +|000040J> 0 0000Ȅ 8/0$@0\0`  (I>I>I>I>J> 0 /@-@ 00 S@@@kdQA-P@@@DT@ 0S 0S`T p` 00  刬`T@T@A-@nP@q`0p0```p0P0 PT⸥0x Ph宥0X P@夥04 PA噥wJ>|J>HmdxN `N J>N N @-m@A@-m@@-m@ |0 0@-m0 0@r0 0@l0P/fHmd@-<0@TP [0 0 @SHmd0P/QJHmdp@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  ppHmdRW SW 0o/Lmd///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S w@tP0T00S,0upG-M`m@P2`0p 봂kXPG DH0* Rp "Sk pd2d P00 000!h8" p-PP嚤0k0$eP(0SHP㰑0SKP 1@^P 1@VP h1@NP H1@F@10S h ,00h0 01@0b0![dЍ0!p P_ a` P0p 0㉧P0qw ဧ0* R t0@ P S T0@LmdL>@kdT ` K>cxT L>P T P c cc<,J>clX DX @-Jl//G-s@dVʀ 0! $"0""   !P 0x ᎧᘧP0S P0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y N e P0S \ GP0p (P ,0S -0S (05#0x %<P0p LP Q 0R(0l0 S$00 S YX0S`P\ d$0PX0 0 0?cF 0!D d08 0   !F@cdddLmdEcgfffp@-T0P@0`0\00`X0`0s X 0\00p©Lmd'@-@0FP @-0 @o/@kd//0000/QR R / /@-MP`@pT0 P0 S0 P @0S*0 TQ 0R @Ѝh`@VUUU'800: S/@-@@"@kd// 0!< 04 0 (   !/@cdddO-`@SP ox0pS㘀|P xPW PL t0S 0S ʌ P00 0SӀ0.X01 S5p,`=P< [ p0S7Zy0S2W 1x0: SR1!0?Ac4ESڀ t֨pS9PipX c 0&h0W00 S00S Z W  0|0S+ p0 |PŏX 'Sd d C 00PECS 0 0C|0`  0 pX0 ӝ ЍORP0 ЍP>@kdEcgfff:(P>Q@-Mpj`@ p[D4P 4ED -E p10: SRZ e0s(@  1o@  1iP0P0P 00P0@ 0@ 0@ܜ 0@՜|0x 0t00 0@YP <@00DЍR>*R>_ _ @kd_ _ a Pce#Ec@-@-@<0 @0xDEc@-7@-0@P1 p00200 p0000 0000000000 p000 Ѝ0\ P/0 !8 00 (  , !/@cdddp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000P>P>P>0 @o/@kd@-)У@P0%㉣@-s@-P`sh@nϟP0F.0 P05/PP Ѝp@#f p0@# )\ H0@) dP,05/Ѝp@1R>GR>`@IR>c d @-//s@-P`*hP@ 10: S)Q00*'@ 0崢P|+ 0@00D00<@H00L00P0%0P 弟|+0|0Ѝp00!000 P,Ѝp@蟟@kd,g iR>d |f df Lf R>R>@-"P@-o@- 00* R | SQ@ g H农000* R S@kd` R>@-@+᤼0@-C9!: ^SpP3 @4T004 0040606L00L000 @cc0l4/@-@, H$0 0Z?uЍLg S>G-P0 VPU0p`L@T qp YX!Q0S@p :f@P \HoH光@5 ᅔ@2@TmdS>2S>PS>A-` f`V@lPp @T 0Q`H0] o@ ^ 6TmdG-`0000p@᭟0  PU x0(60\ (0S Z00P, @\@ ᰟЍ"TmdP/r0@-M@P 0 P @  0~n@Ѝ00@-M@P 0 P @  0un@Ѝ0@-P0$M000@R<` p~000S0 P@ 80 0`0Xn@ 0 0WP0@0$ЍbtTmd$e0@-M@P 0 TP@  0[n@~Ѝ0@-@0 ?P @  en@jЍ P@- R Tmd0/Tmdp@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p_Tmd@cdddp@-HP0PSp P@ `6/K0  0p@/Tmdp@-x`0SplPP@00C00SP 0 `6/T 000pp@PpTmdcG-pP`P@ P" P PV `FPEX@P P #P`OT00Y0S<4B `@=yS>wS>}S>S>/@-0,\ @T 4/ЍTmd00S/ R//Tmd00S/ R//Tmdp@-@P. i.0p@80/lmd 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/cA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 cr r 0  )?)/ 0  )?)/^/@-@q d壜Q0P0Cq 8喜 q (呜q 匜S>S>S>S>S>@-H M@8~ T000 0O ЍT>s 0@- 0@ ,MPr           0 040$0OP 000 S,Ѝ00cr /0/!//A-pQ`.0  P@ x0E1P Hpp`@tT:80*0 .'J Dc@>@-ÚT>@-忚*T>///1/8#81/1/  R/ R/ 0s S40@o//0@3S0/@c/囘U>p@-@0PT3/>p`S0p@8/4$$#   p@/U>U>!U>Q0 Q Q // CU>U>FU>IU>O-P`$M 0 3/$Ѝ03/@yQ  0R $Π  M3/0 0Sp00 `"R 3/ 0A0CS000 3/00u00d0 0Q 0 3/$C H! 3/(!0AYS-000(c0C S#0x   03/ 03/@ 0t3/W  0\3/0 L3/W0A CRS 000 0R(3/07  1 2/0 30 r#03/ $:$(0". `: S0P3/$&0$ 0$3/0 0 &6z R'zppF0$03/60S 6&0S Z0  |3/03/ Z0Hp083/$O8 OS   F0$03/5t0S W0  3/   0 3/W? 0t3/0t3/0pd凰Jq" W  'pS 03/ GR03/0pW03/0S3/ '$0W$ 0FL0G$80 0C2/$01?3 ?3!?#;00 2/@ 0q0 00s00$* "0 : 0#$90"?  :$#: `0H#0$"<407S0 S0s03/ 03/ 03/ 03/0x0s0n0|i$3 l0$2 \0$0LD, R$03/ᴡ$03/t  03/03/0t3/W6 0t0q$0 3/$($0 :/0 oPq0 3/200$($0 %:/ $8$&$p0 7/0Nq_>LU>p_>_>_>a>PT>U>_>_>_>_>_>_>U> `>&`>3`>8`>U>:`>/@`>`_>E`>m_>J`>@P`>d`>``>p`>r`>`>`>`>`>`>a> a>a>a>a>a>a>a>%a>-a>0a>b`>ga>ya> ?a>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$OL- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P N!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S zp@4@c ,00,0/0 R,00,0/@cp@-(0c0@ TPUp@cp@-2@02 P<0#0P20C22S Upp@- p@-\0!C !2 Q02(0$! d (0$!p@@cR/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/@c -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R DMP 0=S0@V20V 0  SR0T=Sp'p ZP@ Z  ZZP  )+ P ЍLe>7@- 0@P P0P R Stu @ + Ѝ0@-@0 }P )Z WMoЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0PN@ @0 4/@TP @> 4/@G8H@c1 !0R$04$0/|uc/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ chmdlmdp@-AQ+ 0S R[ xh\0_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0#00pB@\lmdAi!iL cRe>1?/ //0 ?1@o/ c//0/////?  22//-P/6 c N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N c c c c1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  ((00(0/O- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0@cH00S/@-@0  "!$0p03/0 !!(ndlmd03 /0@-$@4 Z< 4 @ 8 L < @ 0 < /p@-P$@4 Y40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0p<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@/E0` wY1017800` !.pW  0000 0 00 `L<`划0@0 0S101ߍ@c@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  Xn101101 0\! 6 SSO-0`@p0M 46CSЍO2t D000 0$0L0 0C0C004p Ѝt!pppV 0  Z 0cQ  X J<!PP)1\Z 0  PP P0  0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C @cc02/0 $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S 0@-0ZCU lPC^   LL& &0/0@cpP 0@- @ |M l Q \\ QQSH0t SC0  !0 @ |Ѝ0@c0!R 10/Xndp@-@P oPp Xnd0 S   o0@-4 0S$ @ Xnd cO-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#  ` t B0  !0 Pl|ЍV@@ 0 ;/P t B0 !0 P$@L|ЍO^V@ccXnde>^ L | "O- p`0F   0 00p(`$  0,!% 0    0p(`$  0!% 0  ,  0p(`$  0, !0`%$  *  0 00p(`  0!% 0 9   0p,(`$ o0$,00 '!$ 0 B   0p(`$ W$0p,(`$ H# 0 L  ,    B 0!0 S   0 00p,(`$ - 0 !0_  0 00p,(`$  0 !0m  0 00p,(`$  $ 0 !z 0  0p,(`  $ $ 0 ! 0  0p,(` 4 0 ! 0$  0p,(` < 0 ! $ 0  0p,(` D 0 !0  0 00p,(`$ H 0 !0  0 00p,(`$ L 0 !0  0 00p,(`$ l0 '!0  0 00p,(`$ U 0P!0@0 0 0p,(`$  @?<Ѝf>c8 2 (nd @cndG-`pMP `  @T000P00p 0@R 0 p0 00 00000 0?o2P0S0 SЍS0(ndlmd A-xM@P`` pTP0HrQ0X 00 000000xЍcC-0|MT@T 0S P`p` TH@JQ0X 00 000000|Ѝ-ndG-锐xMZ- @P`` paT OHOQ0X 00 000000uxЍWep@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/ lmdhmd@- @p03/lmd@-@0 @T  0 !! L@Jcf>A- ! 1M03/f0P `X@P pX0 Jq T@Xn@@@ K9@ p`p0g /?J~]0pL p4|?0$p00 Ѝclmd>nd0mdDc@vcc/@- 40@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00P 0S#020 0{P 0S"020 0nP 0S"010 0aP 0S|"010 0T Pd 0Sh d0J Pf 0Sj @0@ Ph 0Sl 06 Pj 0SnЍ0+Poq!000l0 Pn0Phj`!0@00e0 Pfh0!000cX0Pdf!0:0a,0Pbd 000_0P 0800Pp 0800P@ 070|0P 070 g>4De#g>*g>7g>>g>Jg>Rg>Ug>Xg>[g>dg>f>rg>1g>4g>;g>Gg>Og>ag>lg>og>yg>@-H00S<00Sw0 00000yЍTldXld00/G-Sp@` A S5 S11P0 @D`Fp@03/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0 nd$ndlmdO- 0@4`lTD r0P\qX pY  R: R:[ Ѝ PN Y  L\!TWX D p(p W*Y )  p 0S p    0@pWr P@@- ^ 0P \0 BQ0Ƀg>A-Pp4`@kiP 0Pp 0<0`@P00 (@0 0,0 @yc4WiG-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0;P  `FP@VU0,00,0000,000000/O-0p `0 W W W Ѝ@04"0 S )4S 0"4PS| V1d0 ЍO/ @D P T*Q0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!+0 0 A3A3C?o20 0d @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0; @ `FJ ͂ .ɂ뤈>}g>lmdg>G-@Pp @ЍTHЍb2"0S@3L0j0O-@M<`N@N;@5TpP3:T#3p0 a?oZ20S 0 VPH 801P;0; 0 X0=Ѝ`@ 0 SPT^0 0 0Q0 R0S 000 R!>S>0 jJDV:V: 0 Dc> h>p@-PN@N@ 0 p@0꤈>Dc@-0 PS@0S 0#G-p`@00hTЍ PZe 0 UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 Ѝ@ycO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0! H`P0``>0 BB6*a"*UbY ;0 0  0 P PE 0H0 H B @ycO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T 8GP%@: P @[H0@@ ::S P%0:0PD0@S G Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R K (0+0  VPV0P00 0 uЍ R K *0VPV0P00  0 | Z$ R K (0+0 VPV0P0 0 0(h>hh>h>h>//C-M`@HPT#L ,'@0'4UF/$ 2?0Rr 岟LQ PPPL P `1|pQ  000<0  cЍCЍi>i>"i>ndndndndndndnd,i>C-HCM`PHT~ЍCnRn  "Ÿp"0*P*P l. (}D3SBP 0S(BX!\1pP H [0( 0( y ] rWT3=WGT3gT3@aT3  \Z1!0S 1*B0S0 1F@T1-0pW0p!(?}`1 0(0(1 G R$$)T3  !1@TT0 0 0 0  xW pYU Ѝ@ 4Xq>ci>(h>Dr>Hr>Yr>fr>r>r>r>r>r>AXV,r>i>r>r>r>r>jr>`A`Amd,ndBr>s>C-`GPG@P03/sTDc03/0L30HP3,G?b07@G;0C 00U0  00U0  00U+0  00UH0  00Ue0  00U0  00U0  00U0  00U0J 00U0N 00UC?0R 00UI?0V 00UN?0Z 00zUS?^ 00rUW?0b 00iU>0f 00`Ua?0  00WUgoj0 `OU04L ЍC @m~ ЍClmd@cxs>(u> P-`@P p!c pЗ!P  R $LpL 4Ds 4/!`@S`!W , ,`! !oDЍ@cp}Reset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! ~!oDЍN  0O   ! "`"Рow>Ā>>><>l>G>Z>>C- @`p(P  0S 00PAP 00(0SZzp(Q 00(0L0 Ѝ@0?  0 L0 00S 0 qt 5  p$`ꆁ>s@-@ \ \P`t 5 00 `$PЍp@-1@``QPM R' $ pz? 0    !y060y$0W0y40(x0y080L00yЍ@c>O-@D@M0Ps3/03/10100S  !0 0Co 00嫲Š4041 @T 00 04/P7[ 0n`S5 L0  y@0 v V%* Q ( R 0R6BS 20000St 400 0(00,008<0 N`1000 :S0L0L - 0Q0 1 ,212:+*B*R8 L>; T S3 RLDLOoB@ 0 s P 4(S$ [009/y 0S00&R ! R &R h!h R \A@X1T@@@(0 0 P0( 0S $N R [ (0L0Ѝ0 xt \40 Z0o Z ZA``PzO@0 m0 Tx 0(0^ 0Y ( Xlmd@c>hmdDc>҂>>O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0  P/ t 30 [0 0a`Pzo`0 l0 qx 0 0 0t 30 0 0$  00@4@>0  P0 @TL@0* R @[Ѝ@chmd>O-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ?oT20S00 ?oT20S00 ylmd@cddd>00P (031000Co//,c@c!:!P/ 0 00S/@0. 04S/Q0 /0,c @-3C.@-3O-0@|Pod0*4S/0S0 0 /000/lmd*4S/@-0@03/0BN0lmdQ(QT0\0 )Q/R0 S,0@0D0//S/0H0lmdQ@-@ (4S80BNX03/00)4S0<03/0)4lmdp@-@0Do A("(RP p$$Ph$! ,$" \%R 8As00CS0p0 p@ s,codqd@-@|0T0S$D 0SX 0S@@8<0QD$   D$ @@DD,ccod0 04Ē Q884/0H4S/sg,codT H$R \g@-@@8P 084 $ 00Q4od,cDc@A-P @`pTQ 0 "A2P 0`PR  V`p@V0A31003@c0P/- R   B B  P^^ $ B$ , Q R!! B B!!,cP/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  ,c0S@0S//0O-P` @P\Q pQ00ЁU00SE R㴑; Ѝ ^^p1Q@` Wp0U0 WU0 `` 0!&Q0 !SL   0E&  @T00 ЍO/QᤠT ``  U [  R`` `!& 1!L0L  o@,clmdodG-1pS@0!R00R0P  \  \ 1!1`V0`0ó?0`QP 0  ^ ` 0S 0PR" S 5YY 0S 0h0hS 1S 0h   PU0S0`000Ȅ>,cp@-0PPdL4S N@l $60L0V L0?4`003/03/+H0pod,clmdp@-`P5@@<@1t+[TP_X[_P`\003/`003/03/`\T4PX4P__pcodlmdp@-D@[PX_0``003/03/`X4P_podlmdO-Ph4dpQLP4Q9 @䀟䠟fU*%*1Qh \ : 0010?0@03/@0Ph>v%!1PLP L0]뚟@03/@Zodlmd >/O-p64M@00U6PH4S 0 ? 0` T"i0 01000X0000Q<6T =0P0 +60$00$ 0(01,0(010Sp P p ^?pV, 0Se>O-@4M` ᦶ TU2T 2x4ST B>0PS0 4pp0V :ͶW @hp&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% =P <00E  Tz[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sj0(4S   0x W4Ѝ,c@csdcO-@p@P` =PP`<` յ  *60Q000  ԰ @03/00 3/03/  0P4 0?PUP'S 0h<0JOT00  S  S80d5 ,0L42 S0`5,clmdod`0@-0@D0PSM+PЍ00 0.P ,40 U0*0,4e@O-@pmXT:哵003/OU$ZZVUP!N`$5ᔠ?`U0 0C0v<P @0  <@0H! 00?@03/003/J`,clmdodA-p@`P'$4$*$00SH(DF0@00V@U($<01S  2# R+$60#X 0S(H$HJ$J@L W000 ,c00 p@- 0$@0P000Sp`H4S d0)$4$G@H P4brh5hE000D40@@DDpod,c>O-`MlP@ጴ0I 0000 T : 0 S:0SMṴЍO}$jjf V `!vP@ p$5?pT*. , 0 ; ᚯ7뚯R0 <+I0    d{0  R!* Jp +4S 0,03/0+4ЍclmdO-^PPE@p댐匠ZT:OP `fV`!P@ $5?0CT*0 GQ!803/@ZlmdO-@p$M`!'<01S 01 0  000Y' ^'v00100PqW X [  G E:P H廳 <WP 0 P$Ѝ @00@0 00 0ݳ0皿  w뚿$,$$0 !R3 0?  PX:P $r <P 0 @00@0 00 0垳0皏   8뚏P R0lœ\l% 0S 00 Lo0 @  0po 0 )ocod>؅>0 #!R/080/@clmds@-@P' %60H:`P 80 00<:8Ѝp@cO-q3Sa100@-4S[0,4T倁勰U !0 PU ,$$#2$$0 SQ8 0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$  2/03/00  !!000T(4xDT U0-40-4|D Ѝ|03/VBn@c,c clmdhmd10 P0  044-4/@c@- 4@S 0 4cP $0T V0(4 0@0/,clmd@-$a  %j @K 0 4$(4K@T R0D4 p000 00S 000D40P0D4q$TPp,tq0000'0$4$0!*10 ,$020 0 Ѝodchmd@-@0 4 p@-@Pp 4S u0 4}FP Pp 1T 0(4p1q*2h$Tܱ 0S0Q D$,$ ,$ B  B R @@TQD$h0 0TX0x$R x$p@ 4iDPD$,chmdcodsd@cud@-@P@FG-`x唱PdαG@@@ @pW0S   帱YQ @T0,03/03/YP`P 埱^ᛱVXp0t0呱U4 (0C4 040C4 0 @ycc,clmdsd@-@(Pn@#>O-0P 0UM0 0@p0 0 0   P@ᙱPkIEPUЍ0    0* 0 100R `0A  S + + 1 L4` 0 0 V'! B!! ! R 0Y0 0 皟  *0뚟 0  0 5  B    S 00 "cod,cp@-P(,哰@@@ <e@ɰpcp@-P',傰@@@ <T@帰pcp@-@p@墰p@p>cG-0X`TL4 90?003/03/@`p P 0` S@03/@@@00?003/odlmd0' 70/odO-xBMgV<*dZʀ 0! $@"08"0"   !&j aw0W:Q<03/,03/03/5 0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0od@cdddclmd,c(wdp@-PPP@}$F@0S0?@003/0p@/hmd,clmd@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-4TD,M`w|T0 0=$4  !0S2 $ ,P$ l&20PYplh  0000# `ˁ \ $4P$ j` V (P jb<03/03/03/2 x嘧Ћ唗P  )5? T唇\딇(P@nl(5? `X唇 "0S70977'3C?6C0C#:%. "&0#2>0#6!' 7}D h@p1q $4!*$010y,$020 0@,Q,1 00C0@@ @@'d1 0000 @@]0 0 000@@ @@@d+0P000@@ @@d |-<0,ЍO/@c,codccO>{>hwd>؆>lmdxd>ndcsdhmd@>l udhcsdP qd!od@c@-W450@ M45 @G;b0H4xdodO-$M,e($e 1@`PQPP(PE~Qܐ(Vᖨ(:$Ѝ0 j@Pk0 0000009  1Ppp@W T:`(% 00JpodqdEcTldDc^>Xldu>@0!S@0d4 S00h4 S$0;00;010?/odxdp@-0`S0@LT!* Sp0PT S`0dUP0SHP,-k$EOR0?pod>‡>-!01; 00? 000$,cO-~0PP04 kp~R@p R R1!ěd`V Ѝ|!t1d弋Ld!\1h帋PV[#0$ ! \ /FVfF<R0 R  j P -$%/("(VR#  U뚿HXhF /JZjF>xdod> !:!/ .,cA- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?pxdod !i!t!G-`@0匀pB00>0>0PT0?0?0000?$:aP(i$5?[%J c ci>O-@ᨐ娀zT:00ЍO/ 06Sx`1`!-P$5?PT:0?L0 HS @03/003/ Jlmd,c0$4 /,c0  ")//0 !Р!/0 ! !/p@-PMG7P# @,`)#~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍp8cHldc002'0 S#3/Hld 0P/Hldh0qp/@-9P p< 0BS B 008ccO-@2@BM<03/ sr $R0S0  "S  & PFgЍOp@g6`Ph 0Se 9@4gtЍO.giP;0Q@p1į0 00S\>0p00 I06SP1Ag 0 G0:0 0 0 0@KLԈ>>>Hlddm>>>>0>`>>j>>?>J>s@-0P `R0  @P1 00 @Ѝpx0d03/00 `40P0  @P4000400040@@x>lmdc/0 56G-p `P /+6~M0@:0$@P $ 6U 00<0 0@0$000 0 00@D@4 //C-H0M00p0'h00LP@0` 0%&x00@`@UЍ ~0 00 Z|>3e c>A- tg0P0>0\ @X0`@Dp@ u00 L0000L0脉>> cO-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJdeЍ褈>lmd>0/c0/ᰆd0/ᰆdT0@-@0 @RS ,0 Ѝ0000갆dcl0P/0 S/@- ^@LS:0 0CS(0 S谆dl0P/0 S/@- ^@LS:0 0CS(0 S谆d @-Kh0 0耼c0p@-`!P L@P$P`=00@p@uꀼcA-餀`@/0PU |fp R0P R 0Lf h O0$A Lꀼc>>7@-Phd000@T hT 0PE0%VE$ @ Ѝ00S 0ES:@ꀼc0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/A-(P`p@P @ 0 40PT`\00XpD0 0L0$0h000u3 0@0⭨00S/cR>p@-@P0Ppp@0/cp@-@P0 Rpp@0/c@-@@P 000T0X0\0`0d0h0l0p00Pt|x0  ]^>@-@]@:O-P@M800Y*Ѝ0 S+ 0R'`^0 p9P S0 ` 9P H0  9P 0p` S @0P#/////|/x/t/p/l/h/d/`/\/X/@-PpeL/H/2>e>o>w>>>>>>>>Ɋ>׊>>> >*>">j>0 8< 0/P0  T0S0CT0/ 0S/0C 0/M 0@ 0S*0 0S*Ѝ/A-\0S"`0PSp`?X@ 0WA @TX 0⍧@0VD0W @@0@-\@M0SP P 8 00  xVA[Ѝ0@ Ѝ0踆dt>@-@`0 | 00 0H0 S 0HP 0p0040P@ޓP L e6dЍp{>do!p@-@P0t00t0w]p0S0p@*\p@-`D @@?\P0ܦ! 0PQS0  @ Pp@0 0S   0 /0W0UG-p@`00⹦PY0 S<80  Z7   3<80S.8倀+00W00զ<iWPP+ s0W@@8`<000⁦00x0W 0P0x000⳦W P8008000 \W00_X00C0 80<80W00⏦00 03/0XCbd͋>p@-P @@ 0R8` 0x0 0  .X00C0 80<800S80 080\80 080p@\00Sp,Pp0p@0/dp@-@P4`V0x0Vxpp@05L00L0/L0CQL/80/l\8 @0 |Q 0d0#/@- | R |080H^|   @\H@^ RQ @p@-@P00⥥L00Lp@0ܥp@-@P00▥0p@0ͥp@-P@`0⇥0Sp@0⿥800800[p@-P@0`03/0Sp800800 [p@-@HP|5a020C0S0P8ՑP@(aUpt>>A-@`@00S>l00%S P= S< SC S? 00 03/l<a6Sn0m o48` `zpS qS00 03/n`6Soqnp2p Ww03/pP 8008080@Q P80 PP8 <203/P00 03/1`6Sb1pG Wdp\ `0R0C?o20S0`0W P8008080@x :RP P  80  x %Ry R P Px0)Sy0SP80080808  PD0S0CPD0PZ` D0S T`P0 O`s0SLJ`o`rpXC`s`pGs 0R8:`>׌>>>P>ct>^>`>>>>>>40: -$M00  (  0 0$Ѝ/'C-$M`P@p }00$0 pJ0 0@ P0 S <6P J0 00@{$Ѝ'>@-4@$MJPp` H0040 000`0 @@p[$Ѝp@- M@P` -00@0< 0  ` 00@= Ѝp`'@-@ M , (* 4  0   @" ЍA-(M@p @`PZ00&4#0D0 :00 0L00H0`00p$`(Ѝ-$M(000 ,0 $Ѝ@-,MPp` @U00$4#0@0 :00 0H00D0@00p$@,Ѝ@-@PP n0P0O-4,MD(,00C#  ? D1P100@00a0q$00 09 0 0`P@PU=,ЍP|P P0U  RTP$ E P!0  ` P  YpV Wp0PE\q@ `A-@p0`P0P0tPP P0t0p0`t0IY0A-P@4`pVd0ⷢT# T) T@t`@H P 0 S08 @TVA0Т00S 3/|@T Y\0Td0Sp!@8 0  S   8 d  @@@ P 0Sdp`0WQ Q QG-@@P(M`0Ed0Sl0Si8 00 03/X ^?0n`0\SA(]$40X3/p(Ѝ0Z@ 80 ;808pppY 0/xz 0p l0  l80Pp;80夐 Pd P0 d00 03/<]0d080p 0d0S p0Y0d  R 003/p&00 03/]d0S60(S3@00D0 00 R0B0CS$000 03/,y]0$0 p0⚡w_0d00<00<0H00H0P#pQ0á`D0Sp 0CD00z80P0 0d! \00'0⩡|pPL0$0L0!0XD @P D0S0CD0pp00 03/]00 03/d]d0S ?0n0 0S 3/0%80 >3>cV>h>z>>Ec>j!>ҍ>O-q@`P\ d0P0C?o2?3\0S0v`` V)`0S&0 U0-d0SpP P 0 :P0Ԡp W|0Pt0Pl0Pd0P\0PT0`/0@ 1/0000q Qt>P P P P P >/0( 1/0000t>P@- P P P P (<00 010000ꀖt>00/00/G-@0]x0S G0╠|PU @p 0R,L0S)80k&  80! P(P  0v 00P80 @00 03/[Px00x0t00t0V R00 8080;80 @P0S  RT0`F6T00bV0 0 03/ H[`0000' }c0?o `c >I>p@-@P4`V0ӟx0VCxp0 x0Spp@`p@-@P|0⺟0P 0p@It  t ,Vp@0p@-@@`P0❟<0 0֟KP0 0T000 0T0@ 00C08080;80  @0 1T"T <08 0<0d0 0S00L 0L0d0S0S80@;8080 p@0⛟S 0@0Ud0S0⋟p@0000@@G-L @p@R` P0S P1`SRL0003/<0\ 0<00` d008 80@   # 880   080p R   080PP9 0U0 0$3/#Z|(788080 ! R"  R R 00 03/8AZ\ 3/Z#0 e0ƞ 0\0⽞Y U 0@0 03/ZVD@00KT<0 0Qp Z 0◞[&>>|>ю>>A-0@S 3/`0⅞P00P0Pt0US0Tp 0t003/ 0t00⦞ t0 00!/@!b0 0Pp 0t00⇞ U R00 0wppT0nsEcgfff>A-@Pp@@ @`0SЍ S`P@ 00 0X q- ^ /$0/p@-`Pf2P@ $@T @P  pp@-@ i2PPp$0Sp p@p@-8@Pԝ@Tp0U @갇dp@-M@PY $0HS 00 03/Y$00$PU !R00 03/wY0^0 @P` 066 99000000PЍp@>J>u> u갇dA-P@`h0C10 @B1d0S10\0` 0C 18000`0A0☝ lA!(0C1plAq (Cq00 03/@Y00000 03/d Y >>>O-Mא>p@-P`t@Tp4WPd`s@>C-`p䑟`0S Ѝ @@PX  008  @P 0SM$0SJ(0 0S0@S $(8> P? DZ 0B F $:dPj 9_(0eZ 0 Z 0B  $= 0PQ PJU !0_AeZZ 0  ZZp0P0}"D00@0L LZDZ<ZQ>>(>1>:>MbB>[>f>x>>">Q>p@-P`@`0Sp 0P 80 @   R @R 8   pZ@z>A-@p`00Sd0SA3/p@ l0!#B@ T_ Q@+P\ `Q ` T\@|Q@tQ< D0SD 0C\QD01TQ8008080@0 0Q @80 ( @Q00 03/V8008080&8 # P D0S P0CD0@PUT @@|PlPLP@00 03/lL@U @ꋑ>>>̑>>>,>F>e>V>6>>>i>@-@`pP4P !P!@0 0L0 V Ѝ耒>>@000  00T0/@-0@0!0L 01@ @<00 2$0S8$0!@-`@0P p 0g! 000 |\Ve2P0210 @LV0 $DV Ѝ@!1 Ѝc>ɒ>>A-@P0<`  pc&8  0 000L0 P "!0 ,V0d08Ѝy>A-@0!< `Pᒃ(p 80C 0 $000 U10S W 00 0 p'$P0$0H1L R 0#3!0 #31P 0 UY80d0Ѝ0 K8 0 8  `\ Q  C40l0@0d 40 0 d0Q 0 XU0 l d@U$8!c(>cW>MbEcv>!>“>p@-PD7@ 8p@l\0O-$M h0 0$ `0̴@< pP  0c  00 XU700S T 00P00 HU@+W 0 0S70d0%t0S 3/ 0 $ _020 \:/Y L0  0 pY `7$Ѝ 000P00 U0d07x0S 3/}? 0 ,03/ ,0 3/<〓 ,03/0   C$   0T2 Zi 00P` \T @T04/80 00 0L7~0 T0I Q(0 T 儀 0 8/(X0 000 0C00 ` :/H0 pT0I Q(0 TT 0 `6/(Q_0 nT0`0[, 00S 0 d] ,03/ ,0,3/ W OT  0B$ dl  \BT604c>>H>b>>>Ӕ>>>.><>r>>>p@-RP@ ` R R0 <T8Ud /p@0d0/>>p@-`@ 08P]P Up] z 0< P 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-p0@PW@0`@0Lp0 0 SP0 0/@P0d0A80帀 00 0 00 0X00\0 P040h00$0P 0/Ac&>L>O-M0`L 01 >>>>\ O- h0,M/0 p0 `P<0@08010030 } 008 | pR50Su80\ 4 0\ 89/t0SY0 $ _02\0 9/d0SO 0L $0000 0: P0 0 00 00 0c $000 0?! P$0% (@+0H00 R%R0d0%0l040\@ 84/ [f;,P,Ѝ3/0040\ 89/ [80|!L0Sl!0 0!!0 T!!1 t0S 3/0 $ _02\ 08/ $0000 0p P 0 S0 8   #8  @000`0 S8 00 0 $dQ0d0P0 8Q0d0(cQ>t>EcMb %>B>>I>A-@ Mp0HP   ` 0 4   ,  ,  P PPP0H00PP080PP0p  `( 0P` D Ѝԗ>!,!(!! 0R://p@-Pm@f`bP0` P.p@0⑕A-`POp@l0S 00PP}?JJJ4)P0*0 Ec>p@-P(@ P@ Jp踇d>@-`@0P ?PS`@_S`0\ LS Q 0SP08 X0 S1> >a>h>o>c!du>>!8@- (@0000hcX@- H@P 0 0pP000hcG-Q@M ZS0a@DvP 0!0T` 0Ap 0 PR 0@0 P 0Q @  P00+SЍ>Θ>O-p`MZPPP3p@0Dh0lJ 40@ W 0 s 0S 03S 50 * 0ES$ PPl0 , &R8  8 n  H  R 0@SP0,0S[l0 P0m0P3T0t0X0|0\00`0n0L@dh0000H PPR8s0 0000 00  00@ 000000000R 0 0SS ST 000900000:000000000 00040 P 00P4P 000 L0$%RPPP%* qH0S 4@ 0000000L @ ЍP3/Pf ],0SdY0000000:00 L*RK> >H5!>00S 0L0Sp //O-qMp P\00C(0w!0`p$0pG3 3100 0P0(0U ЍQP\0S(W`0S$pd0S @ 0`@@D@H@3`@P0D@h0$ 40L0P0uN00SH0㴒 R6_0 (@0*8G0 4"<42@00`0 0 @@B@F@0P0a0 8< 0 4 Z*" S0!@%61@C0060@,0001000 0 @R3 4440 8<  ,4 (0` $:N04, 000, Q>00  1V 5&0S` @ $@+ $4"49#9V0@0$0 S00W0S  T 5  P)  P @W00!@cU >'$>ē!@-@ @A-`@P0P p Q0 ;0 pP0V Gp& X R00 D ]H00l똥>EcddćdA-@aP |0 R p T T X0T 1 00AA0A hcUU UP/p@-Q@P P0S L Pp(>6>R/0@o/A-p{P`0u\0S @P 0S `:A0❑p@-P`[ @0@PPፖOFFF4%P0:p 00s @ S /Q@-@ P)PI0 @00^ C 0 0 PЍа>ʰ>A-@P@P`0d00`0eO\O4l%P 0pFFFpp0 P\OP\p@PWA803/@>>>>>>Q @-O/7>A-`(M0Pp 00 P40 040@0 0|0 0@P 00 D0@(ЍdWO\H>!!>0 8< 0///O-P`oL1@ 0 PP3p11 !)0   0 pWWhSh0@L0zv  eg+l Ѝh!>Դ>0@-,MP@ j508 00  L  @ 00},Ѝ00up@-LA0PH1 8 !o.80080f p@-,M@p` P0G00@0P "0D0  #0H0 $000 00Lp `!P;,Ѝ0u0@-,M@P K08 00  0 00 L$P!,Ѝ00up@-(MP@` [008D#L:8 00   0 0`B(ЍpA-P`P@000S3 S  pf xf | WY0LQ0000P 0X00080 080MP]N0 ᏔPA,NH0 SH10H1><>X>H>Z>p@-@@0PBhQpP`0U0$00p@fp@-@3P@0lfp@0&fA-l0@P~0pSSn0@0SLx0SIypWF|`oP^1 0n00Sx0Sy0S|`UPD0 0n00Sx0Sy0S|@:P)00( 0Ecj!@-@`Pp<<0$M((0 00eЍ(cA-@p F`0@PlP L18 \9@L VS(0 0`0iЍ(c@-T0( P@"6 0<H1 (0$ 4cR$0L1@(cp@-T@P0`S 0S 000 0000S 0S000 0000a0Sp Rp00  Q0S0$00Mp@@- 00 0 Ѝ|>0@-P$0M 0 0 xЍ0萯!!@-(0 0600iЍ䐯!!G-P @P  P0 bbH0$ H08<06000000 0(0T000$0@!A-(M@Pp `DB00@00>00 0<0T000 @0L@p"`$(Ѝ0uA-(M@P @p`C00'4#0D0pT%0:00 000 000L0@"$p(Ѝ0us@- 0@P La@0P40   H0b",4b4#04!400 S0S000Ѝpp@-M@`0La Px0;K?4X0 X 8  !0 X0<0 00 0  0ߍp踵>0@-LM4 $Pd@ 00 @0LnЍ0 @@00@0LI N@-S\ 0000L Ѝ0 0L i NC-P0,M p` @P 0 P 0S! Ġ"Č  Ƞ,ȠH p `  P ,Ѝp@-0P(M ``P @P 0` }P 0S $!$("( P   (Ѝp0@-,M@P S00$ Q>4PT6 1Q0 P00P"0pԀ(80 pH00PN0S A0$0(<@ D0 pl0<PtcP@0cS400Ѝ QJ;00u RƵ>G-(M`Lq@0 P?`aL0V SH1H 0㩜H1  PP P PU Vq(Ѝ-PP80L;L  0PIPX 0 S 000P ~P0S $!$ ("(R  $(  R%uG0 0!$+PX!T1808 080 T1 0P1$ (0d0,0000H1 0H180080    ^P;L  0P 0 |>F>O-$MP^LA0W 0R80 080A#@0⇋$Ѝ@ $PJ4@pd#dD0[h0030#P00S&h+8 4 )  ``&  0  0R0pR@P0 W0 0N 0+&*(0'4a `0p0 0D040PT`Xp\L0hP@  Ec !0uO-$ `p@<<4!44Md@H 4  `d0@d/P2 MF0ZL00 T0P `40LPp#4"48#8S ᢀ P [h5 50Z00 ^00pX`pPN0 4d#d5h&hV`` hFh` &4_0X0``P30F c `$0 ,($0S*/o\" RL\  LRࠑ (0L岠RR 3 ##@000 0000 `0Y Ѝ R R pRoXQ 'Q(0RRR 0<0㑓#K0RA#ᰐ 0 S` S ,0A(Y X, Q   $0 0C$0Q X<0RR!K0R0C1#0S  P Y6C0X00 ^0 0pX`pKP0 $4"4P"8#R#hB#< _0 0X``5P0 0 p 0 ᰠ`FV 岠 RpC; 00 00 p0l 0*Y Y 0 \Zp@pG\ \ 0`F7N &j4"48#8 S㴸͑ f040 g04i 00000"20 00 0@0k 03 0Q<<< 50lp tx| 0uRCs@-0@ CR 00  P0`P0S L140  Ѝp0 h0C1Q   L!4  l(,"$l$" A0C 4"40O-MPO30 F0@pᰣ=)@K0R0La8@@ @\?W Z2C7CW"0CWX?WE 0 0 0pCbP@B0 0 0p?c|GrGWpp>W >W >W0d` @00@PL140 0$#$  4@h>W ?@oT<>34ߍ$>W >W Y?C0CWT ?=W =W@P`PU V 0 @0d0@Pf g0@0C10 0d0@Pgf0UVJ@ύP?3Q#QQPPL@=W^@D`80 @P4 0 @PN0dp0 0@P80S  "L !$ $l("(          ;W ;C?CWG 0W ߍO;W@PM@ 4"4e xE0d0& c@pd c@d@!cpdcc ccccd*>c(c c<dB>@ > Cu>L>>ٶ>0u > N e!R0 d00D H D k0j0  d@Dpm0 0 0)@P40-pz`P  eR0d00 d@k01#n 6:00 00p000 0L@P+[ z dpE R0D00K0?0M0:00 01D@00 00@P6$#$("( 0BS 3y,r^z`Ps  eR0d00d@pk0h26:00 0L2 000L0@P 04$#$("( R@  $@.z,px t pF0,0:02 @ 00004@P0 $4"48#8RS#00@ӑ;@$ 00@P$0 ,0CF0,00 30::03 0000 @OPi 0 S0 <   0@<0;0 9Q080"0$h8@@0  d0&@P 0S  y$  G $:$ F 0L 0  D@P:   B# D# F@K@#0 @ 0 L@P #   B# y@P T*04#!A 0 (Q(0(Q)  +!Q0Y    +!Q"00;000 @@ 0000;;>0>0@0@00 >J?000 0<< S0 00)S@}7 0E;C0D00J0:D@0  (0LM@Pe+ *00C8#833##Yfkm 00 10000h0n43i0g 43oj0# b 4303000 p2000@ }0| 8< ~ ,4 (0 $"000 000 0(0000ߍOp0GS W Q )0GS0*QQA9!31  ߍOCQAQ@RQ +QQ 0AS8 *>0AH 8#8# 8d: W 5/QQ AQ B0ASRQ <@ d{00:0@  d0p@Po0W?00o000:0<0d @P W  WߍOg+QQ QQAA;!31 A AQ A e*X0 d0d@4"46: ,00  0 0 [H u0S<0 8< 0/O-P`L0@ PP5) @ pi1 !)0   0pW}X0x 0ⲀaWaᢅ Ѝ!h>>p@-La(MH0S4@LH1P@0H1 500<0\ 000P0 @@(Ѝp꠆p@-9LQ0`H1  @PH1`0 X>H1@0H180 .80080,pз>@-H1  @PH1`0 >H1@0H1з>@- 04Dep@-@0@PH1h@`0H1QpP`0U0$00p@iWp@-@P@0Wp@0WG-@P@80P0p0Sn00Sx0$Sy0S80 00 03/\f;80<80`l0~0pSn00SFx0SCy`V|pN;P0 0h`n00Sx01Sy0SO`V .;0V8008009(^`P` %>0C800800|`7>E>Ecj!h>@-@`Pp<<0$M(p(0 00`VЍcC-@ Fp0@`MWPP P L18 P9@@ WS00 00pZЍc@-h0( d@"6 0P+H1 L1800S (0$ 4cR$0L1@ec@-`MtPW p@T 10'*"*0*00(00,00 $0$00Ѝh>p@-|0( x@"6 0dLa80 80000$00p@(P|P p@VcO-PL,MxQPH1p0H1 `qt@PP`D  1 1%H0j `S7d1 00 0`0 PP)`0 hl0Pd0\ ` 0X 0x10T P`$4"49#9003H10H1Ft,Ѝ pk%0 0eX0P00`0 0 Ppz`P`VSP N@-LP4 D@  \\ @@ @00L09Ѝp@@ @ 00L0pC-`@pLMP0 00 000Y0 (0 0P XLЍ0S!04"408#80S 0?0S 0Č 4,48#800SQ\Q00 $>4"48#80@- 00 0e Ѝ䨸>C-@P@@0$M,c 0`UЍcX p@-`P0 & P<@P GP  0p@UpcA-P`p%0Mx@PЍ&P L180 0040 00000pUc0@-P$0M 0 0 v~Ѝ0!!@-(0 0600g~Ѝ!!p@-@Pj `14L180X00X0pO-,DTM$ F0@ px|()0@4RLaP83W 0CWg37W@ B27WE  0 1VP@  0 \3\0S00@TЍ QTЍO 0S0`2X0 \0@ ~@P80 TЍOH0S0  00@0 l@P0S(0$00# p" ppS40xx0   00H000 IP0S(0$00 t|pZ H0S=0  `00000 (@P\( $ 0000S0q 0&?00\0L     0 @[   0 k-@P H1 0S H1@P@0H1@`0H1@<@:@8 @6cvdX>pO-4"48#80C-1@SP\Mo< 0|0p`\Ѝ4 00000L(0P P00/ $4"48#8 0 L P< 0@00 005:5 020,30(40$10VWSQ! p`5 0p` #$+4"8  > C"X!\1, P!(00 T!4 x!2L0^?0n/ P0 0p`| 0# 0(0,0002 00 L(0$ OP`_ Pr+0So 000SV Si ,0p`b 201 483 00LP<0'6#$+4" H1 0`=P0 (P00 00 0( P0S"+0, 4"40 8#8S0 48L1 80 P-  {P&wP#   3/P p > NI>C-$M`p@P ⨁Kn FX409400000Sv S  O! O   x0LQ0100P 0X00080 0806h|740 PP ^Paq7U< U< \hl!<# ! \10X10P1T!N7x1S \AG7Q VB7@7p>7U Z \0\l}PL6$ЍH0 SH10H1rh>>>>\!!6>G-PLap0@P<?PQ$0U S @ @L @PP@  P@@ T 880P P800Y .P.PP 080P0@-3@PdM *QL5dЍ0  00R( 0 e  04l>>>p@-P!@0PS ?!600#Q0SP(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P14 X3P@-lX3@  T1P03/X3;X3O-Mp؃@W13`Ѝ?0P X3` t0P R` 0 Jp$1$@ WJX0P0/ r@  ) B$ H$  ))`, 0徲4 #(08 <#T! P2/P!Y < "`P!BV0p@@0u>A-P1l@P`0$S PDPѯ2V*2@8pV4 !$2@TA 2غ>>>>O-(`pT@_[00P1P*02P1P1 p 4 d$t"<402X#  p3`S002ձ02ű@202(0@P<4T103/Dl0Q0XN2TL2 HD@D2,#400lc\>>>6>J>\>e>@-\@GP@NG-pPW`@(  8 @D (,$D00PT`H00#AD  (,W00 02X3  D(0p, 0 Q0000P0S202l4S P10  W0 202 0< 0m4S P10  0S2<2X3@20202X3 0<2X30 0 2022<20RoSp40p4vT1P03/GuG-p@RouP1P"hP1p$0 S 0!R* Pd0P_POP08 u#PCuEc0"p@-R_@ux#Rp@ud0x3T-p@-R_@zu#Rp@ud03T@-@`Pp<<0$M((0 00LЍcC-@ Fp0@`MPP 1P `3d#0 X3A> S9@A WT00 00pEPЍcp@-L(0H@P#04`X3 @t3$0S$@p@wc@-`MtPp@T 10'*"*0*00(00,00 $0$00Ѝ舻>p@-PP@000$000P1# 0P$P L0`0P1 V`p@Z09SYS! 0C023 0tQqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`n괻>>11@@p@-l0( h@"6 0TvX300$00p@PP p@ LcG-@`2PY P1ЍG\ D0T`0"R0L0Sl rs0 00000l R!//Y 0S<00L0S,3d00!C=ЍGtlq 0 P1 ,P *0H P1$$qP R  qqqx3 d00xC0s00 2@0S *"*00S 0S$00P1 sp40Cp4sKЍG.Klca>L>b>e>>" >7>F>*>T>d"Ecz>p@-PT1P @0`3/P P P1 1T1 0P3/T1 0P3/P` P PP10S p( L6@00;000000 e66P1 p衼>>p@-M@ PP *l0B8#8S 00܍p:< 8000lP!Q     8@-M` PpP`-*0B8#8S) ' Q#P10 0,00@400300r2T10P3/P1+4 P1` ߍ-`0uԼ>@-@8  t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@p@-T1@0P3/PPX3VP <61T1PP03/pX30;X3>O-MpPb`@ HQSr 0pdT10VP1 P1& P1  xcc/=,)0<1 PE 0 p`>I%'JI>i )P1  oT L5LMwP<0 pPFL0 $0,(p$  `ͼ0P $00Ѝc moP0Q Q P\ P d` t0PtQL1S 8t/0T | s| 0L1  |00P!00P16n /?0 X3<X3n?0 X3@0X3X3|w /2 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ | 6> #W?0D0Y?ⰰX3@0 D ?i0t# D h | \0W tLK0V  04E00C0A0t#/W?0Y?02Ϡ`Qpp3tL lT40 ,  p 0Q$00 0  (pPpƻ0P 00' E/L m440 , :  p   (p$0 0 0p奻P 0' EG0L1H">>>t/" /">Ҿ>>>>>>>> >4>P>R>>Ľ>ս>>C-@P@@0$M,c 0`HЍcX p@-`P0 & P<@P xP  0p@Hpc0@-P$0M 0 0 qЍ0""@-(0 0600qЍ""O-hhS@ 0M`L8<X3 03Z p 1CZ 1Z  0 I`~2Z] 2Z0 0 0 BPq 0pS   Sz*0Sw <0 t00000 00,0 :601 00:60 0Qq0X0P0S`  `w uBnQ ,@e X00X0 `@帔0YP P!!0S`ЍJ80 ,,ĠჁ ~R`0ЍO{ЍOЍO 0000100000` 080,041 P0`` `cvdndQ""A-`0MX@p `P\ $0HP 40 000p0`0HЍlccR/00S  00s  @o///A-Pp` -P1~0@,0d02\0!40T10P3/P1{ Q. FP1Afl>@@0uO-p @ 0 ,`P[xpP1 !)0  ( 0 P"URF nT1߿P 03/   =   鿄    oGO EtTU L0t4sF n0P!0P!0 Ѝ ">>@-T1@0P3/P UT1P03/p@-PT1@0P3/P00<pU0   " ""   00H00D000h0>p@-2RP0@`2 R R0L00QP0 <0L 6#p@ /0L00P0 *+>>p@-P@` Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@`DMX(h000 P<0 $0O YH 0 \0p 0+ p t0S 3/0 $ _02\ 0:/ .3@ QP8 7P  &3@  T7{P80!0d R2  R00p + 3\ h0;>C>L>U>Ec %0>>5>>>>A-0<`"Pc&@p' 0S 0q00 '.n) 0 0S0L0 zc 0 00X0'<0hPX ` Ѝh000$00 ['x0S 3/ gP 2  L0 C'  p@07/8(0< ,0(000,4000 04 @ 0000CS00ӝڰ2[ >B>s>p@-@P0 g  pR/ 0 0Rs00#/ 00 0/Q@-@ * *>>Q@-@  *0*>>A-@PD0S0D08 R0p`8 RS (< `V< < 0< X X <00<00 R p0>A-@p 1SD R8 < #" R0Q <`P\pj`00PPjK 0A; 0!pdp@-@]P0 Rp   8 @-0@\`\P 0A0 00p@@0 @0Sj HЍp>pd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-  MP@0 `Y00 00 0p@ Ѝp>$=" 0/@-@ 08 0(0!3R@-鳒 /@c@-@<P80y 080<0A-`PDP@p80S2 0Aop0 0AT*P <00Q@Q<00P  P % FA-80@SP <0Sxp% `<0S<`  0(S8P<  @< 00A-P@h003/P` P P>Ah003/pW h003/O-0P`04@T p p 4 ЍO  0S0 00 0S     0R <0X2)QA    Q!PX @ &fP 0\ R 2/P| \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    PP X 0R{ R\ ` $ @` >aꀈdp@-@P`  0B 04@0 0#p@0`0S 3/ 0 pp@ꀈdp@-@P 0<X00X 0@0 00S` p@)00X0S0X  0@ 0 0 04 0 0 00 R0S 0=@Sp@A-`P@0pSVP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <AA-@p`}p0<00P P vh0 03/l<0P0 cA-@`帀p>A-P`0 @T\p&h0 03/@A-@P`Q p0S 0SA 0R 0X00S0  h0 03/ Q\00 00)@-@Y@ 00C 0/G-p@P" U  U  U 0  0; 00 0AG<0 !8#  + ꀃ %$ `` 0`0 0 U  U#  U0 03/08 RV < #"0@- @m0 0Si80S0,8A- @$p71`00 1T05 0T6 0PT 2C7CT,:0,X5<0 R 4S @t T``@dpV<04#P@P -Hcξ3A 2A4Ap@-Pb @`0T@ 0 <0S 3/@P 00C 06pC-M`@P`}%$@P40S    pᴀPlgf00ppf5xp `d0p'S P %0@ @kP0ЍC%Ѝ>c?"pd>R"lM"|?">T@- Dy@P 0P000Hcp@-@ 0P CS <0S 3/p@C-@P 1MSX03/<e4`0S  3fV< R% 08 Q pI@0 00@PR P! ЍC$ \0-Te R00 < A,e O ЍCЍpdpd>xdL]"G-@p`0 Ÿ8 R4聟 00S 0SA. 0a 0  0; 0p P\ 0, 0S"< 0 <  0  80S 0: 0<05#0  0*P 0  P)3 0R S  P 0BSD"S46"PAQcRB>@>4@- $[@000HcO-@P|80S Ѝ<p0S P `0 00$00 #0C#P>0SB*@-@@0@Q00. >0,! ,1Q 0 @っEcMb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  A5G-`@]PP@  ,p0S S8 @ @ D1. 尓 ,/ 408p<003/3 3@ 0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0ꀈd NEFXPi'TDG-p`P@PP 0,00202?Sb40003/S3 PPA耈dO-M M`0P @0MpP00S:0007/<,Px )000&0度dRS00X2PZ< :  R+00d [fd R  PWW !Qd R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ą3p 0p0p00S ۍ ЍOq!y!p[*Wۍ Ѝb!tP t\!p0pGWpXS!8PLHD@W>>>>>>>>>>> >O-0@4MPcpJc80S<0:l=S!08Q D R< #" R*T03/80 S%d0S 3/ `l80SGʉPb R00 @ W(c eP0<` `00SQ  00  `00 00 00< `V `<0 0`C <0 0Q Q<0` 0 pd->pdX="Q>p@-P@`{b PUbp0S \P0 P/ 0 /p@-@Pbb@bpp@-@`PUb0 @Tbp0S \@ Pp@-P1 P#UDP30 P0 0 00(005$ @,08,0P 4<p>@-@4<@D@-@ b,A0S>p@-@P 00P`a)baAp@A- a@TpUʀ 0! $ 0    !9 0  @ 0! T0t l   ! 00 0h0 03/@T \p P @cdddaa/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp =,0帢,<zpsL!DH1003/}#-  Ѝ_?0Q R 0h2100100100 0-/@@@>>G-@p`Nzh12>w""W>`>EcXp">>>*>P>>R>Z>>>@-yo@-MPh0`@ Tp@@d00@0 000`KP Ѝ@ЍpAd>z"p@-@PL`^ 0S 000 P0H0P0@@H@fp@_A-@`LpP^ 0S Q H 0 0 00@_U _PX0S U ^U ^U7_P @^G-`PLp@^0P 0@0S7^cSP,(0 ۆ(0 Px x \tn^l^j^~oP PU @-Z$0\@[A-@tpN^0 03/`$PY^V 0AFEc0   Q @-0 03/P0S/A-P(MsT@P@(Ѝ0`P0$0(0 `0 03/$0 (0 q?00008 F0P; p 0 `p*08/0S)0=0 888/P< 8!+P r? 8 P 0(<03/ 403/ S>p@-P@$0 (0 (<03/400 43/p@S"-d}P0.X X%,à1 0")!0 <"#1o\Q "2MbEcCc>@-XM@X   010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X 701H0T@9C>H0 @H0P  0( 0 0 XЍp@-XM@X  m< H0XЍ0@-P(@\M h;\Ѝ0X V$0 010408020H0P$020>2p@-(0PXM `XЍp00@S SQ 0R0@`X  !0T1008020 H0iTP`  P0@>>@-(@00 3/ 40S 3/00 3/00 2/p@-$0@ `8P8P08<0,4p P  `PU$09$0P@-@t`Mu\0 03/$0PPy99$0\U W$09$00<0S 3/ P0p03/7/PPl 0 4pW  7/PP <(0 n03/(0 /PP(0 $0 /8PUQPP(0$0$0 O(0 $0 P $0 P PU8P0S pp 0 0S $0p p00 00 P7 PU$09$0[$0 9$0Ѝ@[W Ѝ@Ѝ1>L>c>|>>>> k"A-@`,L[PpDPU  0R0H0 0 XP[03/[X 0S'$0 P  [x[P@P[HA-@PT   @ `840D 4p P `84O-`0.40$M 03*@@R  $Ѝ![z [ [ 0  3"[ [ 0 S,  P P9 0 40 0 0@R TP P)TPA  0RT@?4  k h e2!!1 0\1 Tl04  0QPP 0@EG?0 0B0P[ 9 6P o@P +P@  %P[@pk[ 0 x U_ PP   0@40  0400P} 4 0 0P 0  0Pf 0P 0B ! YSV@ NRo>>>>F>>C>>>h>>>>>C-0@Pp`*0) ,0J)00S V :`VL`2" / ЍC>>$ X0R/0p@-)00+P@*0,,JoNOPAVPp(!Q>C-OopPd`【\MBX  0 1HiP 0?4/`V<?oU20S 00\ЍC'O-`lMp0pV Q ;T.;P"PP@X 5020t!(ST0TpU`10W ,PLPpX0G S<<000 0``΁P7 R00,`0 ׁ0@0`P0 ˁǁV 0UpC00 0 wlЍ4 80 P威`2rx>A-`MpP`6@P*U@x 0PN0X TBPg402|0PSd020P0$P@P(00 <T 80U`C00 05)`Ѝ2@x>@-$00$00 00  0@PT P P$00$0Ѝp P$00$0%>0S,0 0TP P0 3/ `PP, PP z꠆>>A-@00PP h0004P<0P0<00 03/pP` HPj`0p`0<0<,0S >">@-000 00>Ѝ@-1 0 1ЍA-@04pP0 3/$`Q\@    0 03/P t`P X00018  1\1\1 Q004`V 6/P`  @T :u0  03/tyPp`P>>V>Pi>>Mb>>0S/pp@-0@4PQ 0# WPL`0S 04A0P30PU*<p nEc>0S/p@-0@4P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ@P@@@0 P0`HC-Pp`"Q P 1  0{ Ѝ@P@@@0 oP0`HC-@P`pQ P 3  0U Ѝ{@P@0 HP0 P ` GC-@P`#pQ P !3  0- ЍS@P@0  P0 P ` G@-0000  0Ѝp@-0@4P; 0# p@@p@-0@4P, 0# p@1G-p0(0S PL@P LP`L@ `⮯P zV0S40(0 3/0000@00Vp@-P0(0Sp@`\V 0R000 Q0 (03/4VbLp@_L@-C0(0Sx@Cp@-@`6VPUpV0 p@,0/0 3/Pp@-0@Q4Pp ` 2/P D$ @p 0`( "4`#/0S 0\/-48 \$ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0( MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00}@P8p0 ~X (0 Xd000p0(00(h`X0l`射@P(0 00 0} jKP@P (0 } <03/ 403/ЍnK rZp@- P@@@4?`;QpC-@(0\MPp`x( X  {< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2"P \Ѝ@ 0b0?o0cS2   ( (0` 1011SX + 010 80t0H0uP X   01(0 080H`cP 0  rr2 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000|P3 0|0 FZ!0 00||t` 00 0|0 $Z | Ѝ0 0 0| G-@(0XMPp`x@ ?0 S㣤030#$ 0 X  011 H0P-X  r< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2" P XЍ@ 0b0?o0cS2   ( (0` 1011SX " 01|0 H0oP X   01(0 080H`]P 0  2222 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000{P7 0{0 0Z%0 00{{t` 00 0{0  Z { Ѝ0 0 0{21BP31 a1/G-0M01S`P`1 @o (0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0^{@P;p@0 m{X (F0od0@0h0l0040(0D00p0(00X0@P(0 00 @0J{@ p@HP@P (0 4{@ <03/ 403/TlЍH rG-`0( M@p0c   0P*5/PP@008P< 5/PPB,1P 0C-\M`PX p 0 X100  H0,@P$ U PE_oYRPU 0XP PX  (0 080HP@P  0 D)@\Ѝ   6$6$2 2 >>p@- P40 S" 3/P@000S@  3/@P\0 4`V  @6/P@p 2/03/aO-pMp\1堠@Z 0100P4` V  6/P <03/H1S< p4`P   ߍD1S R0Ԑd1(0    p xVp@  p 0P0 0 3/W +(0 `-21 1\1Q00S  40S- 3/PVQ < PԐd V TIW```F0 VPW 0 Y03/[VX [ 0  PgPI040S=   3/P>HX1000 R0L!00V,a`NP)d1S Se! 0 Ԑ 05h1h1S 0 !t P000 \1Q00S 0 4PU 5/P 03/$><>[>}>'>>>>>%>+>K>O-頠\1@Z!0P4` MV 6/Pp DR 03/(0L ` 000 ``00*8/PD00`80 8/PF9p 00xP8`0 xX p00000\90308(0p 00DP(0 00 0w fEPP (0 w <03/ 0403/X 'pߍ}Ex|SPp`< !4 4tp00P  'P " (1pS  PXp(0o1S\1Q0Z0 S 04pW 7/Pp2 7夐8#t200( 0   0p*@7/pP008p@0 7/pP6p 0@0:wpP@0 IwX "0 0@000(60 01(000wpP(0 00 @0)w@ 0O (pX 012000 0SpP00 3/pP0 0p  HU -`1 k 00PpP VWa E  06$0(0 Q N  003pP 0 (  pP$08$0(0         Ho48#|2婒\1Y0 3/(p\@3DPUpP (0u v@ <03/ 403/W p0 `0 n0 c0 0 0 R0Zp ѠБ[0 [00 !0 0s1  z  Y x X h 0S T [ H  W8 4W0A( $ pP .C (1S 0 Pt000ᴡ S<#0 0 R XX :1S* 1S' 0!`Pt161`!A?;`V)       '. !R尰R , [0 " !(   尀|u 000$> rw>>>>>>\>z>>>>>>>c>m>>>>>>&>>A-P`@v $0 DS P9 PJ0 0(0 `L rPaH TXX p[1q#3!?A1c L\1`06 SQ 6 `'``La H` P  r{ 6Hv `'q`` HLaiP`d T_XX[ p[V<0q#3( ?A1c\1L!4L1>gfff=>>p@-$`P`@0  p7 `l2 Xp-Pt)Hu%@v!8w`0xya |  pH!R0BS2l p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yza>C-lM@d p(X -02X{P*00$0`80 ` 0 0 `h0&hS `PbT(0P 0s (0 p8P0`UlЍ40S04P0<0P(0P@-00000000Ѝ>C-oo@PpdԐ\MbX  (0H010$0 )0 1P( 0 U 0 p\Ѝ0 1X<UG'p@-XMP`@X YL0 H001`?oT20S (0$0 00XЍp2W@-$0dM@8 0$0(0 0 03/(0P( P $0 R0$0a PPPE_oR_0[dЍ(0 X :021$0;P0RP,000 03/ `lP0`(0$0Q pn |P0SQ0 03/T .P$00 X 20P0 02PP$08$00@-\M@PX 010 PH0\Ѝ02p@-(0P@ ,Pp$0 SP000pEP pO-P @`p/J(0  PdW@ 0 @Pp\ XJ Ѝ0 `@0 0 \rP 0 00@00S (00  002@Vr00 0Qr`0 @P00 0CrO-P `p@I$0 0 03/P p@ I Ѝ(0  PdW@ 0 Y@Pp\ 0 `L@0 0 qP 0 0000S (00  00@q00 0q`0 @P00 0qY>C-P@(\M@>R`>:pTIX  $0@ #0 01020D@H0@P X $0` $0!01020d`H0@P X o&0160 H0@[I\Ѝ@A-@M@! `Pp I$0 1pA?!0@P !0E@P 1 4/Iߍ0 >@j>!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-$O-P@ፗP)m_H01naV!no1SKHኗU~o p\`〉Vn1Hv~A$pڪP ᙪpPW H$00套eH[ ŪP{1 sPC-MPpGpQ@101U 0|10p!]?l4 0t$0`Ap19l!M 0vZa 0~Qv 0H mGn010ȁ1ԁo @ߩ01$ F40 00\` V10㨁 t1>>8"""A>L""@-@pP1haq•1p Q V  0 1 0 @ PU:h0  \p剺4W 100@,tpo>}>c>Mb>>A-PL@L`m`GP0n`AGs@- 1`QPpN@p%J000#@0R'Ѝpm_:GRP 82<"0820 <"0kG0P0t0L`000 01no%1010s 10CS1nvd@c"p@-pP@moGP P2""N0 0 1GpPP0P0 P1"p@-p@PmoFP#@ @@(0 @0 @1 Gp"A-@`$0@PA` E UPmFU 101FUPA101A-pp@`PoL!?R01 AA-p@`@D0L!mϠQ  p 100$PPkFFЍA蟕0 $0+ "PP 0S%0 0000l 00 0BF1S$0P0<0$8 01ЍAoFY>>>Ec"p@-@0P$ mo F$⏨1S1p@SF 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd (0 R 0 0040/|ddO-P(pP`@\p!RWㅡ& W5 M@ P`p1S0 0@0 A\'0S0S  @ T  e R 0 00qT 0 T8 0S 0S0S 0Sp>|d#>Z>>@-0@S f0l S 01 0000S>@  Q Q  0|dPA-S@`p0 100PU0S0 8/00PQU0S0 8/P>|dPp@-P`0@0 P`00 R @p 4@0@ 1Sp R  R ,      0>|dd>@-@ R 040 @f|d-^ 0/$0a(!"$a$"  b"!4b4#0/0@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Q0/o"0#?S R000,c Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 Pdchc>/@- @q <Q 0(Aq >">)>0@-4M@P000(00 0 0    , 0 0P 000 4Ѝ0D"O-4M`@2`2020 00 P0 5/0P  P 5/P -rZ pp 0< h9/P\0 ! U0>0 4 9/0 4 ;/Y  Un 40 3/[  Ue^ 0 !0 < 8/ሁ PE(_CSe(/C#b?0ETPr@1P  P C 000!(00 01P0 0 P00lP0 000 P (00 000>00XPw  10 0|0 064Ѝ>~^괉dcpc@>0AY>|>@>Mb>9>D"@X>@`>"/O-`0A3vᣁᣒᣣLP \[ \  P @P@ PD  \ # ZK0/ᴉd@-D 0S 40@/0S +贉d>@- D0Q d@/Q 0봉d>0/ᴉdA- @0PS ` p 403/0dU00 A/ R 0Q000봉d>N  0O   ! "`"Рo@-E>@-A->p@-@P PpH0. `@@@D$0 p@0>Dc00! $0 /@cd 0(0S 0@o/d@0 !!/@-0 !@@-0 !@p@-Px@x(P1 $0dP$0 ,0KO R0(i,04S00!pdS>\"@cp@-@p  PPPDUT ʀ0 ! 0$ 040pk>d0$/dG-`0p$0PUG|U !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pf10, TP2/@cd @- 0 ! 0^ Q    D $ 10@S@@@d@cL@-0DPO@cp@-$0D0P !;3p@cG-@`po  P00TS\+0 !HP10,p1,a(0 ℑ41 0 , >d@c@-@o  Pl ,00DQSQ @0@!,1!,0,q@d>\" $0 0!0 00 /@cddd,0P 0 Q>0//pd@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S pd>P0@-  d@/  R 0pd>@-P`@`0000  p 07/PPXG0Lq 2/y/, 0 4 8 < @ D H L Pn  P   O R0 P P@ Ѝ@$0,0 0@ Ѝ@e >3>pd"I>m>0@- !" 0 !0@- ! 0 !`QO-RrpxPGx`q<@U@Tp  G210@ 010n  P `U pT X Ѝ@U   0 @[X ≐@0 4P0ڬ 2/p[>@cp@-P @@@@Un  P`@p0/pdA-`1@P0_SL b0 _SL0_S Ip0 _S I0_SO 021   0 0Q000S$ SBApd>>A-|0 `pR_V0@00C{ 0@@_V=Pp @pdG-1xPPxp@ \W 0GSD ,0S 0 0 @0p,0Y`0,0 B0  W30# W _YOO@A$ 5Y0 ` _YOpq _YN @pd>C>r>>l""G-0`@i0 p R, * 0 R& _TC _TP@PQP$B@  A0P% _T Fpd0@-@, _S= Bpd( 0 _S!Cpd( 0 _S! FpdA-PH0_PB`@@@Ap0S  Apd( 0 _S!OpdO-00Y @b_[pLpq0 CX_[ `I`aPPp0Z 0 @Z V O  @  pd@c>>p@-@@0SpP"0 PpA-`P 8` `p00p D1@ ᎈ0P   8/P Ѝ0t Z| x0Q  6CQ@ 6Ao,0, N 0AoXc>p@%`A@-P 0|!SF &BS &SG `ЍpH!S0S&l  P(A 0SlA1  P@`p2 0@0  &0P` ` 6/P@0 \` 6/ |0` 3/0Sk\@\0 0SkD@D0 0@  p@`AcccXccccc/!/!`!//` `! /!b!b!b!b!b1/c 8!0/c#c4 4#1/!b!b!b!b!b@-`P@P0@00 p0 7/0P P d`6/0d` 6/ Ѝ@">c$>=>@-Go 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-Qp@ 0d`6/0 `P0d 8/0 48/V00V*U03S 0`4P 5/ P0d 8/ PV`!U0#02cEcA-0p@ 0dP5/`P Pd08/0 48/V00V*U03S w0`4P 5/ P0d 8/MPV`!U0#02cp@-D00@ !0 4P5/0 , !pcp@-T0@04P 5/0 00dp@/c@0A-\!\Q\a0@0lj  PD p8[ $pR N`0 00`0 00`0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/0`0ЍAdDecDeP1EcO>""7@-0Â"6 @FC$0S0 XPV0@T :@@Dd0 0S B @DT Ѝ0cQY'A-pP@`0!0 48/0dp0 7/0 dp7/0 !!c@Bp@-8 0403/8 0d`6/pA-0` Pdp@403/ ;7/0 4P5/P0@ `dp403/ ;A/-8/48/-8/-8/-8/-8/-8/-8/A-@`WiO-00 0B ( 00Cp 0 00S 0F0  0G V0 S] 0J$00 3,000  0 C 0壐 000 000p4$00S0@0@0000$0@A QIP QFJPPBEQRH P<Ѝ@03/d03/400 劈P4 L0 0R0@ 0R0?ZaPT (Q <0 3/ R 40(3/]0$ 0>c$tclmdxc|>>>A-PM@0 00 ". `6/`P # 001! 0@0P $ 0 dp7/T1 R `   P ,<Ѝ@(0@8p<0$0:0 080 S@   1H0D 0S0009Qd  Yz000040I> 0 0000 8/0 @00 aX,D>>>pc#>xd>> e> 0S/@-@ 0S/@-@ @0S 0CS/A-@M`pP QT1 ԃ00000 (@P@܍ oP: h0R1ʖQ001  d $0` pX@y000040@ 0Q Sp@-@P  Pp/C-MP  p`P): @0 0( 80<  S@ ʜS0H|0D 8  y40 00T 5/00 @00Ѝp@-0PS @  00C0 0S0 0PJ;(Q $ <03/ R 403/p@n>$p@-@R 0 0R 0R pR 0Rp/00   ,000 0H00 4P5/ @o_W@@W@AW@EW@- o ϜDH R< o    @03/Ѝtc-0 4 0/-0d /40P 0S/0S<0//ᄋd0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LT \\LXp` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPLITP,Z`N `Y  \ pXp B`\  ::0:0 & SC-M`p)@p0000 00 P0 5/PP \ЍCpH2傏@   p@Wxd  P ("( 0 00 00$ (0,0 0S3 'Un"0" n2U]"L" ]2L2PUP*00 PPp008/P  1 000:88/P h)>0:! \P!: \P<: R? p@ P 0j=0:* 00 Ѝ>>d>>,>X>#O-0`SP@ Z-0S* cp   P00Z0000 ЍpQ3# 0c  P  0 p@SHG-paPP@::S0YL M"L"8 R Pc  P  d0(S  D  "O-@ P4 pჟ0  Q ` !PU h0pW㋰   Ѝ>c  P  '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0oP t1 R8 8  01Pjy> 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddhh@- 0(0C*s` Ѝ1pP0d0 @0 L~`P 0SQ SQ0 ,Xm`P,pWQ BQ0<00D00 87 H0R/ R0 0SH01H0WH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 hX2H02,00@008000@@0 0S%40040ꄋdA-@2PVD`q@pWA40@00S 80S0p 0sBPh 80S80S808   YpDKXDD< :RD01 "0D20LML q @50@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0 ꄋd>p@-h2@4Pld 5/`Ph”l0d`d 06/@Kh2ld 4`6/h”0ldd p@/'p@-P`и@ᎫPPP jX" gp"R h2l`6/0p2pA-P`᪸p@0h20prx$0`h?0  0 8/ P ЍAK0hp2(Pl5/ ,h2d 4Pl5/4Rh”d 0dpl07/h2d 4pl7/h”0d dpl7/h2d 4Pl5/1h”d 0dPl05/h2d 4Pl5/PGh2d 4pl7/h”h1d dp0l7/h2d 4pl7/h”0d dpl7/h=dph l7/h2H 4pl7/h1 dpl7/0 P h2p"lP5/0p2g|0P  PX4 XЍ>>'d& >*>#p@-P@X`  P4Pp00pp/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/~os@->0`@ P  B` 0ŒQΌ Q @70T00 P05/P  0 ЍpI>p@-0P L00T0@4`X 6/TX0d` 6/p@e>O-,MNx @ d0SS0 p(а d0S ,ЍS CS 0C$0P(0``03/P 0PP0  (0`P  p>P+#>p@-@$0 03/$003/` $00) 3/ $003/P$0 03/ HxF$0 03/\>XP$003/Pp}4PUp3/$0 0 N'p@-0P`@ 0 0T @ ` BT0 0p@/0@-@  T A-0@嘢@q`PU P Pon0 !m R00 C1m$003/P00P$003/0P RR 00`(d0 U T0X 4P5/T0 dPX5/PEc>>/O-@,M1 !dQ Bd0S1 TX00 P0 5/pP L1,ЍOd0T 0C?odP2X5/x d0SS0p谟d0S ,ЍS CS 0C0(P` 0pPP3/p0p 0 0 $Ea h p00 po h00>c`(#>$'#,'#p@- R 0@P5/00 bp ]p@-@9dP8 5/0dP 5/p@ G@-@@s@-@00 P0 5/PP \B00Ѝp000(` 6/ 0000>G-`0 p9d":/d0":/0"d:/`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z :Z 5pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z oZ jpWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/.`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  <  000(0"(>G>p@-@9 dP05/pp@-@,0 4P5/0 0p@-P`@`0000 p 0 7/P  Ѝ@$ I`0p<SүH8008080(040,0 Ѝ@  0 00$0c>v>>PG#G#D#D#@-@6P 0SNX  P0<00 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-@ᒯ`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-Pg 0 3&*?=0 `p?x0@xp x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X0@0/-0d$ /> Q/0>D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PEfU AwEc>"> 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-P@`U$ V  P0UP0p U /0S  \!@t x0dP 5/0dP 5/@p&6>p@-@`TP TV  P @ph@@p@-@P0d` 6/0d` 6/( d`\06/T00T0app@-@Pt`\00\0dP( 5/p@N@-@$X H00H00X0@eep@-@`UP\00\0d`( 6/p@/Q G-@P?10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPUDpPp6Q  c0L0GPY0 d:/ 0dp 7/ dp17/< P000QH 00@00  00004040jP  L+0L0H00H00X0( $00040(0U  P,`T0XP0T0@`0dp 7/ d`x06/0d` 6/E`pX 0V0R0SX0S<0(@0P0T `. 0 rd`F[>|>>Ec>O-0@4P, 5/0P( 4`6/P dPX0S   P0_ X0@0S X0<0X0H0@(_ X0L U  X`H0p8 ē0p 0< 4:/04< ;/ 0 'X0L00 4p7/pH0p  p<0 1 / !U  P+H0 0S'0L0@ 0< 48/04< 9/04< :/2$p 4 < (p,pLpL0S@0SP0<0T  P H0@(Z P b@P :PX0Sk  `  X0L P0 X0<0X0H0@(2V\P \PJV "P` XpP X` `0HP0H0@% V P0S+`P + Y'0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@>C-4MP׫@P0,2 z0P 0 P05/pP ~ hp4Ѝ0"-P i0P P5/kT  PNh2h2ltp0 T  P<;PP`d0hP`O( 2P0vP< "0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`10P,0LPt(? @(0d!`(0P(0(0  (0  (0 (0, `(0,P(00P(04 (0 ` ~0@00 000l00p0 0P00$0S  PP0$00$00 ⁚PZ|P0P (P >>A>LQ#> N,L>@A>\I#DA7>H#S>TcY>p0\ ?R"0/A-P` VP(@P 00S lp#P U@ X0@0X0@$`VX00 @@cdp@-lP VP`@l`P#UX0 U0 X00\0`0#p0X0cA-L@`ۗlpP#A@ \0S @#訴cA-@LėPU `80lpph0q# #訴c>p@-@p`lP`# p@#X0 @-\0@S ` 0\00s00`R`0(0C#p@   t  X /舋dd0S/p@-`d`@Ps뼈h0 0!T0$LH @   !p@ꈋd@cddd\ P/0 !8 00 (  , !/@cdddp@-P@dP\0 0T ?S5/a@02 03/Ppp@Ec>d P0 P!ڠ 0@ S0/P P t`S /d/`/\/X/T/P/L/H/ /</8/4/p>>>>>>.>Q>p>>>>>>-3@-@@-pS@ 04MS 2 03/Dc2 0 3/00 P `V 0 0d0S e00 00004Ѝ 0B S020S' 0S P000  00 0203/0 000820S 0SP0002 03/203/ 0S P0000 000 0S2 0 3/} d0Sq n 00 0$0Sf2 03/2 0  R05"105%R0 0f d0 `Sb pdpg t0 0l ?0_[  203/PJ cFꈋd{>S>c><>&>Ec]>p@-@@`lP!!! 0 _Ech>A-p`幕lP@l!1W 1W 0W$ @!d1W# 1C7CW2 03/P0 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0000000 @ꨴcA @A A(@n>cdQ @-/>0( o( /ላd@-@acd>>>pc#>p@-@PjP " " " #p@r@-嶪op@-P@P%pC-4M`pJK?0S,0APT( 0S 0s S$Q0 0$1 0(1@0q008 0$Ѝ刖$@T4ЍH5dl#p@-@`PLnD @00000 815%Ppp@l>n>p@-P@01SǦ8 p@ R $ R $ p0>@-,0D ,@ 04/01/@-,D@0\ 0@/A-pæP0AT <1S 0,03/@-闦0AT0S $P k@SG-`P@0<   P@Dp0AC0STW0l0l 0lPPpW@DT >000XT0D 1 01UЍ>>>p@- 0PQ@ `M ` 8EU < 0 :܍p >>G-p`@ V@0s5 S20s/ PPE_oRP! Q rP P Q iPP Q `PP Q WPPY U @`FPY P 9/P@-@0@00/X0 @-(/">@-ԥ<1 Scp>@-(0 `MS$8@(0X001T PЍX L D ARF:@ PA,,00@@D  BD H0H0L {M wN sO oL0P  Bi(0  c _(000Q?0@  Q T RC G NX00X00S 0,p P 5/PP H 0 D  pP 05/PP 0  2/$Ԥ,t>>p@-(0 `SX@ 01S 0S P X00X001S 0H  2/ 0,  2/p@X  D  BQ:@ Q0t>A-pX0@`P  h~0 p 07/P  0L0Q0CL  QL P R*P0Ѝ>p@-X0@ P [00p@/>@-pX0@P` \JT0S L*  0p p07/PT$!T Ѝ >8>]>p@-X0@P 8(T0S( 0 $ 2/0T0py>>O-p`@M 0SP㸐 0S5 0  P 5/PP,7P UPU0E U0#3S\ P  00;/PP$  0S@XЍ 0 @ 2/$p0S 0 S @X 0  @ 2/, 0  2/$p>A-@`(Pp 0S `p0S 0 ` 2/,p 0 ` 2/$pG-`p(@ 0SPp㸀0S%  0   P 05/PP,p 0!PP$p 0S$4@WЍ0S$4 0S ,0G'T 0,@  2/A-@P$(`4p 0SP,p0S 0  2/PPp@-@P`Up6/PP Q(Pp@s@-@@N@-@h0 01 0!0!!01(!10!0(1A-@PUP@`PPq O-0p"SMSS ЍD/0C@ S00S0S00001I0S000S 0 0,P5/1 0 0,P5/P`1 0 00,9/P V 1BP0 !0011P0`!BP001UV0S 0 0,P5/ 0P 0,`6/1TQ 0 0,P5/ 0P 0,`6/1TQk0Sh 1S& 0s01! 0 0,P5/1T 0 0a,P5/1SG 0SD0SA0S S<P: 0 0,P5/PPP 0pRP3U_&W\p"P  0 0,P5/\ 0 00,9/P0S 0 0,P5/` Q0`PP S:1S 1 0 0,8/11 0 00,9/! 0V1 01 0 000,9/!0U100C/ߑ    0 0,P5/aPV@? 0 Sb CxC/` 011B/X0`1 aP 0 0,P5/P000@000 000000 0 00,8/00000P 0,   ,03/P:8   ,03/PX0C/᪥X [0S 0 00,8/0S0PPSPPP0S2 0S 0 00,8/0 000@0 00 8 000 ,8/00S 0Y0P00 0 RU 0S3 0S 0 00,8/0=@0@000 0<0 0 00,9/ 0 00,8/ᴚP0`0  R S @S7 0 00,8/00S0_1>  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/P>  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( 8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0X P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0p`X d,0B"3/P @)@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 00>8>@-@M. t 010K/0  $!(! 111 1014!, p1>  ލy#A-P  Q'R R@Л`0Sś(1$!0aVKO0S巛 AlhhիV XP`V塛 ,$#0 S(0  @T`|\0Sij0 a0S S||YtV 0SP0S XNp0S\Q 4D0B0 =0 80 30 .0 )0  $0@ 0 0  0  0   0  pAwXp 0S<Q 0(A$pQ 0AQ ,pM>^>j>>>>>}>>>>>,>>>>!>(>4>B>M>S>a>q>>>>>>>>>/>]>m>{>}>>>>>>>>>>>>=>S>X>h>O-P@pa$!0r0C?o20S (!0r0C?o20SPA Q> P;P8 Q5 P2W10S tm R(hpW h @h 0041@041Cy C/0Bp Y `W ,=$p9W >c>>>> 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q `P 1S P|P(㕀 0S>p@-@ 0P` P@HTppA-`PX4S@ @Tt5@Pp@-0@@ ThPPP T[PP PT0P4p%@-@TPTu0P4C-@Q4MT4P 0p`  8/P z4ЍT4  0   p  09/@PE |cPT4 0  2/0 , 9/@ TT4 0  2/8?W?A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-Mp^@\p PT P <ЍO 0(0  RC> 0800P 5/P  @ 8$D0<4>`P2嬢42 4HVG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4|0Py PS0 PI0X4Ѝt?8#v??#%D#?%%%<%%%%%%%%\%l%(%p%%%?? 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR00?A-`p3BT PQ@Pdp@-b@0 P PpPP  0 22D 0(1S5Q  "%`?b@-@ 0 2p@-`P@P  P p@ 0t(0 CPP p@0T1x0p0p0L1l0P1噗`ZP0P PP@q0T102p@#~? #إ#?L%%|%? 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`8|4S@ Pmែ@Ptp@- 0 R\0S 0 000P00 Ѝ?p@-P00S PpU@t 0  twPP xQ t0x4< 0pPxxQ txTPL00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPpU@a 0L#^P$  RPP $x0$=1S 0"P( P0 "LT-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PUBS  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0Bߍ~PU$Q $]p% @P?#EW?5?G-`@PhZ@ X P G@ 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}埓 0\ R`k0P xw G P L01_o?#q?#???/ 0P/Q/c@-@ሓ R`0S0`Qd\0@-@tT0$0-p@-@PH2Sp$0SpH20$ (\003/$Z @-@$U 003/$@ A-p`F@Pp 00%010H0XB0$0'ptt C``2SS0$03/00S $⎳A~@@#cL##A-@P0S}2$  0H"$0 L~$ b@a}fcd(cUtUUĈc##@-@S @ ddH0 60S @-@,A (0 x@| 0@/cdcp@-@X & R@@P' A@ 000S D@ Z pdcdp@-@TT0 60SP<0p@8h0 ,B ? ppp@ddp@-\@ RPP Q.ၕ5S0(0(0z00C0ppccp@-@MPV[ /0PP0 00cS0`0e@QN@P@,9 x000S HtBJ ЍpcddA-P`ᢐ0@S"%0S 00@0$@-0@0$0 00@0$@-@@p@-@P0P03/0p@0 Ip@-@P0P03/0p@0 < P00/000/P0S00/00/P0S 0S8020////-0 $ B^\\^\^p 0 /G-P@0弑4p X0IbS 0 $0SP0$0W$0\0S000 0 0  1P" P"0,0$0S 0R*10$0P003/0S PZ kP  唏(0S V0@@0$3(0$ 3/V 00$@`Djoob` dW 000$0 0S0SGBXX0S pp@-@DP$qP 00$0S0$0003/l$p@A-p 000 ,`lPPP0 @$2100 P 00 $0(P.&X0  0  Ѝ@-2>  0 Ѝ@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ@-8 "  Ѝ@- <  0 Ѝ@-<  0 Ѝ@-MpP`J@P   ,0 ` P00 0 Ѝ! @-`P1@P  00 00 00 000~Ѝp@-`P@P  n (0P00 0 fЍp! A-`pP@P  T80 p `00 00 0(00IЍ! A-`pP@P  780 p `00 00 0(00,Ѝ@-  ! Ѝ"7@-P@P Ѝ00  $0CQ RR!Q Q @-pP`@P@ Ѝ0P @ 0P 0 @P 00A-`PL,( p0@0 `OT Ѝ< @-,00@ x>P@޾Ec@"@?@-@@0 4@- CRS<0S'ԻRHE@@-@P 000@-@PP0S0S @-@0P 0S @7@-P @ P 0St 0S Ѝ0s@-PSЍp@` @ P P 0S St 0SЍp0  R0 0S00/ SA-`p P0 @P @@@-0@0$n0 !0@0$O-@iI0HDpF`B0 80E0PtG0@Adi R \ i  $0Q \/ i i i i i i it R lix R Xip R D ЍOi Ѝ@@@@@@@@@@ @@00S/c)@Q @-@( /4@=@O@O-P0tMp@ `m0PW E0DF IG0T@H$H0L 刱4PP0<`!`@hPlp `E W KtЍd !R8 "!00SA X00X0\0000`0000d0000D00  r @R( Sr$ (u0 00 $0000< 0,t P  0 0QdP!hh0W]@H5#@-@\MDT0E0DFČG0I`H0p4@000@8 HA00LB4 <P p  ud00\0\ 4$00p(ЍtPP 㿡dP`php)q\ЍH5e@\#@-BP 00੡000 000A-`P`p_@P   03/@g0 cn@G-hP`p@PA@P L@0 4/@@H0 ҹc{@P0$ !/@- ù@@4d@-@Jt ,Kx (Lp @#G-@P` $(P0Q0p0& 0 JP 0 KP0SD0E $|0SGEF0D 4$GtQ VxQ  V@-00B4 i Ѝ@G-`P @-0p 0 G0F $ E D040 0FU@ A0` 0@0;@?0>HHI0t 0P H/0@@0H @0H( 00ЍG譠@@ @ @p@-`Q@ Pp 㝠P $ ᓠ p @4@p@-P` ㄠ@ p}0I"RP Q 00#?-, $ ,# ;cEcMb% @ A-p 0` P0 ?@P 2 @P0 0X@Ѝ @#@-@0P 40`CV^^p`W ^^PU\@p@-P04@Pp0S0 p0SSQ QS Up DQp@-@00$D!srPP00$zpp@-@00$30 0P 0P!00$ep@-0@0$0 !0@0$Up@-@00$0 rsP P0 0 00$@p@-@00$0 0S00  0@$-O-p8@PU`P. Z P rPP 0$0 \=BP 00_@P R ⓷U OR4^R R^[ 0 R   R,    00@^(r@  ^ "$ , @O-MP,MUPPqPU LP7@sP0`x',ЍO,8D8rP7U8P0TP 0080P0T0 007 PPZ ̞`p 0 pPP f`V0  7ḞVP 0ᰞT0S0!4R P` 00CS`( PQUᏞ`0 `P )[`0S0!4R T`0 PRY 0L媁 0 P8  坶 P0P#30 0PP[)  JPp80弇 08P 2 0qB 08- P 08tU Hx8 (080Pd8k8R_[,Ѝ @ @@-`QPp@MЍ@ :P 0S Ѝ@M0Sp@-`0P$@T0s S@@T00 @0$pp@-P@0$>00C00p@$vG-$ p`PPP-0弝000@0PP4P8`p $ $ @04A04B04 04 0S004 04``V5 bP0`V3\0S  0N΅ P P R'4ЍcpQ  1Pd0P J. p~ O 0೤``0X*V`$\ @!< R 1 0$    AQ     A-@P 80SP0P`2PP 0TP 0`Q d0`0tP xP pP A8'8rPU8њC- @PM ~T pe`0S40$' 0 1  0$\RЍd0Y } :P imP HײQ 8Ҳϲ``0S0` 00!@4@!@A-pXPQ0P` AT \Q ` Rb `PU0 X  AT  R- 0 \ 0$ 0 4D\\\\\\ "@ @-P PG< ;Tpp@0,0Spp@/i)@G-@MpD` P:PB3S?0EUS;U%  P  U SP&SU# 0P0200 Ѝ 0P0 S*40$03/ )@!$)@A-PD@p3S AP 0U(`0C 0  U U wU0S0A/i=~P  ឮU)@p@-@D\"P <0Sp@8PU PpA-pP`Tx@P0 0A/A-pP`@x@~P0 0A/A-P?0`D20@2bRS ]S     w `:3S Dp哔$Dp協(c0 /(33$$@dC-DP@(`w < J1X`01(p⸕01e01003& D`(021垟 2|1|!2x1202D0\d1`g0 0 00 2S " " I0S0380ScV'0 0 P08/ 0 Px ЍC8d8P`P w Ѝ$$X$<$$$D$$#$$,(e)@$)@A-YwD@T_ 3S\ 0P033\b(pSW E5@ $|V au3S 80S<3S90003/opD0\rD`P  0౓pD`P $0ਓ003¹ Q>3S  ??᎓0D0ЍV(e@-PvU-`D@(+`003pccpc  Ѝ00S0  S/8cO-`v\0SpP U\0 E2#<@T `0S0 Pd Qh 0 Bh `QhpWd*dp`p$*@p@-vP@0/0pG-p~v0\`V3 @ P0Z/  DP 0S0EH 0\ $P ( P (P (A 0S P O-\0$MP 0.0S 0`S 00$0/@/0^T$$00 eP A | w@\0 D2#<Q 0 @ 0 0S@p0 \D⚃#88 $ !R!  0㚃#<P \0S 03/ 00#"0 0*Pu03 2pt 1 0  0A 070S  r0㚃#7 R7+ g 0  p  0  p@     [0㚃#< 0㚃#<0S  <  2  K P#  @ 0 0S_S0( ,0R PN $y( eZ-0SC$Ѝ0㚃#0p1 pW20    0<    p ppWp0GS  Q 0 @00 P  P* 0㓊(7<0`0-0R*@r*@*@*@*@*@Rp@-@p@ [RPp`( U:,PU 0 ,0$ly( ep@  0000PC-\Mp`t@Po``P00v⬬ 0S 0 CRS G0G G0G pP 0S O`\( 0d 0S^ 00CSZT5$ $p07pp 0 0&pS  W   !R00.0700x%0' 2p103 *0"60#X02pSIڤ$ W 00Q    |tWBh($P (Ґ P (͐P (ȐX 0GH0\030 0 8 0/o20"S R 01 0"000 #0X !! R0R!0GH␐L3\0@0 00CS R  Bʪ. 0" 0C&0$C4'0( aP$ ZP0S$ZP 傫$Pp 00S \us(D(A (< $@( $c0,0001 0(0$00@0 0%P00S  0 CRS0 <@P6 78Qd}A^DQAD W0\0  P | 0W00S x0.0-00 jPT\Ѝ,+@7+@T+@*+@z+@+@),$+@+@+@+@,@),@A,@1$H,@d,@,@p@-@sP0 $\00$p@⼵`V 0p@-P`r@ePPP 劏P$P  00$0 * ,℡(pQ@-@ ֪ Q Ѫ,@,@ 0S$0]S(0S/GS(0S 0SS@-{  /O-M`Pr@`0P✪ (,70@0D048< p 0  ጪ 0  P6 5R0CS԰ C,0o0 0 00 S 0s!$ 0P ЍO  P R0 R c 4R0S S0CS  t4  FCS P$S p  44  60t0 0S$0]S(0S,@-@cmL/@,C$G$E$dH$PF$H$|I$H50:$j-@s/@@-@ P  0T T LXЍp H`R @ 0R0C 0`\婥 $04$00 0V 0 0S H⭳0 3//@RRG-`@P P'(p0@00X\40X0\0,* 0G/000/000/A-`@ MP(p0P PP7VP<0S0<00S,P Ѝ80S PP 0001380<0S P0<0080ܟU0H 0P1 00@ L0 PGq: P00PP#T @ PPP`0( 0 1000000P0TP T0SPPP @0P0LP aL80L0H埌0H0<0POTTPP@cA$ `p@-P@(`000P0S @0S D0P0,D0\p@A-`@(P0D R P 0,D0D<0S0C,p<0 8X0< 3R800B<08000000 0A>T0S PTTPP 0P0LP L0L0HHz@cC-p @R`00@ ЍP0 0s  0{@@-00  ЍG-@ P0SP- (`P9,0'4pWDy P Pl03400@0` 000 PTP@4p喞OЍP@cO-@PP0MS: (p0-4`V,Dx)0400 @0<0X0@0\0008008#80T 0TPP UЍ8匥4`@X`\`,PPPPB$/@0/@-n@sp@-@PnP  $     p@! K$@-0PQ@M 0Q 680Q 0Q 000P  sЍ dP`P <0 0 p,07/ pUDiU@nUc##$0 0!0 00 /@cdddʀ0$R/ -0^ "G P Q H0Q -1CQ0 /@-:10/ W@ WQ@-@ :04Sh=  LPh=0h=h=9h=0h=X$G- M`p P@r 01 0SđS: 018#(!#( 0 R R0S 0: 0@ T Ѝ@-m0 $2@-@mT0 04-A-@`mPz1DT" l=S mt剢 h0 $P  ]Gm@H8H0  th= /@Hd@-:! Q \ \ !R0100  ЍO-MpemPp0@000000 0 0h]04嶤0 PJP  d]`سծP|T]PFm, 0 #P8`\G0#`T 0 X#PK 0 8#PB h=0h=h=0h= 0!  Ph= 0h=h=;"Ql0l=02$@Z00 0G2`1081 aaAaG|.@2 b04"0 ("!G0"'\0$14Ѝ8 h0"Q+ P(Ssl0 h=0h=p:txl0Q`4P\p! Q K\A卤 LЍOHS IU 0C#pTtXx\0T,P;/@Q )@t0 S 0t0x0 @d=S @p00t0 0x0`=t0d=l=Sd < z\0@0@0@Hd0@PO$EcMbU$<,%0@0@0@o0@P0@70@@-@ 0 PЍ: Q/@-<0DT 0 !0  !@c0@- ! 0 !7@-P@ ~U H :(000U J(00C0 Ѝ0HdG-P@0pS` 0S奠00h=0h=,2S h=0h=,2S0P #.P0C ,2 20o 00PX0PGHd0@0/C-h=@`M 8! P(!14  "R. S>4h-<0.p XS ,h-PP Q 4pU h=`   0o,Rߍ ,h-: p $`  UߍC=x1@G-@P` [pTT-0GR8`-!d=Q?:h= F h=P<h= < h= h=0S/:!P o0 0@a0 GE}P T< 030p 0S 030G?1@2@EcQ0Z$p@-@Z1Qp+ 0 /Hd0 -  /00Q/-0 /@-j 0 @-@jT00-A-P@`pP Vx`@P V@P @UA-Ppj,`@z00pP W0S  [PP Y10PSSU SA@-MpPAj`@,P坡8 -<` 7B00000 0}`P 000010040 0800S 3/00S 10S$0 '0CS 0c4`8`(0S S0 ЍS PS0000010001 0C0S B1 0(0R4 `&\ V 0S 3/P8a`p0S 0R S 0Q+Qez0000PЍ@i 0 SR 00SRR`Q:40078%0 0 %0  `P 0FSUi@ J Ѝ@-0S80 080 0P  Ѝ@00 0P D00S 0P  x0 p W00`Su 0CS|000 0P  0P  0P  0P   0P   0P  P000 0P~  Pv00Sw 0CS|00Sp 0CSH2n1 (0RjRjlmP`i M000 ~0PC  v0P;|  n0P3  f0P+  ^0P#   V0P   N0P  FP 000 =0P p ..+|(%0R- 0 POPp2@r2@02@P2@2@2@2@2@2@3@53@U3@w3@d2@3@3@X2@3@3@@-@P p 0S$00CS (0SSPS@-M$@\ ( Ƞ,Ƞ 03PЍ7@-0PS @ P P2 " 0  P   Ѝ0@ Ѝ0!@-`@V Pp1ET0P 00$0%`b0 P   Ѝ@ Ѝ@-@\ (8#800 wPЍO-P4`0U@DHp@B 0  ЍO/@N  0IJ <00D`@0000I?o2K3H0 l00|0帐弰`PȀpP 0 0<P  ЍOa ЍcUSBCR@-@  0S   Ѝ@P t0BS00U  Ѝ@=000S 000 vP ЍS  k00 00S 0 .U U0Q 0 Ѝ@,0S kU fp0@cS`$ 0$ě0 0CS000000[00U R0 04  \[04]8^<SU0[025S0^0 B0A@ 840_ C <#$` #(#p@-0@0Pkc10SZU - U p00 00P00p000p@- MPd0`@00@00 00`PS,00$ 0@`R Ѝp訰>:@L!@-@00@-$M`tPt0p<0L0@00@0p8 000` ]SdP( 0@pPuR$Ѝ9@v$!P/p@-Ph@1 01  hp@p@-P@'T0SpPT0`pp@s@-@P`TЍp@00S000 DЍpp@-0@( AR P0(00(0C40(pp00@-M@P0P Ѝ000  00  P0#P0@-M@PP Ѝ000  00  P0 P@-p0@ R 0 0>0LpP Ѝ ,0RP 0S 4:@!@-P`@0P  0 00,     `0Ѝp@A-p@`wP %(@ pq@P ({ pW< &("(A-`@pOPRP 0  00@@ 0 % (`;@P (E`V<Ѝ@&s@-P@`* |D0  R= 080#80C?o2S  cD03  Y R@0 D0  R= 080#80S0S @P @0  0L0 0nЍp@ p@-@ PPp PUCat<@0~$  & ~@0  { p@屟;@'G-`RMp?a@團7? : E00H000(00 ,0L0d0TH ` @ $ P0P B HΘЍ  Pm0 00>bE0@0&0 S 00S 10S 20S$᫘ 0P   0 SR0 R2R1M `P l #h#Y`L剕!8X@9`0 ;@o<@J<@<@A-pP`@P00P `4VP  'H #   @- @  @G-@`0P00x0SH JL2H0L2 ЍG;BT pTL2H@0L2lz  P @TЍ jP0 #  Q0"Z-.R0W30B00@p P/O-peMP_@O` 0(00,00 0$02P @001 00 0P0@0@``  $0 PX,,0P P 0 S,010,0`00SP ` 3 Y00S `P eߍOEc0S 00S! 10S 10STP@ 0 Q0S0  S`S1   0$PU*080 9c_= 0 |Pgeߍ P 8;P<@<@<@>=@S=@=@f=@=@=@=@=@@-@@0`A( @0CR@Pp0@O@0 ( (0c Ѝ@-1@00  4P  0S$@oЍ<@@-Pp@ @0` T@D T h嵂0 0 0 h Ѝ@辂000  Ѝ @-8@0,00Q #^  P/0@-M@PP Ѝ000  00  P0Pp@-0P( 0CR@00(0 0(0 C40pp@-000 nP  Ѝ<>@@-@ P@0  0 P 0^) Ѝ@H>@p@-Pz`h-o@P 0 0 0 i 0$ k0/ 0$  0$ m0/ 0$  0$ 0/ 0$ hp@@-p@PHT` 0$ R00@DR0S h0 0 0 h Ѝ@00 Ѝ@-0  y Ѝ@@@-P`]P@Dߕp x VP H Ѝ@艕0(00,00 0$0<q P`@p00 APP 0 Ѝ@pp0Sw8  +P v]o0 | Ѝ@0P \  0 SR0 R2R1PZ>@\>@`>@>@>@>@s@-`@P P (0  0` P Ѝp@@-@ `@p@-Pg`@ "P00P `FaVgP  ` $ # " pO-^PR@EGpP0 HL2H0L2O00Y HO SHbVL2H0L28p:!H00H0 gP+!H0[0H0 00 `VHBP/s@-P`\@\P W00X000880[y0\0Ѝp@bs@-(0P@ ?@@R@3: 0`0000( 0V  DLЍp@-0#00 P  Ѝ0?@@-00Q@00  0 Ѝ@-@0  0 Ѝ@-@P@0`0 `0 0 05 @ ЍpG-` MPP\@孓H P` |KV0(00`,00 0 IP [@ -001 00 5P [@   z 5P [H   -P0P q  0 SR0 R2R1`~V00H000 `P K8 `W0 0X00x0\ D ЍG{?@?@?@R@ S@aO@R@O@|R@R@R@R@S@O-`Mp@r5P005kPP H>L2H0L2x%  % ЍO505H+XWP    ((R  eP\  _Z   PXL2H0L2A5 0500\008 #8d%@-@M`pT DP00000R !X0<BP h~0 0 0 hЍ@~000ЍP/@-000 P  ЍtS@p@-P0( R@0(;Pp0< `J<pp@-@h}~0 0 0 h@~s@-@P`TЍp@ D0 4  000kЍpC-(p@`PP W J ЍW@000000  @0PP0P0W0S@  J@- @0@PЍ@-0@ 0 0@PЍp@-PQ`00R@ R 0@BT@ l0R Y\ 0ߎP00p QhS@7S@BF@-0 0 0uЍ@-  0kЍ@-0 0 0aЍp@-@PpXL _Pp$z $PUp@.'G-pb MYP@⣑ ᦑ 000(00 ,0<p P@ $ 00 P HA Ѝ PP m 0 0000PFo0@0`S2P0S 00S 10S 20S0P    R 0S0 ĵ1 ĥPR 0S2 ĵ c0.080 P 0BS@lT@RT@~T@A-Pn@pHP00P `5VTL ,   &/.p@-PQ@T T |0@DT@ T0T XD 0B⯍PpQmS@7T@BFG-p0@00PKPHPL2 0HL2P ЍGbV0L2V H XP  rcP L2HP0L2? 1  Y!  00 `Ѝ&*P/@-0$00 cP  ЍT@G-@00`P@(p 0h 0&hPS@9Oo0XB%XA  BWpS  `P&d%T`P 0 ( qT 0    @-( PO:Z0ZEc@-P@`pJP  0@0@DF  0p`@ Ѝs@-P.`%@-P0@ D0FI T  "@@ @ AOCO R= 080#8S S S 0D P 4Ѝp@ @LЍpU@A-p`@4X@@P0 P@0 @00`0  @VЍ! C-p@MP`4Y@@0 @j0 0 0c0 h@\Y T反@Ѝ`Foo0b0@  R`V00 U@@- 40$a S00@60 PS!Pw `0P% n40 PPS 00 a 0P0 pSQ  0P0 @S Ѝ@?Ec"@-?P@`@-@hz0 0 0 h@zO-M@ "pP` @` ( RЍO 0@ BD0P40#0 @R03`1:0D00`B @0VPЍj& R000Ƞ40# 0^ @@R::P ,ˠ 0 0 Q0  Q0`B @D@0C-`M0@000P   T_PP H和Ѝ0H00cPL2 0L2H000 0 AbVp0L2pV HU000000 * aP L2H0L2m00'00Q - 2W0A00`Pp U@O-`K,MpVPk   000 (00` P,0 $ rP  H᧍,Ѝ0 0$0D0 @0 bPm~@0p< 0 0S;9@00C2@0S<K000 P^L0?SSK0?SP4@0@p pT0 p0 <00P010 p봡9Z3 9 p X000P    0B?o 2 00S0@^00S 10S1R00S2R5p4 00pB0 S-  10p20 S t 0p"0 S@  d10p d``0 p L0 *)@ OZpl0 0 )@ ? 0 p0 p)@1p0 p 'H0 p 0 \p  0p ,8000 PI 凌ER00܅ p0 pS꤅ 0p0 S p \<00 Sy 0p~0 S@i <0pZRp Ĕ 0p嶡e0 SP 0 x 0pT 0 00S>  40pC0 S@.   0p30 S u XA40 |0 4w40 14 0l0 4g&B 0 4p( N40pS+0   B0 p< 9H0 p 00 p(0p  !00 0 \  H0pp  $02 p0Sq0  0p1 0Sl0 Pp1:040 $P @R011pW0H#40H40 0p@0 0 040J0@0 0 2@0 0  @0 <00wwH  hIP \kV@ V@  T@V@EcVUUU"`V@`V@ U0V@@-Ppt@vP㘑@`800`Y0 H0 `I0 ` J0 E`C@0 !nt40 0 0 < <  K"40 0 0 < < @0 00 !;@00 ?  ?f?P P Ѝ0 4J T@0*@ 1L  >;5@0:@005@0:a.*aUP/@-000 P  Ѝ4W@0@-MP@PX0 00 A1P  P 0 ⤈Ѝ0RW@G-P` @P 0   pW@-@h;v0 0 0 h@EvG-P`@wpPxx T0l!dЍG0 $0( ?( (!00@007c *0J8#8 S 0C 0S90Q"' Q/o"3 QRA000@ P0@  0*   @0 0S8#8@TPЍRB0 0?rW@@-@P @A-Pp0(`0CV ,@  @00Veڰ!0Ѝ1V04@00T@3 S0!H00 00$#$S  ,!S S A/o,0"<,& R!0%0P 00 0($(̠ ((   $($L @0 0 0HR5 9 P  0 0@ņņ3@ @W@p@-MP@`PP0 00 `A1P Pn 0B`Ѝp@X@C-p@``PIPE$     0 PP    0PH  #P Ѝ$[X (X@@-@@  `p0PP 0S SL0  Ѝ@ ЍO-@p@pP *p&iI1 @=P` Bֆ<`@0  QV Ѝ!@I; 0@1`P BDXBX@@-@@@ @Ѝ0 P@oO-0` 0?   `P `3Y 0 p ` pW 0 0S  S  t+p) i" b ^ 0?   `P 0S  P $GF`&8 $& & 08`b  0\ 0  0 20(0 PJ80G9 0: 0; 0< 0= 0< 80?9 0: 0; 0< 0= 04 eX@gX@lX@X@X@Y@3Y@NY@UX@]X@aY@C-@4`Y @P0 @pP VBAN @ Ѝx0#-5  0 @P 0 <@RBA1 Ik("(}Y@A-4X@ p0 Pz`P [BAЍ I\0#-5  0 `]P  WBA<Y@p@-@AP*A jA#@< ?( A]AA p@U?p@-@@0P``` 1 ++U **p@ <@-00Q 6 0Q ui p@-@PPp@00SD0  R= 080#8S0!23 Pp@0# 0 0SD0  R= 080#80C?o2S+ *+D0V ` [P R@  . 0 0S0  S(  p@CH@p@-@2B0 00 P4 T8 G, FQ.pO-@PUM$`p-PPhB/H/=@ +=@0㰀`B_HPPS \L20L2\H |XH`@0  j fp  a W0!$005P!aB!$  $ Lp` ,F0 B (>0!0$0PT `!]BA孂 ,Uߍ` 041H0 0b[V4 8!0H PHpWY@P/@-0$00 %P  ЍY@p@-Ph@o1 01  hp@ps@-`P@90   Č \@D\0 Ѝp@ L(00"(Ѝpp@-0@( ARP0%( ;R< b<< B4 0ppp@-P@Pp@0pD0  R= 080#8Spp@A-@`pPP 0  0PpP*@P  ;ЍG-` R MpK@Ↄ ቃ 000(00 ,0< ` @ $ 00P H$ Ѝ P m  000$E00R0@0w03200 S 00S 10S 20S d0P    R 0S0 ĵ1 ĥR 0S2 ĵ0208 0b P,@000#Z@Z@Z@Z@07@-@P0AP Ѝ00 BPs@-`@P. P  =  0` P kЍpp@-@PPp   _Pp &PUp@!'@-@P`pP 0P0 ЍU  @    0  00@-@pP`P =  0p` Ѝs@-`@ 0P O0 a qZ0  iP% N ]F U> M6 FU vPЍp( PP @-@P`pbT@  @ $0  p     ЍC-@2P=Ps@0     ЍC P HL2H0L2 0 009Hb pV L2H0L2 0  *= > SY  C 00 `V  TP L2H0L2   Ѝ$0 0!0 00 /@cddd-0 ,0/-0\ /@-00l@ 4/Ѝ@-0 4@4/-0d /A-Pp@`T d08/< S   S Co    / 0 /c0~  0~  RQ$@- ? R6Ⱥcp@-t0P#0\?C60@ 0 0$1(10  000 pp@Ⱥchp@- T?P@!6T1S `HP 0 p@0/pȺchp@- T?P@6T1S `HP 0 p@ 0/pȺchp@- T?P@5T1S `HP 0 p@40/pȺcA-(0P#0?5T1S@gHP0/`aPh~`F $a0tp000-191910919!03/0 Q$1UP!`0 !6/$10C$1 10 1A#Ⱥc@-@u@1e@-@ P`  G80U C0VH0}Ѝp[@0110   帐@-<0DT 0 !x0  !@c0@- !i 0 !G-H1@pT`(A- $0S)h0L3/# h03/h0P03/00S "YZ 0 00++R4S0000 1 PtPh0L\3/ PUl0  83/00 (P05/ЍGcTdcXmdIA-@p`h P70000p`h0$0Pl00L p0A L$$$D[@p@-@P0d %S 050pp@-@`P0d &S 0U60pU 0h00l00p0p }H$l$$[@ B/o P" RA-@pP* @& 00P_P`P 0 17?,7?00??C S0cVS@@@-@l0D 3/ l003/h0D3/Ph003/8-|M 0V|Ѝp@-D1@S@00tP919!03/03/D1SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p091D1S91P0 0CS910919!03/610616!0p@/A-P`eF0pH@@ CP1S T!R 3/0T10@ 0 0 0J`FP 0vC'0qCPMP P u !0 4!~pTdXmd[@ 60D31Q0@   D91/p@-@x`tP03/D1 0CSp03/ 0 3/p@dF`V 03/Pp@-@tPD!0R@  3/D1S 03/0 03/=!03/0  03/=!0 3/D1Se;11S/6!Q0061210/-!R $!$10(!21//0| 00Q  Q  BQ6!0 210/-!R $!$10(!21/6! 6!6!061 ltG-@ |?p(,2PP` T1S`ЍDP  0$` 06/p` 0  rp`ܑ TE 1TV 1T0CT 1 C T 1?A3c0|Ⱥc\t]t@{t Ze[@1@Xt@1(@jt@mt1(Mb?1S/,!t       000 l0/p@-@P,10,1@1  ` `0d 0 `0d 0D!@0 0910BRS91091R91@09109!t3/P1Sp3/0T1pp@- ?`1P0@ @003/T1S CP 0@0SpȺcG-`0p#0?0T1S@CP D(pZ  SPP⨏ZȀ F0P * 61p061 Y ( A6p61P061 $0( S S00@ 0990`1S@1Sp8@/80OτB 003A1+ \R? 6!@  6! i R6!@ =!@!051( `1RgS61>!0gD!0ETPR;1v011,1 ,10,1,1 ,10,1D!0R3003/08v/!Rs /1AoR6!=!@ 6!6!6!  S61>!061$0 0!1B8ȺccO-0 pLM?/@P`LЍ0  1S zBP P0 `pP 0unP0 n0`@0Sp̠L1S 3/P o!z`>0T1x`0d 0h0S < В0 ` dQShP0 h00&091@1 91091D1S91P0 0CS91091t9! 03/0 3/3 V? d2 !(U0@=K,!D0t0 D0@00$ )$ $ ($ $06$00`1C|1810<1l1D11 1181 01,10,1 `P0  03/`P3 0@00S-*eSw Rh00SZ=9 R = ?A3c2#d S 0"#!0 "#1R 3~?4Z MȺc[@MbZeTd+cEcxBp@-0 P"6 0?.T1Sp@nAP ?1S YU,1 ,10 Vp ,10,1S,1 ,10,10Ⱥcp@-@P 啺@PpeO-T!R 5AP 1!PR 1! A(0q 01pBR0  R<" 0"  @V`0@S @DWb A!  BR!V:,!K ,! ,!9! 9!D!R:9! 9!90@`FSAV    R<1! 0 03/p,! ,! ,!0@`S @D` BR9!@t4/,! ,! ,! 0!R p 0q3a 4A4qA!@ 0 2/@!  /! /! .!R .! $   h0A ЍO ЍcEc$0S/&O-T1S @\@P tPI03/0`S E ЍD1 SPf03/c8!03/03/`D1 S 0S @0V 3/1q0 R 03/ Q  $ P\ˠˠ \ Q  D!R0 ,!Le `V03/03/`j0Sf0S`Vw3/0A  3/8!0 3/;!03/ < @010;0a>03/ 0p3/ 03/03/P0,,0 3/03/0P 01 03/1Sa S`0 3/1@S` 03/s JQd]@TdXmd]@' [@ %\@]@]@c\$8%$$$[@]@%]@\@\@]@]@]@]@H]@+]@?]@\@\@x\@\@\@\@\@]@p%0@-@PM0  0 00 Ѝ0p@-HP0S p`@P 0ST00pTd@-U;0 0 t3/p@-I;@tP 03/03/p@-:;@]G-p@ `APCQR ? U010! A-P@` 0$ pE\: p X0 A\ ^G- P$`(p,00 N\:o AY Y@0 G V @ AT/C-@P@@0$M, (c 0`݋ЍhcP p@-PH0 & @4' P t1  0p@phc@-@xPt`$0M\p'P t1 0040 000p`00-ЍhcG-p0P 6 0`0'x0@U  Z40 0 0ȌЍ0 00:/p hcvd@-@( $0$$"6 0'@?hc@-@`Pp<<0$M(q'(0 00aЍhc@-@dP`p$0MH`X'P t1 (0 00Ѝhc0@-P$0M 0 0 SЍ0L%%@-(0 0600DЍL%%@-@9 1R0@-80( 4@"6 0 '$p@MhcA-pP`@9^ T 0pA/@-9@s@-P`9AT 0( `4/@P oЍpvd^@@-o/@-p@-9@R_|t191S@ @P !?P0P PA)001 $P3/@P @ ЍA-pP9T!t1Q<S oS#P@RoT!t1Q< S 13/PPT10T1S o#P'\^@A-@pQ (MR`ձS{gt1 ! R0ót1 p܈X"A1]S8Ì1\1S `1S X1SEB9p0 # *6p0 #**6p0@ #*5p0 3 #?0\!#b`1?(p1#X5X1%  /0#!0$+4l1t1h!@040A /0#!  0K E!1 0`10\10X1|pQ 1Q ipQ dpbp`p8 ( EP"1(0`1!,0\100X1401L01P0C N/X0X XwPHo@p(ЍA$(Ѝy^@^@^@^@^@_@_@`%%%_@%p@-P@Ro#Q_pp@-tA@ P0 _@P_@|_@p@-@R_EỰT1!0CST1S7gp@ap@0S$00<0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000@P,00AP@(0 $000$  @<05 P '13lDЍ0_@A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 tn9<l=D=Su  60 ,k9l=hml]衆R`@o`@O-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P DwnT-X=\R6 l 0;/ 0P4xV`@@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+tXT-X=\R0P  5/x0PX0 `n<T=X \S4 h `08/ 0 n蠆`@`@000 ͓0\SL+-p@-Ph@ Z1 01  hp@ZG-@}`J1吀011S #S3P11011S dPP 10CS1ue2P@cp@-@mP 10CS11_ep@=  -0=X T=\`S4 0h /D A-@P`}X= 0\8/  D=StpWom<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/a@p@-]p@1-P X5m= S-<Bj=0=0>03p a@,a@ 0!< 04 0 (   !/@cdddO-`@P0ȠY p3 ⓺ Lj ЖP U o%0 0 @ T0 ЍVa@\ P/0 !8 00 (  , !/@cdddp@-@P TO9S 9S 404 0@a 0 (p@,%Ecgfff1%D=S/p@-@=P0C==0CS=>3;3p@hCA-=PS`p @PVD=S@ 0s '=@S蠆A-@p !P`P  0P Q- 0T  \ClЍ0A S  ,6l 0  a@a@@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  ^0d 9S 0Q Q   Ѝ0  D_@G-0Q@pP0MQ 0ЍQ z 4=3/|7S ( h70?0?h70?|7S 0 0@a 0 (|7S H/ox"῍"0 \%  R # 80"^q 8Ba@Ecgfff1%A@-`M MP@P#EsP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q X؀P2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp 70SSp E /  ("( E @=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 00?7H0QN0 pN0N0%*:iFA-όp` 0P@sP 0 `kP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S* S S@@S@@n R 3 t0 g X@Ѝp@ S S@ S@S@@@Ѝpa@O-@dM@=S D=Sd?`< $0P"=0=S >S3;3dЍ9S9 YU 0S990090C9R0 .05 p 0 P 4 0 03/039Sb.030@]  aP303TW ?9S帪PU 屪PU 0S000000C0s R0(P 0 S30 03/>pP[2 0 4t 彛PP\"(0傿)0Rd-! "G\ʔG 0 D9Sㆍ P0S ` P 0!:> *00! 820a08/ᠾ(0"0D100 0>00KC19- S) 101/0< 20W(0 501=0$0P( `!0 h/d=  P 0 H00YXZ Z!0  b 0   0 PD10=   =0C== S-,06>0>p(e)b@p@-0=@S 3/`D]U'n PP `V|IhpT=X \S2 d 0``6/T=X \S4 h ``(06/ P NJb@C-CdMpL 3` <3 `0 dЍPQ RU`@ ,;0D?o2P0S P|ᙄ  4V00P`@UHPlDH3@<30G-MMpG@ l$PPnW`T$A0Vk  V7* V  V @-R u$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  H40 Y0 ۍЍ \ R\P@-R 6  -'4 P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!v0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0P Pl P9S9  09b sPP [@ VF x9i*F%?- S/@-@pP`,M . @v3"0 G,ЍC-3@@DM >  H=S  CR})9 N L)"" FPP> ?PP@ [0 l U C:3@PU0@0 `P3@ > Ud=;d=DЍSP-1R >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#@$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> AP=0 .:^^XW3XR=3 ,=3/@]G  O-@P@MX,=3/`P0@= -b>?oH-2R0S 9l&89d=0d=9S00`P  ?;< ?5989H-R%9" ;Sږo%#}> p ;:V("( ;t0} 0 20 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332 T=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  - 41@Q JUH=S 0 `Ѝ  H=S ?  00C0S00[2ӕ Q1ڮ۾=-  P  Pd `DdT-X \R0 ` 003/ j1Yd<`T-X \R" D 003/T=X \S4 0h `9/= [0=PS 0CS>02t`p@>S 0CS>02p@TH=S >S b@C-PpM+P@ `@P NЍ1Y0CYD1Ye 1Y 9 - 09 |94P@4 =#@=S M\1Y7 1Y . 7@P#@= S7 9S    @y S 4 t4P@3@ @\U0 @0 02W@P4P@3@ UH=S@2iii9iO-@=@SdM +P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0JP L0 b  T-X=`R" D 0p\7/=-0C==0=1 Y k& T-X R$ H 00\3/00` (0P㖯) 0X*7Bmb= 0.`3 ;3B& T-X R$ H 00\3/<0 0` 0 P▯= 0)BDb= 0.73 ;3 T-X=\R  0P5/` 0p`1,)S { S  BS T=X \S=4 8h `P#85/= l3  d=0S $P #0=00 S0"( #0=T=X S2 0d ` 2 9S8t$8W9Sp02"')`P' W70 ..0< p0pTp(p320@@00` P! (Tǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК 4P 3 "*8S00C8,7 ᧋L 0DcX(q^=9_ 8dP 0/⬢)` V%0 c ~ pQp  0H(མ=[8%)0$a= -JZ%8a=0= 0F&>=~)0 S$IBbPp `W  ^  ^ ^ T⼄ዮ l]V\]X] )W n`` pQ 0 /Wp0G'བྷ=[#)08B`~= -JZh#B`=0= ፊ0H(>=nf S0 0 042<#_0CSy0d=0d=9S9Sm `43/acd=0d=_H=S >Sh"PS 0>P9SMd=09`S 4Q`PEUP#8뎄 U >^pP>PqL 0$ 0 0$ p|L&00 02` S08#82́ 000H-Q0R RH RI x$`  0> hP``:g>  L0>YP 1>#F&V   01  ?& ,22?2 ?"LP0C.>2>2?5?# R #.,D2b@0c@c@(ec@c8dc@c@c@c@c@d@d@_@d@O- @ $MP( \ $Ѝ] 'VT=`X S2 d `P0\5/T=X \S4 h `Pp85/0D=0P0D=U_}0 4[P  2PXB  N,w \0 00 'x\0HeGQ R)m\0SH=10S"ld\0H=0 000P0 0d1!,2# 0L=L\( Z0(=v pA\0H=0dp0 0 1!ᤆ2# 0H-P=R0&SS+ 00x0  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=&H=S% %S0B [H=嬥嬕S L}d\:9"a0@gh[Pd:9ȏ"a@h 0$[& ~+ )+4),|04p@04\r0404043099!= 0 _P ^:0㠠 0I10S S2 ԊO베YH08 >PG0  SBQQ Q"< 1?0:H=S0 d=  0 !P0 d0מ0d= d-H-R' R RB d-Pt#Qb?d= d#Qژ0d=T3)Q8<9 9<9< (S:S^/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0T 0 Pe 0SbڴyX *> 2 t=2(x=6=⾀ᰀᱢO844=4!8=141:1:141=1=1=1 =7R@p1X 0>9/  %>pL1a  8>p0T8(}S/@-@L%T⑜-@=S> p@-@+%P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002י`=p": "e0@000t%@s%x%s%dt%dv% %%h@@-@4S@/G-3PA@,p0 <300 U SH墛bVHڛ3<3㓨> - 2X>00`V  j-P 3<300 UHG跛O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S ji@(%؊%%%`x%i@i@(%p%\%l%p@-@P):pp@-@4P P]p@-DA-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0RR03 \P05/2 ,P5/2P,` 6/ `O P@U! N P03\` &N6/0 ߩ`xp0 `VAHN$P@ 4N0P,N#Pj@2j@Cj@q%q%hj@Ij@Rj@#_j@O-P \h ( ` ,@,4/ R@ Wd%Ԓ!@-@0Q !@\0@00A-`P@0S P 0q@P Pr#Pp@-P@#$p@p@-0`@hPRP 0 \00 ,@,4/p*P 0 0 0 0h0 03/P 00 0pp@-@P+p@0,%G-P 10!Up0 0$C! $C1`(,+T 0 S0 (ЍG!0 PЍ#PP  0 P  0$PUPEcMbuk@O-@MphPG+l?#`P ߍO@+P$ \0W%p,,4,$0"Z:@<0 R80S@p<0$Rt+R80SOʅߍ"80S<0Qt0S 3/0 \p$7/ Q0 ,p,7/p<00St0S 3/0 \$9/ Q0 ,,9/<0 R@ 8 R4S@0"'0r0S*<00  *<0S( 0 'P *0"]'* < 'P *<00 Rp    *`mt0S 3/_02 \$0:/ yQX0\ :/0\ :/0 ,:/XP<000 ,:/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 03<3$Ѝ 4à@  P ^8pP pP#8 NMbEc %A-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`' 00 0&PP 0S  0  0` v$t08 l$U P 0,! p@u!k@\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#10/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@@$0PL p? Ѝk@@-P`p@@$0PL p啋 Ѝk@p@-@P0 \`6/)N 0 \`6/ NU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&> 0!d!0    !0G@cdddEc7@-@ &^0202020 DR2|0'@4S0000 ˆ2S " -" Ѝ0@M%% %%q%q%@-@P &@b@-&ƉPp@-@P&2020p@-@4@SS&ⱉ 0@%Ec@-@)&@/@-00 Њ Ѝk@@-@8Đ<0\ @/@-84< ,@4/@-00 I Ѝk@G-p@d尐PV㬀ʀ 0! $ 0    !&} 0!d!0    !0G@cdddEc7@-@&^ 0202x02p0p DR2h0f0000 2S " q" Ѝ0@葞%%\%X%q%q%@-@ &@覈@-& Pp@-@P&42020p@-@& 0@mEc@-@q&@7/p@-@DP0`,0Sp$<//p@-@Q P`00T0 0 00DPSʁ@p0C0Q/ P /P  /C-.04@5 01D`00pP$M ҀP/0. $4"4H#8#8SA # SS $#0CS0S1 #S- CS" BS(  S @$@埂$Ѝ S @q"S ʤ"S ST00 S x"S(T(@#h 4T90{@TT D" 8C8Sm  SF  BSb  S  S0ST@#  S  S+  S0S T @# T@#0 Sʤ&!T 1 #S@0ST@#d 0 00S*T*@#4 >@I2,pS$妆0 $09/I2PS$Z@0,@<UiPh  T 0@0T00Ņ0{@0YP8tY9ƕqJk@  l@>l@l@l@l@,l@]l@vl@l@Bl@@-0 0`( "4`#/0s@-@Ph0p2(`l 6/h2 4l0Ѝp@/0P/0?0/ D00H(/0-#20$A?0R  $$D 0 QH$ /0/0 0H00S00A-0TP@0 `p 0 w(T0Q 0000A g@-#@R 2S00H[0\ @UA-@P` p 0  J0 0 0 0 >P(8S_0 A0 /O-`$MHpS00H@ H(8SZ@2W<7 0SPX 000 S0 Z0%ZZeZ P0PE000C0Џ 00((0R0 0(8S0Y   (8S00R2(`Z 0 㼏 @0W   P @(8S W0000  oQ0 㘏0  0p0Pp0 p,p(`L0P$ЍG-D0p唨Z b@` 0X0T0X?  4XP 0  `(W`( 0Q 000( 0Q 000(8Sf  0 `202P02 0 -(8SO0( Q0000 $Ѝ0s@-@_Q 4h @0 400(`p2l6/h@0d` l6/Ѝp@yA-@0MxWe` PČ T $"d% P ʿ/BPA  BP@0Ѝ %P3 @ %P *BP PQ% G@ PU $8UQP 40 8 0Q l$\`$0ЍAU0$8U84PLQ\ 0h0p2(` l6/0hd` l6/0h0p2(` l6/h0d`0h0p2(` l6/h 4p_Oep@艁~G-D0P唨Z w@p 0X0T0X?  X` p0  p(ۋ`( 0Q 000( 0Q 000(8S  02`020㷋X0 ` 0 寋(8S0( Q0000 㛋0h0p2(`l 6/hlP0 d`6/$P]~Ѝ0yO-D0MP.008S .04005 XpX00p 00X`@ 04T 07 00000 %(8Sw 0`0G000 H?(0P 000(ȕ \Ġ0 000 (\0 `0.\ 0 ("2Q0 0(8Sv40(8S-0(8S$"0 ,0(@C`p0 0((<RC0A@@-S>  pBFP`"@0Sq@P&0T*01S\" <(@ <80A0(P徒1 0p@-0DT 000?P  @-D00000 T ?P A-D0`p<0P@@BT0A#6T@1@q"@V:YPOV  00(P异1 0`0`F~@80@~G-0T` 0 \p@` 0P e( Q0000 X(8SvsP /⢁0P 0S0 0 0  0 1 R X0<( <8T08( 880s00aR1 AG-@ស W~HhP<V P $P10CSp!p1W000$0yL0@ 2 Gq~P 1 21PEcL%D H(R/ $ yO-M0P唨Z @ 80@ S 0S S@33P0@Ѝ`P@  YT`yP@&0X 00S :"; p&pP 0Xp 0 0  B/o"   $(8S00(8PS0(8S 0 0iY Y Y 2\@ 0@0$屇P@O}$82TP080s0S \9@W }<80$ذ", (88S000 4,48#8? \0 0R0  0$ S$ $0 ` S$ $0 X $0S`Pun@O-D0,MPQ `RT 0H00S00DŽ\0s 0 㿄((2R\0X@0X00 @0 0H00厄:~#:0<0p 00`@pQq0X 00 000(00㇄\0J (8S0(8Sp0p(8S0(8S0 020(`#20&a?0R  1$F$00 N\0 @ 0\0`00`00 00$0 0=(8S_0( Q0000 ),Ѝ 008$ 0cP :#:K 0 0PW\$ fZ WQJ 0$00\1 00J (8S0(8Sp0p 0(8S0(8S0 0(`0020#20&a?0R  1$F $00⽃\0$ @ 0\00~p0 (Q ! Z0G-D0.TP@`P pP 000`pX 00 0 0 sP Ox<800p@#.O-@P,M87R\ hx dx  yA>a.0 PSP.PS  (X-000㘙 PP PPx.D+ `pIp&"0H pP57XV`` $600 ,Ѝ 0 ,0p$0Pb2,2 [[0 4P/ ( Q0000 ⹂P ( Q0000 ⦂P ( oQ0000 ⑂ PPPQ)nV 9025( P 0U000E00140(8S 0 0 PV?UV⯄0(8Sr2 Q,0Ak4<P0eH$a X P81S0h0 (Pp2l5/h1dP l5/G0Pdh0 (p2l8/h dl08/z.Y\ Uh (p2l9/h1d l9/U 5h (p2l8/h dP0l5/dQzPhP (p2l8/h d0l8/d=zhP (Pp2l5/h0dP l5/ Z<P Y5 VP   `h` (p2l9/h2dl2 0j 0  9/h` (pp2l7/h4 dp0l7/h` (pp2l7/h4( dp0l7/h` (pp2l7/h dp2l7/z0hp` (plp29/h d0l9/$04yb'yN@ @h ` p2l (:/h 04 dl:/h` (`p2l6/!qhdP1@ l5/,8 04<:0PhP (`p2l6/h0H d`l:6/hP (`p2l6/h8P d`l6/ZyhP (Pp2l5/h0H dPl5/0 P$8EyHPU$#0 0d000hP(L(0(Pp2l5/h 4 dP1l5/0t2n@4%n@n@n@n@o@(o@to@@Lo@s@-t2S P@hP (`p2l6/h d`P0l6/hP (Pp2l5/h0dP l5/Ѝp@A-P@hP (`p2l6/h2d`plE 06/hP (`p2l6/h4 d`0l6/hP (`p2l6/h4( d`0l6/P8S hP (Pp2l5/hP(0dPl0 5/LXUMPphpp2(`l 6/h@0 d`l6/`xhpp2(pl 7/hP0 dpl7/2tx0P8L8Ѝs@-4@L8PS0L8P0h0p2(`l 6/h d`l06/2KxЍpA-@P$ o uXUP M2S 0h0 (pp2l7/h2 pdPl 05/@'uЍ@P/ 0\R/@-@ 0^   \R@-@0U. V? X1 05Ѝ@0o@A-PQ+ t@pT'P P 5`0d 0\0 @P 0t000 0 Ѝ@o@o@p@HBp@ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0$;(8,5.`i @eߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPn\0 P0h0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@00V@0 00W`V 0  @0 4 i0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

H0 0<00@-P@M  H @  rЍ0O-yM00 00P0x0S0pCU0D0y 0` $00(00$0 , 0 00`0@0 000x  0F| 40F0 000E4  P 2  pX)0 X7P$0 E80P |2  pX) 0dE X#P(0 ,0$0` 0 0@0050 0800x  0<0| 0F00 $TP ((P P l1 > pX(0 PXP $EHE0 ,0#0E0(0`0$0@ 0 0000 0x  840<| 00 E P | JW(PpW@@#x0S0S @PdH(D0SSU0SS Px>(yߍ@q@r@6P P /@-P3*/s@A-@pP0SUA@0A` `FV`! 0PE@G-@P`0S 0X  P @0PEp pGWp! 0%H0ppGWp!P H@`FVO-PDM %  !  !  ! "+P%PP0#0P%PP! PP0!0#$0P 00#$, 0+<0 0"00 0#0@0+(0 0"0#,00 "`@ 0,p@,`P` @`&! @@$$p +! p p' p' , ,,0, '00#0#0#0# P(`pP!!@!P P%`#, p'p@$@ `! @$0#0#4(#0% (8,%p# p'p,$ !$@8(& @$+  4!() ,, 0,  , " " $* * 4 P< . , 0 0#!.(P%P%+0# 00$ 00#0#08000#0#0 00 ,,0#,0# 00DЍt!t1G-P@  P@@P਀` ᩐPP`pP0 `0 pQ@! P A, @.p  q)1 0` p%RPPR$BpP@P@PB! ,"0 @ @  說UUUU3333-$M  $ЍO-RM  RO R p pG pP` 1"A0 0`TT0000h`ᄡ0V,`0 0`T0 ` S@F0@ S 0`` P   YߍpV \ t@UUUUp@-8@8P`\p 1001UUUUO-R`M R. R P P& Pp"Aq  TT00 0F[`N`0   T  WЍP[Q 5t@O-EMP@PC 2 00`$00r(0 0,00 0000 0 0`pG0( 0 V000000 0 >0  >2  >2  >2   H  Eߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/c00 0/cO-@p`PDM P800,p($@ @@ @ֲ008 <0,(p$@ @@ @DzP0 P000<00,(p$@ @ @P< ⴲDЍt@,J&A-xM@P`` piT00H(0X 00 000000~xЍcA-@PM TЍQ  0`P _%pq P V yP@TP@P 0P0 `6&0SPPPP 0*&0S(  J%t@u@(u@c6u@cQu@gu@0/c @-7  @-2  @-- @--  @-(  @-#-/c-/c-/c-/c- /c-$/c-(/c-,/c-0/cO-M @0_0 00 S0 0SPq020`0 03/  003/ 0  K0C00 <,p 003/  0<3/00 \00V 0(0,0 !" 000 03/0@0 4/ 03/ 0 3/@@00p0  l02"  CP aP y* 0 9x0 000  $0( 匷0 H@c6cz@z@O-@p`PDM P800,p($@ @@ @008 <0,(p$@ @@ @P0P000<00,(p$@ @ @P< DЍ@4]&A-xM@P`` pT00Hf0X 00 000000ἩxЍcP P/@-H@P 20P0 $!0 /c@@0/c-/c- /c-/c-/c-/c-/c/@- 6 Ѝ@- . ЍO-MtX 0|O $(,04 8<@DHLPX0|Pt@#30X0T?0p0p t000000TjX0?0l0q 0D@p0d0T0<4@0P00P,`0L00d0 0H00800[gx0h |0p 0`0t00\00 0h $ x0}(0y,0u00q40m8 0h<0d@0`D0\0H W 0d R0L M0P H0T CX0<@ Trl0[|:Ѝ\0 ` "a:`(#\ b a x` `,n`(``n!  <pd!a lza'dal*`h쌈!a `ja&aa#` )a*|n:a#an*a,h , \ b,(b)lb((bb,l" , ` \xb,'b )`zb('b` )b, `ld b& a , bja&a̠adb*!l,AllQx  0l0l0# 0($0p'(0 `& ,0x `&00 `& 04 `&8 0`&<0 ) @ 0$`w&$|D0(`p&(u0H ,`h&,m0\ 0``&0e`0L 4`X&4]d0P 8`P&8Uh0T <@P`G&<L0@@00T0D0S !&.L<PP &> 0S !&> n&>ş 0S " &> _P0p0 59/5 0S !%tP p5 0S !P5<< 8$ş45 0S " 5 )P0p0 49/4 0S !$P 4 0S !|4dd Lğ`4 0S " @40( P0p0 49/4 0S !#P 3 0S !3 ̯tß3 0S " l3XP ⽯P0p0 83?9/?0 0S !? dP ?0 0S !?0 ▯?0 0S " ?0 ≯P0tB0&.088/&.8P &>, Qs/&>mP&.00!08/!P 1 T!1NP&.j00x!0x8/`!DP H1P0 5!01/P&.K00!08/ P 0  0P&.,00? 0@4/? LP ?0X8 $ ?0 Pߍ蘄@@x@6@@_@@ 0A-aHM0 @1P4/@ #@P @0 cˮ@ 0`00 !p7/@ 1{Pp @0 q⵮@0pp0 `X0 6/ e`P 0, ?⠮`HЍ蠉@<@6@@p@-`@pMP堶 ⣷ ⟷`a R ◷@Th QpЍp07@-7P|@~ Q@00#47 b0 P Q07 Ѝ0r00#4p@-@P`\08M 00 00 P  8Ѝp@-t @ 0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 8_0 p0 P@`pPtЍC-`p0MMPStX@pP `0 (`(07 ` ``1 N 7 (%`VIM0bP ⿵7 (¶ G {7 (wh s`⦵0 `0姶7 `⣶`p 0b"!4b4# 0(0 7  (p0h 0p0`J FMߍv7 (yɶ ( `F O-M0@, ? R$0(@0 0$0 0p t 07 0001  E0Pppn0ERt  7`EPS0婠@k0C?o200U 00 Q @7 t0 4 t# t0P  U0Q00pp0 Q@0  7 t0@ 4 t0@7 P@@R tRY@0Z_0S0}$Ѝ蕋@(@g@@p@-l@P  ! ,ap0@-,M@PT 4\0  y  000Z?,Ѝ0DJd@ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddG-pP`4AT , LaT@! PU,QP N  0 0  0< 002  ,QЍG$c@-$M`||p0 @P D0!4a000l  $ЍDJd$c0@- $N @ ]萇&$c&@- Ѝ@- { Ѝ@- Q@L@P<@8Y?P@(@Yc&&Ldo@&@cp@-X0 QPIPP 8@⹵@??<> \ SSpcLdP P /A-`@0S !S pPU0p $0WD0P P0D00p0H0 @0@0SPP@c&PdLdcp@-@uSP?o 2R0SU T D00CD00S   (Sp6  PPdLdך@p@-PHNSD0 @T0SpP@ 00 0Pdcp@-@$P5S 0 0C 0 p@lSLd@-@(S 0 0 0@aSPdG-Ѐ`  FRp@0SP03/PPV0$0pPW`SP p@V(0$ 00Ld`dEc`&p@-\@RPU 00S  @P Sp@Ld@TdLG-RP 0$ R\ AAR3 RA @ 2RW _2C6CR00W0P@  00e@e 00E`P 00@|R j@`RLPAR@T 000@0R< ApRPU 03/@P$01`0$0@00S $00ꠐWRX@D` `@|0 pD0S0W0T0SP`@`  W|p@@ww wTdLdcPd@-00@T P@ Ld@/@- 0p@-P@,PIW 0R!p蔍dp@-P@P0,`000<00@Գ h+<@P P0 @WPpp@,$p@ʳ&p&l&p@<&@@@-l 0O-`pp@DM!s0 00<0,(`$  pP{<0400 ,0H0z@  00!(` 0 $ @`pdDЍp@cp@-P<@L0,`P@004 S V 4 p@$!cEc@@dP/P0/ᔍd@-0 ,q0S s<00,[Ec@- 0,OEc@-0 @  00 P P `PP tu Ѝp4 0PP PP$pa ꔍd%@&/@c cQ@4/0|'RI032S 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-P(0@Tp0S @, cp@-@P 0T 00Q 1SZ 0<1i1Jp91S!!1! hfP(0003/p@7], c@d@(e 0P 0CP@@t #/d @#/ N @@80P 0CP(0P #@// ̇?0S@-c. QAAL0Q Q 0 0,1&'1 0Qʜ@Μ@ P P/  N /P PP0// p@-`%P80@Tp P @, cp@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P8P 0"pA-wn0@S!P !R d"00ЍQD@2厏1p0! R U T 0 S1S !0h  REVv|@WpS 堁Q 6Vv1Wp舄U} UyLxP qG PLM0 S'0 Vv|Wp'e 0! R U!VV0 S|Q0!V&R! 1?0|8|Q| @A@@ʜ@@C-@p/z[2 0iP>05/cw^ M0o`000S P0? p /00p W`0S1001^n80 Sd001c00N8fN0S00d0Q00@Sg/1!p11S4H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 SA 01 1S  0310@0xj.1S(01 ЍCb(e@ʜ@, c0 cd؝@|&0.R  "-" R   wP/P/////|0R 0\ R\ !L/P x7S0S/ᐜ@@O-`@u_Pw>0S4 0! px0Sl @TP P W $ 00 p4 cƞ@@@՞@p@-`@%PP0p@ .00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;@@O-@0`pTM 0<^0 9d qw>0S9+ 3 a0 Wdp7  0 Odp7  0 Gdp7  0 >dp7 0 6dY YpPP0S] (RDFdX 2 0PT TЍ\I0X0 S0   0P 0p cp7  0 cp7  0 cp7  0 cp7 0 c0 0RʻP 70A  `P( 0 S0 `` cp7  0 cp7  0 cp7  0 cp7 0 cpm@@B00 S   P 01А/᠜@G-P@PX"B-\8 Q2 +Q  Q/ QwⴀXa` 0 S&100SP6 P Q$u?0XPpQ0Q Q 00 P PWP2q?0^ PP00p |p  ppWQX" 0S `P48S|74XS h0|w7h78 TI:J4`Vh78h7|@J0000 000/s@-@d ^1 R S00#0 0S0:1D!0CR 0 D10D1! 0!0 0 0 00 0%00n\0D1S 0S00 000 R 0D10CD1! 0  R0Ѝp0!0 0  @@΀\Q: / AA!  ////p@-@8 MQ1 1P 00#!" 0 0000 `0V :3/P 1 p 0L 10 18003/@ 808003/000<0 ЍpH@S@@G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::@؍dD&&&&0S4 ( QQ  H/Ǡ@؍d0S< bA0!RR    4A!/C@؍dP0P//؍dQG-@p ڐ1 0  $10$1Ѝt`PXQ1L(10(1<1P1 .0 Y ,X  p7岠`7 1  0 `W p71 ! `80S0S% `03/P1 H!A0 베,10,1W11!1P10o0 8003/ 0`R ᤚ0 9/P  120!S 0! t I0v W㲠`0`4!S 4!j 4 W0f c0000h@؍dH@i@_@p@-@P:3/:3/p@-@:3/:@/G-8p(MW$1@P` ᴐᲠPV0 0#!"! 0 03/P1 0 00R0000 101(Ѝ \0R 1 <  101 :(ЍG/H@@@C-`@ 1RP~P1US^1 U0 0x1 000P Ѝ08 R<8 0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*dw@P  # 0 3/P .w@ꤥ@@أ@C-Pp(0`S!R$  X 0@ as0 0R@@@N@80S* wPU 00 0@ Ѝ (0 S*!R ,  $03/P@@/A-`P@HM pk&40%JV   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M:04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p ?*P`Ѝp@@-0<S !  0 b Ѝ0ꔤ@<@-@ P0@00̤@/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` F%ЍpG-R@P<M0 % ` 1 01(ppG0G  0mm P 80R  $Ѝm$"P//O-@<`IMP 101p     000 S0 0M>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  O0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍD@D@A-@` 1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  QN0 "IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #D@D@p@-K|>  0 "000e $P$\ 1 >  0 &0C   0SH Q1S=Y 00 0 0S9x 0 $0P 0 P 1 $ 4J0P HJ(= G CP 00[0Z0S  rP   V%PPl 0p000[|7S0E00S0S !R 0<<0ppW9p090& 05 !# #^  #P  R\ Qʐ! +0 00 p' l000101p0S5 SE 1S 0 0D; 0Sp10p180080|7S00S2S14+ * 00?B D10D10 q7/00` 00(0 0pP lP 0`00 01 |78*`S,0X 1 8*0 Z000 03  0   P1 90R?C0C?0000`zX0@0. h71 H)00}?B '$00$0101Xx8S1 (00Q?B 000 00 0 2S1 ("00Q?B 0 a6/ 2" 0 S!-0002021 HI!= 0xS!-00C02021  HwI!= 0bPQ1Sz 3/w1  HaIP1 8M HQ 0SH1L1 P10CP1S0 900S000000 0P0101? 0t 0S0t0`0S*j`P0`  Hm0S0S0S0S0SXGKgI0 0Sp S SLXI RE00 4(04$0$04Sj `Y (0 0C4!<0V0` 20 %S ! ( 04  C00010100`00$00 '붡0 ,0$0 00SG XOj0Z<0倀0<X ! Z /P   )P 00#@ +j,0S 101#j000f(`h(0 0(00嶡$0S `|V0`+g080 R ,003/P 1 # ?B B2101M00 0@00 G~f2L XP40  0@004th0 0 0040a6/4JhZ S  03  CH10H1EHqW1 HF n*L10L11S 3/0SL1H100PHP1X7S  H\F I1S 3/ S  HKF0 709000000 0Spp0p 000O-S@Pp`MD #0So Sl 00 |7S7S  40040T@S PS- 1S ?-Cp BP000BSh S] S70CS40040500CS 1 ?/0=>C( 0C0L00L0"h7|7S2S 0J S1 4?D/Gr0=>C!0CL00L0S 40040Ѝ, T⿰0d0252 5$YX0Zp0S1 =.Gr0;C!0CD00D00J S*1 >(.Gr0=>C!0CL00L00SS  2St *St 0S ! -00 P00P0SPn xl00phQ1 =-Gr0=>C!0CL00L0zx7S 0450!0P0C2X00Z0Q1 <,Gr0=>C!0CeL00L0Wx7S0X0Q1 <0,Gr0=>C!0CML00L0?0`0H5Q0[0 1 0; \H00H0Q  04 8 <+S0S JP |~0S! 8+0Gr:!H00H0l0S1 \:*Gr0C>C!0CD00D0 R1 *Gr9!H00H0X VY1  D*Gr9!T00T0YQ xQ 1  )GrX9!X00X0A=P:1  )Gr9!d10d1xU !/ ) W101<00<0101|7hWSPm2Sj U   Pd d7![0R 1  @)D[ 71w. h7R7!66h7[071?%0#  1  @ D ?w>0S)  45?|Q 2  yP5`0S ;!0:1h7 0 000T0"08U l7 ?l78l70 000T0"5   ZP! T P 0`P00 0HP  x8Xh'* 13/?S PT0- d|wW 7S 40040  0 RY/1 5%0N>C 0CD00D0BP*1 @5P%0=>C 0CL00L0P 2P P00S ! $04 zH00H0lZ1 4$0C 0C-`00`0x8Up W - pPU 1  TB 0 00 00 1 p2"0U>C 0CW   IP   -P0P a6/1 HR  ,2<"0=>C, 0CL00L0㸑qἡ  @}B 0 xph:S  0 3/P1  B 000|7S0 a86/h7 1A &00Y>B l00l0|7S0 a6/xYE1S h 00]>B J@@϶@@@@ @!@4@G@]@@@ @ @8@X@@ȸ@@@@@X@,@H@@͹@¹@@@@@@@#@F@Y@@@@ͷ@շ@x co@@@@ @(@L@h@PP@@Ѻ@ 0 C  ! 00 B000 0|Q4px0p 0S0HP! 00C0\!00 0- B00000S 0GSX 1 !O00]>B 0S ! !0 0M B|7 "S ! "00m Bo7S ! h"00} BHW W㐑D  2I/Cp BU0000x8U,  PP` 2 020000P ,.1#  TCAH3V P 0 0, a06/r2 f`x8U f #00=B ],P^ #(00=B o P  $>00=B h00h0H(4  T@` Z7S.W) W7,P *0,0Z 1$  T@ 0 x8U<10<1h00h0 1 3/P  , 0 a6/1 |5I/Cp B000Q7S 13/Y 0S! %0J?B y000|7Sp x0p |7D&S ! h&00 X7WS 000x8U   PP 2 020a6/1&  TI@  6 0S }2 q7WSZ 1d'  T+@ 0 x8 U<10<1h00h013/V 1 3/O1S 7w/C BOd00d0|7S?0 a 86/7 W00(000 0 I(S1 t8d(Gr0=>C!0C)L00L0x yP 1S 8(Gr0y>C!0Cp00p00S"0 $0000 0" 0A S*1 X9H)Gr0=>C!0CL00L000S0 S  S   0Q 0S"1 9)Gr0N>C! 0CD00D02S0 S P P$0 0$0 00S! p*0Gr:!H00H0Y1 :*Gr0H  0 a6/,000 @ D )$ p 0R !j 0<-C Bb W1,_ <p/ W00Z 1-P =E.C BH0A,@0P !@@ t=F.C B80 G  00 Q0  1% =I.C BD<08 8 <0 HXB ipG p 1$. L> >C-B 0 a6/000  C !0pp$W,1 > pM.C B0L 4P 8P <S 0C?o020\3bqE0p01D/ d? ,B>C B借! 0?Q.C\ W1/ ?p/C00Z 1/ ?E.C*0A@0P ! ;F.C0 G  00 Q 0  1p :I.C B.D<08 q8 <0 HXB i pG p  1D*R D: >CK.B  C !0pp$W,1; 9 pM.C B0L 4P 8P <S 0C?o020\3bqE0p01`) h9 O.B>C BLL00cWF01 441)  T]=0 00S8C0FD CA@8,P '0,0,01S  T7=0 Sh8C0,T 0( a6/ox00x0]00 /Ph7 1S  T =0 S7C0Y0( a6/C|00|01000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 0P &0004P &$04020|7S7S 400400LS1 464&Gr0=>C!0CL00L0꺁xXX 1  T<50W 0 0tx8U<10<1h00h0 ᐕ 0\Q<1 h5T%Gr0N>C! 0CD00D0LP*1 4$Gr0=>C!0CL00L02P  P P0Z   P0S! X$0GrX4!mH00H0_0ḡἑ  1  T<30W  0 0x8 U<10<1|00|013/;X㺯ᴒN  pH 202-wh7Q / ? 67Qh7 !, h7R7!66h71  T;Ÿ h0WR 0 0    Ÿ   13/20276h7'0R40040 0CS1 1!0=>C0 0CL00L00q001 01P400401  Tr;0 ^|7S S 40040 1 3/x8U 0q00101 P400401  T?;0 +|7S S 40040o 1 3/hx8Ue pa@ @(@L@h@y@@o@ջ@@x cX@.@P@@O@x@@@x@@Ӽ@ -0@-@PM0 0 P: 0Ѝ0@Ѝ/@A-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0 !GR # D1"022222220 " 8," ZN292S988-#87 0C2c70r0Q   ׹0   04Q   ̹0PP0C03254ʜ@A-P L0R8pL `@f|'R"⭹(R# #0 83/G?G/ @0?@D00Q0000L00 ≹00 R  ⁹001H0O-`qF尡MT9 0 Yd (  00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0D!GR # <0S/S10C1ߍ(0 , 0" R 0Q   0   0" R 4Q    WP0pG@ʜ@@-1CMS@CߍP` fV@P p  `P 0,ᜤ0Q    R,!0R 1Ł_W@p@-2@SP 0aS 0 6/p@03A0AS@-@e ⷸ/C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍCV7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@RUPPa4VA  MPP` 8. 0000000Q<<0 0 0000W P00'  0R 000U @ mVPDVOxc nڷ  ᄣ xW3"_o`/R χ166S1 000P U0!01S 13VP-"TЍCTЍC"1S UPP  `P !ZR !ā B VP2괁X TPP  `P 2 01 SP0} pl 0"P1UP0UQ ! `(0PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/0@@;'/'@0|7S2S/004 S00R  0 u0000/A- MPpJ!%@MT`Pl0$`S9 BS` BS!? S* SU  S `Y$02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C V῵@`U0"0t"]0h7=$`B000i;0d 0k ࣵL 000X@ڽ@޽@*-OYe0'G-p M@`'PR`P0'XHS^ + BS*? S* S  S `@'?;CS00$'S?  Sj BSX0Sj p7 h70h7s&Sc 5, BS  BS&?;C0CS0&SDX @0SC00P0S Q>⪎0pⲐWC嶠C ̠ @0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0 Ꮰ  (״03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R< / ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  |x7 ?op2X  0RQ ÑVP P6P   Q A0 S - @%>@EOB@O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO5 ?Q0 00 0p0PPM.x0@FS00>Q >Q F0Q0 0CSf/4PP/|>Q7S|'R h7   ߞ0>Q $ QL >Q>|ЍOh>W0.|ЍO>=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8OPPH<0 SPo;XK=0S|7S=xhY >⿸PYp:3/0= 8PP <0S0#0$" 0#0 < XOV > PP 3S>ñ:3/V H4U< ' > ` `PPXqs`~!Rj8OPP8Q|7SxH 9eP 1P|Ѝ 9 5 @P DQCA!*R;8dOPP80SS*0|7S-9 iR B0<PP" @P>0CS|7S < @P 80S& < |'R R0< P  < @P 81#3/ @8 f |7S PpP P !NPP x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> fNPP 8⤜x7 ?o2x`QQ 6P  x@Q @A0 S |Q x0@`P|V` x01@0S S2 Q_P|Xe 8ⶰ03A0AS7SP U|7S cP 13/P]!R8zNPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4SPP 03/P Z0U 03/!R8MPP  8 m 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(RiiiP@i9ii:ii8i8i(7io?޾@@) 4'@1@7@@ @* *;@ʜ@cA@@cddid! 8LPPj8` V#=0 % h9nx! 87S (#8 9_! 8MPHx 8  0BS !R r39S0S0 p Q ARQz0W8@   R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0SD@pX0 0CR00h'4PS4400Rh7VLPP 0 0Hޮ-HAP h7~N#2000@000S@@T`'8 0PP0T0 T=MPP  > 0S p7  h7 ; h7h7 ; h7N50000> 0 ␮ ݴh7P:: x℮1($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S|j|ЍO^0 00 0p0PP- |ЍOHL@  P   03/P!|ЍO[ꔥ唅唵Yʀ 0! $%0    ! @aRa/#L6PPWa/ᮙ 0!4&0 !    !0G-@M,00 `p@(0#00a0$  @<0P mP0(0(0 0Q@<0$  a,@lP<  @ЍK@@A- 8MP4/ ! A0     P,`p$0 0 a,(P @4 l0P! @   '.$00 0 ap,(P@4 l0P P#!X0X@XP R T:8Ѝ4 03/dc'@P ceBB@C-MP 0`p` @P0 0 00 l00P 0@ 0 gh?o2P@@T?0PЍC-p@P`M(` #X0  z0 000000X007hЍO-QM0|MЍOkQGR0 0P0p 0p;/o0"/6$R ʀ  !Ā .! 0 @!( , $@TR$@lU 1l #T   $`Q)  S  @*Q PP R$@M @(@@ P R$@iN@xP R$@@,@ ASXx( T(Q@, c@$ ,@Tu \ P,@$ ( x(Ri. Q - Q UWX H0/0$6 3DK <Gt20!R0 o` BB!$ PN 0O 07!Gq "|'- "bt x  !D!(/( # 4)%)M/ )6! 0`2$,(p0/0H0E  0<0@ jP| <400 00!@0 $ 0,(p<0sjPe <0 00@!0 $ 0,(p<0^jPP < 00@!0 $ 0,(p<0JjP<> 0 00@!(0 $ 0,(p<05jP'w> 00@!30 $ 0,(p<0!jP 0N@?P!$ ,(p @P<0@ jP  A \Ѝ@@Dc'F@P cb'@cl@-@᭳P៳p@-@`PUp0S00`00C0  `L-@-0 0 Ѝ Ѝ/@p@-PP UlU`I@P I0000 ( J@P@p@@.C-1P@`p x8圀QH'+ 0x8 S QVed0 9X|! Ѝ BV0 lg*X@@-1P@` x8pQ0Gp* 0hx8S 0 f X Ѝ@N! 0 hW Ѝ@@@-1@  0@ iW@O-1020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍA@ʜ@@ ) @0) 8408008,08089!= 01/t'ht''r'r'2 029 0/202/@-80000#Q0Sl78l7 .0 0 ( ( #- x Ѝ1@-@ h70  (0(0Rh7=h7l78l70@$@+@p@-@P83/p@d@-P` PQVxw- w> G" !@ Br 00# B1  h @0@ GG?0@ Q  Ѝ7SD10A@ Z@e@v@@A-`P8p3/@P\00\0  s@-P8 `3/@P\00\0. 1 %0  "x 00x822x80!H0003/090020T100PЍp@@A-P`8p3/@P\00\0  x8 0 0x822x822xx80!x8 99p@-@P`7Z@ppp@-P@P xG G⹤1S 3/pA-P@p`000 ⡤ ❤ ♤0?0?x80101 M? 061071 N? (Q 4 $Q 0 0 ,1SA/@-P ` pk@P 00 0t ЍA-|7PSS` h7M @ iN@p0 R0S P@xH A-|7`SSp@ h7] P i^P0S TAT20 R0S P@xH0S i V1Sp1 $0H0  0#PԬAЍ̬@A-pymPG|7 `S 0 xH⹬zT |7SS @P ⪬O@1 $  0!R000@C-P@@@`p AT ݐ  P01SzP1 X$40 $0&- Ѝ@\@G-`X  pR 0S R@⻩OoB@PU @ ⨩P 0R01 S  R 0S R┩P0 P0T@`C-p`@P }P@T Ѝ0S lP1 #0t B0    AT  QP0S HP @@@A-P@U, pT&P ЍA0S0S i V1S1 #P0 !f 0!P ЍAЍ@@-@xP 0x8i <P ) 0<8HP# 0H8p@-|7@SP yn089,82xxXP 0 022220000990{w>018|'R 13/p@A-1@`  y^|7S118889,8  PPp >(# 7x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGQ تAR@@@-@xQ `P 1P P 1  r<10<1ЍpⰪ+1 "h'0HH <<8 8 0 >Qh7@A-@M|7S< pin  `IVU 81V6 S2 0S! q , !RRPq ܍A 83/0<0!SPRC57S &1R6.S ( "|7Sh7 8S|i^ P6Sh70h7Phs܍A"U i^` P:h70h7Ѝp@4 c$@+@@O-M80i~ 0<0p`P  0@P 83/@P\00\0 x8 0 0x822x822(7x8 991* h7' !000p 01X'r /@1 zq? sX 000 h0SR c00S PZ R 00 ȋ 07 0 0 0 000?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4n$Q0 0h0 XЍO20 [ 0Ѝ<@x c\@@C-`@yPP ⾙08pS% 4(Y" U a !MV T  `P1 ` 0@0C 0%- ЍU` @@A-2@P !m00C02021 : 0  `2Pq 02HQWP,RP ,PPAPAPAPA0SH1L1`P10CP1A1S 3/ @G-Pp```0V x 'cG@T 0V ` 9/@,@ v'A-x2!@0SP` 2 L9|QI0S1 $2Su :0S 3/"<2< "!0!-200C0w>0SX? $~Q A1 0 lY0Sp7  |7S 1 4 &HE2-~Q A1 `0 10S1  &h76h7p7  1 t h767h7V @AAp@h@@@@@8@W@O-P`|7MSS00 0ppp1 p 0%0W  A@tЍO @T 00Ѝ0W p|7S2  0S F4"|0 0Ph@00x8S} 0 0C8C80Q Ro P1S: 00! 00 00HP 0SH1L100P10CP17@H1S 0 R B0 Y 1  0 g1P 0Q113/0Sʐ1  0 X Y2S 0 ᬑ9/000`)Sʐ1\  X 0$ 9w 8LS@\@@Ec@@S@,@C-2@SP`M !Ⰰ8#8X 0 q7/ЍC`< p 92<2<! !000w>0SB p!,20S 2 hkCWAⲂ0 ؁P 1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 0 GP202~0001 0 7S 1  th76h7? 1 P eh776h7rpq@@&@,@1@@@G@@@@%@A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3k@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 4 0BAP00Qp@@p@-PiN@ @P`oxh.VxHp 0^ 022220000990?p@@@@-!]0!@S001 Ł<>HP1a 000Z.  yGj f070$8@1}p`Uwh,884X YP10XQ 00% E 0 Ei~  FA = 0' 08' jn P6D'@7<7f(Wox8 p  p'    H ( < ) x8 k Ѝ@'@u' A-pʀjPxQ` 0ES  B2U U U ,U UPPH$H@㊀Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ ]s000 0t u"    @v w 0  " @x 0S @@p@A-0 0S@P p `*|7S00 0%  ! 003213030 0        @t0/C-@`Mp9PP000$| Ѝp0 `ݐ0=0 H02 |7S0000(001011 `ݾ0T A   W00L7SPP7HWLW0P7)@-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1H0S "N)R@O-0LM S< P@ 8Ah7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8>0 060000H  0C FR{X8@P000 Vڸ d490Y000040  B    004@]4@Th 8U 0      $D"$  (00 #RH L0S0P  ;@P000> 40H   CW0C00000 (0`0(00 0|7S000 0g > c 8_0 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8d 81081 8  > x 0 08   >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: L$`Y  8P`PPe07 I70 0姘 0 010 1 00 0 0 I0, 0G7, 00(0080$0`0000 S0 000((0Cp70 8000000C001!0110/1!LЍP`:Y0 S  04:P 4:@:@[80[ 0 00徠SX (]t@@@@@@!@2@ @O-0S h'0 p  0j000   J0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0uPP0 = S  岀崠 85 0,Y 1  00:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00y0  , R :01 t 0D0@001 PW|'R  _3Grq穸 0 1 0100L7SPP7HWX0P7080LW2z@$Ѝ 70 PP 0ᰀ00(0101u|8S>HHPP |7h'S000 (  0/  p' ; W00  . x (G lwh'0  4 R  O0Q  0 00 0C0(0%3iPP3 h'00  0  ;X00  岀0  " 101G%0h'0  4 R 0C0(0p 101#RH L0S0P  6PP@@x@L@3@x c@@A-`p!2@P 00(0K0P 000p⒓  ⎓p@-`P2@P 0; 0(0 `  wpG-!=⼠p7p# 50`G@- PP1S  0 000Ѝ ~0/ |'hR    0  + h  (0 pw0S 00000   0-0  00|'RE00 0 ! h7   h72h7 Y0Sl7 00@10 @( #RH LQP  )5PP    N  0 00H   CR0C00(0p 0(00㲀0✒  ☒ ┒북?@@O-@fMP|7h'S000 0 0  ;0h7  9)+ S09h7  h72h7|7S{hgpe_ !PUP0!2!   # 90 9G9S!  p L 90 96PSH(Q PU KQ0CS*e1 S`0 `!  0 ``` 0 Ⱑ PH!h75h71 |  008 S0R 0C00 S 0S00Ѝ0`,@@@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@a1 0 -Ѝ@4. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 c0 4`3V1Ѝ@/Ѝ@@-0 /2S/p@-@Pa0 6/p@m 06 08880 8077090(10101/* * ''l'@-:@0S 3/ :S@0/p@-`@0SP0P    00T ,P1S 01pp\ cdT@P0/dP 0!/d@-@ X0@@\ c0 R  K\ c@p@-<@P0S,d@T P@p\ c@ Qp@-0@P PS l*`0FUp@P# B^R <`0FUp$0@@@@C-1@pg 4!1000$Z4xX倇X0d4`FV`|7S S 0 8C:0S 3/ Ѝ0 a6/  K|7S S 0 a6/x3V0|'R/I032+ D3Q' h7  {1  h7C 2 P@ qWX  4@@-0@M 60b1c2d3eI{J|K}L~S|7SV 9 h7 "w>0l!1@ABp7h4 D2! i  j9k9 0 g9!01"\0Y|7S!=0S* 9'w>0 02 9i9 00/\0n>|7S 93/1  |7T S499Ѝ@+x829009h72h7ЍT@@\ cp7/p@-@f_rp@p7/G-`Pp㬁嬑Mw@WAL WO WO10@|'RN 5) 6) 7) 8)099!  089 079(!%069059000N9 O)PQ R   00 opWPx8S  19ЍGl 08 @\ X 00D 0590690790890Ѝ c@x@@̰@ @@@-h7#1 @  |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@@O-pM`0`  P屌0@0 00P 000 0_o`@GRPPU!R:"R :"R:0ЍC-MP 0`p` @u0 0 00  00P 0 0@G?o2P0S R0 Ѝ0O-DM ,00`pA(0a0$  @<0PwKPJ00<0$   a ,(fKP900<0$   a ,(VKP)0'0000㨐$ 00a,( < AKP0$0h0@00 00a,( @< ,KP   )DЍ1@' !c'Y@G-SP Lo `0@4p8à St# 00000SW  0` 01`P1 0h`0 d`Ѝ@0@T@AJ0^0P0᳐0Y:0 !c@@-  0 @!  Q3  4_000 P1#9P00T0nhX耖C@BC-P`尀p0@ A0 @0S HP `! 0` 00卻 Ѝ !cd@O-P@0MP00p1W;*0S`0 S00qp0少  A$0 [! ]P p 0PQ`1P  0 hPP0p 0 0\AЍ[ <7P 1 0CЍO- !c(!cd(@@O-@0pM00P@`Py 0SP S P S0P0܁ R@*00Q:0S  P 0 ≐00)  0g 0  D A ቐ 0R 0 r0S0 P 0Pƺ0S" P PE P 嵺@GᮺG_PJ!0Rd⣺ X@Ѝ` `Pg벰 0(ᓺ !cdZ@(!c}@@@@@@-@@@- 4,4 8 #8᡺ Ѝ@p@-@0M SЍp@P` 00 0∺Ѝp@-$M840, (  0 $Ѝ䄾c@-`plM(@P@ !0 0  ( 0  P0000C0 p0!0D0 0C0000 0d@S2 001 00@0Z'H0L 0 H0L lЍeTdcO-0HADM  0@ 00ZPЩPpl0!   0 0 0,P(p$  `H0  0 0 40P,P(p$  `H 4 d @ 0   80P,P(p$ @`H 0DЍ@@cc'O-\F,MPp 墨0 0 0 孨0d#dh&hV *吨0 0 0 囨,ЍO+0 0S 0S*+PP t0 0 0 ,ЍO}00C0FCP ]0 0 0 00C0000`P' 0S S S/B 0$ 0 0$ M3"0ZT$S .(0, 0 (0, 9,+< P P  a0,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S J2i @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S :"@ ~ @00娧004 0 004 峧30 R S 唧80< 0 80< d 0S iP`0 0g Pc 00u@0D 0 @0D 倧0S 0CSQ00N0 0S0=Z004 0 004 e3 R70 R S C80< 0 80< N > 0SP`0 0 2 5P 00"@0D 0 @0D -0SSSꄾc@c@c@0p@-00@4S 3P1 00'R0 0S0StܬP 000 01S0H00``<2[@ap p@c@c  BR/ $R/ #/0 0S/d@-P@1S `p 0 @1 @T  Ѝ0S 0CS0@q 0S0 0S;00 ] @@c000pp@-@`Pe@P pP/p@-@PP  "p@-@P " @- @ 0@p@-@PG"!p@ QeO-$M`@Pu \pP u0$ЍT@ @ ` X0@00S @T Y [00S 000S00 0T 003>0P` ` @Z 0 [0 T">0P0T >0P ` 0 0`0/G-pP@0`P t!T 4 06 S H0S 4 R30 IPP @P8 0x00PPH0F!9\Zv 05 0݅6 0654!`SH0Y 0S 0C @ Q*  " 弶'H@,0/@- 0MP3p0ppչ`hP@ 03  !(,0 , @ 0  Ѝ@ ) 0#000S2 0,0-jpǹ 03  !',00,0 03  'P,00,0,0 0 0)GЍR dH'0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@|`pP1hSl l0p AD0P1p00`0101S0@@*fq d@-60!0 0 0z Ѝ@-@Td$,d,lH,l $.` G-@phRhb@M#0 p00 @@0A10A ђ̸>  ɒ EF? 忒  0`p!+0 000,`(p$@ @@ @C0 000!T1000 004,`(p$@ @ @C 0!:0 0040@,`(p$@ @@ @C0 400'㸐!=0  0080@,`(p$@@ @`C0 400MP!0 80@,`(p$@ @ @P`|C@ЍH@ d',!c@-@f0 0S 0P@\0X0S@w'P d0`0S ,!c dp@-P@:0 0DS P@ 00S \0X0S@GpDP 00Sd0`0S D,!c0S 00P0#///0  S /0C\ B /p@- @dPPRL0$!p@ 0S  Q@D0R0 1 dp@-P@ Ho0!S <S21p@-@U@)4d@-@: 004d@-@ KC@(0@s3p@-3@ PዷD Yd@Pᦷp00S0U 0Uᘷph0U 0S d0S `0U X0U D9/,!c80S/@-3`A0ASM=pNDPP@jЍ@ 00S%3]0 001P0 R0000 0003/PDЍp@-M@` DPP@&Ѝp@00S0S 3/0000~0PD@-@$1@ Qvp@-@P 4p001Pp0S 0Sp d@ p@- @P8@P@4p@P@@dA-pHQ`P000⤧@PЍ0 p 000!>00H `P 'P` 1S0 d 1@0H` A0, (10(1 d1i@d0@-@MuPPEUP xЍ0@!>00 T ( P0@PS   (10C(1ѨЍ0@d2i dC-0PSM 3/0 0`C @ /AP 00ЍCvpPXTT T$Y  0#   Q @STX4d dp@-@,0P `0,0EMt x0Rx0t 1x0 0S  0 00I 000p@ d4dO-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y fP 30Sڸ0003Zʀ !  , ! )p !P3L3 H3@300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0St24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0` 0# 2 l.VP0PPδ P. 03 8 #pP,00,0/ W.,P0S  ` 0S0S  S O# 000 0S$ ",0 ᮴p3S0S|00`YU 0R qPN 03/JBc@cddd d4dO-<PQtM p!< R$ 35Q X@ 0I@XlWP<W26 @<@,0 S00$<Q 3C5CQX U D ;W +W !BW-`S R R   `E  @ TW" |;W 0 @k 0@ 0S P !>d60 0 `0i0 0  00R 0`ҳDP@ 1`tЍ|:W 0 00 RV  00 S D:|`W| t  m 0Q` R0`1 0`峳 k0 @ k 0R| @N3 P GP C ᖳ0 0 XZ 0  tЍOc00000 4@PJ 6060X`\00` )D```8W 6C 0CW 80Sl8W1CWi 080 S`@8W0ST 0;%  |80P@ :7'WW00W0S* T1`@ 0S0Z 0W0S00}0SZ|00SX԰Tꀠ0Z0SX6&WW| T600 `0 0 `0pܥPeTw@P7`o 0| 000?893 !>8# B|000000S֣500 0 0婥 P3TBw% SJ00\50SBt%S?00X|  `3 8 3   00  03 P +`P )T Y 0Kj,0     3 PYh0 r`Y SjxE?0t01x0@t010S ؀SS P0؀ ^O`dV PP0Yd0'0 P2`0`V `000d0尳 !0S` 0S ` ` Y00 0 `3 !0S P 0ST  iR0001 P `@Y> `h0S 0S000PS 0 W^PsZ V`[ 1 /``` W003 P R0``0@Q 0Si ii io@ i@iii@%iߖo?i@'i d@oi@:@!i#i"i4dYd08 P R/ !  / d !  d#@dw@d*@dO- MP@Dp `0@0>@@P1ְP@U T100#Ѝ!>00  0 0`P H03HD~P@$ ̰T 0Y00C?o20S7 0S4 땰iP"@ ᲰT 10@0L0S DXs 03 Lgp@P 0  ተ80S 3/@P S d0Q)@- 0@R0S b$",0S R E `Pb 03 0QV/ dp@-`P 0@0L0`0D00@0 0<0(080,040D00040,000@p '|'P'(('' (@-@@ɓ0O-,M,00S@(`A@P 0 0 0T1"T00XS%X,@P  00 ")a! 1 00 $a$" 1040  0pP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80o`0$0$0Y C *,ЍY 0 PP  w0P00@pV @`PpyV`[P 0p0(0 4p*4 0Ằ 05p0x p 0c8##4 Ib4#00 1 00 x5 0 p0 0`p@`A-`p(@P P PU@0 !PT9C-0@SPP @A0S`Დ;pp0 p0 @4"40 0 05W  0  0 @ 0C50 P00 R0("( ,00#,0 Ѝ 0@p 07@-0P 4!4 8A#81C 4 P,000000! R ݑ0  0 Ѝ0 0`( "4`#/03" /@cA-@MlPlpP@@ @0 ۤD` P0@@ @P ΤЍ@EcLd@-T@wL0010P @PЍ0S 00(d 0!< 04 0 (   !/@cddd\ P/0 !8 0 0 (  , !/@cdddA-P`@0p P܇ 0և0  Ї?;$2020S A衕4!c.(0p@-S/@@`ܭP0SP y0P E0Pd0 1@p0@ 0R/!&   7e 0R/!&   )eO-0PXQ p`H ($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 @-P@T Ѝ0S(6P`(`00pY000W Y6`pV (0@@-pDMW,8`P@P& 4  d<00004 0000h%40   000 -PU1DЍ0S/8p@-P@Tp0S 8`0P H R@O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `X7%XpD%DH$H00!1P0&@@1!P\\ Q \\\ P0S 0S0 Ld0SlA- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Azpw&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QP@P 000S  _b0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Sp7pLd0&cG-(p0@0SP,``M く ROd0" 0 0  0 P" P c  EiP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0p=P ' 0 P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PShM;0S/70S] 0` R@( RS Xr   R R S"0 0 0S0C00匀(XG2#212(0 00p08_pP P1hЍs@000S 0CS # 00V000+P d0 F  1> က 60 0,P.L0+0SQ 0006l0S (000L00 00!1ZP\ 'P /0 d@cA-p(`@pPD0S   !R, 00! {hP [8p0SP N奵(0S0 ֠A0Ld00 000080Ѝ8Q@- <0b",4b4#  #$  #(  #< 唤Ѝ@p@-@0M SЍp@P` 4"48 #800vЍp@Q<-cbrjQ 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # B/zPpEp@-40 R@  000 C  KЍ@-40@ R  000 , r 4ЍX0 0&-$M840, (  0b$ЍXdC-M 0P`` @sxp0 P 00 00 0 0@.?o2P0S B~Q Ѝ!cC-PMp@ 0` Vs`0 P  00 000 0@n.?o2P0SP @TP@P T@P0ЍT yc!cO- @p`0SDM!  0 ,@P 0(p$  `A2 0儓!0 ,@0 040`(p$  `,2 0 0 0'! 0 ,@0@ 0 84`0`(p$ 20 400!2 00 ,@0@ 0 80`(p$ 10 0 0!#0 ,@0@ 0 84p0`(p$ 10 0 0!/0 4,@ 0@ 0 80`(p$ 10 0 0!1 0;0 4,@0@ 0 80`(p$ 10 400!h10H00< ,@0  0 80`(p$ 10400 0 0!N0 ,@0@ 0 80`(p$ 1 0400 0 0YP!  0 ,@8 0`(p$ Pq1 XP<1R0@0TE0DЍ@!cI(lJ(dI(cXd$W(ccp@-P @lth 0S Q 0P @@@040p@Pp@ 0c!c!c0 &1XdO-PM@0010pC 6#21 2 P 0S '`5 V#2!12 Ѝ 00` o5010ZРJmZ  T@|PZ  R` 30 ¥2 0 0S DCZK ۥZ| YXj !>000 ( h40800 `$`02嗋0 00 P2型剋0 0 0 唋0 0$#$ (0"(DRD PP P0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00 ! 0 S0!0| X 3X0\ 0 X0\ >U, 19@ @ H L0 [H L ` d d` U` 0 `U 7X (X 0P H0@` 0 @0 0 @cc"c@-!>@tPM `0@@ъp0  0PڊЍL000 ЊcO-=Mm @P=ЍO`5X  1$!0 1$!宊 T=@@0D0D0S S  1$!0 1$!噊@  ꂊ0 0 0 半@0 <   @Pk0 0 0 0S P@0@S W0 0 0 @ATJ 0$ 0 0$ 0Ts PP@ 0S40 0 0 ;`( "$`$"",R a(!"4a4##<S3 @1, @000@S S0 0 0 3 ;0S Y%P 4"48#8T(0, 0 (0, e@(S0 0 0 X Q0(0 C} @ @0;00 0000P(0@P 0@0ĉ1!0 1!40S P@G 00001S0`0 R P0@0U 00400S @0 @p0,P0$800010C 0 0STz 90S@s 0t PPm  t0@0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z vU0t00u080S| $0S @E 0S [@@D 0x0<t0P0<0,Z.@0 tG00 0 0 & 0R*+Z 4 H 0P $0i$0J* H 0$0@K@ xiZʝt0P00$0  i $0Sx00000@@@T@xLP Lvi @ v"U0t00u0,0Sx 0SJ Zz 0R: xZi뉝t0PJ0   Ni ᡝ0000,0= ᙝxLP@i L 9iYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ vT0t00u00 0S 80x0530P P0S KH @Hg000t0 h 4000 vT0t00u00 0S  xhtj0P0  S@T 30S@0@A@@$0p~f201P0P0S 0CS# 2X0X0SD0CO 00SK PmׇX0\ 0 X0\ G W T  X (  (  N #K0T0T0  R  Q W9 h W6 ` W3 X W0 R- H0\0\0S D0CS@p#@10S (0@S 0 0i倇X0\ 0 X0\ 勇`004 S p000S @d P@0S 000010Wp0t 0 p0t b,0 @0<01# 0@3/& 040P5H 0\0(008p0@,P$@ @P(& 0404 040h0(008p0@,P$@ @P&44 0w0 (008p0@,P$@ @P%040T4@ 00(008p0@,P$@ @P%040 0 00(008p0@,P$@@ @P%0@ .040p3 $0 00(008p0@,P$@@ @P%04083 00(008p0@,P$@@ @P%0402000< (008p0@,P$@ @ @%0402 00(008p0@,P$@@ @Ps% (040  D08p0@,P$@ @@ @]%1($0000D ,p @ @I%1$0000D ,p( @ @5%T1`0D 0,p($@ @ @`$% j!0@S50@ T0 0@T *0h@RJX@0LЍ RPP CB! ,0Tj(c@"c(e(H!c)4!cXd(D!c@!c<"cd(c)@))Xd@.L!cpdc@-@ @;P 000(dA-@M`p  XP @P%0 R@ 00S,UP' ( O!>00 0@@iPPBPP 00BR@ЍHP P@IUPc1@P P00UA-@ PRp   ?P 0SR`P71P 00-0\ Q c0 0!0;0{O 0!A-PS@` pPl0 A/4@8!< 8!<chP/A-p`0PPQPEU `f @ T T@ @T@  |c0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴS婂0 0 0 崂(,Ѝ0000 000000#![< 0C+ 0((04"<00 00000@ ,0@0,0VP *0C SURc0 0 0 n0 0 0 7PU{PP(RF0 0 0 QV7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0?P 0( 000@ 7xPف0 0 0 000:, ,0@ 0,0 00800`P@ceO-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00啁x0| 0 x0| 堁0S( M00!>,00000408000S 0 0S 0 0R F0$1@Pn(@Pi,BPP,0 0b mX0 p0 0 b`(W0S004 3SH0L RP0/hP 0 0C000000<@0 @a(0P 0(0a000$#$ 8$#, kH0 00@V0g0 00|`0010k0R `7`P[0 p0 0 3P 0LkP [p؀0 0 0 @0000 0PTp @z0qS>q(0[     Y Z嬀0 0 0 巀0 sR 0 W [U PR L!P dZ`厀0 p0 0 嘀@0`0S0` sR 0PP3 P 0 PT$@P H0S Yp\0 0 0 gAP@0D 0@040 D 0  PW0p/T@PY`90 0 0 Cp`0H4PS0@0D L`0@00 @000D 0ppW 0_P0X    J0  #RV  3Q 0S# tPP X014!0 014!1P80S t80,3/PP t0 0t  P* [ 0S% (PP 00SPP ,0 ,00,0000 , Q0S 3 V0 0 0 (PW `S 0R_X L($KЍ 0S80S W `r80,3/`Pr `Cp0 0 00S U`0 0 0 hU6 3 lUQ@1D!0 @1D!Y0  8UD@1D!0 @1D!O P @4"4D 8#8Q ( %0%<#*T*@1D!0 @1D!5(P( 0<00 (0(DQ ,   40#0 @0A]V Wp 0 ("50 @000PP(0Sc~1 !0 1 !~`J`0<  )0 !><0 0 ` @0DPHP|`P/ 0P+0S( 0#p# 30S  t)3#3 1`00t0aȒ~0 0 0 ~WpMpp3 20S ( ,0@0,0 (4"4 8,P#8S G04X 0R0  t~0 0 0 H1P00,0 @ (,0@0,0 3  10S |10S t(,00,00 ,0 0 0  P%3  10S 00S Q( ,00,0  (VPP((Q Ut~0 0 0 ~tU (0   0, Ppcecc@c@<"c%c(%cC-`!.p0MP00  @S00000 R0 0  xdG- PXGpȀ`H@Tp@W< 00C@S@p0S00C0S0 z@0D 0 @0D z @1!  ꄐdxdcxdO- Pp0`@DM!  0 @ 0,P(p$   0!0 0 040,P(p$  z0 400!'>o@0 0 80,P(p$ ` @PFbDЍxd@p@-@`M0P0@@ @0 㮅dP n <@@T 0200 R00C1 2"Ѝp@%@EcxdEc@- PBA@ꀒdA-@O70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PA\xdEc@"cdO-Mp 4"4 $,$8("( H#8! CQD0Gy0 0 0 FCSC 00 Z V` "(?AT0&y0 4化 0 4y 噆`PEy0 0 0 y8 Ѝ R:Fy0 0 0 yP R\ \ @ 嘕0`R yy0 0 0 yh Q 0 p" 0 崡10T01A0000W2SS}$a@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !R y0 0 0 yX0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  !( !! B! RA10C100C0x80< 0 80< x Ӆ 9!AQ ڴ! Q Ƞ,Ƞ B!K RQ  p 孅! B!  B WZe 0R ` ``d1S 0 0}1`p[ |0R  B   B  ` X sX0- 嶀 q0(t"|p   0 ! 0 1C00S,00V(`8 4x0 0 0 ?x-00  :    0cxddxd-//-/-/@-@-@-p00d0@ ` P d0 (00  0 R(0 0S(# Ѝ1M  @-堊0@@-圊:@p@-@P 0S 0S 0Pp0Pp*P p茒d!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ], 0  02# |0R0@l@ 6Mwh0l 0 h0p0l t 0Sp0 t RwGꌒdXd@(c-/ 0!< 04 0 (   !/@cdddT0M000S ~S 0S/0S001Ѝ/@e\ P/0 !8 0 0 (  , !/@cdddp@-@P<`0.p0P0p 4  0g00 3S0H L0SP0\ 0X0<   0CS00S0 00040 NAp0060J R0 w Su 0 hPm xi p@Tg $ d13$0(40D1;S3`1$80S X00 00D 080  0" 70P00SJ S0703mP2T"0P22 T"m@ 0!0CS103/XQ, ` R 2000Cp!0C,0, 2R , ^0 SQ h!\00CS !0$< Co\P  P0 PQ t0CS,20l1\0h1V0CP C\|4!$Rx:+Ru, R0C HQ L!0CSڤ10C(q0``Fm1x!0| x!!| 1!m1!0CS0X1 10C10    BR901! Va0 BR1011 01R#h0S d@ Дdd1@0%c\"cd@j@]@,%cH"cd8&cEcD"cH?8%cx"c4%c|"c,c@d@d00SH00S$0|pPPᚁN \P 0 ᎁ$@ኁ 0R00S 0@oP @tl1!0 1!l gSo$4RX00D0 080 0 0h~P `AMl1!0 1!Xl@` 000d;lX2\"0 X2\"8#Pc20J#ZPy0Sv0 0Sq* Pm0B @S0Vg<0`r !$!01l1!0 10! 00 0 00/ l0S `0S !  @ i gT0L `CX0S  t1BQ 0C  0C0CST>0l1\0h1)  1R ;.0CS 0iP1T!0P1>/T!6040^;h0 0 0 ho=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ Sohh1l!0 h1l!h P 0Q/ 0;`80  BR0!0CSlxh0 0 0 h\0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS *hp1t!0 p1t!5hU0404 (0pChx!| x!!| ! h,0SC H!R 0L0CS86A 01R8#1 03/ W91X0C10 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS908,P(50!10CS0X1a10C11W0#4 500( 50C01 0S 1  'Q 40?0 0; % 0S 0;841 0S 31V!0R1$ S *sXg1!0 1!cg$0$ 10101\1S$05\150 0 !$10BS$!% < S <0 W0P00J 1 0S0 B'; S1 00S220 0S010;0 0;A821211 PFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S h0 h0 0w0 04 S0 0P0000  h2 200S!>6 l 9&00090 S   hLdD"cd@Ec%c%c,%cH"cd@-0  0'S(P L@Yf1!0 1!df$0 Ld 0`( "4`#/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0:0@p@-P!T1PB1AhP \xX1+8T@1D01@ xSx0 S 0; S0Ҳ;p@t@EcO-0M@S 0 S/p`V 0S?(<(PP p( !R `0d  Sp3p# RppWO^hPPC 0S0S0S ᴍ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4D00P4%4158C00P8%8150<01@00D00S_ P0Se P.P%p0'T00Sg 0 0C1!4!R4!480P00L00T000(00 :0Py  10S00(|! (  0B00  00!0CS41a-V`!;p00\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 P0;00UA(0SP kUP!-C0PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSPP8P90U%pwHp30 @P&QR P0S0S0S0s  `D1S`~PpU1S\PE80P H0Q8S80P H0 8(@0D S8D!00C S:08P0 RJP 8P0STP 41R1'!0!0S01Q441q0\=0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP180;V PF03 PE UV0k80P Po0H00(000S4 P08P, Y( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 005`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#Ѝ1 @a0 40K0 _0  W `4000:80U040<3 b00S0U0S- 0 0 0 2bpP 4 00S<07tbfb024"0 024"qb p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PHt0QAQQ0 3SH L0SP0\ 00<  0CU4 00 T0000 Z 0 S 0 0$00 ($ QbT t0 )Pe"cd"c@x"c4%c|"c@%cd%c])@e@8%cdEc%cdl@a0 0 0 0 80apP@ t4 00S$0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RHEt8 B Q pQ   AQ U 0 BRU RZ ȡKaX"\ X"\Va ( @0% 00   V  `A & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1`004 0 004 ``)P 0R 0!S S{ 8P 0;t4040` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S> l   '8P0S 040Q: Q6 @ Q1J0 A\-Pap ? ?0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRpp%c%cp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R i1M  0MX @p@-PUp@`S0P 4 dG0Pp`d  H Q1Q44!K010p@x"cp@-PUp@`[0P 4 '\X[0Pp`d  H Q1Q44!\010p@x"c@-0 2DJdd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0  :0p@-T0@00SDP@p T$3Sp0p@Yee @x"c*)@- @3)A-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S  00*PP   ( U) 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S0SPT0(-Y 0$ 0 0$ d 00!/dA-p`5PUAn@T P P (Y0 0 0 (Y~0:0aPP<dBT@pp0;PA`V pt00KT *0DX60 T1G2h"R l2S0-Pp2S<0h2S lBT@GPpBT<@x"cEc0@,cp@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 #X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS Sp | x t p 8l2tЍTx"c)d@-0S6& ЍS6&i@0b? S /A-@P(pjT0`8@ TL3K@D0S@D0S@DV x0|  0T@ Dx5X0 P1XVL 0   @T8A%815AGx"c,c0S0 S(00 b/ R /0SA-0`S0MUPSPQ 2q0@S0@?oR20S@Z P0@S PaQL L0 000 0WP  0 00TP! Q U0`0@S010@Sʲ0TT#T1X%XS !0P90D0Ѝ  10CSa0Tw00000090P4 W R0( @Q+ Q 0p00 0sP00S @0G3WS ""!>20 2 0 $080  唽W 0/@Дd)dl5(p@-0P@( V1 01  (p@VdA-8pP(`@U1!01@@(AVd 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=d@-@P E0;@0:= P@ @ 0 \3\#   t@EcC)O-m0@SM S( /`P@$00#.0#A0@.H>@$00#|%2 0 00 PU `0S l:P  :PPd%@-0@ 0@00 00@@W$$00S@ Ѝl@dd%O-4b@=PSPPm0S S8 > t00#.0#8.> p00#`1 p\V 1  xQ6-S1!0 1!8S 8 V00;e1S 0 0A0 0g!P00@0@00=0=S1!0 1!S ЍO-0R:R1 01R 0SH 0 A SS0!\ 0 d%H%cddA-P`ATAAp@O-Q< ZOP0T 0 P0T eOPT1X! 1C1S01S01S0# 0_1S ;S3O0 0 0 >O01;SP!T11T10P1000110H1;S0;0103/1_ 00!L> 004p0,`(p008P$@ @n040> 00!$0 0,`(p008P$@@ @W"040= 00!+0 0,`(p008P$@@ @@X= 00!/04 0,`(p008P$@@ @)= 00!?0 40,`(p008P$@@ @040< 00!P0 0,`(p008P$@ @ 040L< 00!Y0 0,`(p008P$@@ @ 0 !c04 0,`(p0H08P$@ @@ @0 400!h0 0,`(p0T08P$@ @@ @0(04; 00!p000T ,P$@@ @0 (00 !:H0z0$0T 0,P @ @ 040: 00Dʟ!0 0,`(p008P$@ @q<: 00 ɟ!0 40,`(p008P$@ @Y0409 00!0 0,`(p008P$@@ @B0409 00!0 0,`(p008P$@@ @+040(9 00!0 0,`(p008P$@@ @0408 00ȟ!0 0,`(p008P$@ @040x8 00dȟ!0 0,`(p008P$@ @0408 00ȟ!0 0,`(p008P$@ @0 400!00 < 0,`(p008P$@ @@ @040d7 00!0 0,`(p008P$@@ @040 7 00!0 0,`(p008P$@@ @0406 00!0 0,`(p008P$@@ @p040\6 00 !0 0,`(p008P$@ @X0 400 0 0,`(p008P$@@ @)040H5 00!05 0I?0,`(p008P$@ @0404 00ğ!K? 0,`(p008P$@ @0404 00!M?0 0,`(p008P$@@ @04004 00!= 0 0,`(p008P$@@ @0403 00!S? 0 0,`(p008P$@@ @040x3 00!V? 0 0,`(p008P$@@ @0403 00!Y?0 0,`(p008P$@@ @0402 00!>0 0,`(p008P$@@ @g0 400!_?0 0,`(p0P08P$@ @@ @N0(02 00!=0D000P ,P$@@ @80(01 00!b? 000P ,P$@@ @#080\1 00 !D0 40,`(p0H0 010 f1 SRBA?C0 0 0 C0;0`1j 0@ Ắ@P a A@P T0Sį7@S=0f1,cdEcG-PU@ p@`R000S S @ ီ@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; B@P p@-@T P0`S5pS{=pp@-@T P0`S 0SO=ppA-0`SP@p0S9@@+0S ;2XR* 0R 001000@0x7@A-`@pP嵗000S S/@X=2D3>42 咪@ؗP  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   hdxd@dddO-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 DP- 4P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   hdxd@dddO-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000hdd@ddȦdxdO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:hd@\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /hdp@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>0`0"#0 0 /0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` _8@|pG M @I(PU@T D0D 0?8c*]Ѝ 0@0$@p0% 8 4 &#&#(    % ( %    % (0 @10(0D`04`06% 36 3(00000%0(0% 0 000%0e 00#2%0(0@10(0RO-@PlM3 $00 8%P !  ( %qp P$ 0`@  KPP 8<% 0 ! ! % 0 0`48(0@$00$0lЍX  c %`0!&bPP` 8<DT0 4D0%0 010102%000(0C-MP 0`p` @+0 0 00  00P 0 0@C?o2P0S00D DSS  S00 Ѝ%c%c@-@J 101H00H0101p00p0101000 20 2000800 u$00 ohd)%c%c40!( ( "P @@ /-//-/-/@-$0$ КH4 0(%cd-$M840, (  0( 㢩$Ѝd@-F@@@-FJ@@-@޶ܶ-蜗՟1M/ A-P0p`0@P& d0 0  0 P 0PP@孶嫶(3004 0 004 (3Ѝd@-@(0((0M @X@-@0S 0S <^P0 0  0 xP d0"c%c-/ 0!< 04 0 (   !/@cdddQA A-P,p@`10 00S S S ,00S @$!,0( "(0P x@(30 0 0 ('3Nj3 40 0S 0 %P/d%c\ P/0 !8 0 0 (  , !/@cdddA-@pP` )@P%oA-@`pP @`p@-@P<`ч0_忚Kp 12! P0 P $00S"(P,PHpWh P 0Xp  L0jP L0 Qp%p :W 00USx 2X8 Ⰳ&0 N3NT⼄&04` 0L 0vp 0(P\j 0(0, 0 (0, ᅉ$P2!0$0備PP4(080< 0 80< (0"$TřPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX l0 0$ 0 0$ (w0 0 PE Pd@@-0S0SP0!0@SP R \`0  0 0 00oЍ 0妗0@)dl5(A-0`0P@"Xp X/@0S  N0S  ሳ@ЍV0dS*@Pq@P0S S @d0S p0pQqS@ @ 0⣰P Ѝ0 Q@@T PE0S& U @++0 0 0 6+, RSPEUp0 I  6pg@d<8 @-8 <(@<D0 L0B0#00C0dG-P@`(pTG 0 0 0Z 0  $[#@ ׭0 D @  d@cO-PTM000 S p * ,0 PB ,0 Qp%p *lv=W7 \8<8400 0048L墪0P0 L0` `R 0 4"$(0i("( 0R 0 0   0 V |1 000.눇<Gc*0 0 0 n*V |1 x0|0x0| <04,!48##(GB*h0l 0 h0l M*V |1 0000  TЍ>6 6RQ*@@h0 00$0 T"0 D0T/ H0 SS bV |1 000E) 0$ 0 0$ * 0R  P $(P 8@|5 0RR0L0T"@P @5<0@080<@@@ @@00x000(00@00HD00S(0I@000@0S 00 0S~ 040S $"P 0[00000000P0 000 00000/ 0C0 0(0$0T  @00 0S0$0 0 0 0! 0$00  0C  R0T Q   R$!9T   R 0 0  "000D00D00T 0 0Sp 0PP 0 0TP$!00E 0SE":P R (e~ 0 0 0 0 00S坨n$! P(4"<00(00UI  Z00000C00 SE ( : 0R0% * 00"PP 00 Q:P @(h0l 0 h0l (V |1 000hdh}0p0m pPP{ 3ჩ0 ~@dd@cL&cddP&c@-) @0PЍA-`P}}@@Tp!p@ 0RD0S}A}00C08@<00S K((0, 0 (0, V(<NT<(004 0 004 G(D?Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B Ye@-`P@M 8p.'( .h`"( .( `p07Ѝ@0@-ASS!0CS0Sf &B +1Q~&A 0 0 0 Bu&A 0 0 0"l&A 0 0 0 0c&A 0$ 0 0Z&A (0, 0 (0, Q&A 004 00 00 Q QC&B 0 0 0 :&B 0 0 0 @C&Q Q Q)&B &&B #&B &B d@@O-M @0(`PPpPX T60SH60S  0F00V  1!0 1!60!  ! . 000& 000 000 000 000P'cd@%c@X&c@O-(PWM@PE{|P |1 00U0" 8$(0 8$("|1 0 00  0'S(@P" 8$(0 8$("|1 0 00 @00000 0S0% %` * D0P D0 Q`%` *|g5@V   ڥ@P 0 0`0: 0P,0 >0S 0P. `#,00 0P4e"(8,(0 (8,(["0匝B?! !b"X2 0HS%H=0S 0p. #0J. #20 0230SN,0H S00,H|1X1800S 000 R0  0dP 0 Qg:Y 4<0BdPPh  000;[3 00/Un! 8$(0 8$(!ؤ|1 000  0040004 0$0[ 0$? [? !8(0 8(! (0,0[(0, |1 80<0[80<̧PPP @ 0 R 0 3SH0L0S 0 ʦ`P0@`uP@0 R0  H0⽦P H 0Q:00S U  L!88<(0 88 4<($$0 4 $$Q!T#|1 @0D0@0D[ U%|1X0p t p tcP Kfx | x |K|1 000U!084(0 084(W080S U8 U6P 0P0S0%0 * L0CP L0 QF: 000S 70P5`wP*0S00S# 5D0S[ PP 0  3S H0L RPp\0p0pG4pGW500 0 4"4 (0)Y0C$0pC0IS `p<00SW 00S S4 ` 0 SW`` W  0˟ uP  c0Sa5 XP` 0 S 0IS|50 p%0IS00X5PP 0S `Jx ?=0S  0R`%` *  P0⃥`P P0 Q``V 0W0 P XW$00C (0R0 RQ0H000p \ ?^R$00CS\HX R(\0P8 40P8 40 0p( CR G0 Rʅ0pG00Sp$3```-Pxp`bp8`מPPk ᎟X(( K (FY0 Y Y )02s0 (0唢Hb88<(0 88x4<(|$0x4 |$( ^000<(0 0 ?o2R0S (Pp'`A4100T0TpW^ 0 00~G940W0U4p P2X00PX$0XDHX$0S: J{0@408 X`p00S(0S `($0P0$0` aP P P 0  0 40S PH0\0\X DH0 0  00 01`0`pW ~G pp<`J d@P'c@@@@%c@@eYeYed @ped$0;)024 80E)0 280|0|P 0S(0 0(028 )0 (  00E0 #R HL R\0P  0800B00V0080$00 ^ }3V4T10d0dY~I0(0 00980Y 2h0hpW DpGWV1p0pY~I(0 0#R00 S( ,00S 0(0 S  0S 0 0H0l0lpS`000?`P P P0  0 80S 0S2<24D3Jv,0800u0 0 0 000 < 00< P000000CP10 $$0 0` a$00$000C0,00,0ppEp]3( 0Wp ( 0Q 4y04pp(p2W|1 H0L0H0L0S|1 P0T0[P0T0US  P 0X X|1 X0\0[X0\UP !VV|1 `0d0[`0dU٣P QQu|1 h0l0[h0l'UyP[Y^[Ui00`0S0% % *0 t0⾢P t 00Q:00SQ 8$(0 8$(\ RWߍPp00,W0{ AWC +W_ 0V`0 0 0⎢P 00 Q:``V /0P0M <帰0 0  _P0 _0SU 2*3W <W R00  x0LP x 0QO:00S  3W Q  Qp R00  |0.Px | 0Q1:00So  [00  0Pa 0Q:00SX ,Ro P10@`:0000000P쐍Sp00,l9 p92#0Sr  3/m9`V"U d 90S(00  0 i-(0 x0S(hig0S80:S50S0S0S0S  EP#0S0S0S0S  3P R 0!0# U gpPP`d ,;0S(00  0  -尛(0 0S(F 00KP0T 0S P0T [ 8\ O-LMP`pG =000p,P(`$  岻 0:!?0 0D0004p,P(`$  圻6400?00 008p,P(`$ 养:0'006 09> 0008p4,P(`$ m04086 00:!$6 0? 00008p,P(`$ S0405 00!?0 0008p,P(`$ ;0 4000p!?0  008p,P(`$ # 040:0000 0 0!?0 008p,P(`$   040:0000 0 0!?0 008p,P(`$ 040:0000 0 0!?0 008p,P(`$ غ:000? 0  008p4P,P(`$  0403 00:!? 0 0008p,P(`$ 姺 04043 000!0 008p,P(`$ 叺040:0002 00!0 8p,P(`$ x040:0|00 0 00!A> 0 008p,P(`$ ^040:000 0 0 0!B> 0 008p,P(`$ E040:0001 00!C>0 008p,P(`$ ,040:0000 0 0M!0 008p,P(`$ 040:0000 0 0@!@0 8p,P(`$  D o o|0|@D0TToXTD[LЍ@)&c&c)'c'cX'c%c&c%cP'cc&c d` *p@-P @lnh 0S Q0P@@@040p@"oPop@ q0ꀿc%c%cG-S@`p0 0 0 0  0 0 0 ᤜX 'R 3SH0L0S(㾜@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0⶞P 0 Q% *H,Q G 8$(0 8$(RЍ0 #0C?o231 P (MQMa̘  #RH L0S0P  0*@0 0 0 o0H   C/R00C00000T  10S q? *0( 0 (  /R 3SH0L0S0@P  [ [(`)p0, 0`1 01  (Pz d@&c%c(dP'c(@O-0p'S(,`(ݛ@P  P N[ P I[P  0 ЍO@ЍO蕛Ѝ@-0  q dC-0@4M|02`PPQ7P(RrmV 00SS*4ЍCmm 1`1 ^P Z0S  J-4ЍG-⯕@P 400   0 XP ៕Fm@T;mP XXፕ@3m ᐗkmXT 40 X`0d 0S S :H0$U0*`B 004 0 004 `Pd03/@%cc ) dO-ppP70S . 0'0000B$g1娷S 0 qgǟhp`Lp DdxH\UPD ԏ0P   0\P 0 ȏ4 X0006`  ఍1uP ~H U  00 0HPᩏ0 d>0PL60Sh  .0L&0000 07g! 0R 1lgZ t5% 0 . P 0 0>PB|50S  .o0|%0000# NK0L00 M0[0TP IP  P! ?4 -X0004`  ఍1P |f1pS 0 gH0U  ᜎHP 0 =Pl f1S 0 fCP 3(0,0<,0hpP0 dp p-0* 81$ <=40$0 00}~~0T`P T #~=V P~=,3`U FpKY @(f a;P $0S(P[ 0SX0S `8P H0S 0S P,pPԀ pĶH0S 0S  PP H)0S  0 P (h0s0 0000s0 000d0 8Q00 00 oP 10S000d0 00e[ Z 0Xx W dxe%D ^P%XX H0W40$&cP'c@00`00008 900P 09*  `H $)$0 0$0 (0$0(0 ,00,0 000 00ePoA#D P`1P\#!Y  $0S DZ"1YX; p H 8 X HL d d 00&#08  Q0 $00 000 000 00 0P0 X NPPP30  CPP P J000 d@;@iikii O-pl8@QP`M #P8Q 6C0CQ 5CojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi `@ixYdO-prMD0P@`UT D% P5TX@@0S0 00SDPDM PT v ` Z` `$4R@@00S0 800S DT@ 4Q@8&c80S/A-3`A0ASHMpDP@$T HЍ00S1_ 0 000S)iP% 00000S .` e 00 00D`0bUEP_D@0B@&cP'ca@Ec@-@9@A-HM`VpDP`@䀟T P|1S  00 0HЍ00S"v_E00S .`  X 0?0000aP]_D.@P'c@@-@|1@sQDp@-@P dP ^oppp@-`jUPfUbU\9#L r0@0L0`0D00@0 0<0(080,040D00040,000r@pP>*>*>*P=*T@*P<*<*<*p@-P@r0@`02_9l_FUDU Kp@?U00000pp@-@P O00000000p@-@ M Ѝp@-@TPTPp@-@0Q$MG 'R`l P'RX("($( 0t0 X 0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@PAQ R000CS1@@l@A-`pP@8200SD0CS+UXP 40GSFV`#0F0H BPB  <P< V? 030#S00 D )o`( o\Q\ X ^ QPQ `P H000S D0CS #S S Ѝ%S000 00 00 00 00 00000V0S  A0000%c%cQRI p@-`@M 0 C^.^ P?R1 徵 000 C0PU'X X X XX `0 0<000H BKP`ЍpA ER PPC/C-40@SOM  S|1 0 0 0|1 00 0Oߍ R@D  Q *40S $0 OߍCS S #3R |40S p$09|1 0 0; HT, ?`P2 p 24Bύa`a`001411 0``1P |30S #0|10 0(0 SP#2q12L PP `V 2P<2034P09P 20S 0" XU pPP`20S p"07y420S 0@"00000000 00000000` TJP1B110 0141P /P l10S 0 <hr3"p'qr \D10$0$PU ~_EUuX ``1` h0 P 00 R0("( ,00#,0Ѝp 0߈7@-C(0 0CP P,0 00000! R ݑ0  0⽈ Ѝ003" /@c0S/8␅@-@l002%c @-@ 06n 000(01@q0S/@-@6( @0 @ @G0S/@-@6( @0 @ @GO-  !> 000S0 rXP,d0)1PU  PP 0@0Ѝ R S 0S0S0S d0HXP 00\'c@0SE0@-@8P<$MP 0S$ 0R ᭁᚁPᑁP0S0S0s!.0  ❁P $Ѝ0 PS0S ,0 @@_/8`O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  <P! R R R R  *P0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 CPP 0SK 0SH0sEd0 0S0S0S0S090sX3#21208S- 00$`0D0 ` 0 X0P 0 Q S R `QCP CY*0S0S0s0S0sY v!>7l0` x0(0t 00` 0jdP 0S10 0 P_04 @4帐3 @UQx EDX0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +[i 00000S ^0`( "4`4# :000[ X! PU1P iP P1P0P\'c@c<&cO-p((T"\P ,w\M0 0X " %X " app@T W% Pa@TFЍ R0S d  &R&R W d   PD @ (E a0@1T  R0S d  &R &Rd   fP @ R0S d  &R &R W d   PJP @T R R @@@0S/ 0@-S0S   Q Q> (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 0j!0Ѝ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50@Bp@-@08M S8Ѝp@uP`.p 4"48 #8008Ѝp@ 0 /%c>@- @(ㅠp3)fCC2<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00@dG-@Q M`@pI YF 0S BP`0d 0 `0d /@P Ѝ  0}PP 4@@ W 6} F}PAj0 0 0 uA@ Hu-PH0S |1 X0\0X0\0S1 0S.0s+ ? 0 L}PP-TA  0S# UQ H0Q SppW |1 X0\0X0\|00AR@T dO-7M#2p嬠1 20Z@0000<SP000[d0# 0S P lV@P@ @d0< 6PPd`VH0[V40@P= 3PAP<|0\00C?o20S DV@PP Z@[V `VS 0S0S0S 0SG  f6lpT6udRP(1PL0 T PP(UL0 @X &?PP ZUL5 #2!12ЍPP`Z@_W 0S0S0S 0S PT ( >PP(0p040p800`8P0 0UA_EUV: 4 @>PA40 R=`0d3l 00p0S/ 0 d>P), d>P#0 ,0R030S `0 @$0P```0s 0@0P1<00@0P80@0PD 0RJS 0S 0<0s0 X 0<< <R6R[ | r5h! 1Q4 R pX`0I=0SX0W0@`0 p`p0s 0@0P}SzRXy R QRV  #  RL @`$0P$0EpR ZP@j@c8d8&c&cP P/Q|1 00/X&cp@-@PL0@ 8Pz P H@zpp@X&cp@-d0,`P( 0 0@M 0  0"` `P P!PP d0!3d04"4 6Ѝp(0 @-HL H  < @dC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H yP0H000H00@@cddd@d10SYp@-HMPH <0sHЍp$~P 0 R0 $1aUH@, TP1EPH @L00PLP  P ,$P @ PP ,$P @T0U0L0 -/ꔊmuH@d0-C-0008`0,p($@ @ @B'0404 00!E?0 008`0,p($@@ @*040<4 00!I?0 008`0,p($@@ @0 400!>0D 008`0,p($@ @@ @0 (00!`3D0O?0 $00,` @ @ߔ0 (00!3D$0R?0 00,` @ @ǔ0 (00!2DB0>0 00,`$@ @ @屔040`2 0V?0 008`0,p($@@ @噔0402 0Z?0 008`0,p($@@ @偔0401 00^_!0 8`0,p($@@ @Pj o0P J@@@!0CC10@ T0 !0^>6<#e@5t0LЍ R  RR  CB! ,0L*Ŀc@`&c\&cX&cP&c &cH&cD&c@&c<&cT&c8&c0&c%c)%c%c%c%c`*&cL&c*\'c4&c))H),&c(&c$&c @.dd&cdc@-{xPp@-0@0SP S S%p`0 0 0 0 ?pL`00000S 0  vdO-Pp0M)S0 (0 (01yP  0Q*$00 C0 0 0 Ѝ0 0⃱(0R`%(`"* (0 yP 0 Q`` `@ 00K R: R R" [" *  Brp*R[pW) 0S0K y0 0 0 *0#[ Aj0 0 0 ukv"[ R \qT0 0 0 _+0 0C 0   $!$("( K[@00Pv  0b"!b! R 0 0 0 +,0Q*P 000,0 0C@dO-?MOH?Fg`Pp?ЍOEH0vLPP <,0 <,u|10 0 0yK( `+wP *s 0 G R= 9)0 9)|1 0000 0 0  0M 8>(   u PJ0 0 0 |1 0 00 0(K9)0 9)R @ t=02F?! !2Sd2a8(0 8(Y8(0 8(0'S(u0 `R E0 0 0 P|1 0 00 1 R  RQ Q$Q Q  \| R\ |0 0 0 |1 0$0 0$ uy0'S(/uP _ p 00! !0(  tP <,0 <, 0` 4P 0 0 0 4 P h4 Pc40P0:0 00S1|1 000P8:pWP p0 0 0 @0D 0 @0D |1 80<080< Aq99LD00H00 \0 $0Dzq$0pSB dpph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ T0 0 0 x $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,u.P C0 0 0 @` 8#(#Q@;( <Z.P $0R (0R(0, 0(080 , 0< 800 < a ((@004 0 004 jP "0 00(00qP }n0 3SH0L RP0H0 0AaT nP (@(@@42P@TL0000@@@ Ѝ8 #8`V  0 t0h H@pWp4`ql4 p&cdxdd`d@2iO-0`lSPM x R @J (d0CS00|⸀@P=0S00:S|0S*@27pWG DA+㍵,≵Wu$h7h'W0S0A/@\ Lz@P ?Xc0SP@ЍAPP N@@# 6VR  93@034308BP N0 30P""##4 R00Ǒ3S<6@|006$| @G@ T  |$@P@\ |@P 0u0# 0# 0# 0# 0# 0# 0#01Q5 %0 5 %U05%0 5%0``&0`&0`&0`&0`&0`&0`&`101X0U0`0X3P p7@_ ^P $XP0S Pu;0S;  U+ . LP. 0#0;P00|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  3j "3 P" $P|;<3x0S00C0xP唀R P|P;/P :/8P 6/<P 2/pP ./@P7(/-l 0/G- @XPp g`P @<,0 <,f|10 0 f2`3 0  Gd7@-0@ Q)R*SP S {P0sS  Ѝ0 :R0S00:SPz@- @00t0x0|0qp@-``.Q00S@P P .00/U00S00=U00S0t00U00S 2cP .001U00S 8P .080#U00S <P u.0<03U00S @P j.0H@0 c2U`VppP ^.0p0pA-`P0 ,0@p4(ЍR GR*S # GR$1R # GR V R  R R  R  R R.c\00S 0S0S0S 0S0S `;PP-PQ  eSV0  R0V0t0V0  R0 000 0 00PxV0 Vr0So R/lSi0S 0S0S0S] 0SZ 1$PU0-P 7I0 000 0 00^P>V1q V8 00V41a-P 80 000 0 00?PVR V 00VჁ#W<`p`>-P kV39V0 SRx03V\0 R000&V0 R|0,@f@\'c@-@0PS`pM-P7 a,0 00000(000Ѝp@-P`,@P J [P -@p@-@PF@,G-hMP pሠ"y@P0S( 0$0 @@@0 0P @ P );P@9hЍRsZ ;0S @( @0 ,0" r!.$  ,00( $@RaP@@*a`P H0 :@&a@6aZ 0(<$0G- pMS@P  )S *@B pGWP P @9pyd@4pcP P*0+`0G<S00F0 000 0 00@Px@P9WgWl;pGWp0  R0@pЍ d0R88d0 A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R55+0 @@0 0@P d0R55 Pw@P A0:Pw@P A0 +P9 w@P +m A 0h@`@`T s+@P 8@`0`0000( 0CS0 PwP"`PP  8P <0'3Sб410/0S@7 0R;0S8@T5O+@1PwPP0  R00sh700 lwP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s p@b P|8  `V 3S100 $t"PpW0 $ P 0S 0 000V $P p4  wPr408 0<0spafD\ C8P` P  2"PRpWO V 0S tP p 5XpTP04P h!P`5X00 *-0Ev@PN0S S Sd04M d044Hd044Dv@P7*WW > 40SKW$u#0GS##pc`V S19@ 38`8p40@\@p@-@PpP PU00 ` p@F)QPC-M0Ѝ`@pPwV0S0S  }P 7S` SR#00)Q 0 00000 000B0 p0 BP A-P` d@P00'S(`@Pp   A0UHO-UM0?@< D#2102@ 3 700 X.0償S000S 0000S0 000S`0``V@J @P0@@0B q`0d 0 `0d |0@08Q<Q@Q$pQ   !P   !P T`R`P`N`7P  !P   !{P @(pPp(0GS(p:TP@ `0d 0 `0d )@@@PT&"\P> 00@=0 0 pG=g' !4gt# q婽 @(0`0(000 @0R] TQ 0# 3SH L0SP0\ 0p<[ [P \0 _`0d 0 `0d u< 0CS00S  00 \_ 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T N`0d 0 `0d XP ` @0S 0S0S0 0020 `0 0 <-P@0_p+0S `0 0 0 (X0\ 0 X0\ <0S 00(  e< X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0+PP`0D0H0P50Sx1S800X 0Sx1S 95P D`@V<[PP `0d 0 `0d m0P?o20T00S |1 P0T0P0TD0S`dp H $PwؖPl H0Rhtp H P^ܐpPT H0RP3{Uyh d00l 0p 0q  ➧>ⰐJύd01P^ Ԑ[  Jύt0u1oᩒ"YL 50S .d D5`%3 1`00>Xu`0d 0 `0d V |1 X0\0X0\Y1P@ DL P@ Dg `n.P T`0d 0 `0d PM7QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P08ZP T`PH00U@P  Up3\3:$R*PX&D0S OZ U0X x0S 0SX x0S\u s0S L0(0@ 1P>LPpm0 @hLP@0S~R pV<,0 <,aU@ T0<<0 |1 0003S R80 0 0 CT |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN <1 0R00S  @ P @]D<Y<0PY2[ 20%UߍT@PUPe\c X ( ,0 <"  W hP0 0 0 (P@c@T&cP'c@d'c%c(%ced$" 0@/D0Q0*$ PPP0<1 0.UYW=0S RG m0P0P @ $(  $@ 1,PP0 3  10S (10S }@ ,000,0D0 00 p_mS QP0 0 0 [P U*QA0 0 0 LTt |1 h0l0h0lk00S p0(0 0 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0WP@#s7`0d 0 `0d 0@0 p[@PWTp0t 0 p0t 0 0048900(0@0(0l4 000$0( 0S0 ]P 0X    @P 80WP  80  00J04!< 8Q#8<000,0 pA00 0400(4"<$ 00 ]Pu @0 0S @  ( 02x0| 0 x0| =T |1 p0t0p0t,WPpP @0$ ( 00/ 0$  D000@ p@PE[V0 0 0 V |1 X0\0X0\APP/80< S001R  ! @0pS001P0/03" /@cQ/C-@M U~0(pP W`Po T0P4`d@0!Q8P=A` A0P4`8@⼎ЍEc@B(0s/@-@$S@ǎ S0(0cO-2CS0 / 0P0e0%U?0T000 P+10@T ~ODT8K0`V0 g40 30S  ЍO  ET[:4002040 1L0Sx10H0$ ;`P H1L0S <10H0(0L0S I$!H0Sd |1_40 3S0p00 0400` 0P0 fP`0D0S 8P .O0 0 0P@@@@ 'cHeA-@S@PPP*@P8`p% P 03/@/ T@cO-PQ`   0 08p0,`(P$ *[ 0!'> 4   0 08p0,`(P$ [ 4 0!0 !'>   0 08p0,`(P$ Z 4 0 ! 0 1  8p0,`(P$ Z 0!t 9@ 0  8p4P0,`(P$ @ZP㸻$0DЍOhA`'c%cd4`)ܡ+e0SWG-0`SMP@ 0@S>PD PP 10SЍU8 0 Sp* ( 0R*T% 09T 1!00 P100!L< 0( S@%@ * ,0>P ,0 Q@%@ * A0 0 0 LЍT   O<PP @ 0H$!$("(SR# R  0$ 0 0$  ; R   `P 70ؐ 㰑0.1P*뼒402p 0, P 0@L 004 0 004 ꫸(0, 0 (0, 嶸0  @eAdO-EM 0(0pR@00`(0,0% R  R / , 0PP8PPpP,pPp 0S 81S 90081 1IP,0 00W0 0S010 0S0S0S0S 80,0b0S7 0S40s1d0  00S0SX!0SX0S!.0HL$6#2q12(0l8 ,000@P:3xh6#212(00@P0l P0 80(PPQX, P, (  :  (y U,0S|0 0P<0帀3p  6ST(0l00LtlP,8!lⱼP,< 4@P0S 0S0S0S90L 6P☰0(p ! #RH L0S0P  :` sd0    96P☰0pY0H   CR:0C0C00000V70 0(00(000X  & 0 0#(141"<1 81#81Y0ᶠ 0p00`0000p h8(R#h 0\ R 0      0SK00S 0h"hR0 8<0000000 #(R0,B B 0,0000ݶH0L 0 H0L 0@0  8 , 0S  0RB 9,EߍR  RS00SX(0#n*  0 08(#804"< 8 #80 $0H$0 1(0 P@Q0 P0 00(4"<0gtpx@0D 0P0 @0D 傶p0 008 4\'cA@c@Ae$dA-p@`% 0P 00@Ѝp@-0P@D1 01  p@Mep@-@` P@@@@Tpp@-@pPp@ӮdPhЮpPA-@P4S% |$St40CS0!1t0 |$,0h ⶖl0d 0l00d0h004t4,0004080<0@0D0H0L0P0 `0FS 0SV:0ă`F V: 003\( 0##0S0 P P Pß ARx  04(B(0 $0(0< < 0 $R0x4x$\`0 h0R0 40|404h0x Q03x45t:t4S0t t4 R00h ,0 /0d0l dhx4t4!",0l 004080<0@0D0H0L0P0j T0X0\ 0X0h 0,0004080<0@0D0H0L0P0t4S0\0X0h 0CX0 0 Q/8 0K I G E C 0A$0?d0=(00l09h07hԭ`h ѕp`.p`V+ lph Ǖhlpĭ!c Q' \ 0t$,0R!tt0  \x$ 000\ 04080<0@0D0H0L006(3AAAAAAAAAC-lM@P` `pP`p@DBlЍYP0SX@\0UPt$G-hM∠p P吐m` @PpU@P0 ST  0SXU 0X\`Y UhЍP/00@-  !!B^P 31Ñ0PA4@-@T  0DP010# T0S@A-hM p@P `P0S H R `V  PP PSV RhЍS`` /0/ 0/0/-/-/0/p@-@p dh}0S S pP@0`ph0 HNK p0h0cAdAp@-Q@Pp` @0U/(0,  2 "R0pp@-@p`PH&p@ dA- T@p!}P`A@ @0S`H cA-LM` 8P᠀p}(3@Ve 213E=C(0CV} ?30V K=(0V|0 ^n 0 pЍA/2Vq E=&0Vp0SW  q`0F RD `=T2V@ >C0CV a?V0|0.2Vh 1CVQ^ Q^ Q00`0V0 SBp (V@  ⵒT L0S p0S1 dЍp0L|@:p0S1 0 q   R+#  库0S  0R0S7 P-xtxt 0$0Q Q Q0 S0 P 0$000zc}fUcvtUp@- @(| ` ?o2R0S@ P(@P|0(S  P@p 0cC-M pp{x0P00 @0@T@0S7@ ` oP nj@Ѝ`@0S@X #@0S @ 1@P ,@ R0STQ S0#S@1@! Q' ⋌@PZcs@- {@P& PK0S `  Hl=dp`y Q(̪(`,&0000000x0fЍpccPp@- @c{@P P00啽NpcA-d XK{@PP `0SPU 3PЍpP0x0p,' z&p2 PrPp(Ppp PP  Hxppp Q(X(po&0000x000 Pcc+@-@P`p, M' $Hp000S ,pP 6 Ѝ@c7@-@H ;P 00 0  { t0$|`"T] R@0  P  Ѝ0AAAAp@-@ DP`0 nػ/HOp(A//C-M@ Piz0P@h !T@d  Rd*  Pa Q^` V P RW R Q RP  0  @F V ㋩ `.@P5pW ~0p  .@P s 0p0 00 0@ | T@  Q 0 /@W PV  KЍ@cI@- @00C0eXp@- HyP@@Up000pcep@- PR@0 0S   Tpp@@00 A-`cPp^@T 0V `000A00@0@-$M@P |00 0 0Pw$Ѝ0+ 0Q @-)/dA@-@T  0L^ S0   $@ Ѝ qAAdAs@-P`@P0 @Ѝpp@-P`@P @pp@-P~@P p @-0eP@- P H0S <@0@0S h'cL+ep@-@PQ000p@0S p@-@`PQ0P00p@0S G-@p⼠Px0`V S0PP@p R 0 pWppU 0 0`G-(MP`E@GȂpP1A‚pPHq  {{0 0 00sV  S1!11%*X!:Qax|0SxZZ PU  fvP<]KꝖD1 P 0$1;(ЍQpP vpP ߖWvPvPpvPpu0 *㄀P  7/P T04z P #0!AA+yaraA"A+5A++0@-@$MP Q: |c$Ѝ0 P 0 0000L000@ 00Ѝ00y P kAH5+A-PMpP|@ᄂ`ᛊppP0p0  p  ]0 PÉ2p[܁`V lPV0 80z0V404001 0`,@]1$00(0$0ZP00 ROPPЍAwp8100`P8 mP <  mP<D0@ m0P@0D0,0$ mP0$0$Q  H⋎<0#S@0S  R:t,0SH0H0 0L04*PЍAAAt+Ai A A A A$ A. A@-@ʉ@-  qyPZPZ   yp@-@`PP  Pd00 PpPpp(00S0000S01/cc0   (0S"" /P/@-@0 y p00o@-@ oBiA-Pp`@P@  0S 3/@P @- @R 2/@O-LMppt0P|0 0W0 2`@xQ [Z 00Z 0!) Z7 Z< $0峍0# $$00 } QH00$C0#t p0$0 "0 aQ$%00$00 @p0 ;/ LЍ[ 0 |LЍO/W5  03/P 03/ (03/P Xo `100@r[ `[0@X" Z V@ $0I3/PZ0A@ 03/P  03/P Z00S (0Y3/ 03/P @-0 0  00 0 00%Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/@-Q@ ߿q ڿ A!AP/p@-@P03/03/.  03/pp@-P@`03/0 V p`V pp@-@`03/ 03/03/PPP03/pG-@0Pp3/`0 3/ 03/`P` 03/ 0`pW0 3/ p03/03/03/P03/03/0 S \`G-@0Pp3/တ ` `03/03/TP `t03/pW⩐03/g 03/7P03/ 0``S0 3/03/03/  QA-p@` x0xS  &0 A Q*PP Z%Z@0 !P0 0  /H!Ap@-@P`዆P $0 p@0/pO-PLMpt0  0000 <u @P Py40080d(4004000(p00040  00(0C00LЍOk 0 ;40 B0 0PS40(;40˵LЍ8pW H0q;/P 1|!00(P000X40  00(0C00+ X0  R DX8P B;0 40U z v 0S Y00 t Pw 0SX( 40;40!A$:p@- 0@S 0@008`D0VP 0S p PP`p@- 0@S 8PU 0Spp@ Pp@- 0@S 0@008PD0U 0Spp@ Pp@- 0@S 8PU 0Spp@ mP!p@-!^P!ZDWHps@-PQ@ `F"P 0? Ѝp!A!AA-0P@P0`3/D p03/<03/6pWA-`P0@p3/(0F`c0PP03/03/03/`A-@Pp`0 0  0 003/ 03/03/03/ 0p03/03/`hW&h03/ 0` 03/03/X03/Wp0`A-@Pp`L0 c0 ^ 0Y 0T0 O!0J03/xp@-@(0 $003/$0 (03/P(0:op00S/'c!A@-@ڃP,00,0$0( @0/@-@ʃP(0(0@A-`P`p$@P   03/@,0 嶸c!AG-hP`p@P@P L@0 4/@@ 0 嗸c"A@-TMp@P`00S  D P00@ U \U0 D P   UTЍ0 pc'c "A"AA-@0, (` 40Lp& 3W R@PQ]$0 7/(0LP< 5/,0> 0,01 0 :?<Ⱳ3Q#3?P [@P # [P0  R= 080#80C?o2S>^0 7/,0@ 3 #R(0\\Lpق0 0,00 <0]Ec'"A(+A-(@  0 S0000SA} 0#dt0  ~⋹P ,0]@[ 3 [iL嚂0 8/,0@ (0LP参0 5/(0LP凂0 A/!A7@-@(0HPy 05/0<0(0LPn0 5/040 Ѝ07@-( $ 0# 0@ Q 0HPS 05/(0HPK0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LP# 05/}_(0H`0 6/0SPU 0S , P(0L`0 ;6/Ѝpp@-,0@00(0L` w 06/=S  0"Sp-A@-eP (.AG-Ppw@`V᠐<` O pp<0 00(`0`0$00,0$003/(00Hv0 8/3 03G(.As@-,0@!;90(0LPv 05/},dP(0H`v0 6/0SPU 0S , P(0L`v0 ;6/ЍpA- 0pP(@@pD0(0 `Hsv 08/(0Hkv 08/(0Hpcv 07/0@00@0(0HpVv0 7/0  D00D00@0Ѝ D #D   D0 0 00D06 D0D0D07@-@P B 0R  0"S44 0"S (0HPv 05/(0LPv0 ;5/ Ѝ0$03 0 0"Sp$.A@-_P (/AA- 0pP(@@pD0(0 `Hu 08/(0Hu 08/0@00@0(0Hpu0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H`u 06/(0H`u 06/ D0 R60 R R6 0R R6060D06G-Ppu@`᠐ + ⌭pp<0 00(`0<0$00,0$003/(00HSu0 8/3 03G(/Ap@-@(0LP>u0p@ /7@-@P B 0R  0"SAA 0"S (0HPu 05/(0LPu0 ;5/ Ѝ0$03 = 0"Sp$/A@-lP /AG-Ppu@`]̐Hg [ p<0p 000 0C2?000(`00l0$00,0$003/(00Ht0 8/3 03G/AA- 0pP(@@pD0(0 `Ht 08/(0Ht 08/0@00@0(0Hpt0 7/0  D00D00@0Ѝ D #D  $ 0 D00 (0H`ot 06/ D00Q0066D0 D00D007@-@P B 0R  0"SZZ 0"S (0HP4t 05/(0LP,t0 ;5/ Ѝ0$03 V 0"Sp/A@-P 0AA- 0pP(@@pD0(0 `Hs 08/0@00@0(0Hps0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H`s 06/ D0  0  0D066D00D0G-Pps@`'᠐$1 7 ɫpp<0 00(`0H0$00,0$003/(00Hs0 8/3 03G0A7@-@P B 0R  0"S 0"S (0HPes 05/(0LP]s0 ;5/ Ѝ0$03  0"SpD0AA-Ppbs@`忪Zp<0 00$(`00,0< R A  p0,0E$003/(00Hs0 8/3 03rAI,1A?1A`1Ap@-@(0LPs1@S0$0|$ ^`Q$003/(00H$p0 8/3 03~AU3A3A3A44A4A7@-@P B 0R  0"S 0"S (0HPo 05/(0LPo0 ;5/ Ѝ0$03  0"Srp3A7@-@ 0S ,0 (0HPo0 5/0  Ѝ00E(0LPo0 ;5/:금@-!P 4AG-Ppo@`᠐` s ⴧpp<0 00(`00$00,0$003/(00H{o0 8/3 03G4AA- 0pP(@@pD0(0 `Hao 08/(0HYo 08/0@00@0(0HpLo0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`/o 06/D0 Q6  60D0 D00D0 6 0 6007@-@P B 0R  0"S 0"S (0HPn 05/(0LPn0 ;5/ Ѝ0$03  0"Smp4A@-AP6AA- 0`@(P@`D0(0 pHn 08/(0Hn 08/0@00@0(0H`n0 6/0  D00D00@0Ѝ D03D00D0G-Ppn@`ᤐ + ➦pp<0 00(`0<0$00<,0$003/(00Hdn0 8/3 03G6A7@-@P B 0R  0"S__ 0"S (0HP9n 05/(0LP1n0 ;5/ Ѝ0$03 [ 0"Sp6A/G-PMP3n@뺐 Ir?p`0D P D 0SA 0  x<0` 000 0C2?000(000$000,0$003/(00Hpm0 7/3 0 3 P(02H`m0 6/PЍ 0 ֥6A6A6A6A7@-@P B 0R  0"S 0"S (0HPm 05/(0LPm0 ;5/ Ѝ0$03  0"S po6Ap@-P0@ P@T0 0pep@-@X0S LP0@` P$P(P,00PnP00@@p@)c`O,ep@-$0S 4@,PY R00 p@7AeeA-@ 0S p`CP@UTz P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$0Nee@-@D0 000(S   0$00C$0@5ep@-PPL@T  0R 00 0 #Tp03/e 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-4@P0 P0  ; peQ,p@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ # 7AA-@pP R00 0`0C 0 0p0 0 00 00S PPE0p 0@@@| ,AZ 0 $e@- 0 8 00 00 D U 0 Ѝ'7AeA-p0S `P ݜ@P D S\X U PP @ 0@P4 0`e@- 0@ @0@ e@-04 00 ( $  !0 0Ѝ`c-7AeA-hp0S@ @`㜕PP @ s@P 10@0 @Pe@- 0S g@@37Aep@-P`@U@p 0RnP PE @-N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝe(00S @- 3//e)cp@-LP@0 S   R 2/$0Sp p@/eA-P`P 0003/Do@p 0 R @Tj$0AQh7AA-@4P. 0S+ 0QP0000`0 `06/#P`p060 ᣙ0P00U000pZ,p@-Pj0@ j 嫟  p7Ap@-P@`U000000>p@p@-P@ ``UPEPСA0@00ɡ00 0S p@御7A7A7A8A8A|p@- @l!`PW0LS  1S P 0 p@ 0/ppp(cA- @!pP`pW0AS1S  0p 0A/(cC-pp@` @`!(WPP 0S8' ЍS C0QU? @T8 0ll10А p1@0P@ Y0810<1K<@10D1=`1\10 00003/PY 0 R 0YO000000 00 0(cd,W,+p@- @!P`'W\ p@8\  1S P 0 p@0/ppp(cp@- @!P`V\ p@8\  1S P 0 p@40/ppp(cA-P`0`%@ LpV0S 01S 0S  A(cL@- @<!V0S, S "0P(c8A28AA-`Pp[i0P @R0PP0s$040000U0 40S R p R@0X 4/#P P A[000 AO8Aq8A8A8Aec,A-`Ppi0PЍ@qU00004P Q姟 !R 奠P000U00000SL0 H0 0S800 `8/#P  ЍAc8A9A%9Ac,eA-`Pph0sP@Qd P bP0st[040000U R000 0 q 000 AtO9Aq9A9A9An 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-@0 A`!(U00QU0X<000hp8 0`0h   8/c'`P 00h  P 5/Q0P00P 0<00QB(cEcQA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 0Pp o0 R   8/0 800@ 0 03/ ̞Ѝ e9AA-Pg`@P p0S`V+ P @-@0   00@A-pQ0@`P VP0QjP `O-Q4M`0I@PT`C P= 0   A@ k0@000,  ( @$0 4/`P# 00$0 0,0(0"@ 0 pS0 @ P .,0  03/`4Ѝ0@00 ;/p^4 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8; S 0 0//8eQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/:A5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`Pp:A@-0@000\P {0\0`P u0`0P o00P i00P c00P ]00P W000T@O\e\Q@- /6Q@-A/%Q& 4A0&S0&Q  @-.0 .0!/  /:A9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 SW0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V 0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 803/JЍ;A$;A0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 M0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPlMYp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000&\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hl M p'00(Ap,Ap pp:;A;A@-PP@ p`E(0 0 000@)$080 \ P`dP   } y u Ѝ\e@-0 @04 80\0`0d000000 Ѝ\ep@-Q@<0 Q Q!R0 ,R0Q *Q !R0 ,R0!R0 ,R0<0p!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@U`1P3p1:PEU`p0T 08/`0S T W_0T D08/`P T0 P,L`0S  0S 0d00 00CR00d0A-X`@VP1p1:`FVPp0T 08/`0S T _0 `TD06/`0S T K`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00K R 0PD05/`P  K0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?S +@0C4S00*SS *S *SU  SW $Ѝ*S 8$ЍC?*S ! BS;  SPh`h0S! lPP*S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S d8 0TipFQ D\PQ R00)P l  8 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/]0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRC0A0d0>X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍColQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0s Qo\0Cl0S ekl0 S0C BR 0[l0S SV \$ЍC{I\ 0L0HPLPph Q@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0l 1R1R aRYRPRB0dBPP\pB APR40@0D0HPLPpPPPPPPPPPB R p\&P A Rt 0$P(pB R p\P A RtpR  p \0 AR00Ѥ pl0S0D!0 0 p  8l0S S S< 0T 0C 0 S S w o s p ml0 p S03S0!R 0CQccPW< T0X00PA?A; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000pe@A/lAA@AhAApAAtAAxAA|AAAAAA@A@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAp 0S S"0A(0,D R  Á(,//0C-DM (00`p@ a<00,$  @P< s0PL @   p  a,($00 0@< _DЍBA*c<0S/@-@0@cSA-@ S t +hP`pP   03/@NT@@ATBAc 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@p`PXp@@0S/p@-P @ 00 R PD  r@ 0P4p*c,@0S/@-@ @r0@04@O-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ :XV`@0  A0@0000@Y 0S@ T`` 0@,`@[ L#@080 0 @P >BAA-@PpOA@` 0 R@)A-PU 80p`h0@6pBA @-@80S 080A <0S4@EA-P0 @R <"p0CS3 :  `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@TT00@-T00/p@- MP@l T`[P 0 R V ,TL ЍpRV RW SW lp@- \`PA0S@0 00P00CS0p pc@p@- 0@PAPP  p@pc8@- (@APP @c0 000/G-P`nTP0@x0000001T0Sp 0pWT0S1h0$Jh00h뜐 +/ \/h0  @0l0 0p000000t0h0#P h0|0000(00,000000S 0$@w TP S jW<S P h廋0\ ,PL P8G請*cCAteD,CA*c#CA6CAACACCA,TCAvCAA-`MpP0SH4@V =84V ,4V $4V 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQ`3V] 0T3V $H3V X 0| p`P  A Xh X2Vp 0V`P2VA 2Vr 2V |@000000000 0 0 000`1v l00| 0pЍA/i 0     0 0 000l000Af0 0000 0`PlA ЍA @000000000@00000HA0 0000 0~`P@ 0S0 ЍA0+h0 00P0`P3 PЍA ``W W @W@W @W W@W @W@WWW W W W WW*c*c@-@p`R0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0b  ЍP R 0 0q`@ @T@@~fvtA-@aP( ?0 pAc40( R/$ R R/  /te-4( \0^/teT0Sp@- @RP 0;-l0p0p@//@- @ P@A- `X?PP@ @T@`V X0S PpW@0`P`p@P PpcD@- 4,?P@T  P c 0!< 04 0 (   !/@cddd RP RP }//C-QP `M 0q<0 0V@p# 䀖XW Ѝ0 8/P 0S 00p Wp04&08#8 S$=;G"0C S04W00G?o  2%`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  ,t0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZBA01 BA$'*BAs@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 te*cA-POx0UTPS@UTp W `W` 0 `U`RT0 0*l00p3/`PTPTpU@ [O ᬆSO CACA\ P/0 !8 00 (  , !/@cdddp@-@0Sp@z0PS 0p Sd :!K*T0S` 0Sh0T0`!EcMb@-MP(OX0@S `A**x0S 0$ RP`V% 00S" 0p0CS00 00P < p00` IP NH壆<S@N0 LЍteEcCACACAQ @-Ԇ/(DAp@-`P0@ O  `P0(0pte,P,,p@-P@PPP(Ppte@-Mp`PN0@S 00)?0S$  hPP: TP0S4 S P0 0!! !1Ѝ@)h0Uh0TPP @ R 00`SPU0P00 P 9N ЍEcMb4DAp@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ A9XEAp@-0@SP S`B ` < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 Tx嚃0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02"~EAEAp@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pKLPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@,p,0c@-  001P(,0c@-  001Pk,0c40 60 0 1Pn/,0c/@-P`xݺ@fٺp0lpp000 P$р0@@0 P0tp0 ЍEA00cp@-PP@0S `޺`0Pp0p,0cEAs@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HLK3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RoJ0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0} 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00cJ\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcW@cddd$ 0,0cp@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` PI >PlpWXPVI@ I <!00S 3/PP\pEAEA@-@ITT0 TQ S S @Q @-ԁ/DFAp@-@PXc9PpIP  7P X0SP0Sp@ pQFA 0`( "4`#/R/`0  B-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P Q   @-:#:^:,\:( 0 /`FAA-Pp`@@0@Dp@0@L$<#@`W #L0pG`@A-PlL0pLALA$ `@`W L0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0`!pW:X  QY Q  L 0P`FAS/G-` p P#"Y@PX K0S  L00H@PR/G-PQ0Fh pY@p`V8h L0S h L@pG-Pl @R`T  Vp P匀`#801U "0S  _L0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  .L00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  cP p A c Q0000000PL0cQO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@cdddO-`d)@4pS0ʀ0!4)0,)$)   !@WpVP`P 400 $b0@04 00$00 , 0 4 00CSTb40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ J{NH { lHHp1ʡhPL|00 10000000  P 0 Tp ` 0h`Waf`` H`Fd 00C0c& 0R0 0C '0`//0` 0RS0C2x05A45t454545454544 W%00t%W$43 W 0倀TV} Ѝ R97;BSA S S  @<Π` P BP RY 0 S < b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ夂01 `@380!A!Q Q ^: 0 0S  u a`@2{g( 4b`0{pFlpGW04 TP    ̈́I 000404040404PTP!  ̈́I 00p04l04T04P04X0@cdddGA\,\,,,,,0,,X,,8,,,,,,@,O-Pp`( 4M?40S=0,0 T0$WpVP` D@ J I-0@@ @@ P,p{004ЍT0     ,o,9 P,0D0 ,@@ D0 m /0P00#0CS04<0@pspp000X [0R bQ" B3Y 3R b\Q" B0Z 0R b] BP"YY !1"0202 $$Y0XZ0cY0[\ ]0`kX 0D2$ ÆahFh`bV`a$"A 0Qc2 $0A$ Q0SW ASL 0CS>T0H90 P U=l0 S00P10000@!@1P@@T(T0 [!1P@@TZZZ0X00X00X0 S 0@00 pYD8#  T0,88 < T0 JAXFAeGA 98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-G/GAO-PP L0!p!`W1 p` Q02 !X800#0Q00p0` P b C22  A X80z  " Sy  " 0S  F0p0`   KA[A \AS/O-`4MP@XA P^!1 00 Z P0̹p c02Aq4Ѝ W Ġ   ! Ġ ! ,  ,Ġ 1!Ġ !  ̠̌  1!̠̌!!!P P h i P D\R@TqZp0pp PN0@000ȷ@T0 @BpGBS0(01 0 0d$000Cs0v 0S0 "<<"$0,04#$(#$0,0 S "<<"$0,0$ 32# $ (#$,0 0"00#0  0ERa0SP 0G0S@0#Ġ #4 <0!<Ġ< ! 00 Q Ġ    `1! Ġ ! 0##4<0 48,0(4(, L<\0? 00#00#0B0S (0 !aE00pP^<T! 4 8!004#  #4<  48 0 0$30##4<"q 0i3##4<44, 1 00A1@00Z@@P0S0$0 00 0C 000Cs0~ 0S N 0#,,#4 < 0#"<<"$0, 0  R ̠̌   `1!̠̌!0# # 480.̠t.4̌ x<^0[ 00#€t 00#0R Bp0(0 0b,0(0S^0S2 4 8 0 02##4<00 S0 b##4<032#$(#4 < l!0!  0S $0 !bD00@PW 0i3 ##4< 0 1 00R! 4 8!002#  #4< 48 0 0,30##4<00pKA[A \AO-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? 1!pW:Y  ! !QZ ! !Q  C `AKA[A \AO-$R@4M@ R^v C^r*P`! !!X V`"( !X P",!P Z S $p0~' 0p RhʠS: 0 02 (,0Y4:04!48#8400p0R2##48 0S0`0P 0" 00#0 R00`0PY*X0 0t 0c PRx `R 4Ѝ衯0 :00 B0c 0! 00#0Qa0 !    R h@P  "S ] 0qY4*X0 0t xp0c PR`00W 0PE0s00 #  "0  S r  !  " 0S 0 `FBpG0s00 #  "0  S r  !  " 0S  B0`0P0p0 cR2 ,00 (0 1$0Y:0 $4"4 8#8$04  p r  000!Q"  "$,   P r0  00>  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ B0`0PAKA \A[A00 04040404/-H,,X -O-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  A0 `0P[:004!48#804pQ 0S  A0 `0Pό\00PE0 S 0S 0 `FjApGO-Q@,M@Q\ C\*P`!!P pV" ! P` P S"! P) 0 $0 剐<*4,2,2  )00XR:0 E 0=R0S   A0`0PX<:0 Q0$ Q0! 0 a`0X0@0cP[0$00k0僱 Y0K0c[3\;$;b!Z A bQ"]100 0 S0S  @0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F@HeGAT00  ,0X00500\04/d-$-O-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  O@0P00 $4"4 8#8$04  ` R0S  1@0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PE@pGO-4S@P,M@0S ^0L^*0p%!P0`P#80!)V` P \"P !)ᇀ ("( - $0⒎($⊠""00 0000 000 0YR:0E 0=R0S  ?0`0PY<:0  R0$ R0! 0ba0X0A0cQ[0$00k0僲 Y0K0c[3\;$; `ZB$aR!]18#80 0 S0S  g?0`0PP0 0t x0c PpR`X,Ѝ0PE0 R 0S 0`F B?HeGAX0S  0R   Y  Z0X0[ 50 0\04/--,00S/  R 0 eA-`PsV0@P0# (j( >0`0^p $>0$p;SP`; } 0`000  @@ e"/p@-P$0@Tp5/@ e\0P/ L  \/-  , "   eP0cA-p`^@P P@@@ @S PU$R : ^V WQ K=P@^T0 N^@D@D\'LD@D BR@D@D\ @ N!N'O-Pp``08@TV#2 Ѝ 0 U`P@ ep@-P` 0@Tp 5/@ e@-P0P0P`@P , 0< 0 00 20Ѝp eO-PcTHHCUDso @V 0S  $02"R0`W 0 R  R0 pP 00 000ЍF $Q: @B `I\ `r`\A\A@-@0P R8n BR 0a]A \0 0 @-,"l1AAS)pA@T%h!0N!R 0S \0@ P  P  P /oS" R/\A@-0 Q0(@T (0P PL )pL%')`l1& R L1P V0 40  < 0 Ѝ0O- p0YM $00$,008000@@(X0dP 8 0)L    CR Yߍ$     GPP $00?o2ჰgPM040 00h0S( 00=S$400C400000@040<0,0S4 R L0R`08`00L0PH00P08H0Q00 @P<08 `0X00,00?TP <0 XP 6X08 000?A`PX0 0000S(080< 0, 080(0 S0D0D ,0R 0( R5h Q| @"! !RT 4 R .R 8  8 S,80! 60R$  00SKX,0L ?o2780$ @40D0RP T$0000 K1R 00Sp08040H0000g 4 ! P0  P80080( D`080O 08P<04;TP?000 08 @PD00R 00QRQ(080  @0V `#%0R PP 00`  PzAXP bX000 0?mPXP R0$00 ,00S \0@TP\d0 S/ 0 B @-0(  0 0 !^Ѝ`cdA e/b e 0 8?o20/@-@ex 1a e@-0 00@998090R (  8[?08000 P Ѝ R 00!  b? 0S 00 R (,( @(@ ( ( ( ( ( ( ( @( (S     @-0 vN @T0 1 <0C PrPA`Du" (AdB( RPPT  @B! b$!nE1Cnp R 00 0C##< #"02#0 dR, 2/00 0Qo98|7@-P@l@  0 0 Ѝ00C-M 00Rpx@XPh` (   P  Ѝ R 00 b?% 0S 00S=P   PPX7@- @P89 000 # 3 @ `,3 Ѝ00( x00/0 <#<0@00( x0 0/ /@- 9 Ѝp@-P@` ` ` pp@-`P@ H0T *4@0* 0 0   @000pp@-@P0`` 0 000pp@-@P 00   00000CS p (p@-0P@ `0%R @h @ 0X  @ 0x0 000p 7$h0R@h @ 0X  @ 0x  $h0h0p@-0@S!S)0`P `PPE S`0P( 008#80"$R*0( 0000C@0$0p`\dhR`P`P 8$0V0$0000pdAdAYeYedAp@-@PGh p@dAO-0pM0 0! @@0P 1S 0l0`@ 0Y":0S0  H j0` Rp00 R SPSP2/`0S0S-  R*  8?\0"0,@0/O^@00 C)@C)0c<3"P0 0@0@ 0S@P = 0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 B (0 dAO-@( 1p$P0` :C [ :(0$Pp0`0S%000!V"R/ p R,R ` pW50( 00$00C$0 Ѝ`  R Jg"  `PE  p PEp`V3 T0T ``` , 6 P  dAdAdAYeYe0Sp@-P` U U@ T=P  @ 8=P0 <0p/p eAeAeA0-T# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@PBcfAO-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0PPBc//O-0`p,@@x 0, Np ( 80080z0@1l%1 10 10:00=0;$000 0  P p  t  p  x  |  $  ( p``` , 0C` #$00,0 0? PX$00lp0P00ãp0$20$0p 10001. hp 00p0 0S*Z- 0p0&X <8P`  $8oob 8P V p` `0h0`Z   {sߍ@$P V Z  T @ៜ00edAcgAfA/gAgAgA0@-0MS0?-P@  A $@0T JЍ0l0 000t@|@x@@T I""9&@"@ct]egA@DeG-@RMЍ tRRQpeP U  p tR  t x $ | ( t2tR1*800#U0S @2``00@`  P 2 B!P0S WJ00 00$00(000B10SDJ5O< 00p 0&000XPO0& 'Z`P\0 `OV %Z\Jp\0000 ,e0S 0 0R\0  t Q  x 0R| $0R (0R\I``@cHB0 R@ r= rq8 $ rq30 r0 rq+ r(x r%| r" r r8< rqHL rq r"sr 00SS-3#/S-/-//O-@4M0S 0S.`pL Q00 000S(#P Ё QL  0 R0Q0 R H0A0 0P 4Ѝ0 l1,.4,P 0\EP#QP<Y!L^Qɯ Q  L,  l1 (Q%  $(P$PP 0 00PE U P ) Z0SU  WC-0Mp(`h0S,P 00$ `30 @<121 @)@,)`"304@P4 00$ 0/,0 \*@Ѝ0 00R0  R!p%* Gp0 ^PY GY  f)@G0 0C0000 00C0꤈>C-p@00CSʺ0 V0  =# C!l. R4P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 40000 P4000S 0 ,00/ 0 S _R QrH4P re> 0X&  ( , P B R   ,0d,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, 0`60A00h1hAT0T \/@- 1"\0?0A@P4CcsA0@-PQ0USL0R @@T00APES Q T03=?00QS^T ?6?0000-A\\^CS0Q Ӂ0ѳ 0ҁQ/0C-P0M`00@V5p :w 0R  (: {>C 0C"4T0 0  ?d @;c U l0<# \0B#s*Eo*@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ _v@Pod8*0PЍ耖0@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP000lA G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP \))0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[lAC-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁7+  3+  .+Y@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP *  * *`TF`% @P TT@@ YV@@@$T P 0!1RX 0SRRlAC-P@?00CSLM`LЍ@0 `p0R * * * 0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ B8) g*\ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 @-@tPt`0 `x0` @MT` 0` 00 @@M.% Ѝp@DoA`c e/@-Q0@Q@: e@-Q|L  DЍC-@$M` )0pS rBL S?xxN@x \ !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \EP$ЍP @^)0 H0 0I0 0J0 0L0 0M0630-*'X=)0\0800sX L000 BX0@0000H0H @0P0`Cg< 0/@0@OY e!! eoAoA 0Q0A-` @ P80 rGLppF\P:[pd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P/0 00H0 C2 000\0 >0>00C000\ X/ЍApAO-@L8`p0,MP 0s @$ X,Ѝ0 1/\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B 0$ - \P 0k ;P> r 00 0Pd0;0hl0 Q! 0LP ] AH B"     x\P0 00S\P00#SbpAp@-@PzS P @0 0`(f_`囜Np e@-P`P/#@P∜M@C0 000 001 0!a#00qЍp e e@-P)L#@P4aЍ #YN e e ep@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@<"P$FЍ0 0 e e@-0Pp0 0țd"@THЍp 0S (L#`k#%N@ e e eG-P@|xp%X `D2 H.W L R ! V x$x 0 e-   11 1`00C`0`0  0`0 11 1/@- & Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P +Y l0d H BT02000V`pd000 0SNX\0S*(P   ,$$00,0  0[ $ ,0(R:P (P 0(l ,0 B$"NP 00s000p0pD 0S (VpP pGhplg e h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0Ppp`0 00z%0 {0%0 70808<r0"\!o0C00D0l `$0 B"0$0$ 00%0 0P T Up.0Sp P 'UЍZpAO-R4MXP0v\0@Sq: E# 00$0 0(l $p0 B$"z`P5( 0 z/E 0 0! $1Q- q5 :CQ0 : 8 #8#40 (-0(00t0(P 4ЍZ  R 80 #8R#4P00 0RP ,,P$`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`p0S{ L0 X0r00L S000 S<0 0P0<0 00^h m04S4 d8000@ 9PP,l@ A)A)0aD48"03$PP4 h00P 0P80 0($ 00 0 I00JP 00PP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PEPPi h/04S& d0@ 7Pl@ A)A)0aD8"03$nP 40h 00 0 pG  P  0CO-`p8$M000 N@P @DOoB$Ѝl A)A)0a"03$5P0P [ pQ Q @ 8D%P $>%P   PpApAA-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@O0800S 0s \ S00\ (0$000 0QPP30$010,000t010(0@1 110  00 10:0000l0$0d0 0aLЍx-|e00P@8P T P Ă‚007qA@BT0100S 1 +@P0S @0@040S60@0HML#50 @`0&00 0q>@BT 0g0'pp 5  @@BT0 @P@P Gl4 @B/$ 0R 5@00 0 0@+@cHBG-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0!P08< rqHL rq0 000 V@ 0T>P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 V,0@!>P L000L00000| r 0 0 V,0@>P~| L00 0L0000ЍGB0Sk iC-0M@p0S   RP- 0X0P S 80 \p`H@X!V0 @P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$PP p00 0CS0! 0@!T0PSWTPnO-`$M0S S@ dvG 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 0:@PV 0 \ \ >0>00S H0A0X0000 0H0  C200000 @P[; 0S0\ z0T [ .000D 0 0 >0 .0 0@@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP p000 #8 *(80( 0@P @ [B$ЍOr@<@:qAM!Ѝ/A-0 @p0`SP , PW,--G-` P@U-@P pp, @P 0 -00@ ,B@s@-@0P000CSCF#SR`88 d0l 0C S c10PQ0/`P 0##sr$ 000#sr  Ѝp@?8l A)A0<)a21 #ЍpqA7@-0TP@6"XD0@8 w#( #$0 D D Ѝ0qA00\ <M0X 0C S0 0 ! /+ 0 0 0TtqAG-0 S*S* P 8pL  PS  P;0S2  I00 > `!Q 0;S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!0}0`S0040 0#240} 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, 000SF:  PF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$0PD0\ T00CS0H08 S  8 \8 000X :F0 L0TRQ:Q 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  l50 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0  P+ \P,0@ 000 000< 0C( 00\ @TpTp0S [   0^|0P0PX| |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D Z rA rAA-@Mp0@P`00 R@@.00V T0L0 0L0800"0 VT@`00R 0 W@T@M00N0P 000Ѝ@-0`P pMX0S, \0R@#0*x P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, x@P  0 000 CЍ80 000 m7@-@Pkm'P ʄ夅 Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  0 0|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S }P3 @+PH0 0I0 0J0 0L0 0M0 0L0\pp800s  qЍ2@- `P@ P 0   0L 0 0<031009 0P Ѝpvd@cG-0p` M8P0X0S, \0R@#* 0@P~x f0PP(0(wl0dT A@! 0C#p00$?@ p 0K@ 0 00!e   XpLP:!0.e2-8640q."@* X %@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |@P *rA 0`( "4`#/p@-@(0Sp0PS㑱P 0 R@TpO- DMhR/@lp0-`p0P00`$,`@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P  ?P&,$$DЍ$ @P P0`8< 0P0 8 a\$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R BS(0W0 ,000,0A8Cc-C-萟M8P Qo<01 @`pᩬ000o, 0 < 00 0 0 )P0S㦰P7 000tЍ蠆A-PPP Up`oU@ 㙬0ҭ@P0  A-0Sp@n@P 0`PP`P0 P㋬ʬ00`p@-@1004P0 pp@-0`S@5@P P0S00  |፬pG-0`@ `Pp@lT Ѝ 4 WP0 00@0`@`@EcO-M@Z0`@P %1 1PP忁0Z00008p+08p0 P8姁W(8p ([( (( (  (|ҁP%u<00<0%#0 3!0nLVP0@8003!0I@T#%X:>0 SC&P02#@ 05:P"0P0 @ 0000000$000 pᝥ@ 0 SS$ 0$R00S0} @匥0刔pC 0Sjۥ@#!P$$(00D 0(0#00$ 0@@P$p00ʿW0s~!H"Т3" R 0P03Py 30p 0Gg@P 0! 0C"@0 Y0  0U80(, <00PQ00 1 000$00 100@zp0@$0  0@ 0 0T8<$p 000~$0/0 0 w!P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S 3!@0"~.T!@@Ѥ0 R! P0R 0c! 0p]! 0  41T 8@@8081T#\ }#0S 喤 0SI0p}!A!} 0\ RϤ 0  8@@808-e@cׁA\.e1uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0 "Q Q Q 80S S 1H0C200<00 0P  0 P0*&00000$0 0;00@Pap| 060QP T0 ;cS10! 0p$00:0 @P 060 %.P   X- 0 0$00 "$Z 8S  0RP a$0 (000J ( RY#QQY*  R, ( RNڸ \RD  00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* d 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 ?% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AD000  0  0   gX0(0\0,0p7B(00,0 040S W ~X0SZ%Q@c-eACcO-P $@p @@DM $c T<✐0娰 ` P  0 DЍ`&W`V ``P  0 0$3 0壴  ! 7P+X 0S68T08С0TSJT0S 0 { 0 R #1 T巡X T 0V L 01 Cr T 0!z!P!{P0 !# !0Bq  H@o/@-M@P`  0 0P ⸺@P 86Ѝp0@  4/@P2V@002d0  4/@P H6 V 000( (0ADci5AiSAEcqA-C-p` 0TM P pr@P 5TЍ. "_ !>V4D`Y2!>3`04\@ 0$p 4/@P 85 κ(00 0FxADci@AEcA.p@- P0@@`堂<04 @ 04/@P C5 @AiDc?A@- 0 0000 0幼Ѝ @-0 000 00 0㩼Ѝ@-!>0004!4 0ᔸЍO-@Pp`LM$@Wpl5X QP0 7 |8/P $  LЍ ``  4:/P 4 $ $`88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 Sʦx0S $0x 00$0UAkA 0-p@-@P$ Bp@ 0`( "4`#/O-P@P'10x0 0;'P#RH L0S0P O @Q2@P T 0B`0<`0 00 0x 0S#T20U0pX0%P' Pwv101w刀匀(0ST0( @P2\ 0S 0 =@'I000$X:4@P 0 զ0 00 000 0L0040 @P tTv1v0C1,vT 1 Tt #T 000$ 4 0@@T0S000 T 0 @0@0008Aᤠ 4/X0@#P00S% 00( <0R 10 1 @$0 T0 0 0U>002m@P@Pf #P Pz R R 00U>000 C2H)10S@0   @U. p)2000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@寣X0#T00S 0 #T T0S0S0<z1T@0 OoB0CB001 tb凣00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @Q0 00 S00  P  ;t60Q &(10(1Th8ud6@Ty 0S0Y @0 00000D60S: 8, 5(6P:# 80  <0L P0C1001008 ԕ 0`000d0嘚*0<00L 0  ! 2 000d5 000 s 00bR0d`0Y   P:dd0 00 0`0542(8p  ,?$<'Xy,XX0"ra0HS^@2 00?LFV;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :8;忘0 0 0j) ;(0S<Ѝ8< C8    08 08  0`HdA`.eA#Bd.e0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8Z;]0 00 ) Ѝ0@U;Ѝ0S} O-@$MTP`L Hp RQGPP0UPPӔ0U  QS 0Q P:`0S00S XQ0R@3 %q1 10!W?Q00 00U0P00H0 00000`00X0,181q?q$ЍP0PP\0001 1pWÏ`0Wp1 <U,181q/ỄAAQDŽA,AC-DMP` p f <  0$ 00 0@ "4"00 00 0 N'0|0 0 P0 S  f P fDЍL\ 0 \0? 0 0 900 0 0f 0@-8@ h0l P 0{P3<P<#/G-@$q`0d 00000`P`0d P Z000Pp"SR \ R3#. : b#: 8   088  H@-e 0`( "4`#/O-$@ o%0q00o0a@S 0F  `-pF` o0 S  0 `@ poPU- 00pHoo?0尡Z | Q ! |! BR!D&o Wo0S 1S10C1o0S o oo0S ho 0XS  0 oo5%o$$\,%AA$ e( e0,0000˭ q删!!  *P!X& d! ,++:10 0 4 3P !*!0l 0 4 "( 40  ++!⇭EcVA_AG- MP  p@` ?@T Ѝ Z@ʟZ R00 00@@gdTP0T00PP᜿ $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X y0 T0 0C S 00   @P Z? 0 z0P0? P!KpC!0 SH080@ Z  004005000@@?C0 S0 ?:0 ?2@?,-Q P@ 0P 00T 0,Ѝ@0S   R00   S @P ~LCcp@-@Pm0 -Dp@mG-1MsmQa0S 00$mЍ@T0S_@mZ  PD 00 0m0  $P! "b$" S R- Z03H0 $0X\ RP(0` R  X000 R 000'm 040 0#@0HL RP0P R 00 !/ "@c0 eDCc8 eEcQp@-@ @QC\0@$0@0$0ppPl$@-mTp\0$00$0$@p@-Q@pP @QC@pld 0$ 0S (0, 0@@md 0$ 0S (00, @@p@-p`P]l@T 0S4` 00S0C04D"0S00  0S00@*p@l1"@DCc0 e@- {l@0"0 ehA@-T@0S ul00","0Sl cl@"0 e8 eA-pM0S S\1 @#P1P!PCh0 4a4! T#Bl R100 0 Y@P rlЍ̀`V@0@0P `X0 h00|400!0@00S`000pP4"Cl@ꄅApA@c0 eAx3.DCcA8 e- $\/p@-@@PP 0SH0'U(; p@$g,3ꬅAA-@P`p㸒W 0 A/>p@-@P`0 x0 @` 0 \0 @0`@0@ 0<0@@;P J)ЍpЅA`cH e8e9.(e@-@@:H eA-P`pM@ @V0L00唀@0 0L 0h,h/d`dPTP53J3F 0&L 0 H eh.e8e@cA7@-P0@P @T00  Ѝ0@-@p0PS` H`HV 00|03 >0 2008o<080S 0S  V 0 : Ѝ@cH ep@-P@!0S  0S w 0 @QLs\PNP P 0S0j4<p,e8eH e 0`( "4`#/7@-@00Pj000U  Ѝ0@貳 Ѝ0jA-$PU0@$01  j` pv1SjA\ !!% @-P 0`S4 R13U  _@Ѝp $`V@ 0@ Q@ !00 0C?o2 104A04/@P U 7T0S 0@0 0 0 0U>0& T 0(T@0 0 07T0S  H& DR2320   (T @@cA2AO-@Mp84@P0S0&0@0\5`4IW00 Q, 3Q00 3`0 0 00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  tZ @H[ @ R20 030000 3SH0L RP \0 0@`00^ P ,00 B R  R@0 00 c `!H0GS5040v400 3SH L0SP0\ 0 =0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0  0`@0 <  0CS00S0W00  4 e,e,e,e-ee,e,e,eA@-8@EP(0, 0(00 , @0e-e7@-P Hh d  \@200P.0 800(.0 D@@0Dp Ѝ00e$X.A@-4,$0@HhP(p@0e0/0e@-@Hh00H@h0e@-Q0   0P0"3 9i 0ЍA0C-P4 " @ 0傧@P s0  000000) 0w@P Zt2h"1c@P 00 Z9@  {1 $R00S 4 `P 101@@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ į@P1@010@00@1a:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S T%  000000t 0 R00ߪtp@ሀ@M@Ec@vc-egAO-P`1 @pᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,=g0S2vg 0! d0    !tT# 000 ϥ꘷@P8?P 0 R (@- 0@Ec-e@vc@cddd0eeuAG-0@@p` !4#Q!PPC2 |2M 0<0:t0p0x00008|0l 0 0X 00Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 08PK0 TPkJ!` 0  0Sp k j ihgf0 z~bJ P0S00000M \0 Pp0p 3 A  P ~ {T  o v z(@CcA&A-A4A-eEcPCc;AG-PR M 0GS p`0 V Q 40p ~@P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@p VS  7<$(, 0 00@SD@I |@P6ZIY `0 ҁ@P)Z `ZIY 0D@PZ `000J@P 000 s@ II I@@@cA-1Ms1,P@ţ<P0< !0 0ͥBP^@P BЍ0( A(0 !    /}@P  0p0X0 0(0"@P( ( $Ilt`d0@`T]!(p W (@ct]eAAPCcA@DeA 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P  0 P  0 0# JPp 0&p p@cG-p0M0`0@8 ;80PPi "\D00D0 D 0f U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSRQ|U3 , BUDL (!PP00$ 0 0 0 013PP Q 00 0,,PPK 0Ѝ(0000(000000#000EQ QE1(LQ #RH L0SP0\ 0 {( 0   ( <  0CS00S0   0 0,00S00  R,0 U-eA@cO-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C Sy{ZH; AZkL ,<P@P cP<0000<,00, 00 0,0r000J! !B1(L<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS '{T<0000<,00,000,00DA AD*00010(LTP QH L0SP0\ 0 z< 0   <, <  0CS00S0 ,  L 0 ,0v<0 D #RHL RP \ ;z< 0   <, 8, BTL ,<@PDY2P~?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<J@P@004000080 0 3@P AU 080 X0000CS000( (  PP(  41~@P, B[ ,@  0,0?0 0K1 1C! 2P 0 0 XPPX0 080 P000CS (  `P(  4}@000(2 0R$78 00 00CS000 (   y`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  @`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X H'P 4l}P0%'TZ-eA,eO-0pdM00 ,0`0SPdЍlV$HH&圀t00t0 $0   , V@8u 8QPPP# #RuHL R \P   BUL0S0\ P00  0CSPyU` , BUBL $8PP |`800008$00$000$0 000EQ QE1(L0SI|`?P V8080 0&,00S0U0SPqQ #RH L0SP0\ 0 x8 0   8$ <  0CS00S0 $  0 $08 ? PHLPP\ 6 $8fPP~,00(004 00 023NPP mQV 4( `000CS0(0&  @P  0M|PP  @Q0$P000$0]000A A1 2 0R44 (0 00CS0(0   @P 3P T.X+'' SR0 000HS# SR80Co4( P8Ey@00 D0@P 88yD0T`0H`SX <0 000CS000 4  @P4  8yW8P 0 0H@PH`<HP0 000CS000 4  @P4 P 0 0Hg@PHP`8x`唀X H@P 9,0@ HM@PH` V  LP8xH@$0:d 00 D0@TuD0T`0H`SW <0 000CS000 4  @@P4 xP 0 0H@PH`k<HP0 000CS000 4  @P4 UP 0 0H@PHPH0+S[u  p0 D0&@P0@ H@PH` +U `@@TT-eA@c@-0S00 Ѝs@-P0S`@P ^ !  0Ѝp@-@<0 J 00CS 0@JJ܍e@-@08 <6>0@ 001/'Be@-@08<7+0@ 001/'Be@-@08 <60@ 001/'Be@-@08<70@ 001/'Bep@-@PI0 R p@IA-`p P@P!@ 0@P0  Xl030000 @P X AЍ0 弲@cO-@M0SjP{{Xf 00 `00S00 0POP * Q?0 0 S(!0000S 0  0 Ѝ0S. 0 00R0S @ 0S 0  0000`[ V:0N000@000`0 0 000-e>A@-@8 0 ,@PAG-8`08MP0 0C, S0, 0 @8Ѝ 0R@ #p000D (08 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CS]rTQ, BTOL ($f@P yv$0000$(00(000(0000DA AD1(L T2, 3   !  2@P A , 4000CS0,0 0  PP0  3v@hNP 0 04PPT  , 000CS0,0 0  PP0 00CS0! 0  0 0C?o20 0R 1 0 c># C,0!0 0 0H03!R@P  08ЍGTG܌A-eA@cA,e0 X7@-P@0LP! "0S, ,00 13/ Ѝ0)A*BeMA@-@0S 5@KC-`M @MP- 00 0SS S p0 S2 I00>00 P 0  w 0@ЍO-p0PDM,sr`l90V0< 4%P00P0H $078 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CS%qTHh몗0 P@ X@ @T@ T0S@DЍR 0, BTQL $8@P2 t TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L\80 3SH L0SP0\ 0 p800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013P@P A4( <000CS0(0 ,  `P,  0Qt@fRSiP 0 0<`P<T 09tTN0K 00G 0S S@A4( 000CS0(0 ,  `P, 4 @DЍOsS@ ꜖ 0@0T -eA@cp@-`P@M8  ;8P00   08 H@   0 013/Ѝp,'Be@-p`@M8 %    P00  0H X@ g 0 013/Ѝ,'Bep@-@ `(MP0} 0 0$00 000 P`@P A ws(ЍpO-dM000/H0p0H0 <D ` $0O X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSM:oU, BU?L $4 PP sX400004$00$000$0.000EQ QE1(L4$^0q  R[ 3SH L0SP0\ 0Rn400004$0PQ #RH L0SP0\ 0 n4 0   4$ <  0CS00S0 $  L 0 $0\40 3SH L0SP0\ 0n400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05}n400004$03R 3SH L0SP0\ 0 fn400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 M40q u R> 3SH L0SP0\ 05 n400004$03R 3SH L0SP0\ 0  n400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05m400004$03R 3SH L0SP0\ 0 m400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,(80 ^0P3l:0S#S$Pe PPe "؀(,x1 3پPP!  0 E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 匾PPЍP@cO-00$`pT0DM|0T0 D $0' WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_jT@ڔ, BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  vPP, L 0m@DЍ800008$00$000$0000DA AD1(LQQ #RH L0SP0\ 0 i8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0nm4( 000CS0(0 ,  @P, w P 0Qm?@R 0 @P@T4( 000CS0(0 ,  @P, M P 0'mH@\WAT!-eA@cO-0 0p0/PTM:0`<00SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSNhU , BU@L 4HPP! l TЍH0000H400400040000EQ QE1(L3H0A 3SH L0SP0\ 08hH0000H403Q #RH L0SP0\ 0 nhH 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0W0PS5 QN0!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @kPM,P< P 0 0D0Le@PLU@4D8 000CS080 < 8 Dz@P< D8 000CS080 < 8 Db@P< p0@P@kHP0 0D0L!@PLP 80DP @k P@k 0K0 00S Oo0BS@T@$0TPU-eA@cO-M<00`D  T 4P0 @0/P:0 <(000^=00(0`SX040H00L0:0$`40 P 0S`Vڨ+tPH\00\0 0SP1<0,PS    T0(0 pSd 0Q8```$ #RHL R P \  BRH L0S0P0\ 0  0CShgV/ژ , BVZ TdL `P: j 4?<0S <00C00S{ʐ&=<D0$ V 00Ѝd0000dT00T000T00Fa aF00010(LUd0\ 3SH L0SP0\ 0Sfd0000dT0QQ #RH L0SP0\ 0 fd 0   dT <  0CS00S0 T  0T00 L d0 3SH L0SP0\ 0afd0000dT0<  0CS00S0T00 0T0^[XD0`S` <0S~ `3f HL D`P   T\P$ A# d X`P0 0C0000 00C00 0 0<000L<  d B'00X0 0`00\000 00`63`P a(0Sp `X p000CS0X0- h X `uP$ \i `<  0CS00Sb0T000T0 } T0d`P h L5 0RK` X0 0 0CS0X0 h X `6Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh YP0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP VV` X0 00CS0X0 h X `pP \h`P0%'hUP\h`U0PE 000,0C0 0000 0S/0 000$0pS SPpp :Q> 0PbQ ;$p[ P0hH0\hV 0, X0C 040040_ 0 LP0$0, ?oU20SS 0 E000 0C0000000 0S 0 59$0 0pP  0$0SYQ0X 0`(0‐PP \ch`wꀐ(|`VbOAgA-eA,.@c,eO-dM000&@`p0圐l0p0$ H pp  $0 8@(VP4n 8P  " QHLP\P@@ @D[L0S0P0\00C SJd[ A[<L $4@P g`400004$00$ 00 0$0000K! !B1(LZDg`?@ V8080800S0T0S@dЍP QH L0SP0\ 0 c4 0   4$ <  0CS00S0 $  0 $04p0i 3SH L0S0\P00 0CW_L0S0P0\ 0  0CS zcWe400004$00$000 $0000Gq qG 1800,000(00  0 )@P KAV 0( `000CS0(0  PP  ,(g@. < 0CW 0 $4@P 2 0R p50 (0 00CS0(0   PP pP TpXP@Dp 'SR0000HS#SR8ppGor0( <000CS0(0  nPP `P 0 0<4PP<YP 0SW P00PX0?o2P @YP ,fP0%'Wv[-eA,e0@-00 : ЍO-p0@0lM$ `H  x00x0000000 00 @@  ,0Y[P<{ 8P  # QHLPP@\@@DZHL0S0P0\00C SVDbZ  AZHL ,<@P 'f `<0000<,00, 00 0,06000J! !B1(LWOf `?@ [808 8080V0@00S0T0S@lЍP QH L0SP0\ 0 a< 0   <, <  0CS00S0 ,  0 ,00<@0 3SgH L0S0P0\ 0  0CT}H L0S0P0\ 0  0CS aTW<0000<,00,000,0000DA AD $1< [ P8@@@N QHLQP\ATDHL0S0P0\00CS TaT <0000<,00,000,00DA ADV00010(L < 0CT0$ ,<@P ATL ,<@P0S 0<@0 3SH L0S0\P00 0CSL0S0P0\ 0  0CS `T<0000<,00,000,0000DA AD 1p@0000 08004000 00埾@P A[g 80 p000CS000G ( 0 8KPP( > `4d@P QHL0SP0\0 `<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<M@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(c`X\` ^`[L`HPVP'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( l,P 00 08D~PP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8PP(  4c@`P0%'0000 R p58 00 00CS000 ( 0 8ZPP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8#PP( `P 00 08DPPDZP 0SW P00PX0?o2X HP 4ScMP0%' `TT1T Z-eA,e@-4 0Ü   Ѝ@cO-p0\M0 0@ 0 00圐$<S0  D0 00,0*0 00, <00 `SPu 8QPPP+ #RH LQ\P AU!L0S0P0\ 0  0CSP^U  0 x0?R*`b, BU:L <PPP bP0000P<00<000<0000EQ QE1(LTP0[ 3SH L0SP0\ 0R^P0000P<0PQ #RH L0SP0\ 0 ^P 0   P< <  0CS00S0 <  L 0 <0 P0o 3SH L0SP0\ 0fa^P0000P<0d<  0CS00S <0    <                0@xH00L00H0000  06 3PP Q0SZ L@ 00$0CST0@0" D  L`P HaP\Ѝ<  0CS00S0<000<0D P 0 0LTP`PT0$0UHL@ 000CS0@0 D @ Ld`PD 0000L@ 000CS0@0 D @ LK`PD `PFPL@ 000CS0@0 D @ L,PD  Z#3PHwa[0k Ū0 08#800C0 0C00 00 0 0C0V` !8888YL @0 0 0CR S 0@0 D @ L`P?DXU(R0@S`H+aHP1S0@0 D @ L`P D9(,kX04 `04 0000C000000C0  A0XN0 [p(00`Ḁ 00 L 0C00 00 0 0C0 @0XP H` PH`0 H !0 0C0000 00C0L @0 0 0CR. S 0@0 D @ LQP H`PL @0 0 0C R@@L`P`DV$ 01  S0@0 D @ L"PDV  000S U-eA@cO-0M0@00`p$ h,00+000\ 00;8 PPDP+ #RH LQ\P AU!L0S0P0\ 0  0CSY)\U" 0 x0?R*, BUCL 0DPP$ `,P Y qЍD0000D000000000 000EQ QE1(L冽D0 3SH L0SP0\ 0 [D0000D00 <  0CS00S00 00!0000 400 0 0@000 000000 00x0p00<00$0 08 3nPP Q@4 L000CS040 8  P <p_Pi8 P 0 0L޿PLU<W@4 000C S 040 8  P8 0000bPGP@ 40 00CS040 8 4 @P8D [#3P<_ 0Sc0 h0 08#800C0 0C00 00 0 0C0X !8888@4 000C S 040 8 4 @Pm8 0 00@S<^HP0,cX0 0 0000C000000C0  A000XV0 ` 0 000 S0Ḁ00  0C00@ 00 0 0C0 40 P <^ P0 H H ק0 0C0000 00C0 0000@4 000C S 040 8 4 @P <Y^ PR@ 40 0 0C R0404@P8 X 01 00CV@ 4P0 00C SST040 8 4T @P8T @4 000CS040 8 4 @P8 %PQ @4 000CS040 8 4 @P8 0@?S@ 40 0 0C R 4  8@4|PG88 S> LP8 R,Hp0 ,żX H0,P0 11x C60 0hd,P YM 0,0@ 40 00CS040 8 4 @=P78M<0 H0ZPH0T0,0S040 8 4 @P8 P@4 0 00CR4ղ4@P [UI-eA@c#BO-00p L0DM✠0L0<$ H 00$0 P -0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS9YTڜ, BT+L $8@P \800008$00$000$0 000DA AD1(L兺W4\?@Pl0SQ #RH L0SP0\ 0 X8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS XTv800008$00$000$0000DA AD 1p00(40  h0p >@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  06\ < 0CT0 $8@P )E0@?S`0\H@Pl00S=T 0l 08 U6 n3 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0 0 L卹`p 0 @P  0[DЍ 0@QLw 0 L  Lo 0h`L0 0 0  c0-@lЍ, BT3L 0@@P Z@0000@000000000000DA AD1(L~0S;Z?@` V8080Q #RH L0SP0\ 0 V@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@n@P@V0  R- 3SH L0SP0\ 0$yV@0000@00"  @Q00@00000y0A A1 <  0CS00S00K000 00;Z@0q E R 3SH L0SP0\ 0 -V@0000@00 <  0CS00S0000000:00'@0> 3SH L0SP0\ 05U@0000@003R 3SH L0SP0\ 0 U@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 U@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 ~U@0000@00 <  0CS00S00 00000008<@tz {TZ@0  \ #RHL RP \ IU@ 0   @0 , B R  R 0  000408C@@HL@tz {TZ@0  \ #R HL RP\ A Q U@ 0 @ 00  00040H P 00CS@0 3SH L0SP0\ 0T@0000@00\ #RHL RP \ T@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 T@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ lT@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 ?T@0000@00 <  0CS00S00 00000001<  0CS00S900000002 '0#0 <00480 00 0|2 3ѱ@P `AV <4 000CS040Y ,  <|@P, P 8R 3SH L0SP0\ 0 S@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  <@P, 0@?SP8]WH@-eA-e-eȇA#BMb@c,eP < 40 0 0C R 4  ,< @P,e00 H0@P]H0VT6 <4 000CS040 ,  <@P,  8W`Y> n;*[PP <4 000CSST 4 T <g@P[UPP% 0 0<XXc@PXV <4 `000CS040 ,  <xPP,  8V@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < FPP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  < PP, `P" 0 0<DӶPPDp[P 0S 0S P00PX0 P?o2X HP 89VT# $0 N[P0%'T+p@- P`0 PP@0 hp0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSSQTu0$00, BT@L L`@P U`0000`L00L000L0000DA AD1(L#0SHyU?@80VT00S $0S S V@0S T0 屐Q #RH L0SP0\ 0 XQ` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$Q`0000`L0"  @Q0L@000L00A A1 勲<  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 P`0000`L0 <  0CS00S0L@000L000P0 0\00X000 0:3v@P A 0S \P 000CS0P0f T P \!@PT ] X$`0q E R 3SH L0SP0\ 0 fP`0000`L0 <  0CS00S0L000L0T900``0? 3SH L0SP0\ 067P`0000`L04R 3SH L0SP0\ 0  P`0000`L0 <  0CS00S0L 000L0,800<  0CS00S0L 000L0700`0 3SH L0SP0\ 0 O`0000`L0 <  0CS00S0L 000L0,700`0 3SH L0SP0\ 0 O`0000`L0 <  0CS00S0L 000L0|6008p<@tw vTW`0 S \ #RHL RP \ ~O` 0   `L , B R  R L  0L0408x@uHpL@tw uTW`0  \l #RHL RP \ cBO` 0   `L `\ #RHL RP \ *O` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 N`0000`L0 <  0CS00S0L 000L000, B R  R L  0L040HP\ #RHL RP \ N` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 N`0000`L0 <  0CS00S0L 000L000R 3SH L0SP0\ 0 cN`0000`L0 <  0CS00S0L 00 0L0 81R01Z 10000 08Q@p ,C`HHEP0s0{ ,?@c;t7\P PP000C S0P0 T P \@PT 0@?Sp`PXQH@z-eA-e#B-eMb,e@cp `P\ P0 0 0C R P  T\P}@PT[00 h0➸@PSh0T00 0S+ \P 000CS0P0 T P \Z@PT 8WPP \P 000CSST P T P\ @P!WUPP* 0P \x00x0@Px00 0S \P `000CS0P0 T P \PPT  XlQ@pW@H00,2300 @PH0T0d2 0R04\ P0 0 0CS0P0 T P \PPTXx|p RPNlh0Ipx |00\R  4 RI0 4 QSD80I?o200(0S> &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\d_PPsdY`40SZ00S P00`X00(pp?o2x h}Pp ( <0R0(0XPTA80$ R00S x@s#sr8$srH(5 3 )@P/09 ,0 @0  808(0S0ЍP0%' ɋTO-@ 0lM/00p0@@P0\@h00h0Ȫ   U (0 L0  <  (0= U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CY)LY@, B RL (<@P  PP`!<0000<(00( 00 0(0000I I 1(L啭00SKPO`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0 K< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< s@PyU <K0q ` R/ 3SH L0SP0\ 0&zK<0000<(0$  @Q0(@000(00A Aw010 <  0CS00S0(000(0:00Y<0> 3SH L0SP0\ 050K<0000<(03R 3SH L0SP0\ 0 K<0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 J<0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0 J<0000<(0 <  0CS00S0( 000(0008<@ty qTY<0 S \ #RHL RP \ {J< 0   <( , B R  R (  0(0408u@rHL@ty pTY<0  \l #RHL RP \ c?J< 0   <( `\ #RHL RP \ 'J< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 I<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<⎾@PU<0 3SH L0SP0\ 0{I<0000<(0y\ #RHL RP \ I< 0   <( , BR (  0(040<0 3SH L0SP0\ 0 YI<0000<(0 <  0CS00S0( 000(000v AR( ( F0 0 0C11C!0 循t<  0CS00Sz0(" 00 0(00$1000 08@p 1B`HP0s0 !?@c@004000,8 0 0D13嶦@Pp UAn T`8, 000CS0,0 0  `@P0  4L`"PPK 8, 000CS0,0 0  C@P0 0@?Sp 4L`H@P-eA-e#B-eMb,e@c8 ,0 0 0C R ,  0 @P0``H0 :@PH0T` 4bL`8, 000CS0,0 0  @P0 jU P-@8, P000CS0,0* 0  ٻpP0 ! 4,L@P 8, 000CSST , T  ዼ@P 0 0XX`勬@PX` 1 0R88 ,0 00CS0,0 0   㝻pP0X\ ` LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  _pP0 PP 0 0D%pPy 0DSp $0SX P00pX0?o2X HIP 4KP0%'@ 0  ҆0X0X00,4 3 00 0@PX0T`00@`T U`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00 ' U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;GZh, BZ-L 0H@P JPp H0000H0000 00 000000J J 1(L0S3PJp?@`]Q #RH L0SP0\ 0 FH 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS FXtH0000H000000000000H H10 HU0 | KqU R$ 3SH L0SP0\ 0TFH0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00>H0> 3SH L0SP0\ 05FH0000H003R 3SH L0SP0\ 0 EH0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0 EH0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 EH0000H00 <  0CS00S00 00000008<@tx kTXH0 P \K #R HL RP\ A Q ZEH 0 H 00  000408`@]HL@tx) kTXH0  \o #RHL RP \ f*EH 0   H0 c \ #RHL RP \ EH 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 DH0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043w@P AU( D4 000CS040 8  #@P8  @vH`pP U8080<00S0T0SpV Ế,003 3 00 0@P,0T`0K?o 2R0S@  00@`W\ #RHL RP \ 2DH 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 DH0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 CH0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  &@P8  @yG0@?Sp`@nGH@-eA-e@c#B-eMb,ep `D 40 0 0C R 4  8 @P8 @IG00 P0@PP0UT`2 D4 000CS040 8  Ѷ@P8  @$Gp`>WP D4 000CSST 4 T  {@PWX 0 0```y@P``@U D4 P000CS040 8  ፶P8  @F@jp`02 0R $4D 40 00CS040 8   iP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 D3P8 PP 04 0DLPLZ㜀 $0SY P00X0?o2` PP @cFP0%'T V [ ᵼtЍ żXZLO-p M0`ᓁ0 00S$ܻ@hAὼ3 1 H`PΣ 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0EVPP PU 003 00 0H@Ѝ000zS0PT"$ၻoA@cABG-P `MpPL0S@ ֹP 0 003 P@( 0U&2ЍH0S0 RP@IP @ NP0SH0S300 10 CS 8:8ֻꑍA@cG-`@0 S_Tp  SXuPڜ0H0S0S 0 Pᬻ@1 3 00000 00 0 P UU0S 00   zT 0S 0pTᏻT v ቻᇻЍ0 Pf@cO-0pdM A@EdЍA%`000D $0ܳ8 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CS@T, BTzL $8⚵@P D800008$00$000$0000DA AD1(L880V 3S HL0SP \0  B R @800 80$ $ 00 0 $0 0(0400 00 00;@P ]A4( 地000CS0(0 ,  PP,  040)l"0< 'Px0q Bd\%<3R=S9d0#S\$0( 嵏0 $0 (ъ RP$0 00 S21 00S  0IB˱ Q!lP  lP P<@@ 00F PE000 ;< cP_oQeP?$00P40S 00 廊4000P0x RH0x0gT3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#3202n4P 7t05t0$0<Ѝ(0j (0 0s0P Ys4P TsTU TA@-003!z?` 0 Ѝ@cA0@-qPM:Ѝ0@@80@ 3P@z?00`0 rЍ0@cAC-M8`0@XP:@DŔ  8TAVp pϬQ @$ @T@ `h8Ĕ< R d(P`wЍ:AAO-,M 0%!@ 0ᙉPP``b\%1R=Sb `1R\0 嵟 p1>0S100! 0 $8=$S 01000W 00p50 00TpL4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOdTU AГAO-00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP g(b  $  iH000$ ~H0H0 , H0 00S  00S  00R<0D@$0C!d 0 ~~$ 40`R0A|00S p 006@4" ,0S HgꈔAA$At/TU TCcAAO-p`0P4M 0 ?F~0@00 !0\%0$01R 00@ ``&!! X0 00?P@? j4*!, ZS QS:jP ,l 00\ Ó\ >g4Ѝ $0 R  X   !,gTAU O-P0@Ḡ $M}0\ `#,^ 00 0T ? A)A<)a>21,, X :@ 0@P`YjP h 00Q Q f $ЍH  0 0 PSgT(AU O-PḰ@ 0$M|}0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X :@ 0@P@ iP h 00Q Q {f $ЍH  0 0 PfTXAU C-`PḀ@p 0M} 0\Žß0.S\! 00 Q    ` a 00T_40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P /f40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00hP0d0(T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Dp0$0101 0 "p `@ H0PP0805@U50P%P0L05P000Te40 `001 0 0p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0cP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0-PP <0 B2 b061")(! ''0001S 1' d X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(Vgb8U@e8 L0PP`P`U1S 00P000T\% 0 R qq p0@01 0 0@0p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000TI0 p001 0 0p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0El0000 0(*P(l00Cl00 01 0g00T1 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPdcPP0 0ap0T000400`0  0 F Ϭ 0f2f=bd000 00 00  0OPd0+ )bpG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( $Pd>a:a< 0(bd0000000%FdP p喾H0p`d10 `a040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( ጒ0p !0001S P 1 Oa X0P 0 PB2 b50>" pPG Q0 :1S1 !< ^8U@e8 L0PP`P`U00T\%0 R qq(0@01 0 0@Jp0$01 01 01 0` 0Pp@=P0p Q0@558 50P%P0L05P000T0 (001 0 0p00101 0 0PeP1S 01Pp 0 0T0 C)C)ct00<21 ( 0l0000 0(l'Pl00Cl00 01Sb00T1 P  0 p001 P@000 0 0 HPPx0d000 000p`0T0x` C)C)ct02160" *(PPdp`PP0 0a0T00|0400`8P<0d000000(0!cPPd00L0L 0ql0< R 0P00 _x0PT40@HkP ds_80slpJx`40V:[ h04Ch000T1P Pl0R 0 L0P 00 0 0O@H@0H 00 (0 0B@Hp001 P 000 0@00H00 0PPp4ph0400 0000T0 C)C)ct0201<" ("PP4 d_4ph4_PP480< s0L <001d _<04p80P0`X|_10J`Pu00TL0 010l02H0 0 0p001 01 0000 0#PPV4 ppt0p!R  !  0  T B)B1) b072  0(PP400407l0 2H0L q,_^1S !00h  0 0(bPP  0T0() C C")0c7#10 0 ad 000"00  ( QPHd0p ἐ?00T0 `C0)0c VQQ? Q%u/" \5 S 0?!>0  0 F Ϭ 0f2f^d000 00 00  0 Pd0) ^pG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( Pd]]8 0(bd0000000%FZaPd0H 00d^|040n 000?Q00cTO-@P؅p(,`PT: [0 S0S NPZ@V 0000000@@000@ @O-需TMpP:0SA@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0(t$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0_o@RTP$]U000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUPPPP};8%P@5PL0P@vc@ycAO-p|M00-P `\븰[ 000`P|Ѝ0 00\@000S/ :0 80NP0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P m\U :P n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ _PU@7 '\0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @H_( LP@% 0@D TTw 0,0 X ǀPU@m[V 0080\0000!Pi@yc0   R  R*4 Rḩ@-*뺖A000S -/0   R Q   -//@-P`00S-@! < 3@P@P 0@0 0 P]@ 0S R Y@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 @P 0ST 0S@Pu@PL B0pI@p p G pp h뼰0@0 0  Cp 00 @W  A KQ@K0P L" l1. Q*  S0 S 0 S00@$Ѝ 0p@ 0  p    q  @P   z  q弰帀}  @-@@A-P@00S= 00CS9< 6PP0Sk@p?oV20#S 00W: 0R R 0000@0` R C@@-A-P`00SE 00SC 00A0 @P 0S 0S@Ѝx@Pp |뼀 0@0 0 Wp ]@ @ A HcHp ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$p8H\0`0P00 00 P (0 P6\0 44#T20T20$ ;60 0Rڼ2t ?0:# 4080$0H0(#00埰\W@P\嗘@P \YdЍ\0000S00$00?@D0@0S@@T @ 0Ϝ\00 0˄800t RY\7Z0 @0S 00004L0?tPP0(0`E 0/#\00000,< 1P(080< SH007D0 R00S 00S`0 1`0 0 400$0C0 0o T0 C)Cba)0c9c00, `Pg  R !00 R(  ) 080S03 S300S P" 00 00p00S01 0( A0L 0 0P 0 ,0 0,000 000<0`V0<0(00C(0~S 0 00T0C00 T0 C)C) c0<;2 , 00PPT 0U0T0S 0S P0 _o$0R_P@0S \\YUS@cϖA@-`Pp!0MV @ p0 W p0 P  $0 Q D 0  0V `0 P ( ,0 Q @ @0D 0 @0D 0  U P0 P 0 40 Q$ H 0, 00:00Ѝ    O-`0Mpp@P0 s00Su 0@ 00@`p\%1R,5S0 0 0 n0 o."\哞T1`Z 0 ?  Ϡ ,2 0 `x 0n`0 C c00T0 ` C)Cba0)0c"035[P0000x 0`0{n\0\%R ,W nXЍ0 )X TTO-]M 0 0$0@ C0CSR ]ߍ0S1  ;100P`S00|hp 0\5pSB\\?@5D0L 04; pW SØ,.1  0 Su0R: pSWk00S(pDn 0)PY 0000 0 Df8(\$Q?00 \0Z&/ 0Z& 0 0 0 0Pr  P$P$8ŕ0 @L (QcY!0800<00PS 0È)R 0V:0 0 $00 01 $0加S 0 0kP0$ c2# S,P!Q  RQIp S1Q\Q\3PR= $08u< p 0 H0pß $0YW/  0ᯈ10$0  W 00 $ 0H P 10$ 0X #H0P$ p  ~p. ?࿭ 00 S100 0 P 0u0S 0 000 0R    0%00 0/SP0 c0 SRQR3000Z,00004000 ZP t0T RX  R?&4D00\h p BW, W pq0S*0p ,Y ! !X4@X Y   !0 C 0[00 0 0pQt1(( R@ 0pPi1XXϠ R$0 0 0p0 0R$       0 0000x0P0[0 S0&t 0( 0Sp0 0St0Sx0|\% 0R  P ! P01@ # 0@0H  p 0T0 C)C )0c8Ì"h0 30P(0@0S" 00 0 00 0S(0 01H0DL0H0LpW* p,0S40 0,04 rs \%5R,00 0!!0 ,0 S400 P00 L ᜐ pl̠: S?:0p000000S00000 00,0 S400 P00 A1ᜐ a8:<P0%:00S-38%$"6600Q 00Si 0_P 0 b R320 QP1Q SQ ☐ pBᜠ b<  YS:0 B z'z b~3p2z0W p11$0 吓S 0  0H0$p5 5C20000 0G00=0 p 0~pY 0X%0'00 0ᱫP 0 S100 0 P 8@ŕ L     1ptpt1p@0S(0#S [ 0(0$ 0 $0(80 0<080 H0<00 0R8   < < L   0 Rh  Bh    R  ᨽ000c\%P0R !0 !08 P L@ l0 ^85@50%00L508Q Q0(0<0 0S 0 01H0L0H0LpW8up@5pL0p85@00L0TAApGWm8Q Q0(0 TS1 p?H0L0H0LQ 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"7@P 000 v~9SS@ЍQQG-p0 `$PUR@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000刀>QPlU@-`00pdPU@ 0 uUp@ T  ЍT80< @31)` Q0R 0008<Ĕ?LeP0 C c00 0 6P ` 0#0X  0 h 0S000 0`,``000008 1$01B0I> 0008<Ĕ? eP0 C c0 ,$0P `庩V0L"ᘫ0 0 40h00Ō000R@cLApAAAA 0G-p0`@ PU 000W GhČ R 00 0h Rh9S000 0O-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPr p$`W0@: ,0W0:F,Ѝ\0Q.01^ 08T @)@)`"30JPd 00\ Ó\ OGxKG0哸+0[0: 0 TU p0Sp/p@-@PM 00@0@ @@@|`0 0@0@ @@@P0 @@ @@@P  Ѝp@Cc Al.e8 p00CSp0/@- @ jh@eCcl.e@-0 R  @ @0b ` 0)rЍЀ-M 7zPpoЍ&AO-0,M H P00͏0 ipyW X@?n /h+p+ 0 $+4 JP   0q % ! % F\%0R004\5 P  ȉ ,Ѝtl4RR  ẉh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3q  ᗉ000j0P0<(%0 0R@0@0 0T`0$S> ) %> 1S 0DV<3<310P4T$0X4S E>0X4'40`A\VL V$5S0P=$bx $)b`P [PP/ 80HL0S40pH0pՓT0 C)C)0c"03=IPP  0q  E80`$%!0, R0 h0P T:꜀ \h\ἠ_<#| YP  0 ?<#Ή p 0Px 0L\`0 C c00T0P C)CRQ 0)0c03"HPP qP$a"   ]Eac0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 SD0400P008T0<P C)C44)0c03"G0P440$ R:oD4 5Ҡ  0 Z00C?o200004圀AT$%,0R00嘇L0Yg$5S0PŒ, H=[4dS944S@040T3 0P1&b110 1<(%0 0R@0@00P :>0 $  * NPf 0L0[0T h0T0㦸4P CUo P C$>00b0(V 2 20800080 H0S0L0 C40œ T0 C)C4)0c03"5G0P4 0,0 o,04 C,04080g$%0 , Rh 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P08Z 0 <Ѝ\4S  5  0|V000\ \ 0^* a@fdA8 TT 8T AUA/A0AA@-0S0iP@  sA@`@0T d Ѝ 070@T ^^070b`0u/Pp+Z0Y V<C^@^j@ct]e֝A@DeA-P00`SP pm_@P e_@PH0  q`弙@Ѝ̋cC-@p3$M/P++  h0$+4`P6T0h 0n0 51 50@0\%R=S04, 030304040 50m0" " 200(0\5W_C`$Ѝ@T8 O-,M@40ARp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"03=P$ 0m0$000SC8 Py@G-pMR R`@A ZP   hPV!P4 !]PP0 RPq0,mP V 0S 0 0R\!6V 0\P 0]0 P@0&00 0QP嬘U:040000 0hPP,V,`L``ފ P単U0b i0PaUp`z 忊 ҕo…Kp`=S0 Po04=S:0 0S0SMP(0 aPPP 0 0S 50ó 5y=S  0  PP Ѝ0 5< 0HV0004!4!V000C?o20000\4S Xu/V8 5 0 5=S# UⱜTP=S 0 >1C>00 }0SUT◜010PWPU@cHBA/A0AAAA-@`L1pPP ;00' pPB=TSFP 0 <=0S lՉ= S„$%0,RL1hP \^000:0@cO-P@`=$MS =S  \T㜡T00p@0 \P9\T 0*0T RdX_X Tr ҕPpT =S+ 00o0Cn>P$Ѝ O P VT 0P5 p 0   坕XAI0p@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0ԒP 9 ;909  000&00PP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0\M0(0 0 0 ) 0% 0 000 ) S RQ0Sd0$0$ 00 0 ^0X:$0S$> 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  05q80 V 0(00 0 0P40S #H0 .`np`` ? O0:P00S P0S 0) 0p0`085< `F V`!V"40S {#H08<Ř  Ÿ   . ?xD HLW  < W Q  #&&  "00`0,00,000"R0 0 00TpTQQ80@ 0(00 ?P;H0 C2 00000 0&",R0 0 00Kp[@0Sh0'C( 0C8RP] 000 #8 '(80(0嚕PK $00(0 +\Ѝҧ0( 0 8 @  1/Ч[!p@- @P哭 Pp0p@0@-@PpȔ9S ʰ;S  0"*`PQ 0 SL0L0噕a0P0 0 動 Ѝt.ex.ep.eO-pLMP4  P3s:Pp R00`5M:eP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@@P80' @DXT $@0,0 $XbY8 o=080[ 0 0 0 \$  0 $ R0 8P U= 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<@O-@P `R0 pM0 ЍO> 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  ) R 0P0 1R H0C200 00 0;% P ЍO-需,0 0/\*0 ,\0 0 ) Xn,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` ,a@P 4B<" 0 @P4<Ѝ8e@5``L0`(04S <oobT`V 00 0SO:<@-P`mb@P0 0@P   0 00Pƌ0 ЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?R p p 0 00000.0>000 "@P9 W000 04@P, i0S) 0 ^@@T0S3 00S00j@P  0  0@3 100㑐\Ѝ2 9pP 0   0,0j9'@ǐTd@cvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-$}00  Ѝ.e@cAp@- 0P p#*\Œ\\p0QpVQp8LP8840=40 0@pDcLAT0cuA.eHc- P0 SQO- 4 R 40  #H/" R @RP `@ p`f9gpTpTP^@!`n``p R  ^N  ``QRV^ 40S40p ЍHp@D `4`j PUiQNo @`j `>i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000-a0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(09PP 0 =$05L0 C c#3800 9!600< 0 2#T20T2^5P $ 7 Ѝ`(0$ 854D40SU 6600 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000@cTd@-0S    P (000 00 0 <Ѝ䈈0 p@-0@00P`06/ 000`06/P Wz00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0EyPEP0W(0,0ů _t1 000040 0 0"pP ዟ$#yLЍ0x 0 | P ( 01/Pu0@ 0 p 01/bH4Q|OpUp(6*C/Q @ ?QD   00ã 0aPMMM\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0l!  0`啐Lcw hQ Ѝ!yA@-0,@00V@"4/Ѝ66A0@-@0@000@@PD @DPPP0 0 P: 08S00P00000A$AANADAp@-@`P(0P0  _ P bK000@09#60pO-P@p0KM 0`@`0U0:KߍP1 00P0 0 ;0!Q \0:V&0'0S(.^S(,0S ^ P\)0.SP PO-P10DMp @0! 0w 01 0~w 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 7@P0 h 40R 0 h`F ` l 0+w (wDЍDcO- p`0MP$00$ 00@0000D000 t0 P @"D0900 00 0KS@$00|00000 ]9P |0S080$0@OoB@Ѝ᪊PM@`00 0`0|0S0800`0007X000C?o270L00000L0000[00CT0T R ?R5:0X80@040X0  <00 @0C0?d00?\00\0 J0H00,008#8@0 0h0X0H S80S0X0T0 H00(80TX <0t@P t XT0 P 30X t00?@Pq0 00(0t0(P0000ഐYg & R   0 P 0\  R Rj 4 R      IRLXP^P`z( ( (L R  A, T R? 4 R  R8 l0YdPl014 RB  R?\0XH800,0tP 2`0Sw [08S 0$00 :d$X 0h0@0 C 0)X @<  X 0S (<  ,  8 R\0;04 XR@@)@@@@R0*#f @圐 0R@ @000PK2X0[00SW 0 cX00T0 0 儀0"XQivx`$0x000 9{00S6 9S3 D0  wP@0S 0d \0H0L@XH:H@PiM[0 @<0@J,0,@0X[Q@T[=00S X0  <  C 0L 儀0"XQ vx` xp @P9  0 0L 0`p岄P @u! x0Bw@Px0$ 0@X0[00Sf D0  P@ 0 儀0"XQ@  x0w@Px0$ 0Յ x0w@PH00SRDcVAaA@A-Mp@ `0- 0?PP$ 0 T 9 0C8C8900000TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP$0  @@  9 0C8C890000Ƅ0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?}@Pm@00$0@T  R@@@@@`ᴰK [00S S% CbP[,Ǒ  @ `@ T@ 0P@@@@@B [0[ᴀǑ@Ƒ`0S 4"40 [ /0@P00 R ?R *  1/,ЍrAO- ,M@RP0Sp0 P刐`0I $ ⮍0  ?1/P6 0 00P 00000)b@ 4"400 00C0 0   Y[ȃ@zW0 00`06/T,Ѝ ,ЍOꙧA-DMLH ,  0DЍ䰧A@-0"HP Ѝ@-0 \ 0 00\nЍA- MP8@<`P^0yᨀPPP)0P p@`e Ѝ 0 圗@-)@0喗 Ѝ@- @ 0 0)0 Ѝs@-`@0 0IPPPP 3L0 00 ЍpO- ʠ,ʠ`@*ᦕ0  ~@R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#0 0 p}@PX0|0#880'00 Rd0X00$00|0 *P\P3Ѝ z0s8 0@@z 0 { @*0 p}@P 嬰0 Rt 娠0 Rp000*P\P2"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 ȕ@@ 0 pW}@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *300)0 p }@P# 9  :(090*P\P,2-@@@@AA-`p0S t 0d0 0 0P0 Lf@P90VmЍ@mO-` 0M0rPR@X1)RP##G*D1 0PA@0 0|PPP79 08C890 000000p07/P p 0 L. 2[ P ) B(B()    6U  Ѝ.eC-` @PpTLp T, T4000S-@ Ѝ贀 Ѐ@00@ T   b<@ 00 0P @  070 @咆.e(AO-3 0000000S  1!  0@0PPkꫪ@- 0 RR@ @Th R( K@ @p  R0  0@/@-0`0CSxP8<)Q\8}PP P'Ѝp#sr$ 0=P<0S 'P`}PP0V0 "2 0S`L`V <P 4003/P $ 40 <#1/P $PP$ 40 P0<#5/PP >0:0x\ATd@-`0P@ "6000 "40")`) P*0S< <00 13/(ЍpoAAA*Be֨A0   000 0 01/'Be0   0:0 0 01/'Bep@-P@gPڈ000`0 6/ 0p@0 1/,'Be0 0000 001/'Be0 0:00 001/'Bep@-P@gPڈ000`0 6/ 0p@0 1/,'Be0x 0CS0 0\ / 0, 0 0* 0+ 0 0/A0)H6@-@`P9#61S0S(0, 0C0000{0T @00D0@ЍpS  0 R( '0m#BO-M@P D`pI R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !@UP `0 R0: 00/S/0A-(M @  0P$HpLP`!ЍGIT T h厂000@0 4/0V0/oS" R(Ѝ000@بAC- 0" M0p0L @P- MP`0 R&0 S (p0P ` 0Q` ` )V0   00{T hЍ@@ 0 0 0 000 0 @@@-@0e(0$S, , ,0( @c@-@ pP [0800G,0$ @R(( ,,0|c.eS/S  !!0/G-``pP  {@P= aP ;P U Cg000 Qpq0$0 PgP gP gP gg ({X 010@/ec?e@-! @P  !;- $MD0< 0 4 40 , 00 0@ y$Ѝc0D0/eAp@-@ PQFgCg @g$0@s:gp@ {/eA- HP0D`p0C ##R@`V( 01S P `0D1X  Q R 1P `0Sp@-P@P p@0! 000CS00SWP0U:00p@G-HP=p0SЍG0 0 0S1 0S- `` I;C@P0sT@0P `` 0t<`P  =00C0 0 A;V;; 0D0 0p0000C0AAp@-P@ fP$0$0p 00 $0Cp@A-@P`"v$0S000000AG-0P@Sp`P0p0S(W !R 0 !V R"*0PE  1  BS !!  100C000CS0O-p@$PM 0`TT00 !1R 00B0 00TЍ1X0 0HS G 0 $ 0I  0@!1Rp0p  BZ F 0  0G p  00 S[ 0  0[ ^ @G-H`傊p  V@ P B5^:0\P`R  \ #RP  V 0S*0S    0 D@PH00000  #P0S .v PPH0800S00000000C0GD  !! !R  !1   0 S  B!800CS0000$00Cs0 D0HPD0cA-P$0@S`p000$00Cs0 AO-P`H@,MDX0 P0 0C#& #6&& 0! `0p $0s  }0  BwU  R!$00Cs0,Ѝ 0 ` 0 pB`FW 0K0D$00Cs0  0SH$U0@ s 0R0 B{ $0H sF q  [K0 $ 0$  LK `F!,8  AK0S 000D 101PXÕud 10$00Csp  Sdp  Od  Kd  Gd0 RS00P0S W 9d0S 3d0S -dZ  (d Y0 U0B$00 0V  !L0U0 00Z  ! L$0!7U V  !K0W$0j UP  !K$0!7 0$pR0 B 0H 0 P 0Q c cc0Is c0 `C0 R ! B!0 0!0 K  0 !0 0 !K0 C 0$p 0 0H0`F0D`Y0$0U A-`MP `p1@0%T00S`Ѝ,0(@0P,0(0,0(0SX , X00(P\0SP<1 <|(0SX@ @S , , , P0X0S\ , \ 0P0SP0! 0 R00R0S"000P0000SH凿(0X@S, , , 0X0S\ , \ 0UPc.eA 0 !6/ ! !Jp@-PS`@!V 01P 0  0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P` 0S00p@S000 p@0{ /-@ $M0 4  *( 0 0 00t$Ѝ0 A1e @-vP001eA-P@T* 0S' 0pҾ 0S W`P@0 Lx 0S 0 ; 000C0A p@-@5 P pP MPpR| PP `N0 09767V ppA@-@ PN0 0p@-@PT+ 0S Q 0`b00C000嚾 000Ap@ LJv 0 0 0p@p6 0S +1e3ep@-P@ 0 0 0,<6Ptp@S 0s/ R0( $ A\ @-4 00A A"1S@ ^\01,0//O-(0`9p"AR0,0Paq04`0AAbATW" n@P 1@ S0@A 5PQW`p V000 YZ @`W``fV00C00S0S   "p@cO-tMp0圀P@`@, ` Q80 S6 ?8P J80 `oᩒ tЍ(P,0PU0%VZZA8 00`0 < 0 8 V"80J0 0]8P "SR 0 !m5D80S ]8 0J0 00p8 `$6:00@ 000R  0  0 0|6Pi:Y% 7`  MY PZM5JV 7 !=47h0S8 0Jp@0 00`v0A8A|1G-p VZ`'v& TA0$pp P(00@0?o20/ $ AP0# pB"   40]V0X (00(0XH>`$p@p P(p@3`,V0h )/Y L@/DP ⊼@18@AS8 80< <@@⿼3eH3eDA@cc@/0@-`0ML@T LPL   @A`0 0,0 0X0@@kЍ03e@c`A @-VP@LO-plM $@6 `@ lЍn @`  t!@N@ S * 0L0w$ @$F 6 J0 0 07PP[6"R0   46 6Z(`,  [ty Zc4.4o4j 0Sf (0,#6~n4iAAA A-?Pp M     6  %:&p` @T @0 ЍQ"443,4 0D0 06O-$MH L $P!AYpZ `4!C20(2>B"  YV[ pf$ЍOz(0 AT  QPP SPUR QP  RQ  R R  0Rm0@P 0 K000 A`P X0P`@ď T0,0PK`@$Ѝ3e@c 0s/p@-@`M' OP1'< 800`S< < # A 5 0`5PP50  R8 $0AQ0%4 0T-Hs^`Ѝp5_ 0 P 25(0,#6jZ3,T^@cɩAC-Ap ᴺ@QU` Ѝ<0@8PU |޺"AR0@4 R`001S B XWP Q00P `ZV U T,0!X00W0S `"V0P `RU@c@cO-@M ` @VsC f %  ! . R  u1  0SI!/4d    BR - 00> $!*NF  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO%0 @ <P G2 2 S2X    0 ,  4 @, P3e>G- P@ U `D`(00@0$V0:Pp$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0pԩAܩAP3eO-4MX傉 8d娉0:hR 0PZ?)v%t(0$ 0AT,0@T3 0B!A0U QY (@ 0`0DC3f0S   $0%D#0* 0y $0p(0S, , " 80S< < # 0P 02( $ (( P( ,A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0*`09 0 *"*0 # 30 #6: ,00$0 0! 0 0*h0 d!0l!0 \    ,  d . 01/pP6 )4Ѝ 0`0DC3fd0 R  R Z % ,d2x$6d0$0 6 0/0 p,0W  0h 0 0,00P3eEcA>O- 00S #6:(00  $ (01/#P1 0B!0S@(06` 0 0T:0z<<Ѝ0@s 0,  |0J0S Y5 (P0,,10Zv50$0c2P,-/$0   0 N,-0,/,/,70, Z 00 0 0P3eEcA0@-,A,Q0  M*)[P & ![0,0,  P0 "Q0$( R*0 000p0&P p!u ,#004 ,0  $ 0,,Ѝ0@JQP3eDcAAx3e#DcAA1ԩA/O-pP@'0Xp'63ecAwA@-@P  06   0R  06,0 3100S/ $Q 5/@cp@-@PpPU  p@ p@fRp@-P@ T p@p@-@ 0S 0 0P`P   06p 06pO-M00pQ`@HPrPP U @T00@P" 000U## 0@ -P U&0W 0 DL 0D0 00@ @ T4P 0%K6 Ѝ&F6810*0.꠪AO-PM8@0pH.0`0 0+0VŒ 0  `P Y ,,@,, G 4P ` 1`Ѝ0S u,[,, 0  /(0, #60q !6P X,',d,ꫪAO-p00@`0PH9+0 2 00 0Y`P 7,*,C, 3P ` X1` Ѝ0S ,,,,. ! $ e6P  ,+,귪Ap@-`$0S 0$0P@WP   0s5p 0m5pO-`P 0Mb52 p3RL"H"  L"H"U =0@T 0S p@UT; 00  0>5 Q, w 0P"Q+> R  [i WQ PzC0 0  ; Y HW;p9@!Pa 0U 00  @@`Z,@P  6 0&42PK <0 ( 04  rCpw+Y  $Ѝ 0 I++*S+ 0D0 0-Y U  0DACV  0 4SpMp p@cêA̪AժAO-`pAM$ P@\)0h0i0j00$0Xp>0S .82<082$1<0S$10|$1b|}: R$ R l 7<K<@D0H@T0 @HP O P<< 04P@0T  BRT 50 H $@ H@L   P000 <8 /H$ | XY p X 0h0h R 2˟`A&f,P 0V`!0CFAT#60CS  00`00\@d`h0YpD 00|0|P0 D>PP0V200C?o20S6 Y 1S Z 0 * ) * VX P x(0,pw0 06?  0 1/Y Q0F\@0C0`00d0 pP0H0(00d`WMZ <0!P0rH@a <#PP |p P0 @0S k0Sl00l0 0SP0XHp0 <P P@q < d< .0`@\`0d`0_X0bcX0P0x0g(0S [00p0W0 `V 0S  <0 *P3P0Sc)V)o) 0#2<0K(l0[ 0ÃQ 0  i MP uY i7 0/ |O0 X<0Pe Gk0S* 0S'0P 8`t0H 0X<P6 02p00 80<p) P P680  B  X<P 020 Sl0 0Ãl00$PU XZ jB 0@ P 0<5/ PPf0P <;xV 0"Y20P@800 " 0 R002` 81/80S1O E q Gr  Y R; 6(0<0aP3*PZ2P0S(((0 $2l0Z0P 0   0 ,0R< 0 0(0k' ,0(  0 SZ <0vk0ASTt0CP0@`X Hp,`F( 2<`0 0 P ^ < 3!#L20L2 010 800 8  4  @ 04@1/PPN #UIX3 X0/ 0@t03#H20H2t0S0 1P000v l00l00S k0Sl00l0 P0X<Hp0 P `Pf <& 0n1x-0@ X<0P000#10yuP<jW``V@ |K40x PF4'4'4'40 0  V P@ 0DAP@ <t@4 0 0 0'4]'4'T4@sT  0'14' 1 R"P'?'' 0@0 0P0X<Hp0 uPp00 80<bp PZ8`t 0 00 o0u0XSj0De@c5eAAAEcA%A/A9AAC- @ pP)~l0 P RSPP P D1P  P 0@0S 5`P '&('JT03P5:P  ЍDAp@-@P`g  p@)QG-@ 0S`pPU@# * 0 @P U  ZX 0 DcX 0DcA-@p@`@P' ΄0 F@Dc@- .    Ѝ0.   Rp@-P@ 000>p@w00w@- 80000  0 ;  ;d0ЍDcpA3e 0 e3e 0 e3e 0 e3e / /A-D0Dp0Pc00S@]0000A@c@yc @-,0@ ,0,0t ,0 1,*,*l%& 00S:b%0@ 6, P0T|c|c@-\0C0h0H0ade1(@n+10 F@cpAEcvA0 0@c@-@0S#3003e@-@0S+kP  $+0  A$3NOI!( 8vo0W'A5eԫA6eA6e@?e7H7 A :eOA-, N0RǠȠ̌' @N@  0 `p0PP |i000xUOP(0 :00 0 P iЍ AHAG-p`0P00@ @@ A0 < T02XhG 0$pP 0 d #$P$lW Z$J`5eDc>3erAO-DM@p xT:DЍ!Z`VU3#:EB V@P`2/$꤈>@-. .   Ѝp@-N@N@`P@ | p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0$`0S 3+P (0  $0P 0S  $0`,Ѝ zI "@0 )j5eDc>zAO-N@N$M@0`%wPP$p`AfX0z000  B$0PV l(`0 P  rw$Ѝ H <"@0 z꤈>ADcp@-P`N40@N@ 0? p@MwDc>p@-8PPpx@x0P3#pDc@-@P  0, n  0R 1 0,A-p`V@0| 0SP%PU! 0B0 0S0S 0  B;  0ᣪ0S 0S0S"U `FPP0 ꌬAA-Pp`VX+ @$A0S0S"000v""`0 0@oX @*$Tp@-0PVp0 F"@|"0S H""S"Rp@-@P >U :Tp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXk@$0 SV 0 RP0`PX000 00Cd Sd05$0000 R0X00\0d080D0<0H0S  0` 68 4000 R 0F 0H0S LX.9Sl `0< IpPe 0@ P 0  Q 0S `0L$ Hs@lЍ000pD`0 HL P r #RM4 0/x [p 404 J,00,0f@0S `0LHE$0 S@ $ 0CA0S!000p!!@ 0S j`} `0R $@Hp0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #Ph2 d0/ vL(WX D0 @D0 0 &X `P 0DA8P LD 0 !D D$!D 00 0Y D 0  (!<Y 0 |D;PsD00^0 B H@1j 0 pP0 pp0p 0!pP 0D00 0    0K0@R000匨l0\0 LID%LP T - H'EcAA$=eAO-4M$0X0 P\!m@lX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X% T \n4Ѝ,X 2Y , !'!  !0 / @EcA/;@-$0 @@cA$=e@-`@ 0 ````!PP " 0@0 0% 00 0 0SG!ЍpC-`M 0 ````p @P 4 P!~"W' 0`0C0@ 0; 0! 0WD0 0ctW1 0S1  T 000EЍ 0; 0pE@cc 0S:0P//0 R:P3#//dp@- P@00]p@J _@=e0 @0 1p@- ` H0@SP`B   DD00 $p@h;p(0, 0 (0, $0Sp0Spp@/0G-8M,00@p00P  0P0(p$@ @ @`0,0T0P 0H00'>000(p$@ @Pp}8ЍD~1ADcO1G-M 0p` @`.2P0 P 00 0 0 `@G?o2P0S0S 00S00Ѝ R 0000 0YP DcP @-.^P010@=e0@- P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#0\0R 0B  UL b  003e 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B ,0Sp@A-Pp`^@P X10H10@0P 0A!&0D$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```=-0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`G0S #S PH0S Z}000@cp@-P@P 0S xp000p030/@c@-P  c-@ $M0 * , 000 00P Z$ЍAEc@=eA-P`pP @00 1000000 @ 0@AA-P`poP @i0010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO- ;@00CS@0Z p@cA-P@pUPP0` 000 PP00`V D#&R  p@0S 2 PU000~pЍ4 R @ R  00B W $6SV X130`PPV40S @0S00 80$0S0 0 0@00@0 P@0S P080 _pP 04 R@  B@  0VP`U40S @00CS@0  `3e@cO-P@4M0`<0UP!@0, T@1T@!Pp4Ѝ,` 0 Upt2300 000C0Uw0  pQ @ R p U 0 R H$Z 0  0 U01 C0[0 0C00[ C$ U1Y ( ,p  E0Qp   D @J0@@ 1/p @ `D $ 0P P  $R  0S0S 0S   _ 0 S K\P 0 0  BR @c@-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P0W30000pR3O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  P*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  P>Z   R 2/  U   U    B    AX D D H H 0  0 pG-|@ pP`$00LP0PP@ЍpDcO-M Q@ 0| ЍOQ 0QSp0ISP#X*WZ 0P UPQ %$Y PK3 00 0凭PP@040P04 wWp  +>0P`ph@00(0(0V,4s0s 000S` Y 01 0!W@T # 2RW 0P0S  =P:Ѝ pWg 0 0CRb00l"hD$000l $P" 0000H00SU4 C08 !N, JQ ,0P S""D00<00+!D%"D%!D$0 00 0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !0JP0P `@IPZ0sU P3hAADA@-@pP`MS  0p@ P Ѝ@0ЍG-0@P0`Sp0S 00S R 3/000q <@  < 0 000SX@`@@Щ$@ 0@00@(0 B0 2@@ R"`  0p0?U0 0S?#03@, 03030300ߍ3e[eC-MP@P`` p0  PGH1 R*Q,| V! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221cc3eEc0a/Q/0S //C-Mp0@`00 0` Pe0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 OP Y 0 03/:#:SSX  0 3 0D %6SP0S 0P 46Sa0 x00 0 Po 0 i꤈>@c3e@- J$JL^ >00>0^0 s *0#03<@ Q03 R0S O-,M Z%ZU@N@>0 0Y*1 000004$6 0 0U:@4,Ѝ 0FpC W|#$ MP9 @Tk0 @PP Z P R:Z 1 0 $`  PR0 HX ׷V ҷ0V00'0J R$0 0$000$0S Z@X 0! $0 (,0 D 0PJ0SV X $ DD,P Q @w@xꄪAO-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { OP 0 0(0S 00 0<00800400 0 @0 Ѝ0ǭA0@-Q0M0@00  00P Ѝ0` D"Q,`d\:0 P#3e@- 1 0@  _P Ѝ 0 hP 0AS1, 0` J/ @-10BS4 00,00C0C/00>00Fc|cC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00\$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 08$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 tP0 hUh*Pk$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20YY ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P  0D00 Pp@;p@-P@U 'p@4p@-P@P T@@pG-`@P $ճ T0G& 0pM YJPO-tM@$0$0圀@T` 嵳0 $$FJ0H0p T 000@  ,00 000 000,00 0 1/pP  $0tЍ P倳p,0Q P,Q,0,0@TÏ6 ÿQ Q00    0P000P0姳` K0S P   pέA}@-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6 Ѝ@-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6 ЍO-A11 0R tqs݋0\ ,R 0 (R 0!L P ` Ѝ P @`V2 QE A00S00S  R 0  m݋T PP\ /P101101@@@U4ec3e@c0cG-` PpBP |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T c4e 0p@- @P!  ` 0( 0SCH0;H0/{ P0RP  0.-  0+)  0< 0000pA 0p@- @P!  ` 0( 0SH0;H0/K X0RP 0.  0+ 00C0 0< 00 0pA7@-""&*C6@HPP 0 Ѝ0 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@P@⣊T@Ppcp@-@P@׊T@PpcO- s@0PSDM@0S^ D0S@Z b10  B0S#0 0 .`0@`F`0`0@0080S @0U0DЍO- ?@@D @00r@P 0 Q"0p`0[) 1 pW1 @  P T -DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@E   >43e4eEcT?e5e٭A@-T R*0B 00 (mGR0\ 3e AA-`Pp@P @P0SPD0S TJG P  1P4eCAA-$aP0AS A0!>00000000 81Pn 6810`U 0CS*G뤀p0W%W000N@N@W\0ЍP< 0 JJEcT?e3enA@?eA>ĮAO-B2 ApP LD PU@@RpFR`@YP$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0\POP`E>@0   S0P    @P 0>0000000x (0D0 , %``F S뛦*@c@cA3e4eB}EcT?eEc/p@-`P@,0`P @ pT?e0@4ep@-PU@MFp@x0@QX00 1Ġ  S0 Rp@.F@cRA3eA [ @-_ 0pt0S[es@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6 U`" 0p P(,`0p S 0: ` S 0; 02`P &ADA@-@`P0p܇0:0$0 pT Ѝ0 /@-@0:00M0 Ѝ/"&*C6k0S/^ 0S/b 00CS0/@-@w3e@-@c P@T @-0@S0003e0S/@-@K P@@ 0⃇Pp@-0@0P*|p@yw@-0@ R0 @談00娇@ A-@ P ""&*C60S7 0V P , 0; 00  00:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(0" 0 00 0S0SPU 0P `V' 0S 0x0U 0  :0V281` 0 >>⣂R P A 0S 0 `(0`0p 0s1Qӆ9 0 6 &! R  010@ 0"61@ 0"601008 000003e@cc4e3e0cO-M 0DP @@pH뤲2 a  00"603S P0 PYYHP T=DY  E PY ,"($($ W     " "| 0X0W @(0 0p,0<  0+ 剆$ X  Zr0L PY 0 P0 PE ЍP  0,P0SX  R * |R + 0`>  P  2 @c3euA ccADAA-Pp`VUAA0Ds 0 0 0P 0PL 0  0 0b`0 00ÅI4ep@-0@ RP0 @00 R TpP0000߅TUpp@@-@@p@-@P0p@@-  @-  @ @- 0S Q cmP0Sp@- 0P p @nP T  0Rp@ppA000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/C=B=A=@=@-@QPЍ@Ѝ /A- @@Q pPW`/ Q 000  0 +P(P0@/@! R!/! !AT xP 00S 3/V"@cp@- 00S@ SP` Q @p @@-|@|p0 S 0R``&0000P0`Q &0( Ѝp?e3eDc0@-@t0tM@@@0 @"LP @P @4P00S 3/@TЍ0EcDcp?ecAO-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z 0S 0 0 0J0 6$0$pU0$,Ѝ d0X 00L ^0 PEz@c4e3eDp?ecAA@-PfMz0@^0 06S ̓0 0Ѝ@pip 0 VP広 0S  p0 P >Ѝ褈>p?e3ecO-P0M  R0 Q @K `pᄪ0Z00 0Z$[ T{ ǪЍU Z `@ p ( , "&Jp@ `p@` T@ 0S0`J 0200 0S QU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 U  00 04d T 0 P0  (,,Ơ P U ,U R{`3e4e@-0 ) Ѝ䤈>G-`@M@fo p P娂EVW0 0  *V0 ɂY*@ЍpC-@PpȐ嵂`Vx6Q8s6P@`pV 0 tX@jh0@PK`X啂E-@΂9PTPE_o@RPTEcc?eA3eTdp@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0p3eQJdVUUU?e7@-@L0S @PL0#L0Rp00Sd>`0@AX X 00 0,0 004 Ѝ0@4eïAc@c3eAEc?e5e3e@-X0 < PD@@0R@0P_P%P3ec5e3eP/@-aXTH0, P<@(-,@ R 0 03ec3e5e?eA- 0@S0p# PU# _P` ȁ 0S `U 0S 0  ; 0 B 0SP0S`PV Щp@- 0@  P P 0 0p p(0, #6 P O-EM o7 5@5 `=n`P ?h5hEp#`5 DL ,X 0S 0SC0S@50%0 ˿000 00 0RV `\000@0 0 0S#1.2h !0S000C0< 0S0 00 00000/4e0c@-@P R00 O-TMPx0 @S@S#2[@T U0!:3A00C 000|00  U00 Z0Sl , '(0, 0P.0SZ H0L00H#6$000c,0x00c(0{0J600P @0$#6CP0#v0P,0  $0$ 0S[@jTЍ6$0Pv0#fVnWj* @)P@!@1 V`!x0@D @#60c@(00S00PIW@1@!@D @P`1,@x0S (00C $ 00C 0@0D 4 B Q 4 R00C@<08 8<0 F A0|00Z ~Pl 0 kPR 08 0H0S0H0L0Hm0 pS00R0S<D ,0P`s 60C00 0@G @D@ @T@1T@1x0S (00T@1d0VSP1x0S (0px0pUP! E R %p# 6`F :  T* 804  80 $4  Q* `F$ R 0U:Z @PZ@HP z$ p 0 p R0L0 0P@8 0|000|0 R0L0 08 0 |bH @ 00#"(0, 0P@0#0P00S 0S @%T 0S^  P2[+X'*PPUP1[`! `1EpV.PppW PFE0 S0 0Z" l@XP1P!pP`1gEp 0  |Z PP @|uA J@h3e?eAA y?e04 S/P @- 70cA/0@/c/0 \/у0P1cA-@p`H1ƒ RL R^!^D*   R `V`F`P?7 E@V P^@o#PA A B R`V`F` V P L@cӰAp@-P@y2 Q*    0R p`VH6`F`V @ LPpcӰAO-10S6쀟`Pp U@40 @44W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ K3eAcAUAA0@-@X0S0/"R\:@\*QL0@0C?0c@- pP 02 0  Ѝcp <0 P 0 D R 2 P///c4e@-P@-@@-P 0c@-P 0c@-P 0c@-P 0c02P 00 /c02/c02 /c@-@P02 cO-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000xpc3e@-@PL0"D0S 03>4000,02Ѝ0004eA?ecA@-0XP`B 0\`R 00P@0 0 0S Ѝpcs@-P0@D0S00Sx Th5P: T5`A P8}50`P@Ѝp4eA3eAA AJAc0O-M`  0p0P0pw300ЍZ4? 0$$Q0D0BS0S Z5*a=5P .0%P Z`V)50`F`@V @ DpD @R` 00C 0R P 06# 00 P 00C 0jA4ecmAӰAc3eO-,MPP@P U.` 0pvP 0㤠N@T P,Ѝh ``F&&$ $    01/ 00`@0/@- P00 QPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P`ᅝ0vw6 00DѝЍp0 P/0S  4\Q 8< Q < < 8H  BH /80Ce3e P00S/P 0 (Q, Q/8Ce0P  /xEcp@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P0S  00Ce3eP0P/@- T000 T0 @SCeG-@0Q00P00CP0$v'P'P""R,40`q0S)46L140P !:*$uL00CL0$ T00CT04;P r3 `u000P00P0u`0``FV`D`xu, (4B0"@,@`$ P  u%3e@cCe@De,AxEcp@-0@P quukuT00T0uP00p 0  ECe0@-P$0M 0 0 vЍ032@-(0 0600vЍ3200@-  M0 0000 0$PP0 S 0  kP!6phP oP0S $&<$0P00(&00CSz00hs`P0S %h @$0T T0,0h0X 00"\,`Vh 3P@p/0SP0&P85 $5 v`J@ q-P`  g`qV 7P%0@+? `0q04p00S 00 P <~qP q@oq%P %q$ 0$ 50P0 / !|340X !%`PY& Ybp2`0P 30X !%1q#jq@ q%Pb!h%`P0 0 080S0<2?d4;&fj0S0F0Yjh 00021@0X!10 0 4C#"#04>0CYC 0[{1 ,1 I ",뀱Dt!(0<Pdg0S !0S   0 0(!)@P  a.(0,`(0p00000L L P P p`Qp PdpP0Hp PP3e(CeAxEc8cWe@De(A1AA@cOAXAԚeiAAACe AA2A1 0S/G-H0Sp+,IQpPU ,pG哗@T P 0  4  A` \/pV  T+#R<00# H00CH08@xEc3e%A(Ce@cCecA9AG-0H0SG0P SQ@ 00ppW R00S0 00@T p 0$  0 0S0}p` #R<00# 0800X<0@800 00 0T0 0T0 p(08@ p3e@cCe@-T@L0S@ DodX40 0P@T@@o3e@cxEcp@-@4Po=@e$0 0$0p@o@c3ep/p@-`LPo(@( 0F2 0 0C 0T00CT0p@o@c3e000#1 ~7@-@HPt@ ,0 6n@P- Ѝ03e3e@-@aM }0PNo@  N@@ ,0D $\030#R0#02S vo `Ѝ. & R ho`*t 0 D`P Wo 0 D"60 B+ 0 B"6C00S("06BS-XN, !004 0 #6:S"& :///R/>0 0 #@-@nH0 05@oꨋcn&O-$MPH0TQ@`LpP0#0@ 00S 0S圕0S R0 0`P60 0 H00\XTPLp$ЍO&O-Mp8000 0 0RЍl ` 0 ,` BPT ^2(]2Z2P Q /ICCFcO-|MP`x D:h@ pT PF 000000 0 000000 00($00(0 000040 080(2<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 /F0PT00PE 000 @᱑P @@ 婑P0@00|Ѝ`Ps@-@P`AP Ѝp@rЍp@- L@NP 0S 1(S2S P脶AO-0|M3S `PP1S S2S @$$@P $H|Ѝ22 0 00 00 0$pP $/@E  000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J SJ@D@0> $@"R)0&0CS$@ d 0000 0$>@P $0SW00CP $@"R"T@10 @ " 0TL000@ @,@2S0$0S(0 40s0N@N@4@800XSB 0tp<1W00 z@P tp0t00S3 @  C0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!@P00( 0;0@P40〰 0D0@PDP5S7S 2$0 $00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$j ! 0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $1 00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@ 0(@1!00L0 0H0T ,0 S0002 02000x0h@|0l0$03/@P! 0@H0 0@0@Z2G2A-PpU@` U RP  Q 0P : R@T P 艶A0O-Mx02 CR@#2` 0|00 00 0$V@P m p2 S OoeBA `Ѝ0S%P U"0P0 0$1P PEPPE0PPEw@ U @-P@`pP  0 00PX0@0X0 ЍG-X0 `Ѝ0@S P `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ Pp  bZ`    W`{p 000X $p0 $0X 0  0<`P0 ;` cX0V X  RS !fCX0`P 0X0 0\0kR 00dX0""Up^W L4 !G$ hpP a괶AP P P?_?// 00. 0.0 A0 (03100 >0#60ЍЀ@cA-P@U 00 ` 00000p U`  `hFcA- $0p0 $0 0@R`P:    U@` P 00 00$00hFcx @0D0@0D0S/p@-@P`0S000p P PhFcA-@T1  0`/ @+ P!p@P0|\ 000 x0 q 0  0 0@P 003/Ѝ@@-$Ma01@00 0000 PP0p  垯W 0 00 .  00P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 8PЍ0@Ѝ0 -,M $001040 00000~P$P,ЍA-X0 00$@0#,C04@ R1D@(2Dp<`C0PB` R 0 00000H0Es 0 0000 000H0P 000 0 PPЍhFcZ2$0 0!0 00 /@cddd@-0`iM0 0 EP 0 iߍ0@P p 0 tpGPdJ  ]:U00> !0WeWeWeWeedA@-<0DT 0 !0  !@cO-Qz ,M⟹ a0S a3D P䢟D202 000*0D@P R9Q0  b,_00 p 0Q  \PSPU DM@KDׂP`$DPf|PXDP D0/SY0`0DP0F-0p 0pa s0!00 "0jPSq`0 U  h  00`QP:0 0C4/,`000! P0@`@ 8 c:P#$ ,*B00   P0U0P0S@ PP@U00@p\ЍAc0DeHBA HAdַAoAAAAAAAAAA0@- ! 0 !@- @0S 0@ WeWep@-T0PO`d !0UF Ϡd 0!T@!pl?e@-0`M0@ 0 Q00 00 T @`T#ʴL@Q   4/0 0 &#: 4/,?&6 :  X 4/`ЍH@@D0De6KB|ABBAFcA6B΢BAl?eAAA 0O-p`'DM@O! 0 0 0 00`(p$ 0,0> 00!0 0 00`(p$ '0 !0 ,0  00`(p$  Ϫ 0 ,00!= 0"00= 0 00`(p$ 幪 0 ,00!= 0)0 0 00`(p$ 壪 0,X !/0 0 00`(p$ p厪0H ,090 0 00`(p$  z0,0G0 0 00`(p$  f0,0O0 0 00`(p$  R0 ,00![0 0 00`(p$  >; 00!e00<$ ,0  00`(p 'S0,0 0$!`;0o0 0 00`(p 0 ,00!x0 0 00`(p$  0 ,00!:00 0 00`(p$ 0,0: 00!p: 000'> 0 00`(p$ ѩ0 ,00!:D00 0 00`(p$ 弩 0,00 0 00`(p$  娩 0R!0 ,0  00`(p$  p唩9 00R!0 ,$ 0 04`0(p }0ɟ 0 00R!0$ ,0  04`(p d0ȟ00$00 0 0R!0 ,0  04`(p L%0,00 0 00`(p$  8&0+,00!0 0 00`(p$  $(0,00 0 00`(p$  )0,00 0 00`(p$  *0,00 0 00`(p$  +0,0< 0 00`(p$  Ԩ,0 ,00!>0 0 00`(p$  忨-0,0;$05 00!50>00'> 0 00`(p 奨.0,05 00!K?00'> 0 00`(p$ 厨10+,00!N? 0 00`(p$  z20,04 00!O?0 0 00`(p$ d30 ,00!|4 0Q? 0 00`(p$ O60 ,00!(40S? $0  00`(p 970 ,00!3 0U? 0 00`(p$ $90(,00!W? 0 00`(p$  <0P,0Y? 0 00`(p$  >0,0]? 0 00`(p$  ?0 ,00!= 0 00`(p$  ԧ,c? 0 00`(p$  @0 ,00!1 0f?0 0 00`(p$ p媧A0 ,00!1 0g?00'> 0 00`(p$ 哧B0\,0j? 0 00`(p$  C0 ,0m?0 0 00`(p$  jD0,0q?0 0 00`(p$  UE0d,0u?0!A22Ec\2pl9!54De2EcD22}cH2P}cAX22222 c̀2202DDeGc82h2KBSB2 0 00`(p$  F0|,0>0 0 00`(p$  G0,0}? 0 00`(p$  H0,01 00'!?0 0 00`(p$ ݦJ0 ,00!1 0? 0 00`(p$ ȦK0 ,00!1 0?0 0 00`(p$ 岦O0 ,00!(20#>0 0 00`(p$ 圦 0!?0 ,0 <00`(p$  p処 0! =00<0 ( ,`$  ps0$03 00!3< 0?(0  0,` \;d$0 0 00!|30?00'>< (0  0,` A; 0 0 0!%>00'>(0  0< ,`$ ) 0!?0'>@A( 0< 0,`$  0 '!?0< (0  0,`$ &>0,0> 0 00`(p$  05 00! 00 D,0  00`(p$ ϥ5 00!? D,0  00`(p$ 庥 0!5O@,0 0 0`(p$ @夥DЍO-ADMP/ `p  0  0p,`(`$P P P<入 , $ 0 /      <0p(` P Pn ,  O@ 0 <0p(`$P P P@ZDЍA22pC-QM`p \@ ,\ \ 0` 0 P 00 000 0@?o2P0S R0T8R \70Ѝ8874DeA@-p|0M@P? 0`` 0 P 00 000000ՠЍHcC-p0MP0 0`` @0 P 00 000 0@崠?o2P0S  ЍWeC-p0MP0 0`` @p0 P 00 000 0@勠?o2P0S R ЍEc/uA-MⰀp(0@P`` E 0R R#  L,* Ơ$ d `  L\# Ơ1 00X  00 000000DЍl?e3eC-@0M(0`SP0 P$0p ` $0 P0S S P h00X  00 000000ЍXmdG-MP 0`` @p 0P 0  00 0 0 p@?o2P0S  0000 0 P00  ЍO-P|M p嬀`@` +0H`000 00 0@ 0 帟0P?o2P0S 0000 0 PPP0SP +H0sq|ЍO-P|M @pa``  \+0H`W0 00@ 000 0t?o2P@@TP0SP +H0:P7|ЍC-|Mp@P` `(0X X@0 XϜ-@XX H0XS  00000 00 00p0000X@H|Ѝ@Jd@cC-@|MpP`` $1T0 T@@Y00?(P @6 (V(RXX @Hq YR00 D @0  00 Q 0 00 0000p00ĞX@H|ЍJd@ccG-pP`0M 0` @|0 P 00 000 0@嗞?o2P0SD0Q 04QS03"# %05ЍucEc NMb@-1P3@k `q0VM P0 ! 0l:01 00$00墥$00$0P@圥$00$0T0(00,0 0S00@000^H8p0900S  @c0VH00L0H0 H⊥0 0P00T0<00 %0`00d0`0h0$Ql Ѝ0 `n 0 H0g l Ѝ@y@cAA@BA-`MPp@7t 0` 0 P 00 0000@?o2P0St0PЍG-@Q0Mp000` @`0 ` 00 0 0 `@庝?o2P0S, 000 0000 P 0R W<0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 ЍEcɚ;6eA-M@P`pc(0` J0 000000X00eЍC-`0M@0 0p` P*0 P 00 000 0PE?o2P0S@0S@T0$K 0%PS0 0@PPЍEcDcG-`RMAxp P` ($1 0 1 010P 0@Hp?o2P0SMЍC-鄐|M@P`` pH0X 00 000000ל|Ѝt]es@-P`.00@0S 0 SЍpWeO-PM@`Ȱ0U0s 0ȰĠp@ЍO5X 0UT@@ p幞wXU2U`010# 0ZC L R?0O}P XUU|pWU4U}Y[$FFU  P  | &U| RU|# W!`IKq@pUXQ 0`FV`G: |U apP0U  J ;?0|`UV eUU010#`| 0ZU|Y[ E EU 3 PDU|0S Z1`IK@ Ѝ0 M@XH ccO-PR`@$MB @pU0 RQU@D @$Ѝ Z X  H     &D4U  (TZ0 H @p ꔏcx]ecO-|" 00,p$@ @@ @` 0(00 00,p$@ @@ @` 0P(0 0,p$@ @@ @P`0Ѝ褻AP ƒ #60 P *R  P 0 / 0CA-0@ `P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0qL0 0!d 0 P:00 HDescȼAܼA@-L@P 0S  00P 0000HDep@-=x@`PUpPx>00ST)4x<0 80:sxATDeHDescAEcA0000 `xHDe0@-M 0000P 0`@PP8 @P 0 @@0@ 0 y@P Ѝ0S R @!+!@P E@0Dp?  @Sp!@@Dp@P2p x`0S@|dx0000 l@P L0S00p 00=@P HDeTDe$A2O-RM0SP@ AX1 w0SPs,0 Ёa,0zXⶨP08 0(IrQ0(@8(0H> C'(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$02$0 ( $0,0)!@0<]|x|vP[0) 100S$ ,(P?0 00000000 00 @0X bPP  @ ,0a0wЍ 0HDe@BEcEcc.ATDeO-MQ@L @pP `VTP@%ЍH0 0D00@00 01/PP P@ `p@-P,0@TpeP @(sc@-@}@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  o` ЍX/\/RA-PR`@P\p 0!S HP d!X@xPP@@-X^ :S!\@ y +s@-D0`P @P`00Ѝp\De@-@0 \De 0  \De0 !\De@0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/@cA-pP `{V@P tPuP "viV d@000V 0 `@ 0S 0 00 P000 @  u`De(scp@-@PM`u@@ @@@`0     7 O h    $(Ѝp\DeKAEcP/H0 R R 0 R R (scp@-@`Pl?u2@PTup0`0 00$P 00000@}u@`De@-@Pu 0S 0 0S0   L00C0du@ 0S 0S 00  `De@-$ P P PЍ@-  Ѝ\De0@- 0 Ѝs@-@PM`P`N0 0Ѝp7@-@}KPPxPP8P 06  Ѝ0@ Ѝ0\Des@-h` wP0@0@PDPHPLPPPTPXP 0PPЍp\De7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ\DeB\De=\De@-p@`MZ1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  ZЍ \De \De$\De@- $Ѝ\De@-0 0 0$Ѝ\De@-0 00 0 0$0Ѝ\De8 0(  R@0/HP 4/@-  @((vP @ tP@Ѝ\De @-L0 00Dep@-000@S0S00 L0P0p@cDe00CS0/0LDe@- LPDe/@-p0M`0@ 00P0$00|0 0, S00` (0 ` 00 000000ЍEcEcEcDe@-000S ,0 R@)Ѝ@Ѝ@c0M00Ѝ/De0O-aA CJ "A0?P.001P aPP0SPPSUᕼ`P P 0 0=0d1  @PP pn0S @ TPP 0P80S101?1?11` P@V@@pp@-@HPE@080C@00S  0 Ep@Ec@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PE¼wE @0 PUEt#(p0@00XPS 0  P@TE003SEEpJdcEctA@c@c@-@@Tp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0 Q2-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|WЍO QQ(0pS<0(00 0 00?o 2?B0HS?0 $00H?oR20S50H?or20S.XD`xW01x0#L0D4`P(000U L0S:Z0S7 $0S`0$ S0D0@0 P 05@DT`?D0k`P D `=,0jD1@4008040 0S`,D[DDkP80Z80 0T0T@T XH3$ 0R 0 S030#R0S 0H09D`0H023WX`x `wV`@d0X `X@\`: 0lVh0(0p000t040x00儐0X00X \`% 0V㔐0X00X \` )0V㤐0X00X \`(0S V0000X00X \`"+0V0000000X00X \`H0000 0000|0C,CL00 `@9`,CVR00000 00C 0X0 0$000000Cs  0005X @00S0000PCX<C_(0S 0 '" <0 Ѝ`Wecc\sc@cO-p3|M3WW3@03?0 |ЍZ0@<Th3 0,,00,@ԆP &8LC4JC030JP`U L0SVZ0SS ;C0 0000P 0@lCTA? 0jP: aC =$0C1@0000 0S  0S  0000@T  C00S $ 0R ;C000?Z0F 01C $.CB 8jYWP13W@ 8' #0S/ 0@0 0D00H00L00P0 0X0$0\0(0`0,0d000h040l080p00S<0t00< tΐ B@0 82P0@J@`$00 @⻐0 4ⶐ40 HD00ᯐ0 L⪐P@00S0y000 B`FB`/@ccWecc\scO-@!  00 C0 BWڜ!0R0[ 0 !j k0  !j aX 0A1`Ĭ0 1$ЍOG@$Ѝ@-@`Pp?000009@ 0P100Q穬@ Ѝ@- `P1 @00}1 ?@T 0 Ѝ@ ЍDcG-p`ܐ3 PP 0 @P  PU03aP  0 `? ㉬?0 ,00 @P@cDc@-@%@ ?@-@?@@@-@P 40 F@01 Dc031 0g@cgO-l2M 31 T2&0@1=0Q?q1WPPӄaՇ0cU.  `P n  J ~PR0?Sòʂ?1?1P1`11Q1儡UZ?ЍSP  R NX  Y P(P1SQP`>00'?Uw00002q EŠ0 3 1@cDcO-13A1Lprg@PP\m넁`pU0^U ]8 Q020?SP !011QPk?QQ? ҵ ?10 ЍO|[ 00P 0SW ( R 尐uU  P00 Ѝ@cDcs@-0Sa @1S@ @A1S1S Pk?P10``1SЍp0S  R R    gPQ @cp@-@T 0`QT@dPT\>IPHPPJ>UP@pT 0d3IPvtc@c1MR  !Ѝ/1MR  !Ѝ/G-pPt3a @P    T<@@c@-M@`Pp0P @# W#!!  0@@ @ 0  @C  0  @P@Ѝ@cO-%upWpMH@Pl3졓1 0 00S?` n= 210030 10 .11 R`` =%+ W- T^X 0\P0 03 9V Ѝ3 o=0P g (= {@cA0Q`/wt@A-@PxM␀ Pp`x Vdp` P=T HP  }m,<=xЍdHP 0 mcA-P`h0hp@0 0"+ - 0(00  03 b3@cQ-//-//-/-/-/-/-/$0 0!0 00 /@cddd0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Q7@-P@ ht<`0 R 0SP D00000S! 0"PT < Ѝ0c`scp@-XP`@ PD03 1pV T( P p#pc@cc0 100S/Icc@-@-<0k9@e<c@-000S ˌ 0#  Ѝc@-@0S0 R000000S 0s0000S0St00ddVPX00SLi$A@%90 0 0 Ѝ`sccAAAhFecpcxc7@-@P  h04t 000l00p0000 Ѝ0D2p@-@P, 00 00 0X0$00(0tp@t2@-@ 坨@ "`@s@-@`P0 0 00h1d`S\PZ_`0 00 0 !`0`@Ѝp-A(Ap@-QAM0 0$0 0S$0 S*F;01S< `10X00a01v;V  z0 ^  );!(0,0(0,妋  5  0R1!0CSQ B0 00 UP t.S1! B0C 01;0  4ycc2Ecpc3`scc4De`AxFepAAA-P`P p吀H0L,A0 U P#H0LTp0    0S:|03/0S:@`sccc@-<0DT 0 !0  !@cp@-00P}@00/pc0@- ! 0 !A-p@d` P␌0S C C0CS0#T R$ h0l0h0lAc`sc@-00@0Lc@-*0 @0 0bЍp@-PHM` P@ (埌P P`%:( < (" $ 2  N:HЍpc0@-A4MP000S :b0S)  BR/* c t 00 000X!h0l0h0l810000S_0P=P4Ѝ0 Ro4Ѝ0@: ,aR !0521S@0 T @#AT@!021o50  TЍ@pn@Tt3V8 1C7CVM "7C0CVhC500 0` 0@,P(p$ t~ 0!(#w?P  0 0,P(p$ c~ 0`!2" 0y?0P0 0,P(p$ O~ 0!2"P0B>0 0 0,P(p$ ;~0 00!8"~?0 0 0,P(p$ `&~0 00!!< 0 0,P(p$ `~0 00!!? 0 0,P(p$ `~0 00!P!?0 0 0,P(p$ `}0 00!?00< 0 0,P($ `} 21I21 S,AT0t tHl00 <8O 8DЍ8t@KAAFe`sc 3 3c422c@- ddhj`0PTzP@0   040 P kЍ@L3cAA@2/d 0 0// 0"/// Bp@- ` pP@TMpA-P@0`Q ԼP@ptcA-`PD0@XppQ ỼP P@FeRp@-P@ R" 0t  0!R4 0 R R 0`00  0t0$0p\ 0\0\ 0\0 0`0000 0Ap@-P@@2tPQ2pp@-@`PP 2'00p`t0B2pp@-@PP1(0, 0@@32pp@-P@@1$P(2Upp@-d0Q@P` 1 @0, 1(0@S@U 2pC- M` Ѝ0 SpA" S) S /0ͨP@H10@ 0`01 " 0!0 UTQ30 宨?P@0 ᥨP@`S@T0P@`FV`@Tt0P@00 kP0 0 000 0!ʚ;@Bʚ;R7@-@P R: 0- psX0 0X0 0Q 00 0@00C@0X0 0X00"eP 0p`00q 0 0\0 0" Ѝ004 A&3p@-@P 1@081@0p@D1X0@/p@-P 0X0p@0PX00 0@008@0r$p@-.p@-@PP0(0, 0 (0, `q pp@1p@-P@@0p@1p@-P@P00`00p@ݒᲒ(Lp@僝Luc@-P0Q<@P0`Ѝp0x0t0 0@ 0000K`P 0 ` 0d@ 0 0\00\010Q0c@c@-`@ |n0@-@|l0@O-X`M@``x0p0x00P000 00@PT``p dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 00Ż0X005 \`$0`0/(00,  0@0#?0 Y0>00 0 000p 0`P D0 B0 `10;0 0!#4#0 !Al (0//x00CSx08bЍT `[ _@cC-pP `P' 0堐   ( HS@ /@8V-`0@@<%+3 1 03 ЍA@cA-PU@d0p00`h0/,/4Ap@-@d0`P~/,p@/p@-@Px0Sp8UpA-@P pPd/X0 @ 0P  /x0S/Sp@0x`X03V00  ///@cA-R@P` |p4/h003/m/h 0 * !01 0 R) p /X0$ @00C@0 R 00 X00X0K/ I/h00 lқA!#4#0!10  0/p@-@`P 1@0 1p0@00F=00`'t` pA-A@ `p.@0Q0@+/@c #W #X P 402 /,0P/0 0R03 0@2#/ptcFep@- @`.0PT 0T@)0,\@P"}UPP@ 00tUdlUP ,ᝇ<U0\@p U@k FeA-P` p@0U @TP H. A-P0@(PP3pa6.4.@01@0n.1S1S f.!.8?,H1 Q  PP10SP@ch0 0///C-@LM@ B\0 0`0 0PPPX P:嶚 PLЍ(s`P pp-` qp` 0" .0 ÏLuc&3@-T@ gFeL3HAO-P 0pQS lQ`T%P40P <T r @ TP$ @0R @R0@ @ D Ǥ[    @@000㓔$ 10T 0DC1 00  V00TFeFep@-@P 0S =TP |Tp@P\TpPU @Tp PP  PqTpFeA-P-hAT h0pS ``-\0$ 20S$0 E-@A@-,AA-Ppᘀ,ATA3-h0S ``,\ $00$0  uP$00$0$0S -@,AG-p㔀oATPP,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101,0S 0h0/dAO-M( 0$0 d0P 0 (0S $6 Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` @SP 0S< SP3S 90?00P03 @#04/PP30C3000 Z hS P P  ,1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>u0!#4# 11 | p+h003/PPp@8pP |+0 0P+X00X0+0 P+X0@0 X0Ry0X008 0@@0@@0@0 $(f0 R 0R @T @k q+Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|+0@H+X0@0X0H7300+ pRW Y U0@,0@`S 0 0C 0000P+X0@ W+P@0X06300x0S  J+E+ + P;+ 0\00`0; P~P|3Sp< 5310 0P3S7 H@X]p0s0( PӀ h0`0xP*00@017[@+s@ 0S 03# @04/3pC(0PpA 8@P @0!S3S XH"Pt@ #T@0p00h t0 p00*s耍0 *}* @hTX0x# @00 00S R 8 *0SZ 8**Zk 0Q 00 0h0T83S *{X0 X "0X0@00C@0 t*|001* (0i*(*X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@04*  )) 0S@ 8j#* !* 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 8@) ) 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| )000h0 0S 0040)h P 5/P40)U ) )6FexA@c@-,0 00000 00ЍAp@-P@Tp`QP @G-`p3aMI)1 PUG)P 7)@cp@-P@``.) 0@I @p@f)p@-@PP!) 09 0p@Z)00/A-@P@pET|`)h0000h0F)@A00/0S00  0S00o/p@-@PP(X0d`n)P )iX00X0F)p@)0 Q@-@L倝'PP@Y@-@}X0 0dX0h$`03$!$H@ =pP tP @@cFe 0' }Fe 0}FeO-p`@嘰  HQ:/PDPWe \   0VP ?P Ѝ0S 40A3/0`@00@`WeO-dMZ@$ ` +0T L0P $0(`RT P`P8p$p* dЍ P,`P$0p$p 1 00ޕ`V /P n0Sy@!PPt!(PPn00i( 0;0!XPP_P1 00 0000 0 PPN0$ 0C0:P0 1 T01 R )!< ` !l  2/`PH0T S *P S:00S18 ,0 0Rn pP ptP tX0Z `x\P P`RPucFeG-M@` 8pYP+0VP@@0/S WڛЍU0 0 S?@# ,* bñ0 C /  C1$@ KN00<`00 o` NV@ k`F ᢱ0W@C0`F`O-`4Md@q̔ 0L0 ?0NX) 厯낛徛4LP0 0/0 0,0p p00 000P ׍,0/pt0Q0*#P,00 0`PP呛,0L y0P0rP000 PhP|P00(0L0 C5<0X0pPtPlPxP $M >^PP X0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S p20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRm:D04Ѝ(PH! E'b$ $ R!0 R $0_$0P(P`10`1Q\`X00X0 P\`X00X0X0 0dX0e$!$$o H P pP ytP ud[M<WM`0 0R0U0S \{ FeAAc44Wexc00S/ P 3/DcA-P0 `p00l 0 0010 (@0OP Ѝ OP'0TP 0@00 0 0CS 0OP`V pZOPp OP'0SP 00@0G-PM" @@}L a0 @@9 CyQ1q0; 0 @0p0 PpH(@T `X-W0AU2@P 000` S'Ѝ 00S S S  00@0P0p 01@ 01p@ 00P!0 R cEcDcFeTucAPucAC-@PM> (0S; $ X7 `V6 h0Ԑp03/ @0^P00^P 00` 0 ᒉ`P 003/Ѝ p Dq0 (0p`003/DcA@ycP/(0S/P/ R  00/G-Q @DK08( Q!P( U Kp PU PU ^Kp R(0  @` jpP PU *\K(0P(@S0`(`(@0S   0 cPucxucG-PQ pIK@(`T `(䀟VKB$t! 0Sz$@0S LPPtm$dyKv"(@T 0Q S   0 U`@cPuccAA-@`PpU 0S A  0S SP@-@ᤐbrP]_#hP lP 0r@nA-@`>00Sʬ嚐#Ѝ0 0 0uPPᑊ0 0,0pp00 00 0cP ,0/pt0Q0!*wcEcO- `0  0屚 RR  ʅ00 q$1|pqL0 48<0L0 1 111D#  @#8Jp h#\p <0<0$,0S)F,p,[ppPpulP`0<1xp8p[N4#P P0$(, 0P06M#T0T0(G(ax`0pQ h1d0l1=0c?0h0040083pp0 `0%40q40pW 4pw40q40q40!0R "40p#0, h001"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@qe 1\D03/"(Js40004Z0c"@"1S' A"{II(0 T 5@ _"5`0`S "<ЍE'40Y40pWWev $D"  S @yITI u"BY 9t#@@AAAhn3ccc0O-,MpQ #0A`P#@t@T ,0〠X2 P K@PP T P` X !P P`@#0SK帎V 0yU> :$@j$ J@PB ``0V):Z `V 0R0 ` J@P0 00# $ 00`00 @PQ  $K@0@,Ѝ 0S S+$0O@P X x$$ `PEccTF3|0S/@-@h3/0|0h0O-a0#6040080>0#60D0>0#6000<00@00Bt80S  N !0/1000L09L0T!5@ 0 0  0PpW(pWL0<L00P v. .`1Sp fpPw0  0  pW bpq!0R  p :T0    [0 h 000[  [ 0D6p30pGor  $GqP $$0 1 p0Y0#03W0S6$!$$WpWpA /]yz yDJ !DD0ĐN  I嘗`1H!<1d1D1l0 $p $07/pP[T!@X0A  81((0<1,0@100D140 KJpPGh l0 0,03/l00S 3/l0 0$J(0Sm Zk Yh 00Lp @07/(0 03/3 0000 ( 0 0哄pP(01G 0 03/.G0S`)G X D#\H4D cpP -tP )0S pW  00 0003/p0Hh1S u +l0q 00S p0Sz$@zF$0p  $@F0tp0P  1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/@10S XF0S0FNX 0"#  "pE P?P0. pl 000p4(p(p ,pL0 0Z000C0`X^q0 ^(0S rKAp<ЍJWec@cAcFec0@-_MP P@P0 _ߍ0@-(000000 0ЍTF3@- $0000000ЍTF3O-dlQX (XŨ0Ph >f10S `10$0P Q`Ap@-Pa|@T 0Sp 0rP T I P06P0 0S P0 P08P0]A0C0 G l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/8DeH-wA0`SM `P0P:P00Sړ00P0*  mIP|0l 0\000Z 00C0  0 p[l0 1111=I0Z00S H81S 뒏HC^yp6$>0$04GM僟` 180S 3/j>JnT0  o0k*[0 00[ 0 [ 010S2 [ ` 0`Z0|`` 0F 0S  LH= ,8 `0 000 0 V &[ L (f-o*5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x l%0@ ( H R( S0,02 P   , @0`080(0< 0 D0(00H0K0(0 <j}l1S o'  01501 0Z0C000000Bl lV p 0 :Z4$s9pF1 P 0PL 0S 0S5p@ 5 =5Ol0Q Q*00p8N `* x0S u`J8DeAcce@c2AcAp@-a@PP0  _ !O-M00S`؀  X  80S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y &P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0 RP  !P  00C0X 0000PB ,0Z R R%@   B X /  5@00PPUPP0,0 ,0p0bZ0S000lP030dP030 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< 5 =5`V2`H0S& x 0%0@ @ H R@ S0D02 P   D X0`0P0T(0 0\0(000`0J {᱂|p(;(X;((X;0S X (X (00020Z00S   00C0p0St t ' ``%D$s% a PI,C<(E>vtP D& 3/ "@G%; B/o"S R0 400P%`0 _0Z 0RP B+ 40 0? Gc@cc@c8Dec0@-q@M QaT0P0` ,0 TP X xЍ00@-P0dM 0 0@S0 0S0 Q  B?o 2Q0S X BdЍ00@-@0P SMS0R  0 0 0000?o2Q0S  B?o2Q0S B?o2Q0S BSߍ0p@-5lP@0U5Pp@0`P *Psq5<50 Spp@@-X0C50S[0  2JK 00S @Q@cWeO-`$10|0L048<0L0 !80 !!L0?! 0  > OL0 0? k001P DP  ZD+ <0<0, o,0S(}:0[00,00[` P055 l`0<10x080B4eP P0$(, 0P0ကT0T0(G< ( %it4[$ =0c?0h00400h0 0`00,00?m 40!! 140S  3/'10 0S [0[00[0x0*Sp p0t (0x@tH05AAQ  RB0BS  R ly505`0@1d0Sd d0h 0d@h03 R @0@Y 1\D03/2022! Z! ! ! ! !20C22S 4W`20S PP1211S T0  p(Jg?4pP04B 0 0Z 0000 l0S `0l 0005AAQ  RB0BS  R v5A0AS l0k Gj@ @ $90pZ0\W0S5D0DSXP?l0 GcEcucGe8A\AcAlAqA8De3cc@ccWe@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC/ 1哸@f@00@00 070 !!0400000, !  !E<u<P 0 (U@0hf<PFb<P3S @cJdddd0@-@0PM 000 t0PWP 9P00P0@00S 0 022201Ѝ0yA$3@vcA-`|p0PS dܼU @P U G< p0S0@U@` <uc3p@-P`@0`S L帼T (<PUTpp@w<0 3/uc3@-< 0<Gep@-PP@  <0S   ' Upp@T< 0uc@-0@0S R 2/uc 0vc@-(@ P0S   uc$0 0S/ R0/0uc 0_vccc zvc 0OvcGeGe jGevc 0>Ge vcGep@-X@P0`S @8;@Tp@ ;03/@uc3Ge 0vc_@-0@T0 3/@ucA-Pp `e @P  p `m00 (R $@ @0@0 ucAvc R 0$0 b ucP@-@`$PP0!4p$ L00 PU(0(0S%  Ѝ@S 0 0 3/00PTp PU(0 S 04 0 3/P ЍucAAAAp@-`P㓷@  ` "m000p@-@P@u0S   mG-P`X  0003 0@T@T. 0pSW00  H@pW @ 7/0SpW  W @ @@@cA-Pp`@ ``pz0S0@@PA-P`@pi0S 0S   A00 00S<0 3R W pW@cp@-@P=@yTp@- *@0GeSAO-`0Sp,M@PTX!eP ` x/o 00 00P0" 00  `00 @00 @;`P e,Ѝ[  卶$ \0 $$0wZ`p?p : U 0S $  - 0P 212 2<22@022 02SY 00%wc@yc@-|0C0P $l!Q2  L1S  8 %(# U<@c\AGeGeA0@-@D0081 0S Ѝ!GeGep@-40CP0[;P0UKp@cp@-@00SP00#;#P0Tpp@K@c-0 0/@cA$0$$1!S1z?0@cAc 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd00S/A-@`săPqoPX`00S :P P P4 00$  (ke@ccA AAAA0 0 0/cGeO-`Q,MxC1'xS 01O000,ЍO} 㤁0H0SP 1O apc~0ll0@n d0S y 0H0SP 1O apRF~,ЍOB~0S3 O 0@0P+0 0$000P0000S0 0  a @ Q x0 BY`$1!S1Pz?009[RJ@ccc0DeEcDcp3Ge.AcG-霐P`VU`P@@ t@0!0C8R#8 @< A@02S Q B!0@cc0@o/c 0P/,㦴@c0@- 0D0R@00,$00P s @cC-p0MP0 0`` @~0 P 00 000 0@W?o2P0S  R ЍDc0@-@0$@0 @0 @Pk[<Ѝ0@cjAP3l3cDcȥ3@-p p@p@0@@SC 1X01jr@ Hr@@<<80p@強@c@vcwccL4wAwcA(wc@ycA- 0b@SPpb}b0@X4100S []0 !!04L0H0@000, !  !@cddd@-@Q't T 0310"0|P0PQЍ xJ 00S|P 00S t T0 #!R `0S@cc@- P 00Sp@-P@WPpTUp7@-P@|00 Ѝ07@-P@~|00 Ѝ0@7@-@00PDP 000U  Ѝ000/0@-P0M0@000TЍ00 0 @P 0 P QPp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@uP?0S P00 0000@-2 @0 0R  R@\ 0CS00S$@o0 9 |5ZAp R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3S{@7@cp@-PP@W t PpP0 l t BR 8P08P0P0 O8P0MPbAp@-@`Q- P08P0Z0S P0S 0 000C0.p@O41041/41!0CS41/7p@-@Qp@p@-01Q@101`41Sp? PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT@ W0`` 0Y81S-8AQZ. iQh`0 !0L @0;/2 00  00r`P SiЍe 㸱8APU 0RU `0SNPX㡱Pܡ  2/0@ ! * 0 0r`P 2Xㇱ  2/ `0*l`P   0*(tXp 0000@ :0<`00S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* N'@c#Dc#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S N+t20y0u1 00$nV;0 0 `!`0  0 0 0 004 00 0(00\/1S ! !! 1 00C000C00100C0F   = P g P90S Q9Z0S YP 㧮00$P tbb_W,0 ЍF@yc@cccO-PM`pDT 3RU 帼@s,0 \ *00 0 0P 0ZP }s #@T  ᠰ5/ՃL h Q4qp 3{ 2 D@,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S L0P0<P0u/n nZ20H0S@1 1C^X@00#^& @p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S ?P 00LP 00S  | x p@0@@SC 1\0100 1<0SЍ3/@yccL4wAAA c@cc A-0p3a 8Q@T0S 00(q 4081 0*qX(@@cDc03hl2/@c`@-@1 0S@tA-Q 2@sr 0  BR 00 1@0S 3/᪲卽PmT 5P0PSN P0   1hS!!1 !  >  P01 P  !<* @P0#Ᏼu0$ 0P+00C00S  P `W\0  JX(1S,1S |`V J8[aa@ccAAG-@QdqKP00`P  衔 Ѻ'P03P07 F7S  <P > < 00C0  .0 $J $  0 000P00P0Ѝ O-pA000,P0   P  n W& PP_ 01^0USS [G  `W qP (1 S0(100C00,1)|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010xs  Q 0P 0R `P ` ```A- Pp`3@2::P@1@!<`J.PP   40@D@P0Q @@Mp@-@PPp@U``FUPP@p W  B PR / t0Q   0RL     / Q xcGep@-P00@Tp0 P @xcp@- P0Sp8 P`@ 0 QV  Pp!!0p@-P@@0$P0pGe@-@000P @@GeC-MP00`0p0 0` @Δ0 P 00 000 0@O?o2P0S R0 Ѝ7@-D 0 P0PP0@EU Ѝ05VA0/Ge-@-0@00(Ѝ@Ѝ/AO-P`С,M @TpPP VPp 6P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #a0S 0 PP 0x P  0 000!R00! 0V0C0@xcAGe;AAO-0@!T0TX qP `1 !R  !t1 `V`嬻 ` 10 VP `P `V@&0Q@D0 勒P `Y0 `  S      X@ᥫ Ѝ`0   0P (  `VxAxcGeA7@-P p 0@P X Ѝ0Q000 $!@ AA ATA-@-<00S 0,0 ЍЍ/cAAG-`"Q0B  @PpX  p$0S00SpQp @W 003/pP  P 03/p80S 8T$0S R0 0C0!R 00! 0S% P Z$`X!P  Y0000000@0@@000000!00C0AAA AGe6Axc\AA-0a0Q傺,q@T  ߼@U$0S- 0* ~<0P000@03/ P R00S ' :0S (0, 0 VW"P<000@ 0"  xcGe3eHeEccqAA0 /$/@-@RP` Ѝp@O̷0 0 00 0iP Ѝp@-Q`M P0 ( 000W@P @P ЍXp PU@ 0  @P0P S  !  00C0xcGeO-DMB,0RbS20,0 e002"@000S200  _ B/PT:0`PhB(0 <0 P0`,P$  <Q<0 Sa '~0 00 0 0< ,`(P$ pP0 00 0< 0,`(P$ P"0 0< 0X,`(P$  P*0000  0< ,`(P$  @P0 0000/@0  0,`(P$ @p< @PX@m0000DЍ XP 0  @gGeAHeAhBDcHeGeBHe c3BAXHecxc3LA@- @0@@ ,0@`u P %VЍpA`A3@-$0 0S@   0xc@o/@-P`㍶0 H 000,@Pո@Ѝp@-@ʸ000@ָ@-@¸00C0@θG-`PAqT:pW @P P  0 GPP  = 0S  問P1P0 剏Ph p2PP # 80p0@@@ꤥBhBxAxcAAAA0   Ge@-$@ 0$00倻 @8GeEcO-M00`00W0p4p Q @p8 00(0P qP } Ph[$0dbS @ T `0, xP $0S(( Q03/( P,X -  R80S 8P$0S /`,8 X 03/ `0, EP`, X >k0(0 PP$ (03/!R00! ^0|pS@0S 0S uS00(00,00 0 0 0+PUA 03/PxcbAlAA>AAAA^AKwGAAAA%AAAJAAApAAGe:APAA{AA@-pM0Pp0,a @T 0S$ 0S/1ЍU 0S@00 !R00! 0p0@@@  PU  R000@  P 000xcA-P`pݵ@P l T@Ѝ| @@@@ 0@P@0 h@`AA-P1ap3A峵z?0 ` 00S8 /ᄋP r@㮵Ѝ@wP.r@P< @@ 0ܴ@P tV듵0 %@ I@cAc$A 0 =Ge0fGe 0 0Ge0 0Gep@-`P㊥` P@O00@0  @@0000PURp6/0Gexcp@-@6L0PU  R8 00 ;p@_ 03/PxcGe@-@30 _00cp@-@@`P00 Q &p@@cs@-@`d0P000@ 5~Ѝp /c@-$@ ~$" cAO-M0S0 P0 Y`p/᧊Pp 0#a  mpW @@T /ᏊPpD3D#PPG u  SpW Ѥ2Y C0.bЍ00S00$0Yr  㸤+NZ wPPo@tqPcd僉 uP @L P D8(00,0 PPP(@P9(0@P+0!R00P@# 〤1, 30100 0000( 0 @PP,0S( @bP(ط(0 0ѱ 寭u RT  T&G}0U@ Y  PP@4Y  P P |ʒ@ 勤pS$0S0ỒAAHeAAAAA@cA4A?A0  hyc3HebA$0 0!0 00 /@cddd-  0  /xA/20C22S/@@- $0 C0@ ЍycA'@-<0DT 0 !0  !@cp@-P @]wU00p00000P0p-0000/G-`@#202P X4 CX$S\U  W1PlU P0Sb pE1l U b 0bG{@cA@-0  \X40SX4 0 !J0  !Ѝp|0@`V  Wl00bPPPOl00Ѝp@b `Gl 000 Ѝp@@c@ccP/0 00@o/@c/@-D@ AX4 CX$S\#0@lo@cA-P`@pᕢ@0 90000]ȣZA-P`@pႢ@P 0 %0000]ȣZⳓ@-@k⸓Pk)@㛢/ 0  pQd `QT}r}}r4 R? ?  /`He@Bx 0/`He 0 pHe@-0000(0( (0$10c00[ЍpA@3ApHeG-P `0$T@HTH0 00 pPV < 80$+40 Sp|Q0 000000``F`00C$0$YGgaO-4M$0h4, 3\`1`p@00S 8 XX06000 P ! ` m$00 $Ǎ0P0D0V c0 Eap 000S00(000 0S0@f0僡000S00 ?@T 0R@0T rV@]@000 0TP(0$0,00H000000070|2 00 4;80 0$< Sg0;;00S8#$0000\03/$0" 000 0 (00O0P  uS0PH 00 00O0 000SY  0S0 0S  00S 00TT `X d0UV 0`5000700 034Ѝ Km0S1೛0 00 00,03/0 0C00 000  000  0C0?0@ #@c yc3ATd3$0S8$0/$0 0!0 00 /@cddd0@-M vP@T  vU T(Ѝ0MtP U,P /v@>AA:AC-`pl0lPB<@C0S 0SU Ѝ0 \ GAxHeu3O-Pp`BLMa0 (`0`D00,p$P PP P<DPGe0`a0D0 <,(p$P PP PG 0 0 0'!Dk0 00<,(p$P PG0 0 0D!q0 00<,(p$P PG 0D!y0 `00<,(p$P P~G 0 0 0D!0 00<,(p$P PkG 0`@!0<,(p$ `P P@D YGLЍAxHep@-PT0@Tp@@ 0R0P 0S 03/@,ycHe 1S/00h^xHeEc@-<0DT 0 !0  !@cs@-@P0@`Q Q10S8 0 R    ,T Q S`0 S#0@0S 0 Rt    X00S  0S800 00׷@Ѝp RxHeA@AAA0@- !| 0 !p@-s@`3P @0303/P PU t03/pݺ2Ap@-s@cP03/pp@-s@Q@0Q  !1PS]p@ 2xHeIes@-@P@`0S S 0SRTP00S Z0@ \($@J00ЍpxHe@AAAp@-0P.@@Pp0(.Pp0 p@tAzAAp@-PM+ t`@T t Ѝp>rP *P,P  8 r@P ` t@A>A:AA00S/7@-PMt@0(00T Ѝ0prP\0 9rP@ظ,#t@rP (keAIeAAAp@-8`@0PSxP0p p@ge,yc@-00P Ѝ dP ,yc@-@r%r@-@rr@rA-`4p@v?0P዁ 0/᭶0P0AA-pa@0PS yTrqPPrP p0.BP Pr0S [T0./P 0 (P 0SD=\rP 0S7d0[qP 0S*4#qPxHeAtA_AzAA'A:ANAp@-M`PPPЍp6P00S 00S P sP@ slP H_P0 r+qP 0S8d1wpP 0S+4$YqPxHeAtAAzAAAAAp@-M`PPPЍp rP@ rU )PP P Di@P,PP qAA:AAp@-`0 MP0hrP@@ U q @P\rT 8@ Ѝp0000/7@-@PP 00P Ѝ0 Pp@-M`P *rP@@ V q>@P rЍpp@-M`P  rP@@ pV qP@ qЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0}p Ѝ33p@-`@P P 0S Tt  `p XP@0SpT   xHeA&ALA,0 0S @-@xHegAA-Pp`@᠛00$0p ` P@ ,yc0@-l@P0^P UPU  PU0^00 0@x,yc7@-4P*p@P $000 o Ѝ03D3@-` \@gtPp1S`00Y1S0@<0 AA0,000 o ЍxHeEcIe3@-0@p`PM  000@ڦë|ӫ0t t@p`0PP P02@P =10\Y ( Ѝ@YAHe3Ie(4IeIe 4@-`0@0 0@0 0000 0@00C@0Dcc|0H S/P  \\1A |000S \/0!`0 SQ/PQ//Dc@-PZ00C0 -@-HnF\2O-0S0PrPRM 0@0\* 0 Q00S  0 0Ѝ 0@`g`@  d0V  [ 0倐 00 00000 0\00  0#00 00000V00 @`F B>c0@@D09c @T0@0@h @0`0 ` P` P@~@yccDcc0uIe 9G-MP 0`` @p 0P 0  00 0 0 p@<?o2P0S 0000 0ݨP0S0 0Ѝ@-@TZ0S[00[0~&{&d@@-p0 0  ^8 0@0000@00C@0Dcc 0@-81M@T,  낵Q r 0  P@@   t!00P t 0Ӷ0 x0@@ 00@@`@Q 3@ի HЍ0@HAcIeDc0uc@ycAEc 4A4%40O- 000p(P$@ @A@0谟,00 000p(P$@ @ @P-@/0,00 000p(P$@ @ @P\@00,0T0` 00`0p(P$@ @ @ @<Ѝ{cAD4Iex:454000/p@-00CSP0@@$P,\U ᯘTpp@(㩘c A-0 0 2#PU 0`S@T Al<pd0S R@D1$ 0R @TAzDcce@-M`pᡴ@P00a 0 0  00@00T0S@1 0 0S @Ѝ裴 0S 1S Dc@-@P0`0_a 0 0  0 0 @00T0S@ 0S@Ѝp1S1S Dcp@-P`  0 0@0T 0R0S 0S @P4Pp@Qc 0ScDc&HFD 0  !"P/ R0S//DcQp@-@ @PX9Td0P1@0P !0@@T@dpcp@-P(@p`Upcp@-`P`\ T `@00  RAP @p7pcDc `0S  0  /Dc 0 ۫Iep@-@Td0QDSh h h0d 01 0Sp@p@ecA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0n  BR fO-SP ` (`pv"0 0*@T 0 SV`0S U0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#oboYQVT T R S+@0`00@p@S V `0P @$00@01 00001~[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@x @V (^W YcDce@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0cp@-L0@3P1S P0 00SڦS000pp@cp@-P0PSA,00S jaPp`p@薤@c}cG-0PPpa|@P @T P03P0)ATAU ;YL0<L0xWjTGe@c 0 YIe0傳Ie0@啳Ies@-xR   @ ⭧8⪧ | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/0  0 R0d1`0S00#0H1``0S/00 /0 li/6& *P 1:ai@ 0h0`0/0? ?,0l`00000Ct0*|`S4  |Ѝp@Y@ycAA@vcIeycDccc{c@|cEcEcDc}cJe>XMe0@Ie@-H0 .0@Z077pp@Ie 0 @Ie0 @Ies@-@P?`<V8`9V7`8V 00. <P0SЍpBp@-P- R@ *B B0 0CS0 B " p`V@Tp\02S SMp8000CPp\A@ycEcp@-L0@P P`+Pp@* p@0{v 03/@-pcO-TM@  0G C000Q  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Pt 0'C@P ?0 QF R  QR03@0B  x00 0O0$@ 0;00 X@ T VJ8@y 05|5  x@P DATy @c54ЍtV@y 0X01 /@P0X@0 Z 01/@P0Z@A5h_ P% Y[00 @@00P@ VJ0700Z0 CSRL0 t@꒟ @kT@ f0J0 H@P Z$0,0 00/0@0 ^00 0p`K@c44C-M p#@P0S !PU  A` 0 q@P`P wЍ@@-@0 000 0@0㆞oЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍO50S0000(00S40SU YPEU U00=0j4 P 1L0:`@|40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S \0 00080@ 0P  @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S ; 40SW; 0000  EbW000  9 8b 4bW& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@bH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/Ni8<1W<1@1@1D1D10Q/Q\8 RRu1 1uW  11222/W22!2? !. (2W(2,2,20/+80 LJ0Z 01$ 8-[ 0S%GS 10 Rx ?RQ X,k h2WP00 70  70 70 70  70$ $70( (70, ,700 0704 4708 870d d70l l70p p70x x70| |70 70 70 }70 x70 r70 m70A/Ag70B/Bb70C/C]70.X70E/@S7@0F/F10L70G/GG70.B70/<72@0@ 0 Dp470070 00C0$0 0$0(0 0C(0,0 0,0 0S @T00 Y80S $0 C00,0Y * )4@,00 U=0u r1 LЍ R@cclAc1`00/1`<10/1<10/p@-@Q100pcp@-PP`@V11 GP@ 10$00@pcp@-PL`@V11 .P@ 100@pc@-@xp@-P@pop@-@h@-@ep@-P@]\p@-@Up@-@`P| PpR0p@蔘pp@-@Q0` `00p R0Q`R /O-MPp8f`u@w5xGuYw  PWx   P @ P  0 垚P  ЍܗP  ՗P  їPȗP    P   ὗPᴗPᯗP u ᦗP ᢗxNuN널I♗ivN sN᝗x ᜗w ᕗ ᅗPzO-MpP`8ƙw@u6vHwZu oPXvl   _P @ [P  0 P  ЍAP  :P  6P-P    &P   "PPP ww v u  P@- 0  Ѝ"0@-00  Ѝ@-0t`q֖@uӖPΖ$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`q᭖@u᪖Pᥖ$0P 000 Ѝ71M000/s@-@`٘00 0Pῖ@PЍp@7ᮘЍp@-@PT@#a8n1  q Ѝpc0A-a(M 000` 0P @P p0 @P ?T@(ЍA1P0 ` $0R  aP 0p0z/`00 â0 00>]cA(0310S/00S/{@cJd@-d03" " R @" B"2S k&@T*P @cp@-P@Tp {000000@p@-\03Q0S m@T 00@ `Tp@cG-@`T; T[ T[VY h1*ERU:0CVQ Ap81`3  1 0S`} P U* W0@ @03A }{ @T@0U00CS  @00J @@@c|cA-@ `x60 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `PJ60 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#m@P 0 |0| 0 00 p0 P#3S<0 R00Q tJ@chWec4DecA(keDZe0@-M 0000 0@u0P     P ЍBA-@ `$P B  pᦔP壔UV#3ᗔP喔U V VX031S ( ,02 0P03#6P @cA-q`pQ TlPP<@ ovB Pc@-QM`@QP0T  R 0@ 00 0@`PP P7P 5p2W ,p+WP Ѝ)MO-QM@p帰Q @PH0P @@0P 0弖@P:00CS@5 aL0` 000 0o0 00P 00 0 0 p*0@?o2P0S` 00 0勖@P  P0R00P0 ЍAO-QM⨠崀:p0PS5` =@P0 @@0 0]@P⒟ Ѝ 0` /o0"00  P 0 0 I*?oZ20S@ @@O-(DM  $ 0!% Ppa B, 0  0p ,`(P$  1.0 000@!<.  -  0 04p,`(P$ @\.+0$ !H.  6 / 00  4p,`(P . 0!0}0@0C0000   0 S p@vcEcC-@`Pᰐ1qS21 0! 28. h R R R ' ڗX0@00P0#*1S0Ap@0 0@00002S000000SP ЍCeC000@IAJd@-@0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@jF` T`W p W 3U  G6BP 0SJd|c@cp@-@PG p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0(Bp@-TPC%0C0\0(@T@ 0S 0ABXp@c@-K 0!0@@7@c0  /tA0/000S/@- 0@} Ѝ(keA|cb00/00//O-H`Q@S 0p0202  f [0E3" B"2S1 ЍOTp `00S; ; 0  = [ ;0 40;V 00S 0 Ѝ@cAG-P@0 psp_E EY  UP;`P WVV `XBE 0G=<9E0 X0E0 @cQA-Ppp `D0@c`  TE@@cA-P E`@  @V`Y;pX#  @`;0 "S  V@0 A;L;p@-P @H0c   0S@Dp0 S p@cP/0S#/P/ 00@o/@cP/P/ /p@-@P({@0000p]Ӆp@-@P{@P 0000p]ӅLl@-@DQlP~D@4{/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ T@PR  03/@0 @R/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` b0 P 00 000 0P?o2P0SP00S 0@ 0003/P Ɣ |We|cA9A@-彔PA@-P P d`͒PL)Ȓ Ѝ $;⾒⹒WehA@-ⰒA@-@| ⨒p4Qڀ  !L D<, !  +⌒A@cdddA-P@Mp1 p`@T,0@400000 ,00(00!0$@ @ @00 000'>0<0Y!@P<0W0 00PSPDT`@Ѝ`Pp@@|c|Wel4WeC- LM0[0 0<P`pA0D0a0,(P$  @!0P  LЍD  I    '. a 0,(P$00 0! P XPH0H@0<0pP ,<PU@We.A|c5A|c6As@-`P 0@T T0@T  S  0D 0 0 R"P, đ ,o`Ѝp|We|cAWeh0#(1< /@ ρP PQ00@0!!#/@c 0S(0, 0 (0, (0, 0/ B@- @ HP 0S,031!10P@cp@-P`|@Tp 0SP0 `00C0A@- Lp@-Q@Z0S P0S00C00 00 cp@ \/Wep@-@dPUFQp@p@-@803Q 0dP 0 0DF<~p@c0P/ We0S co `/P0`o@`/p@-@00C"0!300 P p !A\  Q` `000PUR0(00@@@#pp@-@P0M  0@0@@@P|0t` 000@0@ @@x 86 0(7 $Ѝp@uA4ccp4В4p@-4` Q[ 7ipT0僌@  0P8+<``cp@-@[SA!iPpNA0p@ 卌cp@-4`8SpP0P R@  v+`084@p@c0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@ c$Ap@-@T 0 R X0 ċPP T x _0000@pt -K0c0 0S/0 ՋcO-pPP`@U#`V0[00 U00 t  N_` @T 0S V x J00p@-@0PQp R00  ㎋c0@-@PPM RS   PP P 0   >PP  E2 1"  P0E"0A 30Ѝ0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@M04`pP,0 000"!       P0?S$P(P,P0P4 PЍ L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ$A@-Pa@o?i?,10!(1T00!41  1 00000110010 0 ]@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0 /A_10101A-0P`q ( @IT  0l@P 010 10010-A!  !!! 1P $P A-@ 0S Pp`eP0 8P0q@0D"0!!#  0SW00S@ p0>S? 0 0CS#0T P@G F 0 S 0 0000@4S P@@ @@AO-Z0M0C01@S FNP3 1,<00Jp"@03 qp[`) `P iP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  [0P pQ   BV *V .`P [3  @@P gP= 0@; B "Vx1Sp` 0\ 0p!x!ZR|||!x}tZ0SP RU =0|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R /1P0jWAccG-P葐lp@U" PP1@T' L0S` ZR` 0  ``CPX P@T %P @TUЍ`0SL``g 0  ``PX Z0S 0CSPd@ccp@-xM@?x ` PG0U0000`0 09(0$(P lP, 000l+P0 fb!xЍp@-P0@1P00Z00l 0000l@ ⑆A-p`@T$ L0SP0S:@]0SP`P+U ,'UVA1PcccG-1`pAZ0S'P\W TP0SP0SPi<0S|PP0S G'0 QU 1@ccc0@-|M@t PF00P |Ѝ07@-PRQ0@2  0$100\ P P P $a Ѝ0@A-P`p@TW [0  d@p@-xM@`Pt F0 0 0`xЍp01 10/O-`P1Mpp0AL" P0  Z(XόSP54c@㇒) l 0R[0"? R (`pap0` 1RZ PX 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOXYP k` 0 0  2ЍOЍc$AO-p1|MSA僿P0  hXN T1%@4|ЍO R (alS`^t E0! Rp 40堀尐1!` p$Y0  fWl>`0STwP 1`@T 0c/ 4/|Ѝ˃@cc/Ap@-@HP`50S Rp@O@!p@}cO-p`PA$MZ0S P R ~U 0 bSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000lPPP04P0ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` Y !!  Rv UX [  l Q W   0 0?P}WqPPP p402S SU 000 000 000 000S0X 1D HQL!`0S7ڠ01,0 [ Q , lP( $0 ?PP01 P02 Pqo cAA-P@q` 4Rk`AD2! !! ! ! !! !0  E2 1 U"! ( !, ! !02A Ap@-@P8`0` \V` .p@ !A@-APP0  P08P0剽\  "!p!,' :P0|`V0S 0 00 '00C0ѼVP08P0߼a7P0OZ/000X C0XHqL1' 䀟P&  03/`00S P I|z?V` 0 t`و;VP02P0P0 :P0|x`$ňpAzAAcP}cAAC-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  KC` RW1嬁p0P 5 1 ` X 0 8/Y/ g P  0 Fs |Ѝ@cp@-@ 314020SS \咇Sp@<@P` Pp 03/p@@cAcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@p@c0A-PpZ0P01P0?`0Sl 00C0|@Tᓻ 0SP0 ᠻ R; AV  3 ` p000G-`1SxMpA 1 0t YB001Wpp00 0 0$00(00,0@ 0EB0( S :P0  /t妈0 R (! xЍ%@ SX`40` 㠐p0`1R^V P 1 `@T 0c/ 4/U@cAA-Pp@ 0`V S R @0nXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/@cdddA-D`DpP@O0S B00U@`00cWe00/p@-0@00S00P00R -  P 0Q 0 p@$Eb 0 }&0C0d0b3P .20 0`p@Ap@-P@IU "Op@-TC\  P 0 P  &}`@)3@cp@-@P R` Q00l=#0`PP0  p@P0=P0/G-1́`S0Sp YP@I DP@@D P @P0Y0>00wLP}L$v(A4ANATA-AA"A@AJA@-03@M` TV 0   n30S& OP B0 rs #9QPP  <0"0 !& 0! "` @PP)LPCX]LP>HXLP9<2$b0`L@L7:!#:  : 000@0QKR1 L,KP.LP )LP?apЍ>P@% KP> LP9 5XPP5 p|0 pLz`On by?iV!FOP\>TU K Q`PNKPKP04 40 0000=4De8cWe@cbAgAA"AHcsAAAzd@nAO-@0pSM800880S PP8 830:QP>@|~KPP p8hNP0ST DD80 0 0S ~?CS_@KP30000000000T007u0 0 `* ,T ,K%KP QKPxLKPlad`80P00S K 8Z8LQڷ0 0R`A*S 00B80 (0PP0 08(0PP `6(,  JP/ 0#pZ JXH8V`P'Z %0 + 6 006 #:: 00 40 `!#_ 1$0$0YJPJPV8NPH   008`P d# \5%00[8D @8 P: MP4% kJ@PbpJ哂aJPJP JPD4x?a}4PC`D R  MP hP@8MP_P 8MP 8KJ0P D R'3[ !P8MPD0S h 03 ~2 h30S ЍPUCT3 J _OPP,IbPdR' JP"JPI0w0cRW  !) I 106 #:: 0000PII 6#::0?K 00nPPa' # I@PZIЁIPIP |IP81l?a⺁1P 1 uNP0 d~@1PUu*0P0000h,!0 Qa 890*6 0 81000 0~8PP8 Q~ N~00PcWeHcX}cA@cAA0c@e4DeAAA"AAAAAAbA8ccAAAAt]e(A-AATAJA*AEcjAgAGA/ Gp@- @RP` Jx0tPS|0|Pp@x0Q0R h R t|0 p@jtP|0p@-釲xAp@- 0@SP`pPp@S h0S p p@FpPpP00SD0P 800S,01@o/c! a v```P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,pYߍР010804 P00F0p<0,MP`B>P H1R0!sR g |XpPP1 00 400 80@8@UpP` `84p40SR40 8✦$@TR4`S-p` `0Y8 @T2B@P @=PV0S1S X@T01X0| <p$@Pt  ?X@070l@ c+00 0@0QP P0S p0 0R  O 0$0S !0(0, 0P$0 , 8+$0 ! ?$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@ovP 0p 0AA;A AA-C-M00( 00P00q0PE 000 0g@P aT@ЍCЍ/ S?@X X` p *4X001 ``\    p @`$0$@JBPP804 \@\CRQ f%PU Q@R0 0P @@`  R XP L0@;$&@P 0$ X> 0 X@' A-` 1V`04S nAWPp`8@T 00S8@P 4p0p8pPPUV  0P 0p0 XP Xp`@4 802#T*0 R0 R P8@Wep}cjAA-P0 n0 p RAn sA S s `Cn@Hn@,n@0pynTAAAAAO-`PM PU (` ) Sᡨ00Ѝ    p @$G 1( P,00 00J P 0 10P0 00`0 0@$0$ C 00 0WeC-` $MPS@p@ ppY 00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`m00 T @00$R01 @00-AQ|O-//0 R/ 06S/`kYp}cl4@- 0 4\ ЍWe@-@0 00 #3  0 0 0 0 00   0/Zep@-P@03/0@0pp@-hP@0S03/03/@p Q \ :$0@؁c@-@@00`:D0 0 0TЍpd@-TP00@t%00`!0 0 0TЍpdp@-@PTp0M00Ѝ/dO-0尐@crW 0200PP 0С~*0  00#0  0 0 0 X P0Sr Ѝ@c؁c@-@  00Ѝʚ;@-@  00Ѝ@B@-@ Ѝ@-@  00Ѝʚ;@-@  00Ѝ@B@-@TpM00PP` 0V P0SwЍ؁c@-@  00Ѝʚ;@-@  00Ѝ@B@-0a @>% 01 0Q1*S10Q0 0Cl@l`P0 @$00R000R 0P0*03/03/@FX Ѝ@7SD  0 0(lEc02AaAZe؁cZe4DeAc0@-0@VB$ZeA-Pխ1@ R R $0$ "?o2W0S A$@$ 0S p倀0x`000 0\奭@TH߭T 80800"#NZe؁cZecMbcEcA0M0000Ѝ/؁cM-p0M| 0 ""$ O!$" (@,$[`3# 0SP@S  {"! ,   ` \@  ⊭ R   4 0 !i0ЍZe KdZeʚ;A1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P00 0 0P0 R00p؁cO-@Pp`.0$(0,0 0#   \$0 x$ $@ \ 3 Q\ P0 00"0(00(,4Q0$P \ P \ P 0  L P0@ rPpQ0 j؁cdʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P0S $000S2/p@!Ze؁cZep@- xҫp0p@Q0}/’\ \#3$0oP55 8@#4i03/p@0/ZeEcMbZe@B؁cA0S0/0G-P@M@(p(0< 0800,p$@ @@ @`kP0 P000'>0,(p$@ @ @P<08 X@Ѝ2A;5C-Mp 0@P`` 堐 7t0 00  00P 0 0$?oY20S 0S0ńЍ者c80< 0S 800< /ap@-@I@0`0@0a,PU 80< 0 y`p@1aP`@-@PP@N@-P@`0S 44q4a 0S@0 Y( 0R0000 A`0 b?` 0SƂ 00"#! "#1`P73 $103$!D0 3/Ԫ0 00000@000@ccMbdEc@-|hEA0p@-`Q@P0 30`, fup 30` p@fmAqA0H-@`,M0堪P0S? T$PU? ,XO80< 0 80< ̪ WbP@ "`H  @R ppD ̱00P1D HBpkW  bb !0 _@0I_p00 0P00000p`p>>0S9 0R 0(0 0 ,P0$  R 0(00$P 0b>P`Z| Q 0   P`FKduA}A=5EcC-@,MP` 0 $0(  ,0p@0000 HPD` @_@U  t000000 T0 外PP o_Ʃ,Ѝũ00E`AA?5p@-@`PPJM PpPBM00p@-@X0M 0@0@ @@@ _  00@@Ѝ@膩Ad0Zed0SA-@p`ဩ@T庩`M Ps@P `MH0V P@f@0T@SP P0PT TPX0\ P0 X0\ 呩U `L@@H V P@0Zed@-@d=X0\ 0S X00\ @P0ST T % kT@`Ld0SA-"<p8`@T SL0P!`hT TT0S TL Ѝ0V @@0T@S 0 |0P 0P0 T0 0 U SlL@ V @0Zed<5B5:54Ze@-@hè0 0S 00 @0S   $TS@@Ldp@-@SPSpp@-@PS@p0-@- p@ 0P` 0td0`00"^PЍ@Ѝ/s@-P@w00`V ᮨ`^ 0  0Ѝp@^>5Ap@-@8P官 3 $!彘<^00p@c0S/p@-P@<B,0S  (0 0@0(0^p@q0 0R0000 000 @0S  Sp@-0P@0 0R 0(0 0 N<P^pp/p@-@PPp0Sp]@-X0@SHKj@ %jp0S/ R/h l00h8Zed @-(ȧ 0   k0d8ZeJ5d0 ,P100S//寧ddA-xM⧧p`@TݧxЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x t0000x0(0\0\P0 c8Ze0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0EX0 0000 0@0YP H0L 0P0S 0003/(@ʚ;8Ze0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0SP 08kH \0AQ00\0`0S;,Ѝ0$p@-PvJ 0@   S%0S@#p cJ@@- @PdT@-@ iP Ѝ \Q?/ɚ;0@-@MP P0 Ѝ0P@-@ P P0 T0S000305: 0$Pʚ;ʚ;@-@ PQ  ЍG-p`@M00  0`@iP <PT 0 00 @Ѝ R  T@0@C0#PPPU 00Sg  hP $ 0 S (0@P0R0P100Q:UGjP !S R(QQ\( 0 BR0 \00 \0 0 Q R^ 0 R R 0u{Aʚ;0@-@,MP P0S00 0MPQ 0 P,Ѝ0p@-@(MP` 0P 0S000, PQ 00 00(Ѝp 0P @- R R S12S1`01 0 Ѝ@-0@SM 0Q  00s   hP Ѝ0@-R@P$M 1` laT U  7P  @04 S#*/00$Ѝ0A@B@-0 ЍA-@QP  U 0!`Ap0 R pW=) -` p`2UP0 S00 10\00 1 p 00 00\ @@S0P S0."? AhHeZe@BZ{c /8Ze?B0p@-0M 00000` 0PaW@PP  0P@0S!Q Q  @0ЍppC-P `0EQ@P XP\ ` f HUp0Sp0 0@S((0,0,0p0 p4M58Ze@Ze0`0X00CS/@-@8~X0S000S(0S, , " d@-@X00CS@<0@-@00S &R, l00& 00@G8ZeA-X0@0CS8CPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0dʚ;ɚ;6ep@-P0S H LA  R5k9 SEUt $\RnE#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A: PA@-0 Ѝ伍 A-1`PU 0FS0!RX00CS 0S 0SxxS 0oHHL@LpH@L@PPp^P@HL@P0ɚ;6eO-4MX0YP4Ѝ0@S`pePePP`ATPW 8H0L 0P0S# X 0BQ%SR  HeP H0 L0 H0P L RP 0 H0LP p AS l HeP H0 L0S H0P L BRP T0SH0LP0P0S0 $0P0Pɚ;6eʚ;p@-@HM` P P1U(P0 0WPU (HЍpp@-`V 0@S@@P(P'p}"p@-@ M P  Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M   P $Ѝ0Q/ЍO-MP`fdPbdP@p0 0PW 01S 100[%T C@W DpU0 @ U 0  0t pxP 40匐P@@Ϡ0H0L0P #0 RQ @ U U% p FT#,H6dP H L d0H PL QP H LPcC6eAɚ;C-P`U@p,M0S U P ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@Ecp@-@`Pl0SpG-1C0(q_@@XP`X R00G蒟 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80# pPR @> 3T`@ A@0@&}0 @H0@}Ѝp舅c`ZeA5@-d@0P }0P H  L0P }0P  L@3`ZeAp@-P<0@Tp0 RrP @ꈅcA-Pp@P`  0R\P `VX00PW@ G0S PP00舅c0@-M@PPP, +0QPaUP 0S   p00S  QR000 !R  R 0PЍ0舅c @-@x0P@tp@-0QX0P@ @0Ppp@+'Pp@Tp舅cO-,MP`PC MpP> P 3Pf2 0@00尴00a00h0l0@P0<043\0 0PpST U0Wp00 01S PU 01S PuG@,ЍpW1 00S00C00 00Z 2 0S 0R dJ 2P!  G!0E0S  0 Sp ,B0p%0%0 UC0PPC&P PE0S L 0`0"0CQ 0 \fD$0 V RX0480080<00<00S 0 P:2D0 D 010 D!/t 0H +"HX HPcp  2L200SM dPPJ 00 X1 O `P. 0S R0P0  9 pP   R    0Z lY{   LH 0A Pꈅc@c@JdAAAAA*A9ABAJASAp@-@P`}0Pp p@0/A-`0@Pp t Q A 0P1 P P O-`p0004PUW Ѝ@0SP  R@ 0S 0CSP  0\ P tP [ 0 ;/P ꈅcZe0@-M@P Ѝ0O-@P`p||0S Ѝ P @pU 05/T OgBc@-@ o0d000C@妍`ZeA-X`P>X A/p0@,W,0p P0@,@A茍ꈅc`Ze@-@<GP0 SP T0 0D X @T@D@@w`Zecp@-40SXJP`0@4&00(0P `L  @L@p@YhA`Zecp@-h0P0Sp@/`0@400(0` PT  @T@p@9c`Zec@-@LP00CSP0 T X0,R( X0D0X0T gC@`ZeZecp@-P`،@Tp@pV0  4 R SD    03/R0 幌0@`Zep@-@$PHP(p@ꈅcp@-夌`P@Tp݌y R0T0 L ӌP 03/<0(qJ0僌`ZecAA-0P0`SxpX@ 6/P0S 0S @T/@\0` P0\`ZecA-@PSA@0S-匌Q0SK`XPUKV0Xa0XPIDL1@0 X $30S PGjT!TA0B $G?p @0R :<RP!`%`56/@@T 6//0t"#0A6/T@3/P0 3/P` R0\0  /`ZecfB4DeAAEc66A9AMbA$0$$08S 0  4De5hZe`Zep@-@PHɋT 0S 0AT 0 0 @p@Jd@-@LP0A-P`嫋婋U㰀q@ߋ0S 0@T 0 0d0S\0S #S`0S (ċ0&A個`Ze@Jd@cG-MP8 `p@PH'I 0S0 0,20SV 20SR GVQ3I.QJ014XXpPk0 00iቒA0 03/H,T\A4f-$#P`_V<0IH7_TЍlI cI IW 7/pP 0R  CP0 4S 0S p(A`Zec`AcsAZeЅcZeYAjAA- Mp` P @P 0 A@ ЍU H00S <00S 'G5/ 1pI`ZecA@-$M@P8 `py0 $Ѝp@-PM ` @P 0S0 0(0 03/8j00\0@ 壊jЍp`ZeZeЅc L0.`ZeG-@pMPPU`0S23`0p0?PP \{UL60 0 4o$.(`P@hPЍb000^=0S0S<0K 0SH 3/PPD0e0<00<0x!L0.h>4P 0(0S 3/4Y.0S  H0`0f@50U0C0   S(0S%_-P  {GP  0R P 0S0 4S "+00`Ze@c@JdZecAAp@-@Pp@A@-@P 7@-@/Ѝs@- P`@P 0 0@Ѝp%HA@-@P @-@=P@@-000 Ѝ5@-000{ Ѝ 5@-000 Ѝ(S=@-000 ЍhS= 0Q/P /@-00 0XP Ѝ5@-00 0NP Ѝ 5@-00 0`P Ѝ(S=@-00 0VP ЍhS=0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0᱈<0`0<00Sʸ0Sp@"?C>@-@v0P|0S@/|/A-`@ገpȀ<0P 0S#Q003P0 000>00C0>᫈@cp@-@Pd00CS00>p@虈//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS A6+0`S0Y030#@D 0Shl`}W !+ P0!!0A-P@l`hpT1S S@ R Tjh@l@NA*1GQ @p@-P @PI0P  $     PU $  U p@pmQ P  80R 0 Q }P 80R 0 @Jdcp@-P 0 0S S, S@t@=pm@P`F`i`V80S@[@P``W` 0V80S@@Jdp@-P`@P P p@@-0@Sl00@s@-A_P 00` `@t000TЍp LDP00PvD@pDH[eAA@-@8@x@-@0兆,0@T   B B  @踆@Jdcp@-M` P@P U 4 $EЍp R 0 R G0 QS8  )PPPP ꈅc Ap@-MP` P@ Ѝp U @P C-Mp `@T ЍTP8 h1 S(0Z?00ЍAAAA@-@&P \> 6$t@2$A@-<0DT 0 !0  !@c0@- ! 0 !@-PDMp@`i+ 7HP+0 000007 u&P  >7 W0`DЍAp@-P`#0@`  +p55O- S$ @-0@(M0T (Ѝ@ll03100P (Ѝ@0 00!4 Ѝ0 0  (Ѝ/ᤈ>@c@yc S& @-0@(M0T (Ѝ@>t03100P (Ѝ@0  < 0 Ѝ  0(Ѝ/ᤈ>@c@ycG-p@ࠟW `PU0``0C00S 0WP1R 0S0 P0pG0000C00 0C000 0  c꤈> 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q i 0R  ^P 0 @T   0S  R `F P0 Ѝ  ꤈>@-P`p᳇@P0  @% Ѝ@-P`p᠇@P0 &@ ЍA-@`pzPPdUz@Ѝz}@Iz,GzT0 @c\ @\ 8 G-`p0S0 0@P202@P0 S@20C22S 61 0@c/Ϊ֪/ު///M0P PЍ/  /M0PЍ/@- P P R:H0R 0R  0RЍTVRPA-` pP@Tl@lpT: X@0 8/P ЍPP PxB|B00/@- 0  00 Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-KoP/P/@-?oM0 Ѝ/   /@-PMp`0 _@PV 04/Ѝ@-0`S@ 0S0000000H7PP000 @0100Ѝp1.  0S !S_.B"B(BPP OPT10L1P) =3;0P? 6;0Ps`V) 0Ps 0PD`V 0P0S P P N, o00@T KLAatadrbmngnts@-P @$Mp`pTU80pP@ 0$Ѝ WP0P@-`Pp$M@ Q p PAP $ЍPUP 10SS 00T00p@-(MP`@  ` Ѝ P(0 0CS"00 "` UV000! R 0 1   0RS "(ЍprbmnfߍAwMQf/@ J0 S0;30?`aV! 0S 2     *! R R 0S fߍA O# #P O<?`P3a:4@pVp 0 Wp0pGd @]d@edAd@edA|dhd ydG-0`S<$0@b /o bX c0?o 0c\0 P$0 ," S  R Q $TR!p  R ("( R ("($ R 0< R @  pV  \}U `  @ 4VGoAAAAAAA%A*A0 60/80S/p@-(0@S ;;S0`s- P S  R8SP peo(0aSR a#"P R 02UXf/rp"2P 0R*pWEVs@-P p5 `@PA@6 #:@$:@ P  b*t !@P TH034o( 0&f(Ѝp4A7A@ 0p@-M0@P0( `!Pk0P X <2 CP*P0 Ѝp00 0 !Pzd@hd A-0(M pP0`!@P. 0 !@P&`'d0' pp)q ap *(@0T p!(! * * F(Ѝzd@hd yAAp0S/@-l0@ 0P 0 .P0p0ЍHB@-`DM@ePP `& l0 00S p0StP Fp0pS0l0@0 0p0,pP$00004`P0tpt0(DЍ00@-0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PhZ0L$PBU 0PZPp p@ 50 p@3|f~f_e_eA- pM`PHZ| 0R( p@T1 00S 0E0C@S@1T( T@# 00S0 SphcZ M@LZT W 0UZ#@Ѝ@P JZ_e@_ep@-@T P,0,h0Y p@-QU@`PpV 01p`U 1S 0 He>A-P0QppU@`P `U1S0 V He>G-pMS`f@Q03/ЍG@Q 00000 ` 0PЍ1 G@\ 1Q  013/ Pq181@c@6-1R001@ 1S ; @ 1S/ 4@-(0@tQ 0 @@cHe>1 2/ :O-P@|80 S2Ԁ<0t`̠Wʀ ! , !8!<` U@PL0S p0HP3L0U \LP p@PmU@ 8gU<0 3/UPNd@cOdOd@-@) 0<0@cp@-@P 5/p@ @c {NdL|NdA-0@SP T`L0S50S  0 (U 0S xp`W 0< n0<   03/ \80 \!AS] OdNd@cOdS@@T`臁 13/ pPhe`geG-p0 @0 0 P  (`,(0, 0/X(0, 0Q S000C00Ѝ 0$ 0 0$ P@  13/P pV 0 &P`A>A-@Px`K@pPEPJEM804P"8%< 40R:ALpp@-@Px`KH0,PU< 40R*p@Kp@-@Px`K0Pp@KA-`@xPpK? 00+0`@`PPPEP0pE8AK//\00S /@-X <!t  L  R0S Xc@-mK@K`_eO-PP@QP1 ! !1@11/ qQaPP0P00@004`gePheOd@OdJd@cc`_eXcA-`ph M@PP L0 0H00D0@0@0 0<008000y Ѝ@iep@-P`I\0(BTp@DI1801II10C1@`_eXcd_ep@-1@P  13/p@C-@p000`PU0ěY <P1P0  $00 $0 Ѝ P0RP Q  (0, 0(000/, 000P`_e`Ap@-0@0S00S)3  P`01!000C00aP0A!400C40p@0 2JdJdOd@Od@c6A-d0@S h3/00P x`pIPЍ00dPpQ <04S I0S   0— E R :@H B, R:0CP }Xcp@-@`PH0 ;SR 0@0<Q ;T0T0T0H`8HT040CT0HU@pT`_eXcd_e@-A-@H1S0/R 0,2/ HxP7oH00HpFoNPU Q 00Q 00=U 0VA`_eXc`A0je@-@@@iedh /l~I//A-Pp@`ᘀ010 R BT1P000 0 0 Ѝ P   0P P@cA-t0@@Pp X0 0 `ሀ010 \ *! Pp0 0 0 A \ 1:0 SP@cG-<1@PY`10S 00 1 8 000pW2 V`P 0V00  TPZ y T T00T00S Z oTrpW <003/YЍGkpЍc(kedmdc @-kG 0 ,kec00S/gGꌈc,ke00S/Gꌈc,kep@-P<YG[@@ 1 @T R1@Gpc@-@P DG@Rc@- 0@ (keO-`0A?oR20LMS$00$00 00pP?o2 00 000%PPppP  0@p 9RFR< RE$0S0`803/LЍ0[00 V 0 V03S000  +p X6R @( g 00P 0 0p@l  BR  D B6R P0 GW p@ R b @ *Q  !0@ P K  0 B  0 @ Rz@@@ lR @   @LLP0000 p00@" 00PQ0-ppZ[S S G000 0h0SQ000HBN  P  P @AP@  00PZp0P P P0@ P5 0x0@0Zp0p RZ  KGG00CZ W0P|4XZE P @Zʟ p0 R0 00 40(00 0C W [V 0 V03Sp(0 S0 pC 0p0JZ0Z0 @ C Y[V 0 V03S@I@  00PpZ0G5P|P  00PP0@ "P P P0@  0c0  I P0I*0IWG 0 0!0h0L[ V V 3R  0CSi   ,09,0  3ig [Vc 0 V03S] 00  Q R`0`0FP 0   [ V 0 V03S000pGW> 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    +ꌈcBBjBBB-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/ _e-@-T031[  1 0S 00 00 ZЍЍ/@c-@-T031[  1 0S 00 00 @ЍЍ/@c-@-0 0001Ѝ Ѝ/s@-P@`0 `"Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@(ke@-@P`00 `TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <!1 @P >`Ѝ  00 U00S`C 0S. z,@T@p T @@Δ 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 BcgfffB@-< 0 0 0,0; }@ (keB t@-@@-?@-@P0 @ @ @800S @ @,Ѝ0@ Ѝ/ _e0Q   BB@-`@P 0 P000S   Ѝp _e-?@-@P@P 0  000Ѝ0@ Ѝ/ 0S LP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@Md0 4 0 000 [Ѝ@ Ѝ/B@-P`|10S A3S  ltPT #T212@00@00A0S<$10SA0 00S 0 0Q000 Z#p0 Pb 0 pp0 0S `0` 0Q01Y]P/0 `@vc@c8ke(kec_e_ea0BDke$B'BB-@-`00/s@-@P`T 0 ,@J0 `Ѝp@4DeB-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 `$00S Ѝ@ Ѝ4DeB(ke-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`BT 0 ,@0 `kЍp@94DeB-@-  ЍЍ/-@-00f Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0  0SЍA4Ѝ4De(keB)B-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p$00S Ѝ@ Ѝ4DeB(ke-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_@<A@(p@01 010101/A-a(P!R Ap@1!#880Ro@$1 q0$12020YiA@@-`R( q@_@T0  (0!R@D!!!R Ѝ@@A@@ }iP t@@ Ѝ0 00jP X@Odp00S/@-`0`@0S@0D 0 @0D E@@0D 0 @0D @{@(keJdOd|0P-  !T LD.!      /@cdddl 0CS@-T0 !< 04 ,   !/@cCBddd@-~P 0P@cp@-X4 0P@T4OoBPp@c$0 0!0 00 /@cddd@-<0DT 0 !0  !@c0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@A t?Pp@-@h? j@00/A-@Pp` >00$0@p#0 GA@cA-P@`wp '0S00  0S00 -x0SAA-@PpY` 00@000#0 A[@c0@-P@`xpM00Q ` 0 T4 0S0Ѝ> 2?[JdT6?/0 0 1PS/ /@-r @>00@-BG-@Rᜐ> PU``1S `VN PQ pq F D0 P00>`6p@-@P>0S` p@>0U* `V 0a@-@@ {>p@-`Px>@Tp00u>`0S   0S>p@ s`p@-@`PW>@T 0S@A @>pP/0S /O-p`P:>0S R 1 ЍOl>j>)>@X:c> 10@>@T R AM>K>  ЍO R !  R   .>,>T  ЍB@- M@  0 R0 00CS0 R=9 = 0 Ѝ@- M@ 0 0S 0  AQ0S00  00 Ѝʚ;@- M@ ᨎ0 0S 0  AQ0S00  00u Ѝʚ;p@-P@P@ᆎp@-PM@ ~0 `\0` p^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00,ʚ;A-qP M3 B1=T t13AT \g=@ ЍH@=000 ^T=R=0 000@0 0@P! /00B! 0㨀!!3Ba<T -P)=p@ ^"=! @ 00P P@ᴍHc@cʚ;@-P@ 0 00   `pP10e 6 0S0  @P0S0 0  00Ѝpɚ;ʚ;C-@` 0M0RPЍ0 QPP pYP  R0 AQ@XPP0 00S2TP Ѝ000 @ 00@- X( b0A*(P Ѝ䨈c@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@P}3 X0P4 R0 40 Q Ѝ0@a0U -,^ :!!<  12QX0 0(ꨈcX 0 p@-@PB3`Qp@{31S.A-@pP`-30 00@b3ЍO-s,M@0`PVP`$ 0+t3B 3 3  2404#C8("<pXw/ 0C0CVp40 2p8<000Td0av@PY `|h 2d0H0> T`X` 00J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,Q1011410Q&3*`5WpF&8!U. P0`Pd PR0 ީ 0 PSD d0 $SP= F@,Ѝ`QH  B(`z`1QES 0 @APi h00<  W0O< @@ Q ? P q`F pఃd0 lLB2( @,0,@SI$1((0(1v2ꨈcle(teB7t7BmeԈcA-@p0 M`00P 00 0p0@N0 00  0|0p0@0 \0\ &P(X00@0 p0P0 ? Ѝ le7BH7>1=1cEc-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-iB00@-M00|0|@| 0x00c00PP X R} 8ԓ40 0 Ѝ0@蒓pAle7BB 7Ec,,00 C#' ,00/JdEc00 Q0000$  B',#  /@cEcA-@PM` pJ10 0 0! 0?P W 0  \ \0P  PP ,1Ѝ$ 0  0 P^B%7dBp@-P@1 PT1YA-@P1t0 3R 0SP` p!VU A71S0@cG-0P3x0@ i0p `V 00 01`03/V00 0 0 Hd@c@-@G@Q@cs@-0PQ0 7 0@S 00 `0ЂЄ 0S 004 @Ѝp@ *@c(%7O-0Pp,0 `0@ `F`! P Q(0P@0 0 PP PUP@Ec@cp@-P@J0000PPp@0/A-<0P@0S 00 `p06/,0 0$ 0 0$  $0RP@Pd@cDPdHc@-L@L03/@ 0`0d 0 RS`0d D@=0@PdPdA-`pP/@"^\Up `0 0 P0 @0 00UAT0Dp0 000  0@Pd@cDPd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd0@S@-70 /gBA-@q`@T;0 (左 b/1Q0 @⩦ @T/D f f  f f  0EP}00 0Ev00\0 0L0000040Ѝ$c@PdwBB}BT)7BB(7\00S/QA-H@H@`PQ /p"R0:AC/JdPd@Pd 0h 1g@PdG-pP.|@X\`&V\U0 X0LL0PTp/P 0`XPh0\`/uPd@PdJdC-`0@0PSX 4/X  Ѝ|0#2q12`03"p'qrX Ġ 0 0  ЍCJd@c0@- @r(7G-P ` @R 0Y 4/Y p0#2q12T03"p'qrY Ġ   Gc GYJd@cp@-@PO.000CS00.p@Op@.p@-`xMV 0@S x P ~000(`(0.. ^g.xЍpcC-M 0`p` @对P0 P 00 00 0 0@t?o2P0S RR! %*Ѝ(cC-M 0`p` @P0 P  00 00 0 0@t?o2P0S RR Ѝ(cP  0R://O-0 ,p`@\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 00@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 R00 00 R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`*@*(lp@+p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4MI* 0SPX *`%ꔰ[Y( ₡@`@P  (@`$ *0 0`P ( Y*4Ѝ@A$@(`&Rl00& 0T0C 0Q `*h 0l0P$0hP P0$05* @)00 -*l PU T`h0Ss`P@$`(Pp@-@ $)P0P@ P00P0]@PpO-pP`$)@T @)T ) )00)0pF ),4Vp) ЍG-@Q8@T80S <`)P@0U:)@8080D0@0t)o)GL80兑P p W 80 0   Pp@-PL@y 0D0<8@0 <?)08 8  0 S  1)7)80S q)p8@j)A-@`P$p#)h`0l0@h00 00 00Q0U)p@-@$P`) @TH)p(0S H0S>)p$P ($0S1)@H R*)h07@-P @P@P 80S)@ Ѝ0<00)18P /p@-0P@ PP00_ p@(LB@-@W(@E @- @(0 0003A-`@p( 0S P %00 00(A(QU q(00CS0(`(@-@o(X(@d(@-@TP 0T0 @)ee0@-p0 0mPP@`TV P Ѝ80S z(V P@00TP TP0 <0@ 80e(V  ee18P /O-pp3TM`3@ QP00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0QP @@ ^   Hp p'X L尵T`P@% `P80S '00 000'T`- @p`~D0<'80!0S0 80R1``80a8000'v'$ 1 P 0R,:' 0  @#T 0T0)W W  'T0T0TC0|' 8'0Y00000n'1@cee(c0SS  S/@- @P1@8@- @P1@8p@-P`& 0SS 0 000p@)'0AT &0S 00 0\00CS0'`'@-@&0TP0s0XT0'L$@z@- @   0 03/@P0W0>   L@ `3V0 0,Q * Q :&@  0  @001 001 000    a   h@u#000 S 0/ 00C 2 0 0 00 3/@PW 0  "  00 0 0 3/@P 00 3/@0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  {(0`S10 0ᕏP@0+%P@g 0 03/0 0 0 0 00 @BEc~f}f3{f@|f@-@}P p p@-@Pp0P @ 003/@@p@-@M P KЍp@-`@Q0P @ 040S-@  3/@p@-$M<@P @, 00`V-@% 0 10 !0S! S S@ 1" 000 00p q/ 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  MnP0000Ѝ7@-@P @nP KP Ѝ0@-"0`p SB@ pP P`0 @  O-@oopb W T0!03SP (0S0P ap(0SY @ 1!H  @@R PU @rP-dM"h0 (00@#0 00 ,8dЍg7A-0P`p@0 TЍ@- #0@-G-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;0 ЍO-`0#MPܰ" 0$0P @Ѝ(0SppW @P (0S0pWpWpW @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 -P@x  @q0  @P @g0  @PJP ([1 01  010 0PPQ`0 @ @ Tg7Ep@-0PS@`M  =HP0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqP  (0S[X\00X0 00 ` _X 0 .  0#[ BO-0p IR@4M, [P  G@P!@T  G@P @  R @0` @P "H@ A4Ѝ?@-@p0t 0 0x0 @p@-d0d@P&r"0@3@#Vpp@-d0d@Pyh0l (00, @@Vpp0p@-Q@ 1CQ 1CQ pP\h0l 00010p00f@p@-d0@P0S S p80`h0pP<yvp0@`BBp@-@d0P*@ip@cp@-@d0P]p@Wp@-P@P ,@*pp@-@P` F&'00F= 00'`P000@0 pp@-P@A` h0l 0H0` &r0`3:0@p@cG-0SP'@  pܢPP srF h0l Y^:0 h0l n$AЍX#x0S `P000p0t 0 p0t (p0t `0Sp0x0 t S PP #`PA-0SP-@ `Vphl 0 y0S 0Q h0ln $@z  dPX!x0S PlЍp0t 0 p0t p0t P0Sp0x0 t S PP #PO-50S`5 P0`P-00p嬰 0 0(0 @ @H @00y0hl`n%+  @ 0300 ЍB@c0 0R0,00 0 0/s@-P`00@t  #NPЍpp@-P@L`U<<P@P PPP@ @pQdQdQds@-@`00P EMPЍpQ@-@ @ 㿓O-`pP(@T 0(  Y d$Z  @ IPW(@ X G$[  @T 0( k p,0H0@0,0lPPj@-@nP@oЍ0P :0Q:///0/P$ Qp@-$PP $@*p@0/P$ Qp@-$Pp@%P $@*A-@`00PUE4UP@ 0S 0Sz00T5 0`8P40S$p(PU )PB88@ЍA$B ELPЍQdQdQdA-P0\!Qp# `!0  PP  PP0S Ѝ@@P P0 0$pPA 0=804P(Pt,0<0S``aT0`0 sPP`(iU0S G@cBQdQdQdO-STM@xp|N `PP#@E W 0S@P;0  00 0  R0 0200p f@P(P ,H4@L@$  P  #@P ,lTЍ,048@<0P80,0 @`H@TK 4@TH VWm k`P0  RS> QQ< <`4@0p40S@  @004PD00$L0}u@0SD  D 040S8d@T0@P0S 0AQ 0S 0 7P 2 ,#P`,`ɚ;6eĜBʚ;u0@-@M0@d QP#!0  ᏃP@   k@ T@Ѝ0@cA-PR  p@P `VP $0 p|P/(0PЍ@P/@-MP@`)P V0 ! 000Ѝ"RS+ P `V $pP2U0!0P  RR   *P2U0!ПP!SSp@- (z 0 @PX p@TQdBpQdO-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO10P ,ЍO;0P 0 $07JY )P@/ [, $ @P&$P Y 0 0 0` ($`P : P 6,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P @Pa0+ S0&%&b"x1Y, 0 $0@PM$ 0RXP 0 00(P[2 *"*kA 0 BQ    "A0C?o2S0S0S000  P S00S00S sPP IPN@HtBBBB0@- 0@SP$M  PAP 0 P     $Ѝ0 0 R  //p@-`Q0@0 Q)9Pap00[p 0@-@ 0P  *BP $BЍC-@$MP AP 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V PPPXX V  B@BB@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @PP0P&4Ѝ@cWe@-P@`AP 0 Ѝp0 ` O-R@|M 'PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@ź` /@@P V Ṻ 8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @0Pv (( R LP0PP _ \@@cWe0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0h3 FP 0PED00S 0 @OX0P4Ѝ@ccWe@-P@`3P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@᷹`  !?@P V ᬹ8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 @F (0X0B 0 R  @OY (( R LP0OP B ?@@cWec0@-0 0I ЍO-1PMp0bP P @@ P @fPP# Y I " R 0 N!TH  T"0 S>  0 03/PZ  ᷸Q@f [ $/ X  P 5/PP [ $/ ? P R 0 BN  ց0 S @㶁 0 0@ȁub xz/  A$4` 0 , $(    TIf rdAedAedAWe}f~fg~TBG-pM7 P D0` SP 0 嵔 Ǚ@,ᜁ)Ѝ>    7@P  07 000LxP8'7 {(P0S6  S1#U S1 #0 L⤺P  7@P0@7 Lp@P  7 O0 @L↺Pd h@PU @4UP0 oAP @HJdB@cBB00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0@c/p@-P@X ㌷pG- P @`$pX X X@(0WPP@ 0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0 \@#dRЍlpp~Np@W02: 0 @  01/@A-@`Pp~ 0@G-pP@`l S!@"0R  2  00@ 0@/U0"(0  ,0`$0 @A-@`pP> ჊:= 2`p0#΅"^0@@WA-QPp Q! Q`+j`@2` R`   Q`02-@20$C-Pp`2  Ѝ S @ R0P0@A`0 00r[(0 #c 0R P A-`Pp S@"@Q  0" R0Q@H0 00?[ 0@ "cЍG-`VP:Pp  @ U՚ 0 @PP$!c2 02PP 0 ( h @  &aI R 400ЍW ȵBBG-` R P0S0R@9@ 㳵0+P@@P)V  U @$Pᢵ0p ?@@P{P`@ P0 qZ@ /pW ჵဵO-0TMp$00S00 0:`P#`TЍ0 0@`P0?  0:`P003 ``3 1P00hC p$`W[3pWb 840`op@⫲W[<3pW4@T0,0 T 1 #0p$, ;,0 @Tp00P00S Z 1 !, ;,0` T00P00S U 1, };` VP P 04Pm;{0`$`P PPp0`$`P PPp  bj R<  <` EYj`` P  R , ("( $ , 0 0@@00 0$0000pu  6j R<  <` E-j`` P  R , (( $ , 0 0@@00 0$00pOxP@t7P 0 03/`?NV`J`N``g.B@cxcxcc8B B @-00S/A-@P`p 00P0000 0n?@r?v_` A-P@pA` $0SH0( ` $ 0R`0P @cp@-P80@T ,P\pAQd0O-T"DM`!p <4B 00 0,p(`$  @P< [ 0! 00< 0 <00,p(`$  `Z<0 Sc 0'a!<0 ` 0 0,(p$ Z0 00<!0 0  0,(p$ Z0 00<!)0 0  0,(p$ Z 0 00<!80 0  0,(p$ Z 0`F@!  0,(p$ ` @< ZDЍ DB0c QN 0 Rdp@-@PBoPPUP 9( P ?=p@z+ R00 A-\0P3`q00CS@@0$B@T <C|@cA-@` 0p =PP ЍY@P` 0 PP 0`P  `PղP1S!!1! PU020( l P h aRdp@-@PM TP0QPP+0@@@MT& QP`@@ @@@`0  ,xP0 @@mQ PT`L0Ѝp800@0BQdBEcRd7ep@-@P`0P ( R r pU  @@p@-pPPM @P @  7@P0S00C>S@0`S@ 0S@ x'105Ѝ0@-@M P  P  8Ѝ0@-PM m7@P  p@P @p0`S  0W000Q  d8@ЍO-@$M 0Hp̱0` i<PP ñVPP<@ᒢ3 Pz@P  & (  , ^ R !W$  RR R0R Pz㊱@  @80j/ 0R( P 0W`0" k1 00 0 100̽Ͻ嬡@ VpP= @   P $D1 00? 0@0 4<00000 P Py0 00  pL0 T# $Ѝ0S@ P^vo^`rτn0X@Sk/1!p @@PFV00c BP BY Bo QdRd0p@-P @`M P  L6PAЍp/G- p0`^PP PK@nj^ 0 Sj$0SD `V10 c /o 0b4 baQ  S  !R!0C31$00C$0 PE > U 40  7?oW20SP   7P)ЍV   09P P` `0 200"20 #P<#(P@- 0000@uP 00Ѝ0@-@PP$M  5P 0 _P 00$Ѝ0O- 3P MⰰR`)0S: S: Y`  @ 5`P 2 > P `P  `Ѝ r]U(`; p 0S:$ 0REXc00 40h!  @ 1@1181$0 SfPU `x0S P x x|0 00$0080匰$00$0 A(b Z VU   <L [ 0d P `P   P0 #R< # 0S000@@ P0 0  @@P(`(`l0cRdc0@-00 Ѝ@-@PM  4PЍp@-`0SA 1X03/5H0HSp< 5H0HS p@  !p@ =@ccC-$M@`p]PP @ \0 0@0 0h00<0p `0000@0@P ]$Ѝ| Bк7A-`AMp 1PT i4@P*0@& (=@P! 0  0c? 0  0@P B_5@TYЍˮ@-10/10/G-Qp /`PW @hW0S P0 sG @@P P @7 P P0P@@G R H@p@-PA PP p*? pp@-@Q @P @pP0$P R !@ @@s@-@Pa 0 @ TQ  4@Ѝp@-p|M?WP$x AP` ˁ00`0p 0}0$Xp0v t pPP W 8P |Ѝcp@-@aPZ 1S s@T 0S 0QU00001501 0S pw PPO-03pP@`ᄠT nP 0 S ? S @ 0SwPP02P0q@c BC-p`$MRP0P P0CIP0 4P0W%@ RP0 0  0E@P $Ѝ0( ?0 ` @p@ #P U<@ @U  @c B@-`@V  2PP  ` 0S  PQ Ѝp jP P0 3\C-@MT;0 p0I S@#* aV PP {2@P U Ѝ 5@A-p@Wq0P 7@P ?T0003aN ^@P  ۬@֬$q$Qu W@Ƭ@c@-0P@3UQa# 3PP[ Ѝpl$Q  @bxL  0R # W7@c@-0S@}P 3ЍG-pW@ PP F0`0S j [@P0S Um@/p@-@1P 0c\ iX$ Q$180p`p@-`R" 0P1S 0@S PpP0  00pp////// B 0@Ps //Q 0S P 40 P0@1S///eA-@Xt03@`P |0S 0 R0`hCd0P0U TpHz0ADͫ0Q00C0 R0 QJd@ccceO-0@pPDM(0( <00,p$@ @@ @`<@R<0S% 0 00< 00000'>0,0(p$@ @RT0P0000,(p$@ @ @P< RDЍ Be$707A-@pP k0 P`㨀0 V:T` V 11@`NPЍ0`1S 0 + ` BJde BC-M 0@p` P*$a0 P 00 000 0PBN?o2P0S@.0S@*VPPU@$ @kpU*0!R0X H@P@$ @#PЍeJd@-808@ P 3Ӫ  @Ece7 B0@-M 000 00 0p׹@P@,P 0R 㰪`0 S |Oᤪ @ R \@0`80= @1@P ЍeJd@-0 000 0 000@ᕹPЍ@Ѝ0C-Mp0 000p0 0}PQaV  0RI@P0P X@ЍwP w3pU W @0U@PU0pPpU#Q  0@0S P 剨P dT@ Q0S 2, Q@cJdcc@0G-M 00 00 0`P@ hJpP L@Ѝx4143P@刀60S S@ u`q tp P@a_TQ  60@u`L@@@ |PUDY W 1S O0ሀ0,QJd@cc0"!S/ 00/P /A-L0C@1S`H1P@ATA p~r`@@c00@-0BRUbPEQᆢBDU"XOW[YgP @Pa X g I-0Pe Z  0ѧ0XWYPELD  /-0P 7P 0  "-0P *P  -0P P   -0PT P   ,0PrT P   ,0PdT P  %{W < ,0PY 7  ,0P0 01 0 100/oX" R0  -0/oW" R  -0/oY" R_  ᕰ -0X z  z@c Bp@-P@U`0M  ,PPP  ,P P 000Ѝp@-@PP4M  l,P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V P˦P 6,@P81 00H@P >-@ U ᱦEߍ@c< B@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  +PP P  +P0(ЍpE/08!PR/p@-SP@HaoP@10D1@A `0p 0 pO-0`SP Q0S 0@Q @280SP81^0S \8@0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00_   0 9UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍOX @ PRd BA-`唀p?`@T|@0C0P@PEP7 0 F0 f021@& 0@@ARdEc@-@( -y@p@-@0Sp 0P R @1S0@1  0S0000p@@-0M?SU1p`0@SPT:4U `P Z@@D@ V@@ S @Ѝ$`圱V00S @@0` 00?@P@T /@Tt T T 0 d0 Ѝ@00@cp@-@xMP` x x` ]*P0 xЍpp@-P@xM`x x001`0 0A0$ uxЍpp@-@PaM. wx, .f. A+ލp0p@-MaP. *@P 0@  .@IT@ލpO-A$M>ZL`0R00pPA 0V4U 0S31@0b *x " oh H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 W-W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[LH1H0S ,1 F[0(0[0믳H0SP2 w2 020Ë00008`1 01 1R 0  0[-P jP0 4P0 xPK0S f,$ЍP[H0 $AceA Bcc0@-P@Pi( ,0  4!0 0p@k@-@  B)Ѝp@-a@P0cτT1m|0 !! !! ! 101B,P QP04P0_p@2cp@-@QT1S (,P 7P04P0Ep@TcτmOQ@- 0 =P K B0@-PMP @ 'P0S Ѝ0A-`q@PV 0! ! ! U 0  1 @ 0 S @3:0 ! !01@0@-P@PM ~'P0S  R PQ (Ѝ0O-`V@p MF 03/PPO }PPK =`P0 0`0S``LOV 8/PP5h2X!@0 X!\! \!`! `! d10d1` ku  0* P VQo@00Wu 0gy*PVB#PЍp1ZS^/x1|! 0A|1 ˳p1S 0p1x1PS|!|!|1x!  V7 xX4 N 0 $0S 0( $ BR( %0Sk) , 0$( 0Q0 @R 0S0h000Q 03/PPPX` 0@3/P Pcʚ;@-00Ѝ s@-@`P Z@T AЍp Bp@-P@ B B poP h0T @DT p0PpO-M0s 0Spe0@SbP@ @PPhy Ѝ4HqL0 l(13Q&00|@0T 0S 1 S2iwh0Y00S rEZx` h0Yp` S` p`Y`F 0 `P妯P ThMAc@c@- @ %P0~ЍC-`0PCMJp@PP ѭ0 0001 00sPP 1Ѝph10IS HWV@-@ 0 P  &PQ  &Ѝ0G-M p 0@PM؁}XP 偞P 00S@00S j`P x@$P!PYDL0 @aM0` 000 0@P|p |zU P ЍZ 1 S| 0S qW]YP ٝU ӝPPr@cJdcA-0MS90PS5 f@P`P@p @@@1 00㝮P 1@᠝Ѝ,Q ˝:1  姝@굝@p@-P@`u 0SP S00C00 xP|PU x0sP 0C0Pp?U p0PS ʀ000h0S x0UP@-;M-0`P |D!DA@M!0 00`,P($  @pp@-P@P ;Pp:p@-@P .r9000,03/@pp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@yP1QB 1CQ [?0Q Pp@g{ 1R::1Ppn!0Q 0 0!0000\0S: R :SP0C BS000DKP s@ Bs@Dc@c~f s@-@R0 0 0h0弰@Rp@-d0T@`}R0\,0(@P@UwRp0Q/p@-t0@QP d0QcR\0S0010_Rp R0*UR0\0pp~fTf@p@-PU @d0`(0p`h0@Rp/?Rpp Bp@-@d0P2Rp#p@0Rp@-P@P(RrUUhwpfpA-@Pp  qR\00tp00@`0R00F= 00'`PP婩嬩 @-0 @0 hp$@A\  \ R/ A-0SP(@ `Qhp\ 0R$S$X#P0S0 0 0 0 P0S00 S PPQЍP S QWP\0 JQ  u~Pdp@-A@ PQ\0S`V0p@[Qp@cO-50S8QpP Q1 O@P)00夰 0 0(0 婜`@hⰮp#HJXQWKK0 rTSQ%+  `(0300 Ѝ@ B@c0p@-@PᶷP D0R ሷp`(QU'Q~p p B@- M0@ P " ЍO-P4M`UXp޼PڼP yP  81R J 4Ѝ@PW =U8H0L 0P0S XX0 S'IH0 L0 H0P L RP 0 H0LP ?Tp 0\0X0SPP0PIPcI Bɚ;6e@-@LM`p N!P P0U(P~?oU20S  S"LЍ B 0  @o/p@-dPp@d!| 00C/(0, | 1R@0@@1B @@VIpeQQ03 0# 1Q10C2q0Cq0CQ0C0C3+C? R0//p@-@pP%p@ep@-@pPp@eO-M0(0P`p` @\\$ X $  Oo0y>BP@T$ЍOЍHc-@-0 000kЍ Ѝ/ B 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddddee@- Pe@-@(U080ԭ(ҭ@eⷋs@-Pn10@T H>‹P4弭(Ѝp@s D(PЍpe eA-<1P@$"000000D1hPWPUP U D1 _```fh !`F000000000UD!000000D13 !_ 0? R(  U P D00000 h1P  U  _?0S00hPS0C 0S S! $0d < L0 ܯ< L1 S0AL05q$0dL0X <į0S@ BD?eQx B B@BH'h B B/ BL B Bu B Bl B1 |0Q@-@0_O0i BG-MqPUЍ0`AT0AT( 0d@Oo@@d D12 1"!10CS1!1R10!1 T䠕 V. V1 V# ]`V00d@Oo @d0D00 0 lA Y   #Y Z Z P #ceHcp@-Z`@`0@1B @ V @UFpep@-@ 0 cOPP <0<1Pp0SppQ èꮨe BA-pP`W@ P0@S@@@V(` @0 0000@P0C00@1B  @e0 @-#PO-`@pᄡpS|M 0@!B @ < |Ѝ0< #" (120!Q/[0, R) D!& $? P 1 0S Fvla #TYH2[ _?0WP ` D1 |0 S7W) v` dVd`#wPp%`WN<1) ?0X!JW#0PN|J `D1pG|0 S?|0 ` S)5Q0`h 0  0A000 pG000/P0 0D1|0 S0<: =e@ccEc Bp@-0 0 00`,(P$  Pp;(0 0 0!?0 0 04`0P,(P$ ;1 0 00!? 0 0 04`0,(P$ n;000X1 00 00!*>0 0 04`,(P$ W;1 80 00!?0 00 04`,(P$ A; 0!?0 0 800`,(P$  Pp,;h0 00!X0+N@0'> 0 ,`($ @<08 ;DЍe B088HcX 8- B 1011 S!1 0 !q 0$)Hcep@-@PX0U00 00@1B  GpCPe@-@$?0  (@up@-@P LQ 86Q 1 _? = 0>;0p0<0~|Q hM$p@p@-@P 0! `c/0000`0001S 0V (vpAedmdc eA-P`p0| @@ @@1B  lAT 4/0 y#P@P ep@-@0P#PP@ bm pEce@- @$S^eG-DaP@ 88$ 0 4 0 T 4 T ( ,8q U( ,1:00%<$ P - 8 < 8 $ < $  R P @u r oU <0SPTeHb P @14 0 LS 0000?Y$0!D1  L0S81  UP h:P000@1 t1S 3/P0000  P , 9\0+4 V1SSQ   ^li090@W1SSQ D15 0L s yD15D1;6RH L1 S S RP N1SSQ1 e P P p\ p0U P P  l p0D P P V  "@ Z1 S S R ,L 00 S   | 1R"Dy  PX^ U_ H1S I1S J1S* ( U& 0 08C0  :/0H1 S S R  P PEUP#U PE0 S = e B@1  p@-P@$Lp/e@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`PpA@@ | 1R@ 0@1B @ TPT Q X @ep@-T@p`<?P,00(@@UpeO-0DM S @0 Pp#48@3@(00vD h1 Q/[ , S) d4/P[01 0S4`DЍO G3`Vp<0Ya00VX0FS[`0#4 0=0 0PS!RRQ   R V`0# 0 # ?0cR81  TP hv P000@1 t1S 3/P000+"Q8 SQY0=@0T0R@2 @A0.@!B +@)  `qQ =!008  R(00C?2cO 0@CdB$@FSzYL0S800q0)T0S 0  8#`?0 `X1S#V V#VH /S0`PhC0CU P<U D<U50 B <Q ]k0CQ$0CQ;0S 軟3!1PS ;U;U0CU;+0S00;U %40cS KS V0CSX{T 4P 0 :/zC { P 0  9//:Q ::0S[  S 1 0S [0 P X M @ E4:P | Ѝ:0AUE 9UPu *1 0R6[03 PP9U9088 0;b9U 0CU 0UiD 10S 0RS&9U 90SQ9U( 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0Pz k\8U >0Uu >C0CU 0R000U(U d7Un70 S' S007U& |7U0Y_ v{P4   u I+,70Sd70S  P;H7Ut0pp1S 3/P  L\p8,T|00O0| 0CI0;PUPP@KXvX90 0Z - RT 0H0HS ]PP  0D @0D 0P+H)cP w]U!,婝,^k]Z@U T ЍO, Nt%0S ! S +[0 0S00c0 1 0R[0 0S00\1 0S[  $0|00@1$0\1(0S`1 yd,4U D1 "    2D10D!810 R<1 0;; 0D!"0D1 (t 8P D12D100FNx Pttf0D!  %<D!0% Q}[z   Q0(03/tD0<0?wP wuoP7 100100@[00[0xfCP#0S ! S-[0* UUpRePP 1 0RPPQ<0 51?P0S ЍOvSF$!UЍO! Petrtht@t0^t et,@Bt @ut@cf@^ Bt@cJBcTBCt gtcEcvtt nt ot st@jt@wt@HtH~ftn Bt,dmd$e=Bp@-@P0U R  @  @1B  N0pR00|PeH/H!/81 - p@-U1@ C/oS" R 0\ <0 rP 03/pT1 S S R 0<0l1S (Hl13/#/#pe/p@-P,0@TpqP @`c/@-@P%D0@PP  80P  R 00 0Redcp@-PP L0@T 0S 408 CTT 00 0:p@e`cc@-@P($08 CTT 00C 0@$ecA-@9oP/pPP` +qPa00|0p @R 0PQ 00400S  R  0?eB`c@-$PP VdcBcB@-@XT08 CTT 0S 00S   ec/dc 8080 1l1S 0 0//ԉc 8080 1l1S 040//ԉc 0 601/ԉcp@-PT T0 601@0003/(50lQ00npԉceA-pt`P"@@@ @L0 @ S@P0/@(0,   AR SD1 WBP00Ce0 /@-P0 @"6 0<  $0000P0*@gԉcp@-@Q@ x0`"6 0h Q0000X00X0 0$ 0Jp$p@AԉcG-0hMS~ 1P!0 & q`됀@@,   XY 0X0 1j@P@  ,Q,#NjhЍ YY 0DY0 hЍGj|0S  @ Z;%@P   i@bT0@@ @hpdRd #A@Px yj@\IT0@@ 0R0T0S.@#@@ԉceO-p@`x2Pt"0tM & 000L @  I L Rh00 4 Xr 0W#000  ` @P R8m XyLPTdRd #AQ@!@1l$  jPOL @000(CT GT p RdR@1d@#  iP. @ `D!L"$ L\ "P R (*d ( 2/H@D8K(Zr 000 tЍԉceG-PH!D1 60q0`|A@ 0@ # | R    X0S  Y0S@ 0@  L0  S  0@ T@  BQSD1  @T Q cY 0^@tԉcep@-@p p0 601 R R p@ Ph p04W Tp 0Pԉc4BeHBp@-@pP0Ep@?ep@-@pP9p@3eA-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @ኺ@Wep@-d0PQ0A TT 0SlA@OoBU $p@T@ԉcHeA-q`0S3@ThJ0VT@ PQ,0TS@   R P!o0@@ 01S`@0PjhhN01S Pb``ֆw0Avԉc\BHeA-P0` VP@P@ x0x0qP!l1S X[@H0@`l1̀R0003/D1;D1@EԉceQ8Qp@-4Pp@$0S@@4pԉcHe@-@ $T@ {0Heԉc,sr/p@-Pl0@"6 0\ \ a $L 0$0Dp@ԉceA-`A0` F@PpPP840101@0@$le 1810<10D1K<@1=`1\1Dl1S000( 0 03/P @ 0qP \PЍ00   b0PP0C0 eԉc+p@-PP0 601P003/@@dpԉcO-쑟p3`!1 ر 60P@ @` -1 Q$ L0S1 8pL0SP@T:L`pZV#51 0S [ R@P C [  S P 5@< .#@ X@%T @|tf@dT L0S8@l1S 0 03/@@cԉcEceG-`,$(4 6 0Q4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;mP h3R `3Vl 9>C1CV %@3Vm 0 $p 07/pp{ 0 $ppr0o 2 Rk0S Y`v2V, 1\0CVMh||2V" 0CV 0TR 0 008C0r,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>SxD1S 0 008|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0ԉc`t\8ft_t u wt@ept tttut 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-`@PU VBP0P0 0`p@-@P ރP 0SBՃ000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP k0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0SM  0000`P  BR1 " 0010 0000S000p,BO-`QI@p0 S> S 0S4 000 0R*PP P%PEUP j R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [ DB0PQP/@P - Q^00@S0\3Le X0P/-0^  0CS0\3 Lep@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P /@c-[  \ Γ@- @ [0  P p Q  Q\K1P!  S[ @ [ @~@茓@@at cp@-`d0@31[  10 PU 8|0  @*p@@cp@-`d0@31[  10 PU 8]0 @ p@@cp@-0@1[  10 PU 0@ B@p@O-DM0P0<0p`<@ @00<0,(p$P PP P`(*<@0 0 0<4,(p$P PP P@`x(DЍPeB7@-@00P000U  Ѝ0@& Ѝ0@-@H$0S 40 S   0 PeA-Pᔀ Me@T gP$q\TPP` e  {6 p0S Ѝ@cPeBxc0S/Äc "2 2" 2" 2" -8pᮙTPU000 W >0 =00 =C00Ks 0 0  )0 0 H)00P0001P0100 )00 *0)00 0z)00 +0s)p,͛0S 02'$ pc@c@c@-8.=0+=0$ ;=@0 5=XeeP}8|8p@-` P00P0T0@Tp@D0D.=P0SX@$0S 3/,PXecEcep@-h T00T0\0@Tp@L0L 0?0c =P0SX@ 0S 3/,PXecEcgfff0p@-X00@ X  $Rx01X0S 3/P0S P 0S00@ 08 04 0c0p0S 3/,PcXeeee eO-LMD@pl 0R!  0 00,@(p$  `{% 0! 0  D 40@,@(p$  @`g% 0! 0   40,@(p$  @`R%0 000! 0   4,@(p$  @`=% 0!\1P 0@ 0<840@,@(p$ P'% 0!1 0@ 0840,@(p$ P% 0!00 0  0@84,@(p$ P$D0 S @dPd`dpU:T +LЍOP 0"S !@LЍBDew8B0BHe$P00 !XP/ P/ R/XXec@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P 00%ӕ/BQp@-@!@3PPP@p0S @-3 eBp@-P@eP`  H0S p@/p@G-P0P @NP D0S G/p`W 1 !P @T)kPF舐Y B BR !  kP @W1!V``@- @0P @:p@-PP@p@ F20`S% S S  p@S S020\ FS! S S 嫖|xS S p@ą0P L\ 1 p@I p@A p@5B(BFB/BdB!B7B>BaBA-`p@0@TP0SX@0S 3/,PcA-PQpT0@T0 R X@`0S0S  3/,`c,0(0 0#1P! P #/Dcl?e0@ S /@-$0 @#PЍ褈>G-MⰠ P`p ` @c0P00SS00-ЍS0 000000@?o2P0SQ $0S S S h 0QQP<0H 80(0$00Ec؍etBEcEcC-釟M|@P` pSOp0p $  R0` c2 020202HX00ߍ؍e8p@-1@SHP囕L0S0L0 DHL^lP UpH@0100p@ ǏDUH  L00L0H0P @0` 嵏T^ p@X0\ /B؍e 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-$M`0@T,Pp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P 0S 3/ 10@c@c@e؍e 0O-DM`'p!< CS P00 0,p(`$  `!3 ?0080 040`,p(`$  !83 ?0 0<0 040,p(`$  !000 0 'Ȣ!0 0 04,p(`$ !0 000'tŸ! 0  0 04,p(`$ ! 0'!2Ÿ 0(0 0 040,p(`$ n!0 000!1 0100 0 4,p(`$ W!0 000!T1 0700 0 4,p(`$ @! 1 0I0 08 0哌NP 0 P@< 册  0|P &R+3'! P<0l  <0$,0DЍO؍eBAAEc8EcEcL88؋8l?etBA-@`(pP$!$ Af؍eP 0 0S/p@-X0PP Lɍ@P 0 H@Q000 0p؍e@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` 嚍PP0L00H@40 400;\00T0X0؍eG-0MZj0\ 0pWЍ@L\ T 0E0 0 SP@T 0H0 0E0 0 D p@` `FV`!  apG@0B8BeBP/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ0/0\/ APQ /p@-@TPPP@pp$00$/$0S0$0/ 0S00/@-@p@-$PUp@Qp@@-@0 ( 00@Kp@-@q0 0P0 p!R 9100 uB؍e RA-@P;bS`:pc@P PU0P SA-@P;bS`:p_@P PUl0(PPp@-P GP@ V0@pp@-@PPlTp00 00FS0_ 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 M_0@DJ0000CS0000`VTT`p؍eO-pPU' `V':S`F' 0$ @P 2V2(0 0C(000(( 0 ` 6P(@PHV@` [@P 0 0l 000 000HLgH0H0`0000+ ^0O-rMP`@0 ``(`0 0`S`F 80000U Vn0  ( R(|pPEWY80 fXp000<)0" 3SH L0SP0\ 0fX, <Pp 0% 3SH0L RP \0  <  0CSS10U 1 !J0PI00<,00 BX 1U  1Ip@Pp@ppWm 0j 3SH0L0ScU 0< pP7Ѝ<pP U)0& X븀V0008000T   #RH L R!X B/o" RX0@0C0pfV0 X 1S  0  00HAQ00@0Wp!S  ]000P`V PU @P@-P   Ѝ@-0000P7 ЍP/@-rPQp@-t ⺏`P@Pp0 0` U PB@-@P@Ѝ@-  0S  Ѝ0bSG-@9p`PP2 0 0 0  I,b0W`!V`! V `!0 7]0pGI0000CS0000@TWW@xP؍eO-PR``Ap0PPPM 0@P 2 (`200V [ ^@P P Ѝ00pJWp!fW{  W 1+#  \ @PZP`F R[ 000R000 p؍eA-0@S" `;(0 S8ʸS C< 0CPHPu[P (00 AQ(0000PP 0 ?0W@ \OpP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP ;\pA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` `0 QPp000, vVQ@&U #0SPpGW0pUv  :  0 $ P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S000 0 00HLydH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! c[BB@-R Ѝ@-L ЍO-0P0tj RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 o0000H 0CS00C R0 0000 Z00C0P0PX 0 YDPB ` ~Z00C0 00 &000b00rBG-0P ⅌p@P: ;  0 0  000HL/cH0H0`堀V>ZPP P  0  0 00HLcH0H0`!Zy@,B/-/-/-//-/-/-/@-@b`-@-A-PUp1p!0@W`DS W c c:`PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  /EXP  vYWPp  mY`G-4pPPP8 `9@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T U @ 00040"0P 0  0SI20@T D@DT@0P/ Y1V> 1CV VO `@'4TC@@ @T @H00@0` @T,`1@00C?o270 T:0 `T `V4 `V1 E?T``P @ 0 ;_@0@T@#C  R4@@iiip@-@PPPU@` tX`Pp Bp@- P`8@|<0P p|@0PppPp@- p^0Pd00S P/0pDP<@|~80 @f0\B@SdeTdp@-P`0` 0@ 0AT 0S`0S@ 00 0pTd@SdA-@Ppu C, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0`P@@A-P@pB0`,P}VU  AcQG-41p!,10RC*Q`= T PP<*P00 /R0S /SUPPo@ :%`Do@ |⠁0PP 0,`8$0 Pa{<{@<2$h`@P?@SdcB@-@P po00@-@<2l8 0S \0LS   ,P 0RoZ@DJo@SdSdp@- 0@0CS`P 040,PP_oRU vpp@Ap@-@P 0S 80 31R00 p@cp@-P40@AT ,UPqp@@Sd@-0 00 0~P Ѝ0A-0SPp` xJ@dTPP (0S @> 00 0@PSd0@- @P ,0S@uT p ˉЍЍ@X@-@ P$0 0[  'Ѝs@-` @P)P,0S(0S@ 00S |0 31R@幉4T <00S 刉Ѝp@Ѝp@@@c07@- k@P@P$0sT@ 0$0(0S @ Ѝ0O-@PDM TP^DЍOtQ @A@AP1  @d @88D|4q@0 a H(00<0,$@ @@ @Q0 00!00'>< 00,($@@ @; 0\! 0 P0< 0 ,($@@ @)uF PP DЍ@SdTd<8BeBcp@-@P8m0 r@P mp0@-`PP (@BT^P ЍPPp RhP P0XS   @00C@0B `V40040;V"Td@SdA-p MaP 3/@P@P 0 (00 0<1R 0@ Ѝ0 @P  ׉0 PQ"03̀1 0r@BP 0 @0@ 0QPQX   803/@P   P凉BDRSP@cSdTd@Sd@-00 0 Ѝ G-p`0 M 0*@P⚉@P  Ѝ0 (00 01R 0 h@ D H03/@P% PhaIP cUZ0}@@000 P @n  i@ FT  0P G`P 00 0RV @x0!0R:G@@1PPS0P1@01@Q800  PB@SdcTd@- 0000 00gЍ A-Mp yP@$`'X``P$P @@$(0V0(0  0"@P  ~@(0T0C(0  ЍW` #@0 0@-@MP P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0܍eO-TMP4L0p0L 00RZ(Y`|    "200 \20\2x0S@|0x@3080|00(05<0X008 P z4S @|  $7 +LxTЍ00 ?o2Y0S 9@40SN  <0R0 YFTD0S0ST00à R0S  6|0 3  8 Pa0@0H0Z|0 L 000L0,08L0S 0cs 0`(0 000D4 R8000S3# RQ. $ 0  0 R& S 0!Spx 00 N@H0P$0  H0 `0 ;@P(6@00 $H@ 0S@@ [fY90 T 3 0{b W p00K *G@C0`H01``90 D $06D0@0S0m0$ 0H`\p:XP#:0 P000L L"4040T 00 0C0000 00C00 R0000C0 0SK ,0p`L(00(08pXTY,`C|00001`P LR   Y;( 10R04 D0x 3/0@S000Y1;ò10PL02Y[xY Y p{p [ 0 0 RppR@@TKd K`0[00S  @@4 x04/'@(@#@ @0x0c>e08I0O-@`'~0q@! !@-@pp@p P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0T1d0 0!T!0    !/@cddd,cDe@-@Q Ѝ0l  R:` <P#!, i` @!P 00@H 0TD@D0<0RH0De@c,cG-RpP`0=  ( 08`w  0R<8 P/D @R+ @ BPS@P P֯PP  0H@L 40B300\00T0X00 +W00 KEX0ST0S@L@T@P;BG-`Rp 0 PV T0SPLPT0XP0?w@P  EUP`(0 0(0@Q`Q@PU7HBA-@R0 wp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PZBA-`@PpTXUZ 0000 0RX 0SUG 01QT0S0T0f@U8  R0#&  3SHL0SP0\00<0CR1Q 0lD 00080 080@P@0P00@pL@AtjB@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@rQ/T RT 0 0Sbp@-@QL0LPpS00S0T@@0Q 0 00000 p@D!R R0P00p@-PL@Q``U`QV 80v0S0C0000800C80Q 0S L`L0SP0  RpT0pPEL`B@-@@0S87@-@P1 < @0D0 Ѝ0A-0Xp@P` U[<S !P  P71 S010S0PR 5 cA-4$P 4p0?RL1S(@8P ,1S 0,1010:01 01`A@P 00000111010044P0P041418181@1@1D1D1H1H1b00 P <00111100!1.01 0.000003/P&f``& 1R 101m@-L@Q0L00P0T0PL0SO-(ppP U [  s@`(5@P U U .PP  H@L BÌ\PTX0(D 000P W. GR.B@-P `@P   BЍp7@-P@000T Ѝ0*00@s@-X0,`0 ( P@,  l0@00U Ѝpl@-AP0P@-8P/ R/@- @@w@讶VT `0.0X` `@V@@BWeA-PM`pBr@P 400000 0>@qЍ7@-P+r@P a@q Ѝ0p@-`PV M  V00 R0S@"  q@P0UV ;0@0    @P Nsq Ѝp@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1010 S;305<0@ T C$ zr= tr $ Yr Ur 00$00,Ѝs@-`Pqq@P19@ 00003/@pЍps@-`PVq@P 00403/@pЍp@-pP' c@0P0  P ЍT@ 0 S 1H05 !PV00  B0p@-M00000P0` H@P #0@P PpP pލp@-p PP`IM  @P0 0000 0@P # 0@P PpP oIߍ@-pP* c@0P0  P Ѝ RT@ 0PR 0 PV00  Bp@-0M@P` ( 000 00 00 0 0`4,00002PP #0PP 0Ѝp@-P4M`p J@P&043,0$0 S0 0 @P$0S 0@ P T @ ;@4Ѝ @PBO-PPlM%  ( @PnB00S@i8:(8DuP- ( 80,00< (0 @, Q00(0H2 , 000 p@PG0DT@0` S;# p0 @ts0S@( 10@" H@P 0冲*S`   @X0 S$0 00  H0P #0@?oV20S@ P TV0`D@ ?olЍX0S- 0HL@P H0 Hd0@P`0`0S 8(,08< SP00@ S00S p $ HA@P P000ɚ;6eB@-@0M 0P 0# ܍@-@0M 0P 0#܍G- pW`P_R/R-U@PP 0L00 H@$ B# \PT0X0Y P `P i;W@ W ` 0 R $R ÕP`0311  U`pV 0 0F0ER8f000  R` RB@cBO-MP 0L 4qM Q6 Q(@A:S` R. 4  0$0 8^4 Q Z R7Q=@20SF WP? S P ;8@` s@P @0V RUSЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* [ tT00#T0S  T 0 0$; | zhMU T00S 0@ 0OR0K@@BWecA-`MpP m@P 0 0 Ѝ000! @zm0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` P3`$00 (ЍpO-DM`  m@P0P S;# p0 ts0S 0 P0.m0U@DЍ ~0Pⅲ! 8p0P ,0 <00PPB-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppPeO-P0㄰U`!R `VP R@ R R ppG'qZY08/057@-@00P000U  Ѝ0@ Ѝ00R0 0S  0Q j98B @- @-p@-@0`PVp@0 `儮ἭCp@Pep@-@P0S 1`0D0]H]@0L0@0pp@-@P P \@P'Q@-@}{-p@-@TpP0P R  RpPp@ R   R4&k Q  101pB@-C-@MP]` 0` P 1 p`00B]A]B] A]n]0S PЍb]`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @0(00M  XЍpjBBp@-P@e Pp00Fp@-@f 000S0S P A-@pP`V Ƭp&Qp0S 0`V-`x` 0S  0S 0SD壬@!cA0ݬ6P APecde@-@5p@-0@SP 0S%Q0S 0S PPP0@Pp0S@`%00d jKP p0cPeB@-@P,I80 S 08  @< @}cPep@-@PpP6 0  p@o(0 S 000Pep@-@P400C40Y p@j\ep@-@`P֬Ԭ 0 ` ̬p@1M/  \@-  0S 0S00i)/BA-@`pPP 00S0p O-5l@PiëS0S 0S4 3t| }a`V/d```V8Z@0SX`(V p囫(0S 00S 8 R4 S 00S ȫ `(a<08p80弫WtyQpG p&W`pd    G  B 0 Rᕫ 0 R  4R 8 R ( R`V  1Q   R  @ 0  0 j4h0 @  % &iZ   e(pW0pW  8p  8p0S 0 0@0000001P/ph$`V000 ;BcPeEcde@cc890S p@-0S pP@1` 0 彪 0S /O-PM0S@i@0%@e@`0@0  唠p )60`PR 0,0X000`[4$@P @T ,7aPNN0@ᇠs@00@0(N@300@0$0 00D0, @0^@P N\ ST0 0$pTaN@00@0Ѝ @O-pDM@0%@(@0@0P0" 50`P @ T0,00` [4$@P l &@00@0DЍ_0S&@ !^@P`V.=@K0  B0Ѝ@(@\eP/ l89O-@S4MP` 0S 5R0 SppSpWX%C+1#0 000<5!05 !1 0S⢝pP 53   0 01QM 00; 0S4*#W pp 000YT[0 g n@0 L00H@Pp4000 0J00p\0T X 0f[= JH 4Ѝ"fP (0Se pp$  (3( 0,,5*0044k$ 0 00e[ 0SP 0S0S @ p  X@ @ @0 0@0 \P P" 03/@ dTz  P @0 ,00!0C00!, 0 (00  C@ 0 ( T q 1R0B S8BX P<0S=/ pPH!@0Wp  1Q@0@0  P  03/@ 0 P7}{ 10 10S, )S9z0S S~($d9@c0cEc\e(Bc8BBP P// R0@-@d 0  000R  0 /0@-cMPa/4@Pcߍ0R@-@ %0S R0a/@-@Z0  R 0  /0@-R@cM P cߍ0a/ P3,P0S p@-@`P40Ot 1]P\ps@-P`  !@P @JЍp00HB00PBs@-P`d@P0 @FdЍp@-+IP00%IA-@`p PY@P <N 1H]@\@-P` p @P0 @I Ѝ0@-00 ЍHB0@-00 ЍPBs@-P`4d@P @cЍpA-@`p\PN 1\@.\T @@-P` pS @P0 @eI Ѝ0@-00 ЍHB0@-00 ЍPBs@-P`c@P @cЍpA-@p`7 P@Ph 1\@/@-P` p@P0 @I Ѝ0@-00 ЍHB0@-00 ЍPBs@-P`c@P @1cЍp@o `P/@-4b|B 0(xe(00xe`O-QM0 | @ЍЍOQe0R 0 0p hW01h0#0@T_WPUY b\P\PPE0Pb|.P@T d2`VPLa0 @ [030#Z0S@x 234Ph  T0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%0U  &H & 'L ')(  P̣U0S' 00S 0/ m0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#PlxeUdTdHUd@c0P R0ox/G- P@ U `ἀD`00@0$V0:Ppf 01St埣0 H0L 0 H0P0L T 0P0 T %R0XP5\p5L`Pl0pBBxeTd0P @-P8P/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd/P 0%%#3/xe| `0R 2"-D | 1# H LH RH P LR P Tdp@-`P@TQx^0S<@@ @DX  S d A F0SpP!p_Q^_HcxeBDcB@-P7310! 0xeO-3#SLM  㑢 卢3X#0S @@   D HPp9`@$@`3`c 0@@ @0@0`X000 @@ @@00X Y#3 pB࢟ 0(<0Eg V< "0&5I^ V00 S"0  0 ,QlVp{VW0@`p<"[z 02 À $2;L0 ,00Rp((0,Š  00 0>P0` |@TX 0#0L0R    |V@fV 00 000$0l0 PSp  p p0l U  %庠Tdxe@c4eep@-40P (a09#900S? 0 0R9ڜ  I S `P 40083/0` =V0 $$BV 0S 1pp@|Q t  | x x |000900000 0S"cVx0p@ WxS0000 |  @|    , 0C1p@;VꔐeTd0UdxeUdp@-@P尟Op@Tdp@-@奟0  Z]<00 0'G PU 0 0͟0p@/0 ğp@Vp@軟Bp@-[  P8 l0Sp p p0l X  @P  0,P Hx E4 PllpA d0ic1p0吜 ʜP00Tdxe@-pM(ppP,`@P" 0 "0V060000S0#T20T20SIqP V 0 0 0 ЍV 0 0 0 @c@- (pP @ P@P $0 m;`P Ѝ`q0@0O-@0@Dp8<P @ P4` TK@P@0 ?;`P Ѝ {P L510 k,@``10@0TdA-P`pܛ 0Y@P 0 p 0 0(90AcATd0/xe202/@o/ 0R:****-//p@-@|Pᛛ0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@輛Ud@-P`pAT 0S *T-P A030#A(0000S  ЍA- P$`@ZV Z Q+ aA 0R010 ` ";0 S(0 1D 0 (00a@00C@0hU *A> 0R010 0A SUdDVd@-@0Md `2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4&0 00000Ѝ@賚@Vd@c8eEcDVdep@-]@^L !Pp@ PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0UdEcDVd20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0Y "!Wm0 0NP D!00000  `D!000$YX)0W0WPPU D!@000t @D!@000g >PU D! 00 0D!@000Q80DVd@c@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY P D0s: 1sT @@WL 1R" I  .  @ : #:0 1!Dc  0DPL P T [ QD!(00(0 0PP T G>D!000$`V4D!000Y 2T@0@`$D!000DVd@cO-`2P 0$MS ao@p῿H0S; 1s@1I@K 1R" I  .̡  :L #: 0 1!b 0K P D! @(00(0c$ЍA81T ѿ !D!$00$0R2 @ *0.SY Y+0.S (0000S X 0 0CX:00娿"@ *# =@᛿T X0 0000$ D! 00 0DVd@cO-Mp80 0 0S:RP0|b00T @ 0 S`0cV`V``V:HZS LWq O` $@ 0 80)0  *# V t P0(  0P0D00`0D0<T a_ɾW 0 W7 .R4 .R1  ! `1 ЍO 0=0@P0 Q L  L 00 L0 Cᚗ*+;!R 01a@ЍDVdUdEcG-`0 S@Papp mZPp` Qq a廾G踾0S 0 0 /1M0Ѝ//0S/9@- 00 ЍB@-0)  0GЍB@- 0  ЍB@-@a`0,($@ p@ @`<08 6DЍeBl?etcp@-@Pp0SpP`0S  ! GQPUQ 0L 0000 0C0p0S  ! G긙etcp@-@TpP`Pz# 04R00 0 XG00peeȘep@-` @PT E@ 0 S0S 0R00 0 0 ,000R 0P0@%@p訚ee@-@ݔ0 0C0@ꨚeO-`40@SPp0E  0S>Q  0RP?S 0 ! 'G 0 0S 1z⩔100P+tEp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 0 0 9CR:0S 0긙etceeA-@p`PUdd0E0Pp `P00S 0 000$ 000 00PetcA-@ `PX00pQQ0S0 R\S  ! 0< 0C0 00C 00 0C0 0pABtcp@-@0PS`"00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`B8@8X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 8U 77Cߍ870 <P@@p@@0$ p@W`<0S J@T P$<  G@Pp81X10  hH@P `J0 0 :800<024 @00D04jG@LJ T Xf p0 W|00 06 <@P 7 0 H%,,H0pLXp\ (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* n$ I i6 @T($0S C$ /  C,701 P0CVS @@01ڀp41p@H X<T(  FG@P" I0CW IԚe$B@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@6`F F !p$@ X0TC0@0 |@ ᢹT0 F k@5$ЍC-P`M0F000Fp00 0\@P t@Ѝ0 C /  C07s0 0pB@6T8 1 !S X ip  P000`F 00 갚e@-@,(0 R @0@+谚e|c@-@TP00S@ S @R 000갚e|cp@-P8ɑ40@Tp@0S 3/@갚e|cA-@`TpᲑH0PU4 0S  3/@PP갚e|c B@-  Q &Q  (FP-/p@-@@P0S0 0S!0Sp00Q!5` 00`00Q \R H  (M< O C0\S1BqB(BUBp@-P@@0Sp0400P 0S!!//O-Q48 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00Vdc@cB 2Vdp@- 0@ 0PP 0p0P00p@-P@ `;APp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P :10P@41O-PMU@  #DPC R& R#     cP 1T R@ 1P@**P W *pW`/oU" R 5 0Ѝ `P  0j*V O-p2`M0 @U Q Q 20S@0000-   R  5P Q P``9 c0 P N/0P I/0001$p@ѱ`0V  x.`C0 /RI 0S  0 0 ` 0 0S :/0 P 5/0P 0/0000S =P  `pR0"  ! P !PS 0 0 TP 0 S !" 00 `Sv r 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S .0S00T0.0 X.0T0S P X  Q   P S0S s.X.0 0000000S 0CSg| G 0 00 00C08+  Q~  00x0d0 p0Pm pP\0 00 c03Sa d+ A.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S .0 00000,00SQ 0N <0< (000000,00 ,0(H0(0b0S .P 0p0p00S 0  0UG U- .d[/ -TP0S p00Sp吰[ .P 0 pP0  .P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU |S-zX0 0T00 0S 0S0'0-00 0S S0S a- t-0 00000[S009   R S R S0C- 0T00US0S 0S0?0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d !2 000 40@ U=P ?-B H,\0 p00['`0\pp0`Pt`P 40p  R? ?X -,ꀀx&,80Sh50S 1@0,80/P$0 `@R0 r {R`" /U  0X P@0凯  0 S o*000/U  ` `0/P$000N0}P 0X0S 0/U00S 0S*0S 0P0 SC*/U 0  L00/P 00`$0L0 /UZ Z2* 0S/ P) 0 S*/U  `0 00 /P$ X$ R  $0$0+ 0 0 S:+?//U  X X 0S gP1 0 S */U 000 ` as/U X X 0S `HP @0 1  0 S */U 00/U [ [* 0S *P 0 S *000/U  % `6/U [ [* 0S x Ph1 0 S*0/UP <1 `00g/U[ [* 0S P  0 S L0g*/U00 000#/U4[V P1P8E70 d>C 0 S 00J*/U deԚe@cWeXBB@c]BjBrByBYeYeBBBBKBBWeXeBBBBBBB[ * 0S /U X @P870\  dC 0 S */U00[* 0S /U X X 0S tP76@ }U0 { /P 0R00Ǘ 0 g 0   `^* 04 0 00/S#+ 00S0 00 .R  .R0/S0 0 00$+40 0 /R" 0 T0+0 00S* 0 00`pd0  P0p0gP 0  }  { -4 0 0 0 00C0S *wT00 0X  900S00@TP *T@T0 0X00(0S ,0Ѝ*6*Q** R 0CSP S0S *X*0 00000*00 RX R/=0S0 X R i/a>P: X 0S /U[ tP75:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@P?Pq/`PPkP(,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0)0 0PS x<00U0S R 0S ,0  0 PP )U`V ,0 .``4ЍA- 00S : B0pP`W900@   0S P )@00WP@m.@P t)BB 0@-@DMP\, 0\ 0\ 0\P  B 00 05T4@P00DЍ0@ BA-P`pO@P P 0 P10 A-P`pF@P0 @Ѝ0 G-P`ሀ#pᨄ@0T00/ 0P0Tڄ嗄(P Є@ /,PV  6/P 00S0P00P0嵄)P07@- 0P @P  V9@ Ѝ0TBp@-P`@`` TP@N @JpE  D @ 0!p踚eVd@-@P<0(E0P q@!긚ep@-P"@@ "@pp@-P"P@@@ "@p@-@!@A-P`P 00p@T/00 0S0PPP@ 0S@Y@V P@̃Vdep@-@QP \00SpP5T ` @ Vpl꬛ep@-P`@'@夃0 R000@00P0փ@pp@-@%P 0Pጃ/R 00/ 0P0p@V'0A-`@VP ps/R 00/ 婃UP pd0000@@@嚃VAO-`M@'$P̡̱$00 7Pژ7@!OCAd@9 0P p- 0 S   '4 pW x,PÚ 8pP# !(7p :W j'W' kPUPW00S XPrX R0 R 'P $P ڔ  BR%*'@'PW ЍEc@cgfff@-@>"0 !!|0x0t0l000, !  ! 40 r@Py>}B@cddd2qp>R P7* 95@7T <Ѝ@2P% `P' PPf D0SO@ 3/@d00Cd0T\7`dPK0 (b90d00d0 @Pa Y>圀PU D0SK d00d0ЀD03/@匀d0T0Cd0<?U|~0S2h帀Vd `IVdeO-dM0P刀 00 0`0 p2P / dЍ0S '  !H@P /x3 000 0PM80 |pP` 0 2PT0P00L$(00T$Y8P #P M=0S # 0!P 8#0 000b0A`8@#p!PP  jPa10SZ L R$[ U U@00> U # 00 U # 00@⃦ 'Z #Y #*fY쐟0U# # 00 i#0VV P l#00 P04004V$-kBYBccep@-P`~\0@T Q   4 p@j" R R @VdeG-@(pP3 P000~`@00P  0'00& PP( 0@`000`A`0~WW "0P440TPP !PP 0~0`0V0PW3pW <4$<"V "BB7@-`0P @P  P 8N?U.0 V? k< Ѝ0긚eBO-pP`0M⁩Ё @P Є c P N?U.0 V?AF<p V  lV9V T9[ H9@P Ѝ踚eBBBB@-@9 @>B@-$0C00S@@c(ked0P0S R0 R 0S 0S/00긚e@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00|Ѝ@- 0 0tЍ@- 0 0lЍ@- 0 0dЍ@- 0 0\Ѝp@-@H0  9PH0 0S010H00A PA00Q00@@@pؚec"0O-DM@00(00p050S75@0!B B@-`00V@YPH 0 P0JydPUyV0 6300ry R00S5P ЍptP!y@PT0SdPXyU .Td!B!Bp@-PH yD0@T0BypZPh@d00d0Wdc0P/p@-P@ p1Fx01000.%/&.%/& o Nk+VgU +a# +[ 1|0pO-p$ML@P`H NP0WM 1U㤁$10S[  =@?0P 0啟<T00 ޟY # $Ѝ P1 ! Va0[ V I08/P 0V+cV  h0UNR@TPPP 05/P +` 0V8/P ꈢ Q=Ԛe0@-p0MPU U@ UPЍ0Ѝ0@l /00Ѝ0@DWd0 0 $ 6::70//0/ؚe00/\B-/0 0/00/00/00/00/0 0/G-Q MWha@Pazw0p hq0S@0@0@T&:XY0!,1 (x0  0 R8 R BQB<03!`P`w P0   U-`w0S SV(0ꘋcؚe@cEce!B-0/0040/0H0/-L/0P0/T0S000/p@-T@ $00$0$@@T@UwpIwe@-@Cw0>N@{we@-@,7w 0 0 00+NmweQ3O-M  @ (R0 @PBU1# (pU< `U QP``0 @P 0@P( 0 @P  ,@P@  @`0V s0U mߍf`bPC-$M@`100 00(00@ 0 ( 0P1 0  !000p p1-p 0.pP  # 6$ЍT a  8p 8&Bp@-P@`M$ G !|`*+Ѝpp@-@P`M< 6!! +@k-Ѝp@-DMp `P@P 0P,@@00PR'4P@P DЍ -@C-p`M!*PP*0@S+   0P0`'0T)PK0  000`0&0F)PK0S@! @*P -ЍyKxA-Ppl@Pdu` 0/S 4@P0 3Ѝ0 du@ 0/S n4@-`Pddvp 0/S 4@P 000dv@ 0/S P4Y ЍC-1@3p Ma)YP9+ 0ģ@P, @P'L10S 8 Bʮ0<00@00000&D@P (0S" ,<&,,(0P(@Ѝ  P @P0P0$0,( <0P0T0< P0+@P(,@cWe$B@-DMpP @P`P0{ @DЍ ,  @0 0&4I@Pp0!0S RW# S+R@ , W+@BLR@, *@,+WA@'G-M⨀`P pa@P [@P0@0%@@P($pY +H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0%L|@P}0d``PSx08x0V +0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `!@P<U `PU 0R'S)XD X 0S#YH 0RD%@P 0 8 f*0@X03/% ЍS@@UV /+-+0X03/ *yU u8 * pn@@@8 @-P !M`#q @P 0,00@0000$4#@P B@T ,*T <:2@Ѝ@0@0$0 0 00+8+D 00, @0*@P@c A-pMpP`+@PE?`00\@4@80$4d@T pЍHP0S@00000 00!0$0100! `(0 `+*@P !(@P 0`F0`@-Mq` P@P 0,00000@0`$4@P 0S ,*0P@Ѝ@0@0$0, 00:#:D0@0r'@Pq@-0J@ seO-5LM@P $ p`tRP P p$P$P dY  LЍA8, $00x0PYPSPUQ |PUPoU00&8pP|P|P0E S p!#P# *j| p ՛P6 0S U0 (P T X41Q (<(Pf0((0P 00 (~(Bp(P pP pG |0S 5$` @ 00007%P0 WP0zr0 M85 0|0i 0M( ra[x0S | ~ |[BWr0S Hr~ $0  @002 00   0S 00 0$P] PX0%r M8M( 0& 00001 0! 0 000 |0PW  Hp [* 00M(  A +%R0+r[0dV 0 oP V-040w    R Vj 0 RPb tV-00|00 0$PO-DB$BH$Bew]L$Bt$B@- 0 0 0000 yЍA-`PMp @P0@00<@@0"D@T PЍ(P+|(0 @@0P 0$@P 0 0@ @T(PBq0S Gyqes@-`@PЍp0)qP @00!-0@P000Yq@-P@pM0 0 `P Q! T@,0 /!bR 0ᱯQPU @@0 iPЍQ$BEc$B :@-@-T3\M` @P04#P0 S0, ` @P,  \Ѝ P @P ƚ@$ P @P$ ( P @P  @P(  p写@P( ’@P  u@P@ `@P@ @ _@Pp@ `S@P @P@ 0000p@ `:@Pv @Pp  G`@ (@Pd @p+`@P P @Z@DDB$B@-@M P ЍG-@!MS$ ` p! wWP0O80- PP%W$!b ]P?@0Sp 0崖<P0@0 P U CЍ P@ Ȑ  *P00/S S 80SP +4@+  Ԛe$B@-PX0M`p @P 0 0 0{@ ЍDBp@-@`L 0P@P r@p @-PM p`9.@P  04 00#0G@-Ѝ@cp@-@`L 0P@P >@p O-1MP`@0D`@ zp0 0P[0$0P 00 00P*U!@UT@H0@0 UT*0 0 0P@0 3/0P` +P P@@0 3/0P 0[T0Ѝ $B@-0 000Ѝ G-p`-@P.0  0S@ !,#PPY %$@@~0S&   P  PǕP @-Ѝ G@ T  i@ ZTG-0Pq$@ @`AP  PPPᆕ{ $M  G{@c0@-Mp 00000` 0 @P -@P0`Pl0S@@!"@%T,Ѝp@-@MP `@PU?000,@@04@T C@Ѝp00=0S@@!n"@P$0s@- Q@P $P@`ᶔ#00Ѝp0 0p@-M 00000P 0`W @P0 @PBЍpO-5,MpT @P= a$$-@P 0 00000 0P  000 0@P$0  y-,Ѝ R  p-$0  /@P$00P@Pa$$  E-@ C-p0MR`P0'kP 0 3/@kNT T+ du40000 000@S +b@ @P0/S ,@P0  bЍc@-p0@ @`hPP @ (0 T@H Ѝ@c@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR000BS` D00S03P R30Ѝp! ! C- pሐ'P@``V`3'1P01 0@PP  ЍR0p@-0P@+0P 000S 0 p@Fp-p0ASG-Pp@ `^PP00S!3 T` TS @P0p@-`M 0000 0P@P@PT0P00L@$@(00T$.@T {`Ѝp8`vp@aT  @P`0 0S030@P 0S@3:@O-P0!M0#q` 0000 0@PcUPd  b,@PX  a@PF@T0SG  P@P   @P  +P 0S-@+" m 0$  N @P  0k0X  X k 0 P@P" 0  p+Ѝ-@@@c@- x Ѝ@-M pP 0` @P @P`@TG@Ѝ@-M@ 0P RЍA-M P` 0p@P @Pp@T 00 00@WЍs@-P@P 0`00@P @ Ѝp C-P0M 0000p0 `@P  i@PvpP0* @Ѝ @ @0<D@PZ(`V@&P$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<K!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,< !,,P0< (@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0+@P+X@P$0`800 @4`0 <F@P 0$S@0S 0R@4  @$!$XPTHЍp@4 $ 0PI P/DBLB@-; 000c0 Ѝ@- 0;0 00Ѝ0 c  0c000@-DM 4@P$P0@,P00004@P 0S00,V 0P  P @DЍ0  ,!@P ,=  0c G0D0 c?@-0S@`@P3(0P @ 0,Q@ 0P000 1/@'ЍpC-pM`(PP 0' @Ѝ 0,Q !!1/@P pQ@@'00@-MA0 0@QЍ0C-pM`'PP 0' @Ѝ 0,Q !!1/@P 7R@@'00@-MA0 0@RЍ0C-SDM@`p.  E_U_`Q@P#00P,@@0|Q4 MP 4P@T WDЍV@ `c ,@P !@0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00Py4@P @ЍpP`@ @-0 c Ѝ0@-MPP @@0cP aЍ00@-MPP @0cP PЍ00@- 0MP00P0#@3P <Ѝ0@00@- 00 cZ Ѝ@- 00R Ѝs@-P@0` D@P u@B ЍpDB@-P`&@P 0 p`@& Ѝs@-P@0` @P J@ ЍpLBs@-P0` D0D0 0@P B@ ЍpLBDB0@-0 c Ѝs@-P`&@P0 %@;&Ѝp@- 00 Ѝs@-P@0` @P  @ ЍpLB@-P$0` L0L0 0t@P@0 )@ ЍpLBDB0@-000 c Ѝ@-PH0` @P00 0@ ЍpDB@-P` #&@P @0@%Ѝp@-00 00 Ѝ@-P` &@P 0 00@%Ѝp@-PD0` D@P@0 @ V ЍpLB@-PH0` .@P00 0@ ? ЍpLBG-M0`@S11\p @T:0s_2 0s0Sp 0PPp?X!(PPP 0 SP? P0UPP(b0 s` 0 s pUZ0!(003PW  0S  pPP Ѝ 0sϷP0PPDBLBp@-PM`=%@P @0 @0c0 f@$Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S (P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` $@P @0  00@q$Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ 5@P!4@Pi #!K@ ЍpDBp@-P@U$0P @ 0<Q-@ 1/@"$pp@-PMd$@P0L` 0 0 "@m$ЍpG-PME$@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  @.#Ѝ@p@-PM$@P0L`` 0 0 @ #Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp#@P 0 @ 0 @@P0 0@0@0S 0 00?#ЍWe@-,0@31!$ =@cp@-P`Mt  &@Ts0@&0S00P0@PЍp07@-<P @P@ Ѝ0DBO- ` 0M&J0 S1 0C 0 p +#@P 0  @ PT 0S@  0 Z@0"@Ѝ@G- `@ 0p%J0!S B   "@P 0  @ PPV 0S@  08@ "Ѝ@@-@(c$0S( ( (0$ @dWd@-@, 0c,0$ @R$$ ((0dWde0S ( #P QS//@cp@-@pc 0S0\P 0 L#0Sp Q R$0<8Wdeee0@-@ 0 .# @ceWd00CS0/@-@P $ 600C0@ e0M, 0S*00Ѝ/ep@-Pp0 0AT 0S P 0SP@p0S00   @eA-p䀟3AT .c`Pgc0S @000[cPU PPhcX0 $3`U3@103 P000 @@cWdeL031S  R R0SQ 0/@cA-`@P 0S00p"P P 00 ""V DbP 0$0 bUWde0@-0@M@P b b=:8"0h 0 \ \0  00  , $0 $ Ѝ0Wde$BZ:@Z:Ec1S/p@-P`tpbAT`b\@Q p0S `` ```@` $RWdeA-p` P0@PP0PpPP$>b 0 0! AvbWdep@-P@`-b0P 0 1S 01  0S 0 0000p@TbWde . + (G-PP0S0C04q0S ʿ!0SB !a00oG+b`a3}?@T  bV @ $` R   R  R R R A 0S  B 00 0003``}?00G!eWde@c@-P0S003@oѠ@c@-P003@o@cG-`P@# PpW@ Ѐ~a ` !@TW% V@ @00@P Wt`a0U 0S  3R  P $@030eWd@cee@-K0@-E@vaWdp@-00S-@ `P4@P V\ aP#@!a@P (Yap@@ @꬛eWdA-@t`p a0@00L@aPp `E0S0P0P0`WdA-@`p`P|!a,@TXIT0S0 R @S    [WdG-0 PP;0`0S5P $10S00@S00 c 0S' ` 0S00`pW`0;00S0C0I 0S j p}`0h0X`LP00Z 0 3/`Pp0N ꬛eWdee7@-PP00@1S  DPđT Ѝ0@-@- RA-@`PPpVP,H035@A,e0P R0 5/p@-0@S`L X`0SP P Q  - `0SPE 00@0@@U04 @ V @ 08⡷U@P@ 0R08<╷0S  B2@ S * p00Sd% 3 @0T"#!p@, `0@(00PpVXdXd,eEcEcMb%B@-@_200CS4o` ⚆6@A0@ l,ep@-@@P0SSp/P@-@ P BT@DpP P p@-0 l=@- [`0p PNA6T@P0P00 00""00,p,eA %BXdp@-PX0t p0ATp 0R 0RP @,eG- P@R NU `ἀD`t00@0$V0:Pp _p01StE_0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P0p%B%B,eXd0P/- R  0 RP <04Q0 4R/00C-@2 TMc刀pn0S @J500^嚅^H0   . b?H0<9H0^߅ 00@SPP0S ^ P^c0 000P T BP 80S ;40789/0 00CS`3#-`P !0SP B`0S h`4^0t p 1S01  0S00b^0U ^p0 0000O^0DP00^TЍ@cXd(%B,eeeP0M0Ѝ/O-@`P㨃娓娣Mp 0R0S P001 U %V ^]oPP ^B`P00 ! P0 [oP X0S "e0S&U V ]]`P00P1S  EPUQUD \0RS~ЍL 3S00SV 1P ]p]V P GV `P0 0 0oH0 0 U ۄP]?G]PYH0   . b?:H0Y {YXd,eO-M ` p`D@  `XPȐ`İ@lY P AЍ@0 t p0 P! A`ĀpEY Xd,eG-M -8<p %`X @ PX$YWp0ĠȐ t p!R !  R t  At `!R ! 0 R ЍGXd,e7@-@PX0t p 1S01  0S00P00000XP hr P p qB@0XL000000X6 Ѝ0Xd,ee%Be0S/T  BRT  @-/@%B@-@P@oC-PKXPX Ѝ@Xx0S 0`3X0Px00ptp`t0qW P UHbX 01Kt010qEcXd,eXdp@-P@`X00p@X00/0S S\/ //G-S `@H@ VBQA<`IQpQY/ `PW, X`V `$G+pQ`n` N@PT0~0 (00 `$GQ%B @-@P` p0  Ѝ0S0S@-l0  C0 $ , 0 P *0{WW/@cc H /p@-@0 0P0:0P0<4P`0@ P P  p@ ppOpppH0 /@-@+~3WH0  .?)H0 L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVYS 0S [ Y+T 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000 00UP48<40=  , L06   03 00SpP * P RP[P2 PV UG@j0@01[D00, 00@0P ;y[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P YSX  X S, 0P0[P0L P P@ 0&@ P -OY 1PZ- 1y 000 20 @cp@-PP@`e SX00CX0AS oPKp O-,M\@`ကP`dpP>0 0%!X0ЍS`!B =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡@-TV@GߍHB@-PGM`p0 {@P\0 @P 000 @-TV@GߍPB@-PGM`p0 {@PH @P0@] 000 @ -TV@GߍA-`0 Mp }@P'`00 0@PppU0PV0 `F000pP P@p!00q-TV@ ЍHBA-`0 Mp E@P'`00 0@PppU0PV0 `F000pP P@p!009-TV@ ЍPBG-P M @P)0 000 @PV0`W0 pG00 0xP P@!00F -TV@ Ѝp@-PBM`0 z@PP0 @P 0  @-TV@BߍpHBp@-PBM`0 z@PP0 @P p0 @-TV@BߍpPBp@-PBM`0 z@P9 @P 0@N0 @ -TV@Bߍpp@-P`!0CS@VPp0Pp 00p@-@PL0 "p@DLp@-@PL00PP8Lp0@-P0M 0 0P@P0 03/@Ѝ0&B@-000 03/Ѝ&B@-000 03/Ѝ&B@-M0<00  3/@PЍ&B@-M@000  3/@PЍ&B@-4000 03/@P~Ѝ'B0@-0M00 03/@{TP PyK<0 0R 0 "KЍ0,'Be@-000 03/ЍH'B@-000 $03/Ѝd'B@-000 (03/Ѝ'BC-0M p08@P% 0"sr`@ P`1K $lK0 ,03/VP T 0"Y0 3:UЍ`'B@-M@0000  3/@PЍ'BC-M P 0@P @ 0 `J $p$K@0403/ 0P Y` X0#3Ѝp`'B@-( "!0 803/Ѝ'B@-( "!0 <03/Ѝ (B@- 000 @03/Ѝ((B@- 000 D03/ЍD(B0@-P0M 0 0PT@P0 H03/@sЍ0`(B0@-P0M 0 0P<@P0 L03/@[Ѝ0|(B@- 0 00P03/Ѝ(B0@-T0M0 0 P @P0T03/@6Ѝ0(B-00$M0"!#!0 X03/$Ѝ(B0@-,M\!#!@0 00P @P0\03/@ ,Ѝ0(B0@-@0M  PP 000`03/@PU 0IT 0 0'JЍ0)B@-@000 d03/@PЍ$)B0@-,M080\ 0<0 $0 0P @P0 h03/@,Ѝ0@)B@-M@00l0  3/@PЍ\)B0@-@0M PP 0 p03/@PrU 0IT0 0IЍ0x)B@-M 0400 t03/@PNЍ)B-$M0(000,0 00 x03/$Ѝ)B@-000 |03/Ѝ)B0@-P0M 0 0P@P0 03/@!Ѝ0)B@- 0 0003/Ѝ*B@-000 03/ Ѝ *Bp@-x0M` 00P  00 @P 0 03/0@P Ѝp<*B7@-00P00 03/@ Ѝ0X*B0@-,M!80\ 0<00@0P 00 @P003/@,Ѝ0t*B@- 0 0003/Ѝ*B0@-L0M 00P x@P003/@Ѝ0*B@-000 03/ Ѝ*B@-000 03/Ѝ*B@- 000 03/Ѝ+B@-000 03/Ѝ+B-,M 00H0400800<00@0 0D0$00 03/,Ѝ8+B-$M "!00 00 03/$ЍT+B0@-X$M 0 0P @P0 03/@%$Ѝ0p+B@-M@000  3/@PЍ+B0@-X$M 0 0P @P0 03/@$Ѝ0+B@-000 03/Ѝ+B-$M0(000,0 00 03/$Ѝ+B-$M0(000,0 00 03/$Ѝ+B@- 0 0003/Ѝ,B@-(000  3/Ѝ4,B@- 000 03/ЍP,B@-\2Bp@-P@`P00@000000 0(0P0Ppe 0 //00// //0/@-@-@-@P 0P hP @-@0$ @ @-82B@-0n$0@@-0n/// / 1R *1 4SHP// 0 //0S  0S 0@-@@0S  00S  /0D 0C S 0 0( /, 0 0P3B7@-@00PF000U  Ѝ0@ݏ Ѝ0Gp@-0@ R R p PT `h 0pPCX0U 0S @c3B3B1 011M/ ʼnG-`@ PpY0S 00B0S00%0 `#Ⴥ၅NL =`0 00CS00 00CS0@-0@0S(Y0 0 SQ3B3B3Bp@-Q@`pP 0S R0C BS0(0,1 %@V p0)( ,0Q0@@ QZ0Ls 0@ 0 0@-0@0 0DkD@O-TM `@(0|0 00pS0p0 @ "1/0@zS 0000 $0 00( [D00 X 0 SCT00T03D{ R x0 p000 $00X3p #H3PL0R0 70  0# "00#00000p( 0c,0y 07B, 0SB[CQ0 [3$0800H00<00$0 P9 0 00\ 0S- ?\r \dXBXVʀ 0! $ 0    !03/ 0!d!0    ! TЍ8$00 @,3<0S ZHL 0rq R x $0B 㝺$0   pJZ  ([W  Z  R 00â 000 G40ڡ040$ B, $04 L@W b4LBH PX@Q@0L <8@X#< M$0@c4edddO-$pM@0L0?o2D00@ 0Zp0500#40040 80S200#809$0H000  BCX 00S"jЍD0S00<00(0`0 0` 0$000P00  01/0 0, 6 ?R 01/0 6?Q 000Si(0S `0S (0( 408 03/({0000 0 00SZoQ00 0S 3/00SD ZC K 0000 00 0 02P D P C 10Cs0 S0 !p0R00S/o" @ 0Q0Es<P:@0Shi0 S 00˟ 0#0S !ϠUN  P b B  , PP/P P/P 0>^0PSP 0PU,0%V Z1 S\0<q0P0 A!00(0S#0(0AgBX 408  (0(\*40X803/P  0R \A$0S40S  h"R 0$0S  0R \#} 0 V,0"&0:808 01<0D0 000<0000 0R 0P $0Se <h<< l0& $0ST P<` 0P0 0e0S8 00l08 Poo 0bp @4\  0P$0S* 00, PYV`` 0U`V <\ b00D0 0000000,00P $0S Kh0`@00@PS 000 $0 P0<731|0L0S  0PX0 @00`V,0P0U`PY0 `]@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 I P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ  &L0S4 00S @X剼T0X00S 40S 0| d0  d / ,01/PBg@0Sg$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C 540St 3^P0x >0 PS 0%VZf0H 40U g0T0tPx`F)0 0, RS00V00S000 < 00 ET 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 0喺00X 0##@0 080UDWY 0@ ι 0  P0SfPѷķჷ۷ 0D0 0p0 \P Z 0<!$0SL3 L00 'fX wfw$0S0`0~ W05B@c 1O-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,0Ṳ0`S P00 0 >H0  d0S]$?W ,0S 408 03/%fPEߍW5@12 0 SpPP) ff`눀X `,0 0e 0p,08P @1 40/0\3/PP 0 0]$0( 0` @1]V` @1 0S 00<0 90@`D800 0 0zPP "$R( 0XP )l>X H0  0S0000 0S 3/H0  P d0SeL0+ gH`>i&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0 P (`,_es~˸e 0`! 0  D1 SD1P P0  S 00(`,S XjᲸjt$(0 T0,0X0奸040 bX `X 80` 0S4`080P8`P @ x 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000md[ `x0 A !d` B[x0x0   м> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`0000d `0 0`0`0 \0`0S"X# d (`,0C6`ïd0` x0P 05/P!dU 0xP`0dx0X @0PD0  $0P(0 R \0S  R  J ድ`40S  ႌ  <0 0 S e C 0 S\ 101T0S@` T0S xc@c4e05BU5B3e@-0 000! Ѝ 0  /A-@0MPb d,0F00 00vЍ 1A-@0MPb K,0F00 00]Ѝ 1O-$@ @` pLM 00 0 00 0 0P 0AOoBBLЍ06 ?\0c@@c|13100 000 ` 0`p%c 0S@V)cQ(T B1 0@  @& (  6, ?(#<@$8 0(@P8 R  RT 0@ 0 0tCဴ`@cG-@0(MP3 聓0b៷Fa@Ѝ @F 0;T0 0T0 < T0000 0$@ b62< RW1Q00Wrp @0ϸ(Ѝ@cO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+p&b0 @20>00 0  .p0 P(0 S00 ,40،P1~pp p,00 00pG<010801 1!&ፏWK8傈|1 0(0` 000 :#: 000 ᇅ8m0 U ,婌XE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H <߅ 04 H忄꤈>05B@cDc3e:p@-@P:0 +p@:G-P`$0@p3/@PZ@00@800 4/@P 40T00S vmVx P P$03/@P P 0Sf P @0S|00S@0SP 00L0D 8/PP H0U00S @9@ 0W4 V4 P 0S t P 0P l 0S0S PP 0S P P b<0 P0Ѝ0P PPSSA-`Pp@ T ;W 5AO-P @`TU  !T 0 0 06/@ ЍG-销@0H?oP20p`PS V TXTYGO-DM,00000l h 0 @P QPሠ$0 3/@PF`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Ux X880 R R<`VS <`0S0S VV8=<P @84DЍ8pW0S@; x0S@7 U l0 0Rl0 @P*   03/@P0 @t 4/ 0tPp1@P 000,0p 0@ 0 t4/@L00SF0 80S @@400 @ 0 t4/@P40S,80 0,0B 0<0 0p0@000l0P0 0 #P`@p 8p40<`S0 `p@4P Tt o<0 0p0 000l0@080 0,000V9`@ 0  4/@P`t0 @ 4/ 0Ptp+0@t@P000p00l0` 0,0 0@ 0t4/@Po00 00g 0R S@`@ 0 t4/PB@VS@RA-P `@0pi0S 0aW 0ZT0S A0O0@-P @ \ 00 0O-pM0<0P0H00P0 8`@DL 0{@P& W0V04 P0Y04  0 ЍO  ^P0S UP @Ѝ /A-@` Pp?P W $0 Aj<@- 00 00! 0!""##$$ ᐾ@-77Qp@-@ Q  8-PPpp@p\5BQp@-@ @Q'\0@$0@0$0ppPS7$@7Tp\0$00$0$@Qp@-@ @Q ppP97 0"s7 0"p@-Q@pP @Q @p!7d 0$ 0S (0, 0@@R7d 0$ 0S (00, @@p 0S/S 0 / E/0S//0S-/@-5B//@- G-`@0S 00s  r Pl 0 r 0 pW S S W  P UȀ-  //@-0  @-   9^  e^o    ^v]/@- ]@- 0   ^  A^o    ]R]@- ]@-@MG^P;^P/@-0]p@-@P,]@p*]  ? Ra0 ? /0S S S00 /$0@-h0p05B5B5B]\]M]]A-`p@ PP @A=: <900    P1 @0<3@0<O-@`MP@T@Pppp@-`@P,P (Pppq@- S S 0 00 0 0 Ѝ Ѝ@-0@0ڻPQ Ѝ0S S S+ 0 / 0 ///0@-P M 0@P: 00Ѝ0P/00@-DM000,00(0H0 00@0P<0A$  <0< ~DЍ06B/p@-0P@T ` @pp@-P`r@P 囻@ቯpA-pP@_`P$ 勻`vV000000 0 0!!!!""""####$$$$|0|0i /@-p@ P`7s[M: 0000 0CS 0 `p` 0@Ppc 0` ЍC-MPp`04@P  0 $ 01/@T 00Ѝ   @P  T@P [A-`pPȮ@P  0 n@ݮT 00Ѝ @P $*@P 10T-/G 0T0/ 0X0/O-`DM@ 00 0 刀匠00 ` P p  01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0 0 DЍ U! R P PU˰p  P 0 p Wʠ6BG- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`W  3@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0  0SS00/S0 /p@-0` P 00CS0@003/@P 0 1X00X01pp@-0@` 0P1X00CX010p@00/ 0@-0@00CS0@000/<P /0 0000/p@-@P0003/@P 000pp@-@PT` 0R@0003/TP P 000pp@-@P0003/@P 000pp@-@`0P0003/@tpA-@P0圀p`0S000X X00CX071PPV 0  01/@-0 6BA-$0@@@P0`00XpXW0S 04 0 13/@X@8+B0     0 1/@-WT+B R0R0#3/ 0 / 0 /0S  0S 0@-@@0S  00S  /O-`t0@PpW  z{   Pu  aPp0 Ѝ@@@-\7@- 0 R R A@ ဿ Ѝ0A@ c6Bp@-P0S0@0 0S p@Ķ0\03/-Ppp@-@04400 # #$0Ѝ7B0P 0C S0 04 /, 0 0 06B0 00@-000S @</000S Ѝ@0sЍx]eeO-P/됐`bP/0So S|/0Se1311P 0S]/0 0QK 0 0/n:Z/00C0 I 0S00Y<1/YPF, 3R0 0=1P 3R0 017P~a/00/Y/00Sd/X/000D0 3嘲PPZ  Ѝ,c@cex]ee7B37Bs@-P`00@T H!/P4(Ѝp@V/ D`TЍpx]ee00@-MP 0@P "0 ܼ0S T $0@0减Ѝ0&P @@-`P c@P 0S-@ @0Ѝp0@-PM@ KP@ 0S 00 3ֽ0@Ѝ0@cO-`PDM0S S|@ %P 0 |0j DЍ0S^ 0S1|!3000 0pPK4@ TLTHĔi?0?00 ᠄0偋}0DpQ1! T 0 00 0@j0 0D X !zZ 㑎000 0 0@P pW 0Z0SX @chd K7BO-P|M0S @0S S % X TP 0߼T  ^ |Ѝ 0S2"3000X0PKl@ TLTH4$0刞D2p@Wp1140r1(80l`40c 0?<00 0 0S 4;0$D0?H0?,@0 4;00<0 40@0ǤV0 DID0 SH0 $ ?ẤW1!V0T0000,0  0(0@L0!oL`ZT 00 0D S1[!00 லTǍZ[X4( 8,k$!.C( ,0A`T000 0@!`FQ@chd [7BO-PTM3吀 00S 0Q Q >@P.4-Q, Q8@T 00 0000tt@P `]-T0S pP000  @P  aTЍ 0S 0S 0S00 0P@0S2'40[ 20 0 00 :2P@ \, Q@D-T8 @0),Z\ T @ -Z .T0S \aP30 !006/PP@ 8<(1#,0"־囸P 8*L1 0S41  :  P@, ܷ@,T啸P *0 0ST00 0SZ0C 000C00S00s``PL30 D (06/PB@?@cx]eej7Bxch%6hd l!6d@@- @PN0Ѝp@-`MP  @P t0R R3000 0  0@Ѝp3000 0 @c7BD D0 4S 40 60CpS//cB0S@-0/@-@  @v6B';eG-p``\P+"? !@T0@@0 @@@AP0p00 0` l +TG80 R\ \ @0@0   x]eeG-`Pp +"? !@T+0S0 SRo+P Z|++0@V 000S +00@P++P$0@踛ex]ep@-`PA+0 @T 0@STQThp+pP@T P @+[+_P@px]ee00/0@-M@ P PT0@ D0D 30000P+(#Ѝ0@czd@p@-P@`*  Q 00C0 0 + Ix*0Sd0 2?0!0S 4 0 p@*a0 0x]eep@-0@HP*0`0@,0D0*T:p@6x]e P  800P////p@-d 0@Pጡ .0ㅡ p/pO-P1S0l*`@PP @T@@}>w0;*}.0bd 0[P"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H"@ ` 0P2 S n2@`{? !2@T`0!ߠ!:#@T`0!Ӡ!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @壠0< 圠 ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@ᲲQ<0S00$00V (`嘀?`aV $'0#$+4ሹP W8P< * 㒲%!  (❹$0 & V (00100 @ D@-0@00$00ᏉPp@-@P`R/2PP`佯 Pp@-@ (0!( :@ @-0@{0!80@(A-P?@ `!tpR( W\00\0  WX00X0%0S`00S 3/050(A-@`PP p((p@-0@pP(@(Tp@-0PS@p A0x 0000߷\8``(0 $A&ⴸ(0@; Ѝ@\9Bb9B0/G-P`t@A(U 1P0咸埦0SGq(0S0p SڬP嬐U卦PP x\(03/( Z#Z P &hb00C0Z $00?('@cp@-@PPpp@p@-@P'00P 00$00xOp@(O-M00pQ  (@`TB  0 ٞ : 0Ҟ 3+t 0U0Ѝ0 @00D0 0(庞 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  ᾷp`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/CE/⌱p20S%0 700ĸ`P1 TT *600 0!00 2`070&f 0R88@9S}E/E@%P` 4 ~`%0$0> 0S`: 0⛣`P3`%@T 00%T{ xT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp -媜!%6000!0 0Z1pP Pt` lq~(0S00 3/Mw0%  (ЍG0 (p(P  Wpt UPT<$',P * 8SЍR 0030#  P0l 0$0 "ǃ Q0* 0 (a o9B}9B9B9B:BO-@ᄠ?t`pP Q4$0SU`V` % Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU/A-@P{KkKG-`p|@O0P ᘴ`PO00k)h$01$a℆0  ፨ 0 ᇨ忢%  0 EtC$ x00Cx00S  . tu$屢qT"K 0!400rK$K:d:B:B:BĜeA-@|`8 PX X0 0 1@01?::0 5:1<,Q@p`e`  0Wp0GT0A >A-P@᠀崪0 )P`tp#lJdPK$䞪 έ##ϳṪ00:BĜe LcG-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC ⸭PTP1#p;BO-M`8, FtF, R 0SS  ! FZ Y pF PZ)8ἐ0(, ũP, P@嘁FU \x0P0Cx00S  .  Jɝ$?FcⶔPP$  $/F 0 4QF1x0 P0Cx00S  . d 垝$F8@`ت0 SX0000Dߥ 1x妔Ptd;Ba;LcĜei;BZ;B;BA-@`@EPp吀0T*0QU P <P06P #(!FU Ay@ĜeA-0MP00p 00!t0  00 |@T`x00Ѝ0SP* u (w 8*000 w*, wϒ (⩣`yV 00 0@G-Pp`E@᠐0U:ET 0aV X ⯨P T &# 0P᎒@Ĝe;BG-@pP,E@ T:t|E@aV X 0Pl,jE@T@@ṓĜep@-PE@DP0Sp@0RE0Q 0S @Ĝe;BA-@PD DsP BPP  D`PPpU:A%EQ  R 00 00 0P S $kĜeLc;BBO-Xp@wuM} X0p`#00 0?PP+0P X 0P P" R R0uX8⟂&  V3, )T 00S 3PC{uߍPX X3 : ,4L HZ\PGS %{3 0APEz}`X P L0 l:0 ,qPP  s0#ju Pp 0⇓ ? PpX 2& 0& X  ߑ0 vP70!*" s s(0, 0 0S 1!3S$ 6~?.0S S*Q #?0000. [ A00 Z X{s P 6X⠤P.  Q#?0000Q 00 Xs XTs PhX0 qR 000X0008fPd e>Bd>B>B>B3?BT?Bd?B@B@B-ABT0Tp@- 60@B@P P0S@@D,pȷcA-@Pf/p)<(00`S3 #01 1@ ##:!#0<,8  q00 q0 H0<0 0008|0X``00``k8 (0 0<0`0,0$0@000(040,0AȷcABWEVG-1( @"6 0֍PP 0S00Gz꤀ $0 BR0 08 pRvW00 BR`!`1Pཀྵ0W  '*ᴩ00C0ȷcA-` P &0)`劍@P@ |p; UT00T0  UP00P0%0SX0 j@fD%P倏@PᱼWȷceG-`<1 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 pcPP$ pO-p@ 6 0o RQc 0Q0000C000 Sc0 0`S 0n`S ,PPP HZ%ZeX!4!  0 1a1`d  < adF 0`S:#::cSP!P10S  hP  0S00 Ѝ0S 0S00 ,0 Q #BBYdYd>p@-l` d0 Rk@H0P*0 b,PAd  0@AkpDcYd>Yd0 60S#3//0 R@#0 Q /R0h0//dA0( #&0  R /~E/00S/კG-`w0 00000PU@P< 0 @@@@Kp P@TT ,N۹Y ЍG% T1# e@PW01H $.WP0 hCP @Ѝ@ce4!  \ / S: YBBe$0 0!0 00 /@cddd0S  0 00/p@-|0pPd3@1`000/(0, 6Q 0/(0, S @@V p@c@-@0 00R 0(0,000@p@-P`I@P @ `T`0S $0CS@ R(08 8@@p耝ep@-PU @`00p`h0PpppCBp@-@pP}Pp@p@-@P`q0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $UӸp0ꀝep@-40@SP 4?3\0,0S S 00 008@Tp`0 6/@ꀝep@-@P` R寠 0P6 #::0t $00000@0`0: 0 pCBA-Pp@3A`1`00 0S60S50S 0S E`LP Q 50S0 xv050@ceL;@-@B$D0S MP$@@-@50S0500S @A- pPPF9@0(0@P<1``00exNvPz LPPPPPPPPlPlBI 00 0`S 0 , `| 0@FPЍ訡;eCBCB@-(@,000S S 0 bDP 0S Ѝ@MЍ-\M0000Q 0S 3/\Ѝ G-`1@p31`00-e 0RP[50Sxv0550Io멒B R  00 0S#P< 0 0 0  P0 0000&6Q  R  R   0 0  |pPP #P 0SPU  P P @c 0O-DM!0p`hA0 <0 0,p(`$  @P0(` 0$ &^<040p0 ,00!0 0O0 0 0(`$ ^<040p0 ,00!H0U@ 0  0(`$ @]DЍCBc;;$;O-QdM@0 | PdЍdЍO^]Q0 00000`0 PPPV0/op"/8A  @T@DHX01H0#0T$0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H k X  <P `J@ GrpT @DPꀝeO-造Mx@P` p߉0` (0 0l M,1 0(10$10 1H00X9Y 1?o2P0SЍ耝eأ;C-M 0P`` @|p0 P 00 00 0 0@Y?o2P0S  BP Ѝcp@-@P:@T $@DT\qTpP 60S(@0 (0 0IP뀝eDBh;A-0pP@TU,`T`1 ᚝@DP0lDBD0S/0@-0 H ЍA-@dp`P0S$0C(@@ R (0S $0CS `PAꀝeuDBp@-@P T-p\P g@8<0@ @}$ n~ p耝eCB Ydc(e@-<0DT 0 !0  !@c0@- ! 0 !A-@`XpPU 00`0S 0U0  03/f?(ep@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#212D@T ~ 0"0#!"4Ѝ00 030 kgb`P0S @D R 2x# P1  PT  C\0 : ;0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ :07>?00A0Q01 0ٕP00 R : :  P( U 0S40S  81  00000C0( @D0P0*i>(  '2 80S 40S 0 @PU 0 @PP220:00lp\ 7/U P @p03/@c Yd0CBeeeA-P43,a @T @DT@T $@DTAb!0S 0SVS@0S&$008P0(00S MpP ZG<ታ080儳00=(@ꀝe YdO-@$Mp,00@T P8b8@DT$ЍL <0RVSM (A婺0 0 0 崺 H0P: U&a000PPPE%卺0 0 0 嘺W  0R H/  0 S$ 0S,h0 0 0 sP0 0 @T @DS00 6P5Hoᨂ0 pQLa :/0X0 ꀝeMbA-@p `PBM 2SJ@ @(@0 0@S  q02 100 0 0P`5BߍD;@-0  Q:0 0(0 0QS Q   Ѝ>D;00@-AM@0 0 0 0P00! ! 0@u  0S[ 00#212800pWY `$pGW(#2!128W L8Wx8W 2;C?>CW >0W >C 0CW H4ЍO$8$(0 S008(0 Sx007W 0Wn 0S 00`7W:> W^ 0S  b`l7W  ;CW0CW5C 7C0C87WA H4ЍO6W` 97W >C0CW/`䖟 W 6W'`VfX! +0 W0@P0X  &0`W`pp:yP$V#  V L,6W! 17W 6Wh 000 RV 5pW $pGW`5W 00N L 0S0Sx%0 R01 5:S 000x v ` XX  `,5P ṯP `~00m FN f 0SF 4 R6`P0400 R0S 0 S `00  0  5` 0 (00pW $pG`Ps  0S R0P  WS R (PU $PEU`4pt000IW  P040 l 0 B R`+0 E0 0A0CS…Q%X1 ܕ`P,0(S(0S P P`` 7`*a 0S S "000(pY1X*,1`{@?P 01 1{ P 0S 0 00( , 0 !(00,00z060w000s8000S080l<00S<0e0@0b@0 0D0@cwt@HpB@~B f@pBEcEczBe YdoB@|B@oB@< $ 0,(p80NPQ0 00!0>`0,(p$ `80< MP? ; 0!<0$   ,(pMPg 0!p00<0 ,(p$  M0PU    '.y` ,(p$0 @ 0`< MPB >P1S ~?S?11~oS1O@oaN<;EBEBc;8FB0;@Yd0e;@e;O-LM@c \`d` P@_: z t~ 0@Da<00,(@$  `D0mMP <kLЍ 0!<0$ 0D0   ,(UMP 0!00D0$    ,(CMP 0!L0>`0P,($ P @0D 0MP ;T;EBEB;@-@P8: 圭 K@ ݥD;p@-@PY`# Q   * 0p@W   RP PP   ;0 <0x 8RR00R0S 0S/ 2:;0;A-`pS 㓥PTP@ p 90V`` B8;;p@-@Php0p@/A-M`~Px@ppTЍAx d3P q~v@@eYd@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@;;;0;;;;X;\;l 0@o/;A-P`pJD@5PUAeD400S[7/3@P@-@4f00( R @@0000@0edc@-@0S0$S   00C0@0e@-`pP@M>PVP@vЍT@UP\0pWU   Y0S   =+@PpPE`?@0edc0L YdO-0M0b5p  2PP, 0 X`0@"40200  2 .x$0(0`0`ЍH;0S@-@m0XPm@,/0p@- 0 `   H0D0R@U DPU ?D02DPSH H0 cmR0p@%PH0S D0SH0D0H0D`SH H0 PmH`0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S MPP0Ӕ00 Ѝ0p@-@`P5 0 50Y3Upp@0⼔0 L Yd0S/ L YdA-M@`PAp0堔P00GDPP@AЍA '.˿PD@-3M@03XkQpḿD`PPԿPL80PUЍ᾿'땿`D0S00P00C0-,0S 3/XPcG-VM@V/ vp M }? 08c13"02Q  ! R!"0S Qu050 a, bab8䁄刀 2S C7  0 2WRU DPEU RU& DU# 0ZHP /%0 RS  R H0 3/0,P0 8P4.&U$1PU"  JLv81'P Q01Vߍ40S 01Q 403/0SXP0S    H03/,Yd@Yddc0ezFB@;c0L ؿYdA-~`u@pT l0S~s@DfPP 0 R Dc@%P@3 P 0S 0%P@e;p@-@`PP@P BlpA-~`/PpU@ l0S~,P3 DP@ 0 0R DQ $P@e;p@-@`P@P .pG-pW0S !S* 1S l Q`~`P̐Ul0 S DP@~P 0SP 0 S:V ` ,  D.Pdc;@ep@-@`ᲽP@P νp@-@PZP@p@-@`ᗽP@P ᳽p @-DvP00SDuA-@p`xP@P iᓽA-P`$V  l0Q R DJP@ 0S 0S &$P Q $P   0S*p0   D';A-@p`)P@P DP/@-(0pMPL0`  @P %(0, SS  3/ЍH;Q/p@-P@-0} QQ* 0SCA\T' S("0S!0S  S 0 |ظ!R01d0S8Q Q p@-8C80## FBFBFBYdXmA-`pP40@TA80S 3/X@cA-pP@H刼W`40 p0H0(0DhP@A蘼G#P DbDUP 0 0R DRL0S h$0e@-@@@-@~@|0/0/0/0S/  Yd0 R0/dc@-Pl 0R;C-0` M `00Q@S 0`8`0}? >aCaaq t@$aab żb)T!0  40!` 0$10V!0 $0 p䐟00S0 SW 屹pP0Q:0PSp`W !q`2$AЍ0dcYdFB@Yd0eFB@-@l@0A- P @0L ^U 0S t~`p_@hpT ᏻ 0S0@A8l0S P ~M@@e;p@-@`NP"@P 0 gpYd@-Q@MP@`pPP@ \ V  @Ѝ0<S %0! >@0A- P` @0L ^U 0S ~p@ကT l0S ∅PX0 û 0S0@A~@@e;YdO-p0M#08PQX 6^0Q@t XhYP  03/@bNTdhJP   03/@RNTTG:P  03/D0S  Pb `]PPPtGP  0# 3/'0@gS8'SSX `V@` PqEd~@OpЦW ~>@X0`C`Ѝ< <0!l PaR_0SCD +P `qX` Vڐ P$@P0`F)D@ P E@ < ~pX` ` ޅ1Vڐ P^$@P`F@D?@< v3@7s3@Dp3Pn3k%Sl $ Rt (`Pf@W (0 00000 0Y@ (T P0S$@P4 <P <p@ 0$3/@@P 0S-@ <PP@ 3|`|0<M03/@P |`@ j@"0<#S 80#S %'B BS #S #S#W6 0 0 0` 0w@P* (V"S  S"S "S's |"Sx"p"S l$'a S `M BS[ BS30] P@0S-@ P[ p @0  4/@ NT0 0 (@04/@#00#  GpxW#0T00S @q|P/  03/@[  妄 0ࡄH{ S#B%B}e Sb O!"'S s[ SX *.l82@52@&i@c@c@cczixi@eYdxi 0e;iiiii{iFi@ui niiiccIii7iiiG-Ppጸ~`w@|T l0 S 50S0 0P80 Hᓸ~`@@e;Yd0  6Yd0 她YdA-p`P'@P 00S0L  #PP #@  FBGB0 ģt;;b 季;p@-P@l40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@- 4@QPM `=1h0Q o0CQ 0Q 3QK `Ѝ3Q 3Q 1}0Q,0 00P0 0`P0@S?` SRp @㠛? p !`P @ᗛ3Q 0CQ 0Q 0CQ00l2Q 0Q X!I`0!  Q SS  @#!@  ! ! !1 ! ! ! ! ! ! !! !! !!,!1<13" 4`t3 1 `1 3 1#>0880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @qP 0?S@ Ѝ@b!S``iui vi iiiG-l Qp`PM P1Q-@UV810 00 00@P ލ@f6T @oP  0R ɶDPP1@ 0Q Dv@P W14  ]41i iQGBC-qM@`,P)  03/P5NU# 0S  S OPp@0S   m  '0SЍ/PpP / +@cx0/p@-`Q@P R 0 0 0 q$7p000SP0PP00pm*R 7PX$0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  ^mR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PP!p0@-@0M0S0咳@P  UЍ0ϖozGBp@-Ph@ᬠ1 01  hp@赠@-p0$M03`A0AS P R R R1  %/@ #MRY R +@ &000 S( )04 0 #RH L0S0P  p# 0 001   01^000000000 0 00000 005@P #T@$Ѝ3  r&0P0C@0@ 001 0 S&#0 €< 04"48#80CS=10 001   \110000000081000 00@P @j0  0H   C Rw0C0000P( 0 (00(00   t0T0 0 i0 @P| Qx 5@u2@7@GB33@-3A0@S AS S :<2@S 3/4P@-O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20 `Hp2Y HYRpUHp0 0pW0\70PPY0ݗ0 00  pP0@cp@-P`@Tp  P P @A-0PXMP- 00 0XЍA/`@p 1#`1014"410 0CH00UL 800(080@`, 0 0 0 03/XЍ(e@-@MpPx`z0 00`zP 0 |PЍ0 "|@oGB\00@-:PL@0 R 00 C0.APAAꫪB Xep@-PQ@M 0 E040060000 $0T l00p0 200P000 %U 0 000#0PR,R02p0LRlP0HP` (06/0  U NDЍp耖GB<*<<<(eHBp@-@0|0DjDRx0003/H7RUHqHHRQp0S  0 庖20C24(e40SD/Q/D00S/   ! """ GB00@-0PS0 O T  RQ7@-\70L QALQ 0,aL\(00L S A@LT 0aL\  0C70C020 ^0S?.S,S :S/ 0C70C@-@ 0R R% RB 5~0 0~ R '~   ^           R R  R  R P~ D3          /|HBHBHBHB@-`P@HQ  `P/`%0, 0) " P 00 0 } }0 024`S 0 0B0@202HaT ᴕЍp`@-@HP  a`P/` "@P 00CS 004`S  0 2H0C23ሕЍp`H*</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Spt4Pp3" p@;1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00So603 P p7Ppp@1PpL2!4<01p0 " $"S $2p@p@E8"Rp0S 0 0 83Pvpi1iii2i(#iX8i(iHB 2 @-$2@0$20 P$20$2/(2S /@-$2@ 0$2 P$20$2G-@បpP(ᰀH(20(2p02P0H028(Z p@2S,`Yp`%V v H(20C(2,2S0S,2?02HW  _ p 3/`P  0S0S0 0"p@-@Hj,2&jPU R,U 0S,2?02(20C(2HU @2S 3/(2Sap 0S0S0 0"PpA-@` Pp0H   CR0C0000T7@@#RH L0S0P  G@0(00(00S]@P  z0  $' ! "$ &$ "$ (?Q0@ a060HB@-0S 0 P0 'P Ѝ $"$# &  $ "$  $"$# & Mzq0C-M 03` 0 SPdp0弐cS0 ỹ00004PY 0@DC5( 0 0Yv 0 00S:0 3  00P  |0P<<00  0:0(Phg(0, O0@,@(0hq I/oP"0#2 D)D NPP p0D#DH# $H)3  0 0<P0 < PPU p0D#DH$H pzq Ÿ Io     3:#:SC1T Th & 1T (0Sf0 c00C S.0 S   0:0d1T?T  *PP  z /~ 1T,  T 0T0@  '0T00S 0@0000@000 0 R v  P3Ѝ XeGHBd 5Zd݆%cĿcc(1O-0 QDMA00(0M?0`p0<< 0 0a 0,$   0 0a,( P @< 09DЍ|RBXeGBt hl 65;  & ;0040 0P0p0 000lЍ$p@-@PT0SPPp`gT0P`P0CT0@-B@P dxe֟xep@-6@ @& @0@03/POP bOPx00Cx0x0PS L0S 3/H03/p0Cx0A-`pP% 03/@tT3@ @0 8/@`T x00x0YA-@p@TAlL0S @ 0QU`0S꬀g6P`xeheG-\@P`p@TG0!0S0 $9/@xehep@-PL@P0  R 80<000@0,0$0(080$0H0p 00o\࠳ࠣSp^ 0$0\@X`6pP@X@\`60T`!C`@0@0o(0@,0( @`xpeQBEcP4  0 :  <08 ,p$` `W*40AP 0@00 ,p($` `P<08 F*DЍ4RB"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PR{ T @(@ЍU Eg Dg0Y`* sR `FU T`T BT` 0 ` @  YoP@0h@P  0 0T g0  `0pS`P k@U *PQ pI Q`FBo B10P0 00 00TPÏʁecRBRBp@-@Q`P 0 g0P @pnPTp0SpPO-P0M`Q@0  HpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUff0 S0 0 TVV 00 0PO P4PpPRBA-P@k`P p   BnP TO  mP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@kQ e  BR  \R\QN 0 Sl!0 SD9 0S0S0 0 S0Q00 R Q RSR 0Q `U P0P0 RPPQ AQ  0 %SBISBeSBrSB0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ ~0P@  pecA-@`pp 7R( `0PX 0 0`0d0(0 0 0P0000 0eu<||<o<u<0Sp@-@Pp0P 0pp/p@-Q R 0000Q R0PpP@T$X\ 0  Q 000P:hP`P` @TpP@ 0 00~eSBcSBecSBSBA-Pp`@#)S"PP000q10S0@@`p@-P@0`S   00U(P}0S p@3pep@-P<@ 0 PR0䅦00p@ZdZd40+ 6p@-40@P@`L0S0L00x3P0tP80S`P@T嘗Dp0IE/@ZdZd@cZdZdDZd@-40,@640@0DL0P0@@Zdp@-P@U0P 000P Z40pP X0 `d0  `d Q0`5d 5 p0@-@@p P  PP 40L@040,0 GP,00,0(0S  3/$Z(10(1 P8 h3  =C 8"<0@TV 0 Z8g`0S   R 0 0  0S0C004х.@P  JV4 @  P  P  P 嬅7`EW p  PNLP<0S0P0$QpP 07PP 0 H0p媈1埓(0S  3/ #`P ᗈtd0S uD1#2!12TЍ0S , `Z @8Kg P000V  @C@p P Z 8/g`T7 T T`,PU00G~,gPP00<3`@c epeUBPe)TBZdO-`TMP|pPq 0P0%3 @@PA]Z @A20x@PT0L0S 'P 0S 0S40@ 31 4 I0P DP $`(Hp0UQ4PP AP [ Z RZT 0 0 0 P @@ P4 4 @3h "$  "$4 NIx0 80 0 $`(7 TЍHePe e@-@Pp`0UpW01X㾁V 000 |W"010 w(0S`AUpXp㾁@cVBcUBe\ P/0 !8 0 0 (  , !/@cdddO-QM`p @tЍO\r^oܕ000l00p00t00cx0 0|0lPUU47[@@T@P@ m0@0 ER45034 0bA53!"ى50,0,@00T1 ~OD0T+ U p0S   0S l^P@0S T `l YPlLPP&Up0S "Si20000Sd DSb D+ ᳉0 0 0(00l0P|0堰S8 [5 x0S2U U UH pPI \ (0 l;/ [ N[30S 2 030(,0 0 |P|0 0|0D0"4 4Z DJZ^00004D1@0@@T^ ~ODZPP@ R  Q^ X$0 $060U00000>800 l0lP%|0S" 0S x R " ,  4   R㸰 R԰8 |$ 8P|0$ 0|0وX$ [$0 D^P  0 l3/ f>H < \03@P8 1@P`0PpH0x0AP 0 T Ѝ蠍c@c000S/0@-@PM4 > 8>2 43H@008 1SS0SЍ 0C#^10SY0CS!23 U !5% !D!C ńacP  03/m`0 D`0@00800L01H08>2040 0,00131`000S0 S000 0 ,zP 0, V W 0`x 8000`400`>d03` ,1`0p02640h00x0x0FcFcc!@NVB@c@c0@- 0G Ѝ@-A Ѝ0@-  : Ѝ@000S/-0 00 <P H0SL0S 0 R00/0S  $+4 $0h~<Ѝ0` TdWBp@-`@P@THp@0U@H$ #Hep@ eep@- PS`@(M 0S0 @T!>0000!>0000P @ 0$0^(ЍpTdr@-@0S00 e@-0  @0T0S ( 0 }ЍꔎcWB 0 0 C-0PM  0!S1000}Ѝ蠁X R00ЍC 03 HedTq@%`VT4] t 0!S10<000U`IT HЍCtd  "P"X0`` 0 0``0`@T0 @S p ` BD `0pe}}*i80HJ 0( "ЍCXBWBc eeEcl<@-@MPU 0   0"S2000Q}`# R   0LS@20 0rA0Q 2T0S  0 0:.}(`V "HcᬿЍ R% 03aA0AS   00  0Rh`I0$! V" R&000T0S p ` `0 pf|000 0S0 0 00RT0T0S p ` z(`0 p|eXBWBXBcEcl00 @ @]$1 03/@ЍpO-`0Mأp P@P 6 6S 5 J@Ѝ3 T V@1T2"$1 0@4/@oX uT060@i0 0 0 j@m'P0!  {@꬀P E $1 03/@9T,@ 0 8ЍO eYBYBYBO-M0( P0`pW0@ ⶀ0PP@ LNi`0d 0 `0d i0%@P 3!  =JK $7J00  {i004 0 004 i pW$pW@K~;$  G ((P @P(Z Y!X~ 50R' {Li@0D 0 @0D Wi h5 0 h zU T pQ Q ,,Up T pP}lpP T ~W (ZiX0\ 0 X0\ i5 PPYhh0l 0 h0l i hdh0 zP4(4ᔙ8က#80 0Sl`hP0T 0 P0T h$Z (9hH L9 H LhX0US 0S SZ00 ( 0% PP U OP40" Ph P 0 U`  0 0`0C  `006z 000 0Smhp0t 0 p0t xhX0S h00 ⺵d0h  z$0S0 SbWKh(0, 0 (0, VhVȠ̐ 0   `00yG PZ6 X0`S00ʠZ5 0S ZS!.(000 0 PP}$1 0P5/PfY lU06 00 5 NP 00 H6|倵 gx0| 0 x0| gL0S  hD Hh0y00  fPPl@00S g0 0 0 gP0S h` @0 000`0Wyg0 0 0 gH0S  h 0Ph Ay5 5H6 & [& [㸶US Y !>00 0@0 _PYD !>T00吠唠0PTTSXg ?  0agLg 0 0)Wg 0Y0SZ06oᩒ0S&2 0S6b`Rg 0$ 0 0$ 'g$QP0"wP  G0 0GTݻ G $G<0004 Q0P<<00000(00,018f0 0 00 00 f 0@hЍ)!>0吀唀$1 03/X 6ᬠ  Y  OG KG <00000Z8TaP/ e(dYBYBc[ZB(ZBZBZBZBZB-[B`[BG-aqQ剻@PG07yaf0 0 0 lf0S@PA /{P 40 ᐐIoᩒ S)F{Y =f80< 0 80< 9{2fX0\ 0 X0\ =f300SR@P  4"4X ;C RL f@0D @0 @0D fp 1  5   EP 0? 0#PY@d0\@S3  pE \EЍ00E0 <00⸰FꔎcEc[B$e eA-8pP`@d1!01@@Ad ep@-\0  up^0 RP02Ƞ@,Ƞ00   ! 0 p@C 0, 04[B0 3p@-@`P< 0 0 p@+O-<`Pl2M@0 0 00D2U5P0``3XTy`@P 4l衟< lPP q00PU:cyЍ 0 S/ R 000h  z0S4pP0p Hy @$04/py@W  z W V hy z` 0S 0 S S Rh  yy @$04/xZ@  y00P Y V hy y`  (eZdp@-P`PUpx@@8ty @ Dn0LP0p茏cZd\B&\Bp@-@0@TpP Pɀ` Àp茏c(eO-$P2M@0p@ 00!>540@P吢H0 0@X0xT DdP< d~`PH00`VMxU 0bh@Sw Yt  $09/ OyЍ 0 X S R 000h  ,&y0SDT0 kx $09/>xY  ,&yY U hy ,8y @P 0S 0 X/ Rh  ,x;x $0:/xZ  ,x00`Z U hx ,y @P  x ](eZdO-$M pp@P0 `fP 0倐hS [  $0;/@ x$Ѝ x @ ὠ@ZdO- qdV Q ʀ !  , !p0b[@p /00  0唀0 0$ hWx R l$@ !d1000  ! Ѝ@cdddZdG-P`U U9 $0pp [@ [0Ud0 P  C C$0h(P 0(0$0 00T0x 0< }T`00`00<p(eZd0SnO-0S4M$PP!P@3 P 10S T. 0 0S0U0SvpD00`Vw ˠ4Ѝ`` 0 lP 0h wxI0S" 0 S/ Rh0  0w 0S  0R v 0 p$07/vp hw00`/@ZdA-d0Pxq@M0D 0S S2T1pH1p(@< ~U`F00< <0}@P~PĀMv}~hw6Zp3Z@Ѝ`0< 0C`00(|<0S `U0P@S  0 h@#vfwZd(ep@-HsDP@`L@T403L0$l@P 墶p[dZd@c[d@- @@Y0DL0l@@葶Zd0L03@o/Zd@c0 0 0 /@-@ YO-p 0M !P``  @AP0垆 0\ a0 000000@P?o2P0SЍ=O-,`tWʀ 0! $!0     !`@ȐPU` 0! t0 x   !00C0 00 0S003/ .h@cddde pi9e `4e P /e @*e ,%ep4]B4=0e`=X==H=|==@-8@0 P 00 0 0 p@c?o2P0S 0 S$  Q0ЍPe8De 0O-DM(0 0Pp b!0 ,p0800P$  @C80 <00!00<0 (p,P$  / 0'!|1"< (p0 0 ,P$  0!80 (p,P$  .0 0 0!08N` (p`0 0,P$ `(pp'㌠ 0 8 a,P$   0',0 0 a0P($  DЍ^B=@- R0R0 *0R \ \ 00S `\ \ \00SL00S0 80Q L\00S^BPe R0 Rp@-0@P*0 R P@D T00SpT /P \0P0 SpSp(00S0 00S^BPe 0 /Pep@-|P xS#cp@ lkc \c L c <c ( cp^B!=Pe=d=="=$=@-0@!cc ccc@cPeP@- P0@ P@ dd 0 \ 0C@P DmЍ0D@P lPeX= _B_B`B@- B 0RS d00S Q PQ @aP4 0DPЍpel`B@-B B  \03< x00S @vaPX 0CPЍ$00S bao@pel`B 0O-RDM(0"0p`008 000p ,`$  @t80<<0)000 00,p(`$  ` 0!'>P ZN$Zn ZJP & ZDP Z` ZZZ ZZ >P Z+$ZK Z'P ZC ZC x>P Z$Z3 ZZ- Z PZ% Z% >P Z#Z ZPx & ZPr  ZPlZ Z u>P` Z#Z ZPU & ZPO Z ZPG Z Z P>P; Z#Z Z @>P+ Z#Z ZlZ Zd +>P Z#Z ZP & ZP  Z >P Zn#Z ZZ Z =P ZY#Zy ZyZs Z!Zm Zm @=P DvBTvBdvBtvBvBvBvBvBvBvBvBvBwB P0C /-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/wBB(wBP/Q //  00  00  00  00$  (00,  0004  80<0/@-@N@P @ "G-@MPXp @p P` 0@DS @Ѝ@`N@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@7NP000//o/00//p@-@M P@ `@M@T@@N@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ MPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU/QO-R@M2 `ᡰ@[N00<0唆+00 0<  BS 0 KSP`F0V6*0PS㔃'!F<0pG   RVKЍ蓄% 8 09/P0P0'8 09/P0 Up0V* p꓄' 8 09/P 0p0% PEWP8 <9/PpG0 Q /@-0s Ѝ F= 0 R/R 0+wB0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @-0@-Q K @\@ ,0CS @PUT S @CP U\0^ PL_UQ@A,à0@ 0@ 0@ 0CSQ S`0\\QPAQ00@0000 0@0 ! 0#2 /UUUU3333 @-\// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00$/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-g0o @-@oQPO-(p@@@, P`T @H.`VPW:/@P WRQp@-@@P@T@ P`Q@%.PPPpQPp@-``` P@.@T`PpQPA-`` p@P.W PU`@@@-0 0(0000 0P 0@ЍpQ=@-0 0(0000 0P 0@ЍQ=@-$0000 0vP ЍpQ=O-`pP-  H@P W  0 0W H@Q @-HR @P,30 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,U @k0@P`TF  00 0S !,! @D ...|.q!!,/LwB0A-@R0@P0`?S + S# *S, R& M[S0^\PP^4 ]^F S -^>pQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  [/Ѝ@-@P $S/@ ( 0"PBO-@0$M(`00p 00P0$00D2 0@00  // $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0pBBA-`P@. $QY ?PU(p8 0 8S($)8 c; `.7XPP0Q`pDa(!"$a$"  q.0Uh ЍA@S )@ c8 7 ) 0(0G-PR2 p@q?p` @g(U: B. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (#. 0$ Q0 0$  0$ @H< 0$ @ .  0$ @H< 0$ ?XG @-Z@-@P $-@ ( 0"pB@- @-@@-@P @ (- P 0$$萘B0O-P \M@000 0Pv00 8`$000 : o#R?0V FAa#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@ꔛB0`( a!"$,a c"/G-P`8 p#T0.@``T%0  Z0DD 6ੑ  cZ&1000DDD0DpW@@@%Te-M Ѝp@-@ P` !LNF! !@ApA-PP@#*pM`P @  N@P `0@PWP )P s)PNUP@@-MP@@@`@pT:Ѝ Pp0P00 cFꈧBB`c00yara0tcid 0 c 0 cyara 0 ctcid\ 0/\ 0/yara\ 0/tcid0S 0 }/c0S 0 r/cyara0S 0 f/ctcid@-0p3A#+`P @ 0*.P 0I@PP @P0(Ṍ Ѝ@c /p@-@P")0PPptcidp@-@P) 0Ppploob@-@@ @-@@ @-@@ @-@@4 @-@@K @-@@W @-@@R @-@@M @-@@H @-@@C @-@@> @-@@O @-@@` @-@@n @-@@| @-@@ @-@@ @-@@ @-@@| @-@@w p@-@P((0P pP pgntsp@-@`sP{(@0P pP TpatadA-p[Pc(X0P `‹@P  P @ԋgntsp@-@RP dP'pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P  p@p@-@P  p@0!P/ԛB@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  LPP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`P@pWY FWl g:W =W *W # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8ЍL3H3 S R 0C# M0   Q S@0S00S > @ @@0 SbW' fW ?R0@SfWQ ` b6b` B@S8a8  C# c,1 c0 0 FW'Pf0?Sp Rm  P  c5S CP2QPU 0  PU H  0  Y=  0 fP0U08  0R4 XS+=W 0  Q  @U 0S Y 0 P  @0  0S @ s $0S,R$00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` Pp-@-@`P P@ Ѝ/p@-@P EPp-@-@`P P@ Ѝ/A-@`Pp P-@-@`P qP@ Ѝ/00/ c0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

0BP/0 SP0//BC-@P ЍPo0 RQY0 p 0pᝃ`P 0H S00Q I p`PꥃBBC-@P Ѝ0Y0 p 0`nPP 0S00, pgI `PPzB'B0P -?o42 ^0S0 S4 /BP/0, S@-P0o/BP ?oH 2\0S 0SP00Q|/BBfP 0 SP0m/Bf@-(0pSM c`@V `0P PP 00 0P S Ѝ`0S 0 "R00   6P,BP 0 0#/-0 S RS R RP/$0S @-!4@坌ce=׌긦e@- 0@a(M 0l`S A  H H P(ЍЀ`, P + QB`BXBp@- @P!>p踦e @-V06踦epB 00 S  \: P03#/S  \ P0///p@-P0S 3!@P VXU<@P tET LPP ?4A0t>@p$@c=eeЦeB@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@ 耞B /P/ 0R" 0 !SR* R0*/-0  ^: P*0  S */@/ //@ 䀞BP 0R//သBP 0R//သB0P L P ! R0* /0 \0://သB0P L P !  R0* /ɒ0\0://သB0P \ P  !R0 * /-!0 ^0# %/သB0P \ P  !R0 * /-!0 ^0# %/သBP/ 00R!  S //သB0P D P  !  R0* / R0://သB0P D P  ! R0* /R0://သB0P 8 P  !\0/1 //သB0P 8 P  !\0/1 //သB0P < P   ! /!S //သB0P -?o42 ^0S0 S_/သBP/@\   JQ\//သBP/D\  Q/S/Q\//သB@-@pMPW ` `0S$(0S!0+ C 00 0S0xSW  000000SЍ  pPꠞB0BR"SO- GP`0@ pD TWpp-T@p` +T@`00T 00XS0 A B0C QR@`9U70T PPſ 0  000D ^aD\WDAD\7D U0S0:0QP00\00S 0!0@P0 pY ЍY S FB0BR"SO-@ ` 6G0P pE UWpp-UPp` +UP`00U 00XS0 A B0C QRP`>T<0U @@gĿ! 0GbW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0SݞBH-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0  `PO PU# 0S P@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00==>p=p=Q@- o/@-IM@qpP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 bP ` 0 0P0 5/P 00BA-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S /P0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@BA-`[pWR SSS P PPPzzP(0SP 0p P V` P PP   PjByBdB~BB{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P IzPP@pPH5@P <u/0 P`000U MzeBl갨e$0S @-+@! ce,=@- @   e؟BieG-@pP`VU@ 0@焑QPU@ `F¦`@-@4@1p@-P@@ӪwP%pp@-@P X0R@yPP@p,00$000@00 0긟B== B0 0C0s@-@P 0U S y▪l6Ѝp1PP`P 0 0+PP0 0C0PPeA-p `Pxy@P V  ! V @pyC-P0pS`@M>0}S "S my00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0S(y0h P ,0S(0S  ,bP \P=BBp@-@P `\0 R@VPթ PPPV @p긟BO-0bPS00@0幩0S  ЍO BP@ Ѝ+P pP 0IF0 03008P  00C 0P F@U R\ Q ` V c` P 0SrP 0 03/P  0R#P P BBB0,S<S4Ȩeee@-@ 质ep@-P@P! 0 0 0p@pG-@P 0R@ p PP`Z@ 0冡ᆁ!> < 0冁 0` 00V:000긟B0P 00R@-0P   0/ḟBp@-@PѨ000p@!p@-@P ,0R@P㾨@p踟Bp@-@P L0R@P`᫨0S@#*+@p踟Bp@-@Pᘨ@pA-@P x0R|Pშp0S `ӨVP 09`P p긟Bp@-@P @0R@ P`_ v@ᯨp踟B P /o00"\ R\0\`/ḟBO-@Pi pl2 R02  .PP @npm@L0S (& PP []0Q=P8P/O h P,U<UU p1P` `1 k 8P ,PP *,P#U@, Ѝ` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@긟B c,=eeȨeeeBG- pPW` vW 00@ >P 0S0,S  0 G0P -?o<2 ^0S0\ S/ḟB@-@P+ 0R'P`G0 @P 0 0 B! 00C0000qo Ѝ@{ Ѝ踟B0P/?o( 2\0S/0\ S/긟B0P -?o42 ^0S0 S/ḟBP/ 0R/B0P -?o42 ^0S0 S/BPG-@6 @`TPp P* ʦ Ǧ0 S @ Ủ S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@u0P@ A /Bp@-P(U0@P 0P0 0p蘫eBP 0RR @-Mo//0Sb G- 0PSGt/ h@PR  pPWW(G0 0"!00 Pa#.<`P%c?P6 0$P0 `0P* P0P$ pGP唀W%10`` P R0P&RP0P Wa<`=0P =P/ᴠBB@-@0P u_1蘫eO-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR30ĠBA-p`PV@PQtPP  P `PQp@-@@ P`;t@P0p  0P@ PTHtPQPp@-@PP@PP @p@-@P D0R@00S J @P000ꔠBP/ 0R /ᔠBP/ 0R/ᔠB\ ?o@-H 2^0S0 RQR q 0 /ᔠBp@-@P D0R@ P@ sPP@p U ꔠB0P -?o42 ^0S0 S/ᔠBP/@-@@T ?o 2^0S}o蔠BA-0S6 (P@U2`P& 0$!P( $0S%  N$ 00 RpisPP 00  0{P zs 0pPЍ 0X PP XasP@PP U Vs@B B/P/?o4 2\0S0SP//$Bp@-P00S $$ @U 0D@Op(ch=e@-((A0@ 0;$Be0 SBTB@-@P 0R@*$BP/ 0R/$B0P -?o42 ^0S0 S/$B0S(0S @-0@ /dB00C0/0 P R   //A-`P rPP@PPj-@P Dpp~0 P`000U r꠬epB@-@ǣ@ģPG-@" @`TPp P* [ X0 SS 000 0! 0 0!@$0  B @ⓣ④@p@-P@@0PႣpp@-@P X0R@%rPP@p,00$00X0@00 0pB= =G-`0DQS@0SPG P@CrP PP 00 0 1pP  00C 0OP l@FP0 03/P  0R 1#BPꐡBBs@-P@ T R q⥢`".ЍpADAP`@ 0 0:P@00C0@@꠬eA-p `Pq@P V  !V @pq@-0`SP@p0]S @0 @P  Ѝ P 000$ `P ,0S>B0 /p@-P0@Q q 0 Q000pPpp@-P@P 0 0 0p@dqpA-@P x0R@ bPP` N@ 0q5 0q`0V:000pB@-P000p@-@P ,0R@Pҡ@&ppBp@-@P ,0R@P@ppBp@-@P L0R@P`᭡0S@#*@ppBp@-@Pᚡn@pp@-@P㍡000p@ݡp@-@Pအ@@@ҡpp@-@P @0R@ P`l0S 0@AppBA-@P `0 R@pPT0@0S@ឡ 0 0a000 @pBp@-@P <0R@ P`*@{ppBA-`PV p@PZ X 00S 0Sx0,S00 AA-@P 0RPp0 0a A? 0!1 0S0C00000A pB0P -?o42 ^0S0 S /pB 0Sp@-P`@P (0S p@:p/ꔡB-0!!00!1Q100 000000 0#0, 0#000!R0Q000! 00000p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0}!000p@t000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG- P`pX@0Q0000R0000@ @SA@@ @H :/P  1P@0R000000@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!00000\00!0000000T   0Sp  T`"P P- 3 T!, ,  1000 T R`T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-4`P0@ pD TWpp-T@pP +T@P00T 00XS0 A B0C QR@P(V&0T ``f[ 00D \a0DSW0DA0DS70DV P   S  R 0 @`  X`EXRȡB  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/6  0RR! R/P/0@ 0A0S,*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//1A-M Tp @00S 3/P0`7P V 6/0p `Pލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0`` 0R,0 @0 4/@P T p0  P$ 0 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@J@%cp@-P0@Q #cPp0< 0 Ppp@-P@AQpPp@-0@APS`0q< Q< <Q< >Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 ( P  Ѝr@t@b@n@@T(PBBBBBp@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPUa@P  aPa<WP0 Pp 0 03/P P 0S PP|PaPaX 6P P(VP PBBBp@-@P` Ppp@-@P Ppp@-@P`E Pp@-#)¢B011/A-@pP`P UaPp` P102 P @-@\& P QRS  T00HaLQ R S "  T  00 A-% M222s5Y^W-뎽뽳a #K*늢맳M?b wdhihN믩7t Z_+UEgxTZ:<儠Loc,#륓s"e14 9<  3Q% 30S#* :3#Q% 53#Q% 5Q *ck.(<ǾkyL؆f۩;grg0  ߣ08S$J&q7빣ST 2R @00@0 뭨U %p2pc Pp8@eTᝏ!fh 멣t0X"  000R@P4;0Jjujlgdp됾AqbU$P'PU닪1܁k,j1@T(ej@ѺU _ 1Q @ |1PdV P. '`%0 000rs/Ii!( A0( ?A3c01|pW-j@>Z 0/MZq0AD 0 VP!Xi0x0T @ j'@vcd@cDcEcl?eEc N'0DeAcJdb2&Act]eHceMbcpAOA10A :dmd%d: internal %s image area dkmatch_bootdisk: can't get label for dev %s (%d) mainbusno mainbus foundsdwdldWARNING: double match for boot device (%s, %s) boot device: %s iicziicnonei2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!@ 0A @ 0H @ P `@ p @ p@ @ initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller couldn't map registers scoop%s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopunable to acquire bus. error=%d output write failed. error=%d : GPIO controller ioexpzssp_init%s: not configured. can't map bus space couldn't establish power handler zssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846%s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferdefaultSharp Zaurus LCDC(.}Tccouldn't establish power handler zlcdstdSharp Zaurus frame bufferdefaultSharp Zaurus LCDccouldn't establish power handler w100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) console F F F G $G ?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ couldn't establish power handler zkbdM>N> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    : pseudo power management module zapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller couldn't establish power handler %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %cconsKwG m S>@h @i j k pk 4`l p'6l 4 base 0x%x-0x%x irq %d drq 0x%08x core %d mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus**************J***************f***_***U***Z*gmv******C~Y$&/4~mxo>sI^ 3!!!!!!!6>0x%08xr%d, rrxlsllsrasrror, %s r%d, %s #%dsplrpc a>a>a>l_>a>l_>a>l_>@a>a>Pa>a>`a>l_>_Ma>a>P a>a>a>b>@ b> b>P b> b>b>b> b>b>b>b> $b>b>(b>-b>0b>-b>4b>9b>9b>@b>9b>Eb>9b>pPIb>Nb>Sb>Wb>p[b>_b>pPdb>Nb>ib>a>ib>a>p mb>rb>p 0vb>rb>p `{b>rb>p pb>rb>P b>rb>P b>rb>P @b>rb>P Pb>rb>- b>a>b>a> b>b>b>b>b>b>b>b> a>a> b>a>b>a>b>a>b>a>0 b>b>00b>b>00b>b>00b>b>b>b>b>b>b>b>b>b>b>b>b>b> c>l_>  c>l_> c>l_> c>l_> c>l_> c>c>"c>&c>"c>a> )c>-c> )c>1c>/5c>8c>o:c>>c>0/a>8c>p Ac>Fc>Hc>Mc>@Pc>Mc>Uc>Yc>@]c>Yc>bc>hc>kc>hc>rc>hc>yc>hc>c>c>c>c>c>c>c>c> c>c> c>c> @c>c> `c>c> c>c> c>c> c>c> c>c> c>c> 0c>c> Pc>c> pc>c> c>c> c>c> c>c> c>c>c>c> c>c>c>d> d>d>d>d>d>d>d>!d>'d>!d> +d>!d>0/d>!d>@3d>!d>P7d>!d>`;d>!d>p?d>!d>Cd>!d>Gd>!d>Kd>!d>Od>!d>Sd>!d>Wd>!d>]d>ad>fd>ad> jd>ad>0nd>ad>@rd>ad>Pvd>ad>`zd>ad>p~d>ad>d>ad>d>ad>d>ad>d>ad>d>ad>d>ad>d>ad> d>d> d>d>d>d>d>d> d>d>0d>d>@d>d>Pd>d>d>d>d>d>d>d>d>d>d>d>d>d> d>d>0d>d>e>d>e>d> e>d>0e>d>e>e> e>e>&e>e>,e>e>3e>8e>>e>8e>Ce>8e>]-thumb insn eqnecsccmiplvsvchilsgeltgtlenvund%s %08x %s%s%s aif, #%dl_>l_>a>a>l_>l_>a>a>l_>l_>a>a>l_>l_>a>a>, #%d#%d ; #0x%x%c%dp[r%d][r%d%s, #0x%03x#%s0x%02x%sr%d!{r%d-r%d}^f%d0.01.02.03.04.05.00.510.0#%s.%c%ddaiadbibedeafdfafafdeaed, #0x%04x0x%04xspsrcpsridie_cxsblsdeppmzp%df%d, c%d, %d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown] xv v 6oshstoshnshstnshishstishstsycpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxtmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxundstrtdaWldrtstrbtldrbtstrldrstrbldrbpushpopstmYnWlldmXnWlblimbimbrangeswistrhtdeldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsdpmsrpFmpF2bxmclzdmbkptkmovwdZmovtswpdmoswpbldrexdaldrexdldrexbldrexhstrexdmastrexdstrexbstrexhandSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnmulSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsdrfswfcrfccmfPRghcnfcmfecnfevandNuqwvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddINuqwvtstvsub  "No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxmachdepdebugbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() -1single-skdb-k-dask-auserconf-chalt-b-2-3-4quiet-qverbose-v-xsilent-zw!N_bus_dma_busaddr_to_paddr%s: curaddr %#lxnot in range_bus_dmamap_sync%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botch\u>ju>ju>uu>u>u>u>u>u>u>u>u>ju>v> v>5v>L%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x VARv>\>2PVAfw>\>2VArv>\>2AVAmw>\>3VAtw>\>3 VA{w>\>3pAw>\>3qAw>\>3qAw>\>3qAw>\>3qAw>\>3Aw>\>4D w>~>4D w>8~>4i w>}>4`Rfw>\>4 i w>p}>4qAw>\>4TrAw>\>4TtAw>\>4TtAw>\>4TAx>\>4T Ax>\>4TA x>\>4TPT(x>\>4T`A 3x>\>5TE`A =x>\>5TE`A =x>\>5TE%V Gx>\>5TEWV Vx>\>5TE ihx>|>5TE $iox>h|>5TE0$i}x>h|>5TE ,iox>h|>5TE0,i}x>h|>5TE .ix>(|>5TE0.ix>(|>5TEAix>T{>5TE!ix>{>5TE !ix>{>5TE)ix>{>5TE )ix>{>5TE-ix>{>5TE -ix>{>5TEAix>z>5TEAix>z>5TEAix>z>5TEA x>\>5TE A x>\>5TE`A y>\>5TEJ`A y>>5TEJ`Ay>>6J`A-y>>6J`A;y>>6ZK AJy>\>6KPAWy>>7ApAdy>>7AAqy>>7A/A~y>>7A?Ay>>7AAy>>7A/Ay>>7A?Ay>>7AOAy>>7AAy>>7A/Ay>>7A?Ay>>7AOAy>>7AA z>>7A@Az>>8A0A%z>>8ApA3z>>8ApAAz>>8AAOz>>8AXV]z>\>`A]z>\>XV]z>\>?A]z>\>@XVmz>\> Amz>\>@X/Vmz>\>Processor failed probe - no CPU ID %s%s%s (%s V%s core)Jv>Rv>Wv>`v>gv>rv>wv>v>v>v>v>v>v>v>v>v>v>v>v>v>v>v>v>v>v>w> w>w>"w>)w>3w>9w>Cw>Jw>Uw>]w>unknown CPU (ID = 0x%x)%sHz: %s %s : %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DunknownARM2CPU_ARM2ARM2asCPU_ARM250ARM3CPU_ARM3ARM6CPU_ARM6ARM7CPU_ARM7ARM7TDMICPU_ARM7TDMIARM8CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM250ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15}z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>step A-0step A-1step B-0step B-1step C-0${>-{>6{>?{>H{>z>z>z>z>z>z>z>z>z>z>z>rev 0{>z>z>${>z>6{>${>z>z>z>z>z>z>z>z>z>step B-2${>-{>6{>?{>{>H{>z>z>z>z>z>z>z>z>z>z>${>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>${>6{>z>z>z>z>z>z>z>z>z>z>z>z>z>z>step D-0${>-{>6{>H{>|>z>z>z>z>z>z>z>z>z>z>z>(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)|>}>z>}>'}>8}>N}>_}>z>z>z>z>z>z>z>z>step B-3step B-4step B-5${>z>z>z>6{>?{>{>}>}>}>z>z>z>z>z>z>step Bstep Cstep Dstep Erev 10step G{> ~>~>z>z>z>z>z>~>!~>(~>z>z>z>z>step Jstep Kstep Sstep T{>x~>~>~>~>z>z>z>z>z>z>z>z>z>z>z>*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15~>~>~>~>~>~>~>~>~>~>~>>> >>>{>z>z>z>z>z>z>z>z>z>z>z>z>z>z>z>userkernel C>4 T> f>4 y>( >>( >ۃ>( >>( #>D>( U>u>( >>Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=%08x, Invalid, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x data_abort_handler %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap badaddr_read%s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)  machdepkmpages@````` ```pmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx,c  dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable %d device bad device not ready area improper i/o error aborted from console error %d succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)# !!!!!!!!!!!!!!scsiverboseperiphdisktapeprinterprocessorwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storageunknownscsipi_dtype: impossible device type22@wuQa~>uuw>\bb\\\NbbR-pp },scxspl%sunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer 0x%02x   %02x DEFERRED ERROR, key = 0x%x >&>0>=>X>h>w>>>>>>֏>>>, requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal) , data =Sense Error Code 0x%x at block no. %d (decimal)ES-6600 request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d q  polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedcommand abortedsearch returned equalvolume overflowverify miscompareunknown error key"/++-scsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter probe%s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d)async, 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueing tagged queueing N(8V]]]Fsoft error (corrected)ATA illegal length indicationATA volume overflowATA command abortednon-media hardware failurereadonly devicemedium errornot readycommand abortedillegal requestunit attention%s unknown error code %d probe%s(%s:%d:%d): \gg\gggg?wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d !̈!!!P!wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: %s error (0x%x) wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out ~!|!p~!~!atapiscsibusdetscsinitqscouldn't establish power handler : SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info%s target %d lun %d: <%s, %s, %s> %s %s%sۥ>> >@>> >>> > >)> >>:> >K>T> >e>n>>>> >>> >>>Ϧ>Ԧ>ݦ>>>> > >>'>+>4> >+>E> >+>V> >+>g> >+>x> >>>>>>§>ǧ>Ч>§>>> >>> >> > >>> >>,> >>=> >N>W>h>N>m>~>>W>h>>>>>>>>> >>ʨ>ۨ>>>>>> > >> >+>> >->6> >->G> >X>a>r>w>>>@w>> >aK>> >>>ĩ>!ȩ>ϩ>>>> >>> >>> >>> >>> >>> >>> >>!> > >&> >.> > >7>@> >Q>Z> >k>t> >k>> >k>> >k>> >k>> >k>> >k>Ҫ> >k>> >>> >@ȩ>> >>> >+>(>9>>>G> >X>a> >X>r> >X>> >X>> >X>> >X>>ū> ʫ>ӫ> >>> >>> >>> >> > >>1> >>B> >>S> >>d> >>u> >>> >>> >@>> >>> >@>> >>ì>Ԭ>->٬> >ެ>> >ެ>> >>> >> > >>> >'>.>6>;>B> >I>R>c>>h> >y>> >>> >>> >>>ϭ>>ԭ>>>>>>> >>> >>->>>>C> >T>]> >T>i> >T>u> >}>>>}>>>}>>î>N>Ȯ> >ٮ>>>>>>>> >>(>9>>>>O>T>]> >n>v> >> > >>> >>> > >> >>Я> > not configured LUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X VGENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307PiSCSI SCSI CD-ROM QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA Virtual CDROM !l!44!487p'6734scsibusscsibus at %s channel %dscsi_subrKwGtx!lT!x!y!tx!lT!x!y!{!tx!lT!x!y!{!tx!lT!x!y!Py!removablefixed%s drive %d: <%s, %s, %s> %s %s : %d targets scshutsccompxscmdcouldn't establish power handler atapibus at %s>߲>>>߲>>@>߲>>@ >߲>>@>߲> >%>߲>6>@<>߲>L><>߲>Q>V>߲>g>@l>߲>>>߲>L>>߲>L>>߲>ó>ȳ>߲>׳>ܳ>߲>> not configured ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibus"&) J-88c&&&&&&&&&&&&&&&&%15:9&?&&CHN&R&&&&&&&&W''''''''''''''' &,065':''/>/>/>/>/>0>/>/>optical mediaread_cd_capacity: extra large block size %u found - limiting to 2kByte cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cdm4!!!!t!!!56c4!!d!$!!487p'673!56ccache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack >>>>>>>>>>>>>>>>>>RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry !!4!!>> >$>1>?>>Կ>>> >$>1>?>X>, %s: (error not notified%s%s) wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %x P""",("+"D'"&"56cwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed DMA errordevice faultdevice timeouterrorrequeuechannel resetwd, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcacheIDENTIFY failed >>>%s<%s> SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jd)WARNING: block size %u might not actually work ""P""|""" "4 "|"couldn't establish power handler hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate wd_standbyP""'"'",("487p'673&"56caddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS1"<"0"p:"80"wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwaitrecalpiomodegeometrysetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq /"%%H%dW"/"/"J"atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqataatastart%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout ata_thread_run%s: unknown type: %x %sunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atabus_thread%s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d,32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusP"@U"44M"487p'6734atdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxferxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't establish power handler , " "%s%s%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x)%sat %s function %d%scouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed init failed sdmmcbad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short #(-27<FP d'CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: SpectecSDIO WLAN CardSDW-820writereadextended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz pauseerror waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't change bus clock can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d e @ can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostCardHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) ~>a>P>> ,>@Pcan't get SD status: %d  SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenance can't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x d' #(-27<FPunknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d error, retrying ld_sdmmcldKwG">>config_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270PXA250: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxaintc pxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dpxagpio: can't map registers pxauart %s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostC CCCC !Not supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d unable to create new screen (errno=%d)console lcd_free on active screen h########: DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmac couldn't map memory space unable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicsss: %d slot%s can't attach failed to map MEMCTL pcmciaunable to map register pxa2x0_i2c_intr_sub%s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't map registers couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer sdmmccouldn't attach bus   CW[jM_a8]o \#Y#apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM : %s reserved> >>APM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %s : Power Management spec V%d.%dget power status%sunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedZ#Z#44c#4D[#p'6[#4apmdev couldn't establish power handler pcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) , %s%s (manufacturer 0x%04x, product 0x%04x)%s function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! pcmciaJXjj[  "$CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x , %s%s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS 5>>5>>=>>=>>V>>V4>(>>>>>>>>L>@>P>>>>d>X>>>%s: using CIS quirks for , %sSVECFD605 PCMCIA EtherNet CardNDCEthernetAPCMCIA MBH1030201%  8  @!!@! ! #/ ''w0 g'' c0c ??$?HT&?2?z;?H?zg?n? g?n? ?u?|??|????@??@????????l??'?H;??$?D?I??Y?n?@IeIIu?z?I0I0E|????@&II  I??|??@"I0???-/?????????+??@??V?n?u????????")??uE o@o @o @???????$?@& 3BI@?!? @(#0can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAEthernetAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETAdapterSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAETHERNETcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0NDCDYNALINKL10Cne_pcmcia??TBcouldn't establish interrupt configure failed, error=%d %scouldn't establish power handler MEGAHERTZMODEM XJ2288com_pcmcia ?-? ? ?2'E ?' ?. ?1 ?I ?b ?j ?u ?| ? ? ? ? ?u ?' ?u ? ? configure failed, error=%d can't subregion I/O space memory mapped mode i/o mapped mode wdcattachunable to establish power handler Digital Mobile Media CD-ROMPCMCIA Portable CD-ROM Drive NinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEPCMCIACD-ROMIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmcia????????VVwh3???3?S?h?t?????????P8soo P q q sMklt??tt3?? hC?? h&wiinitcouldn't load firmware configure failed, error=%d %s:failed to attach controller couldn't establish power handler SMCSMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC Cardcorega K.K.Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11coregaWL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaFILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~usbevtusbrhxfer g@o@w@{@@@@: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hc%susbtask-drunable to create task thread: %s usb_create_event_thread taskH#P#usb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s couldn't establish power handler usbusb at %sunknownpre 1.01.01.12.03.03.1|#x##4,#4#p'6P#4usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach usb_desc_iter_peek%s: bad descriptor %s: descriptor length too small %s: descriptor length too large addresshub-addresshub-portclasssubclassreleaseprotovendor-idproduct-idvendor-stringproduct-stringserialnumberusbverbose port %d configuration %d interface %dusbififusbdevifvendor %4.4xproduct %4.4x!@!@!@"@"@"@"@&"@2"@9"@A"@Q"@Z"@c"@k"@z"@"@"@"@"@%d%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %d%s, %susbdlyusbd_fill_iface_data%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@eaQ@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@o7@O@R@T@a@c@q@}@@(@v@&@A@N@j@o7@gO@%@+@4@>@0@`1l703% cU cU c9 : %mZmw`%  2 @@watchdog timeout open rx/tx pipes failed: %s tx list init failed rx list init failed usb error on intr: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) usb error on tx: %s Ethernet address %s couldn't establish power handler usbnetKwG$*@hub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d singlemultiplesselfbus : %s %s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s couldn't establish power handler uroothubuhubuhid at %s reportid %d   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u     u ;u )%u&5Fu 3 4u&6F  0 1  2 5  :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F  uhidev%s, iclass %d/%d couldn't establish power handler could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lockuhid_usb%s: was console keyboard too many Variable keysbad modifier sizemultiple key code arrayskey codes not on byte boundarykey code size != 8 couldn't establish power handler attach failed, %s PPP A,V$U$M$\L$L$ This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). 5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;< =>?@ABCDEOMPJQNRK ukbdPNNLN#9_@_'T~unknown4g$e$Dh$m$Dm$n$ %s T6@^6@b6@96@>6@D6@H6@L6@using %s over %s quirk init failed could not read endpoint descriptor endpoint not found %u/%u/%u %s: Get Max Lun failed: %s unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=%#x not supported bus attach failed couldn't establish power handler inoutINOUT%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s SCSIATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumass s$ r$  % L r$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ fc 46umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbscsi~!|!p~!y!atapiF  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |%s: reset failed %s $4$($|$@}$~$z$0z$y$failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out if_aueusbnetKwGy$<@<@aue %s @$($2VZP~" `"'`{%1no union descriptor no data interface setting alternate interface failed could not read endpoint descriptor unexpected endpoint could not find data bulk in could not find data bulk out faking address if_cdceusbnetKwG$>@>@cdce# # %s: reset failed %s failed to set configuration, err=%s $$ $H$t$0$p$getting interface handle failed couldn't get ep %d %s: read MAC address failed if_cueusbnetKwG$ ?@?@cue@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0 %s T$ԓ$$ܙ$failed to set configuration, err=%s %s: warm boot, no firmware download %s: cold boot, downloading firmware dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!%s: failed to load code segment: %s d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^%s: failed to load fixup segment: %s d%s: failed to load trigger segment: %s %s: reset failed loading firmware failed getting interface handle failed couldn't get ep %d missing endpoint could not read Ethernet descriptor if_kueusbnetKwG<$BS@IS@kue P@9WPurl_uno_mii_read_reg%s: %s: bad register %04x %s ̞$$$$$,$К$l$failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed url_uno_mii_write_regif_urlusbnetKwG$T@T@url( B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn media change failed read PHY failed can't read rxmode %s $$$p$Ц$̥$8$$failed to set configuration, err=%s getting interface handle failed couldn't get ep %d failed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axeusbnetKwG$ W@W@axe$u$u$x$x$Pxmue_csr_read%s: reg = %#x: %s mue_uno_rx_loop%s: packet length %u too short %s: rx_cmd_a: %#x %s: invalid packet length %d mue_uno_tx_prepare%s: packet length %d too longmue_csr_writemue_read_otp_raw%s: not ready %s: timed out mue_eeprom_getbyteLAN7500LAN7800 %s D$`$$D$$$$L$t$failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints mue_chip_init%s: PHY not ready failed to initialize chip %s id %#x rev %#x failed to read MAC address mue_uno_mii_read_regmue_uno_mii_write_regmue_dataport_writeif_mueusbnetKwG$Y@Y@mueF hF  %s ($$$$$p$$l$failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed if_udavusbnetKwG$Z@Z@udav42-# s%s: %d silo overflow%s, %d ibuf flood%s  !)com: unsupported I/O width %d $($$$$$\$$p'6484device enable failed timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTNXP UARTDesignWare APB UART, no fifo is_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO : %s txfifo disabled console Could not create workqueue: %d unable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%L%0%% %d (%d) wi_start%s write fid %x failed init failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout wi_rx_intr%s read fid %x failed wi_rssadapt_input%s: null nodewi_tx_intr%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundwi_tx_ex_intrtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%x wi_scan_result: unknown firmware type %u f@f@f@g@g@Fg@og@g@g@g@ g@ g@ h@ h@ h@1h@1h@1h@Th@Th@Th@yh@yh@!h@"h@LucentSymbolIntersil could not establish softint could not get mac address, attach failed 802.11 address %s %s: using %sUnknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d device enable failed yyyyyne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete THIS is A memory TEST patternwhere did the card go? setup failed 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT ##$atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1 atapiatatimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnf|%4%`%%%atardlX%%@ X%%@%%44   @ @ @  0        @* Root hub ) 2%(%<%8%l%h%+CP]j 9999:OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted @%%%L%t%%,&%`%%|%<%t%%%d%@%%|%%%|%ohci_setintr: 0 interval %%$&% %t%%|%l%%%x%%%P%ohci_device_isoc_abort: early return ohciabt2WARNING: addr 0x%08lx not found , legacy supportohciabtohcixferOHCI version %llu.%llu%s unsupported OHCI revision      SMM does not respond, resetting 0%%0%%%%%%%reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so/libexec/ld.elf_so%s-%s%scompat_utilKwG &p@invalid AES nrounds: %uBearSSL aes_ctAES-CCM overflowt@vt@~t@,&>t@t@vt@~t@n@ &t@t@vt@~t@Jڧo t@t@ vt@t@as@t@ vt@t@Q?}-s@t@ vt@t@@ZC˔s@t@I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6cryptoaesselected pu@w@ v@x@ v@`y@ AES is bustedaes: self-test failed: %s AES self-tests failedaes: %s  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN%s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed    !"#$%&'()*+,-./%s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed 1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }%s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed   !"#$%&'()*+,-./%s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed cryptochachaselectedchacha: self-test failed: %s chacha: %s KwG]&@expand 32-byte kPortable C ChaChaL@_&Xk&dh&o&L_&hw&Xo&@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[xchacha_streamexpectedxchacha_stream_xorjUS_&)ûIt~._dyz,(4y:b,ia /A&chacha core 1"3DUfw̻wfUD3"-chacha core 2  J1AY'A;B'{BP}sՊtS.&hchacha@`@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q@ؖ@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHh@`@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHh@`@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@h@ؖ@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rieee80211_crypto_newkey%s: invalid cipher %u <@E@O@\@f@%s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s ieee80211_crypto_setkey%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! ieee80211_crypto_encap[%s] no default transmit key (%s) deftxkey %u ieee80211_hdrsize%s: control frameieee80211_crypto_decap%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckipieee80211_hdrsize%s: control frameccmp_setkey%s: Invalid key length %u, expecting %u N@0&$&&l&p& &h&[%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONE@L&P&T&&&\&t&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize%s: control frame0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-out of buffers with data_len %zu tkip_encap[%s] Discard frame due to countermeasures (%s) tkip_setkey%s: Invalid key length %u, expecting %u [%s] missing ExtIV for TKIP cipher tkip_decap[%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt <@T&H&x&&&&&TKIP0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt ieee80211_hdrsize%s: control frame@&&p&&&&,&WEP333,*,**F$(Kc & = ieee80211_hdrsize%s: control frame[%s:%s] discard %s frame, frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: %s[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed null nodetoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6D:too short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xdatamulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued WEPPRIVACY offmulticast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xrereassocassocWPARSNshortlong, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d authdisallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s  JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 maccompat_20link-layer statistics and controlslinkIEEE 802.11 WLAN statistics and controlsieee80211ieee80211_sysctl_treetop%s: sysctl_createv failed, rc = %d client/peer stationsnodesdebugieee80211_sysctl_setup%s: sysctl_createv failed (rc = %d) vap%uparentinact_runinact_probeinact_authinact_initdriver_capsbmiss_maxieee80211_sysctl_attach%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done %s[%s] %s replay detected [%s] michael MIC verification failed ieee80211_load_module%s: load the %s module by hand for now. operating mode %ubogus aid %u, max %u_ieee80211_free_node%s %p<%s> in %s table node_reclaim%s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u ieee80211_free_allnodes_locked%s: free all nodes in %s table ieee80211_node_table_cleanup%s %s table %s: %s[%u] still active , ieee80211_reset_scan%s: scan set:%s%u start chan %u ieee80211_next_scan1%s: chan %d->%d ????essibsswepno! %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s _ieee80211_find_nodeieee80211_setup_nodeactivepassiveieee80211_cancel_scan%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULLieee80211_get_rate%s: fixed rate %d (%d.%d Mb/s) not in rate setieee80211_tmp_node%s %p<%s> ieee80211_find_rxnode_withkey%s: add key map entry %p<%s> refcnt %d ieee80211_find_txnode[%s] no node, discard frame (%s) ieee80211_find_node_with_channel%s %p<%s> refcnt %d ieee80211_find_node_with_ssidieee80211_free_node%s: %p<%s> clear key map entryneighborieee80211_create_ibss%s: creating ibss stationshortlong, protectionieee80211_ibss_merge%s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s ieee80211_end_scan%s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %pieee80211_node_delucastkey%s: delete key map entry %p<%s> refcnt %d [%s] power save mode off, %u sta's in ps mode ieee80211_iterate_nodes%s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d ieee80211_node_leave_11g%s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble ieee80211_timeout_stations%s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivity%sstation timed out due to inactivity (refcnt %u)re, QoS[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated ieee80211_node_join_11g%s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s ieee80211_node_table_resetunable to setup initial BSS nodeieee80211_node_table_init%s %s table, inact %u scan$$hhu Penadis[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!ieee80211_encap[%s] no default transmit key (%s) deftxkey %u not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!ieee80211_compute_duration%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuPPPPPPPPPWPA IE too big, %u > %zuPieee80211_send_probereqieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u null nodeieee80211_send_mgmt[%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u ieee80211_mgmt_output[%s] encrypting frame (%s) [%s] send %s on channel %u ieee80211_beacon_alloc%s: cannot get buf; size %u no space for 802.11 header?ieee80211_beacon_update%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued >{4%$$ @@@@@@@wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl"%c0x%02xieee80211_newstate%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%s(%s)TODS %sFRDS %sDSDS %s(%s->%s) data %s type#%d WEP [IV %.02x KID %u] %dM +%d   0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x        ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparams%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon miss%s wlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtsctsackcf_endcf_end_ackassoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocauthdeauthreserved#13reserved#14reserved#15linkieee80211rssadaptdebugexpavgctlieee80211_rssadapt_sysctl_setup%s: sysctl_createv failed (rc = %d) %s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d -> %d %s: dst %s thresholds %d-byte, T[%d.%d] = %d @external%hu.%hhu%s:%hhuigmpplinetigmpstatsR[b]G)GGGGUGGGG <<lla_lookup: new lle malloc failed inmltplinetmulticastipsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinternetL!c\x(((Ђ(L!cCLP(G(G(X@|K(L!c)G(G(@)L!c@(G(G(@\ )`1)0)L!c(G(G(X@L!cC<=G(G(X@=L!c)C<=G(G(X@=L!csC<=G(G(X@=L!cC'G(G(X@$'P''L!cC(G(G(X@Ի(.PPUPP*}PPPineticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutstatsbmcastechodynamic_rt_msg     ICMP: redirect failed to register timeout for route to %s, code %d }E#(Dicmp_errorinetipforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumstatsdad_countanonportalgoavailableselectedreserve(@AAA==A*28;OOOOOOOOOO  ;% ?????HC  .   ip_output%s: refusing to send from invalid address %s (pid %d) inetipmaxfragpacketsipfrenplrip_abortrip_acceptinetrawpcblist(( ((ĺ(((d((`((((0(((((((bqA  #9L7Ptcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULLtcp_output%s: no template%s: %d < %dsackholeplS tcp_inittcpcbpltcp_new_iss: unreachablesyn_cache_respond%s: impossible (1)%s: impossible (2)synpl @@@@@@@hV)(Y)PZ)[) 1DW]e_ace!!rfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlavailableselectedwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localidentdo_loopback_cksumpcblistkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesmaxholesglobalmaxholesglobalholesstatslocal_by_rttdropiss_hashabcaggressivemsltloopbacklocalremoteremote_thresholdvtwentriestcpinettcp6inet6$)\)D)d)t^)|)@) ))X)l)^)H)L)،))T))) h)L)X)))reno)L))|))newreno̞)))))cubic""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwudp_abortudp_acceptinetudpchecksumsendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunction@)))))))()))))))$),)))D)2@)6@0)C@X)O@8)T@)_@l) bsdrandom_startrandom_pickhashdoublehashrandincm_pulldown malfunctionm_pulldown malfunction8BZ $>FN2:BJRZbjr@Hf~%YbxlJJ(src=%s dst=%s tgt=%s)m_pulldown malfunctionicmp6_redirect_input%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_reflect%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d _icmp6_input%s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) inet6icmp6statsrediracceptredirtimeoutnd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfoerrppslimitmtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtudynamic_rt_msgicmp6_error%s: ENOBUFS in icmp6_error %d NYIPv6 address: "%s" is not on the network lla_lookup: new lle malloc failed in6_update_ifa1%s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s in6_get_llsol_addr%s: in6_setscope failed in6_join_mcastgroups%s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlin6_if_link_up%s: %s marked tentative in6_if_link_down%s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headerin6_ifattach%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback%s: failed to configure the loopback address on %s (errno=%d) get_ifid%s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal%s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6d&c)*)))d&c:C3***A%*d&cH+*ܝ*DA +d&c(؝*ԝ*@*`1)0)d&c،+**Ad&c<)d&c++d&c,8)d&cC$ =**A=d&c)C$ =**A=d&csC$ =**A=d&cgCP**AP*d&cC،+*A+?Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %d3!inet6ip6forwardingredirecthlimmaxfragpacketskeepfaithlog_intervalhdrnestlimitdad_countauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyanonportminanonportmaxlowportminlowportmaxauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsstatsuse_defaultzonemcast_pmtuanonportalgoavailableselectedreserveneighborgcthreshmaxdynroutesparam_rt_msgip6_initm_pulldown malfunctionip6_input%s: packet to an unready address %s->%s ip6_get_prevhdr%s: off < sizeof(struct ip6_hdr)ip6_nexthdr%s: m == NULL(@AAA==(A*/1inet6pim6statsregister_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctioncW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aassumption failed: hdr not splitip6_output%s: refusing to send from invalid address %s (pid %d) m_pulldown malfunctioninet6multicastmulticast_kludge ))))))))%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timernd6_init%s: workqueue_create failed (%d) nd6_options%s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt nd6_resolve%s: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest%s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 nd6_na_input%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_ns_output%s: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer%s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_input%s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) nd6_dad_start%s: %s: starting DAD for %s RSRAnd6_rtr_cache%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: src %s is not link-local %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, %s packet %d) &.3;CKS[cksinet6raw6pcbliststats++P++,+++X+++H++4+ +++T+ ++m_pulldown malfunction  sa6_recoverscope%s: assumption failure (non 0 ID): %s%%%d in6_setscope%s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s XAbAgAgAoAgAgAtAgAgAgAgAgAAinterfacelinkunknownsiteorganizationglobalinet6udp6sendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunctionudp6_output%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket +<+++ +t++++`+x+ġ+d+P+̡+ԡ+Ȼ+0++*&Rik  $ "BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d AAOAAA~A72AAOA AZAA!\AAAv A AFhAXAu A AJFAPAA &A A "AA A A A N AHzAXA A A A[ A AU Ao> A 9A A  AaAcCeElLBAnNDCoOsS[ZuUxXzyzZ|{"5% mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0), --_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\5$#"12< 3>!(4[")5]#@6^$+7%-8&/9'*0-=.%`bB|_pP&oO`!vV  dDlLjJ/zZ0wWaAuUiI eE ,;' cC' tTsSrR3nN4mM2\yY{xX}.:kK~'?qQ 6gG7hH8fF(, _d/^ q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ 5 12 3l#!4>"5<#6$$7%8"" &9""/'0""*----.' xX.vV_lL[cC]wW^kK!hH<7 gG>8fF=9qQ&+/f-0uU\iI/aA{ eE} oO* sS? nN(4rR)5tT-63dD:,4yY@.#$ |pP~ zZ`bB+:mM%16,-"27..'38jJ;;2 9 d .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>|  9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm ++ : input=%d, output=%d, feature=%d uhidreacouldn't establish power handler + +H++++4 +p'6+4x'6c addr 0x%02x(unknown) ()%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlisti2c-indirect-probe-strategyinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-bytenoneunknown probe strategy '%s'; defaulting to '%s' WARNING: ignoring bad device address @ 0x%x : I2C bus i2cdevstcouldn't establish power handler i2c-child-devicesi2c-no-indirect-configi2c-enumerate-devicesaddrnamecompatibledevhandleWARNING: ignoring bad child device entry for address 0x%x iici2cexec,i2c_bitbang,i2c_subrKwGt+i Am A$++44+487p'6734i2cexecKwG+ Aiic at %s bus %di2c_subrKwG+ !Ai2c_bitbangKwGH+(!A     mii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4x OUI 0x%06x model 0x%04xmiiaut!A  !@@@@mii_phy_setmedia: MASTER on wrong media, no media present HomePNA1%s%s10baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXauto couldn't establish power handler RRTRRRRRRV'A'A (A-(AP(As(A (A (A (A )A;*)A.M)Ap)A)A)A)A)A4"*AG*Aj*A5*A6*A *A *A +A <9+A ?V+A ,s+A -+A +A +A ,A =(,A :E,A b,A ,A",A6,A$,A-A 9-A8_-AP-A##   1 @,\ ,,,,,,,,,,,: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX  22     * #hhu hhhBCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyA L-A: Media interface : %s, rev. %d ',T$,',DP83840 10/100 media interfacensphy) 2.A.A .A.A: Media interface : %s, rev. %d d,,+,L*,DP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyter) 2p/A: Media interface : %s, rev. %d 00,-,/,QS6612 10/100 media interfaceqsphy) 2U0AU.0AU2I0AU3i0AU10A: Media interface : %s, rev. %d 3,\2,X+i82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphy) 21AU51A: Media interface : %s, rev. %d 7,4,X+i82553 10/100 media interfaceiophy: Media interface : 3Com internal media interface $9,,8,ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexexphyM V x@2A{ ^2A@=,,<,@=,T:,<,: Media interface : %s, rev. %d 100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphy) 23A#3AB3Aa3A3A: Media interface : %s, rev. %d dA,>,@,ICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphy) 2}@4A}b4A}4A: Media interface : %s, rev. %d D,B,E,using Seeq 84220 isolate/reset hack D,B,X+Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphy) 2v@5Avm5Av5Av 5Av 5Av 5An`@5A: Media interface : %s, rev. %d H,\G,X+DM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphy) 2X9d6A: Media interface : %s, rev. %d K,J,X+Am79C901 HomePNA 1.0 interfacepnaphy) 2: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d : Media interface \N,,X+ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyxor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zerol\,X|,^,L[,u,g,_,^,[,L_,4%s: emergency X server detach screen %d-%d added (%s, %s emulation) wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted dmux kbdmux %d: console (%s, %s emulation), using %s wsswcouldn't establish power handler wsdisplay at %sloadedwsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDID =( dumb:A,,\,T,0,, !!!c        BBB257#A^bgejzuxwsemul_vt100_output_c0c1%s: ESC in kernel output ignored ,̉,,,,,<,ԅ,4,؈,܅,`,vt100 24;20;0cP2$u%s%d\P0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" BABA BA&BA,BA2BA8BA>BADBAJBAPBAVBA\BAbBAAAAAhBAnBAtBAzBABABA BABAAAAAAAAAAAAAAAAAAABAOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_versionwsevent_copyout_events%s: unknown version %dwsevent_read,,X,  mux %dcannot load keymap: console keyboard, using %s attach error=%d couldn't establish power handler couldn't register as input device connecting to %s disconnecting from %s wskdetwskbd_detach: %s didn't detach H,,,4,4,,p'6|,4wskbd at %s%s: event queue overflow wskbd ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmuxconnecting to %s %s: disconnecting from %s ,,$,4T,4t,p'6,4wsbell at %swsbellrasops_reconfig%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported rasops_init%s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary @`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????cwccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not locked0c&1c&1c&p^Ah^Aop`A`A                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~bAbAabA)$cA2McAcAcAͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠBoldfacecd9660nopl%'-79 &..RRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991APX4-7-TF@5-45-PN4-RRl3-CE3-ST3-NM6-:-CL4-0PL4-0RET3-@RRl3-CE3-ST3-SL:-RRl3-CE3-ST3-SPER<-CE3-ST3-cd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] ;CD001%/C%/@%/Eroot_device4kAiA4hAKwG0H-fA cd9660_strategy: spectag VT_ISOFS, isofs vnode .. e?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥmsdosnoplmsdosfhplo-o-loadvnode(): pcbmap returned %d ;\o-:do-:deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld updatefats%s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. .. msdosfs_rename: updating .. in root directory?d------|---|-msdosfsmsdosfs_sync: rofs modRRaArrAaUmsdosroot_devicePrAKwGl-FqA   msdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu .... ..  eXrA1B9&B ;&B-&B-&BH;'B ;,'B-H'Bh-d'B;'BL-'BĻ-'B -'B-'BH; (BH;D(B ;((B;`(B ;|(B;(B;(B;(B -(B ;)B<-$)BH;@)BԨ-\)B-x)B-)BH;)B\-)B(;)B ;*B\y- *Bw-<*B;X*B8;t*B-*BT-*Bx-*BP;*B-+B-&Bo98+B:T+B:AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zbind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d BDZ\^`bdfhju_acknfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpw6.6.6.5.nfskqpollnfskqdetnfs_sillyworker%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_init9.9.x:.:13/nfs send error %d for %s nfsd send error %d nfstimertimer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s  @not respondingnfsrvdescplAA܊AȊAAAA|A`ADA(A AA։AAAxAbAVALABA6A ?BEF   build > MLENF''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  nfsumntnfsnfsstatsiothreadsbuild > MLENnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%u/nfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootA0AAKwG4.A build > MLENnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)`.eA1B9&B;&B:&B:+B:&B:'B:'B: (B:((B:`(B:|(B:(B:(B:(B:)B:$)B:@)B:\)B:x)B:)B:)B:)B:)B:t*B:*B:+B:8+B;T+B:,'B4.H'B.d'B;'B$.'B.'B.'B`.D(B ;(BT/*B=. *B=.<*B;X*B.*B:*Bl.*BP;&B;d.e8A1B9&B;&B<';&B;+B;&B;'B`4;'BH; (B|(;((B8;`(Bl.;|(B.;(B;(B8;(B ;)B;$)B;@)B;\)B;x)B;)B;)B;)B;)B;t*Bd';*Bp-;*B);+B);8+B:T+B:,'B|.H'B.d'B;'B$.'B.'B|.'B.D(B ;(B(;*B=. *B=.<*B;X*B.*Bl.*BP;&Bo9h.eA1B9&B ;&B<.&BI/&BH/'Bt.,'B/H'B.d'B;'B$.'B.'B.'B\-'BH; (BH;D(B ;((B;`(B ;|(B8.(B;(B;(BT/(B ;)B/$)B.@)B/\)Bt/x)B.)B_/)B.)B.)B ;*B=. *B=.<*B;X*B.t*B.*B.*Bl.*BP;*B.+BX.&B;8+B-T+B:ffs_mapsearch%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%sffs_nodealloccg%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%spid %d, command %s, on %s: %s uid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s ffs_freefile_common%s: freeing free inodeffs_blkfree_common%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free ffs_blkalloctrimwqtrimwqcvffs_blkfreeffs_realloccg%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %sffs_blkfree_snapffs_freefile%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_freefile_snapffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblockAAAA        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt0}00:0:ffs_newvnode%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mountingffs_reload%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty20 0T 0/%0s0w0 %s: options QUOTA2 not enabled%s root_device%s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' ffs_sync%s: rofs mod, fs=%s@AxAAufsKwG<0 AA|.eA1B9&B;&B:&B:+B:&B:'B:'B: (B:((B:`(B:|(B:(B:(B:(B:)B:$)B:@)B:\)B:x)B:)B:)B:)B:)B:t*B:*B:+B:8+B;T+B:,'B0H'B;d'B80'Bp0'B0'B0'B0D(B ;(Bz0*B`0 *Br0<*B;X*B8;t*B0*B/*B0*BP;*BT0&Bo9,B/+B /+B\/P,B/+BD04,Bd0p+BH;+BH;+BH;.eA1B9&B;&B<';&B;+B;&B;'B`4;'BH; (B|(;((B8;`(Bl.;|(B.;(B;(B8;(B ;)B;$)B;@)B;\)B;x)B;)B;)B;)B;)B;t*Bd';*Bp-;*B);+B);8+B:T+B:,'B0H'B;d'B80'Bp0'B0'B0'B0D(B ;(B|r0*B`0 *Br0<*B;X*B8;*B0*BP;&Bo9,B/+B /+B\/P,B/+BD04,Bd0p+BH;+BH;+BH;.eHA1B9&B ;&Bp0&B0+B80&B`0'B0,'B0H'B;d'B80'Bp0'B0'B@v0'BTl0'BH; (BH;((B;D(B ;`(B ;|(B;(B;(B;(Bz0(B ;)B0$)B0@)Bܴ0\)BL0x)B0)B0)B0)Bp0)B ;*B`0 *Br0<*B;X*B8;t*B0*B(0*B0*BP;*BT0+B0&Bo98+B:T+B:,B/+B /+B\/P,B/+BD04,Bd0p+BH;+BH;+BH;mfsmfsidlfcfsmfs_rootAffsKwG0A,Amfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_close.eA1B9&B ;&B;&B;&B;'B0,'B$0H'B;d'B;'B;'B;'B;'B;'BH; (BH;((B;`(B;(B;(B;(B(;(B;)B;$)B;@)B;\)B;x)B;)B;)B;)B;)B;*B0 *B@0<*B;X*B8;t*B00*B0*B0*BP;*B;+B;&Bo9T+B;mfs_initminiroot() called more than oncemfsufs_inactive%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: dirty filesystem?%s: bad dir ino %ju at offset %d: %s not roundedNUL in namemissing NUL in nametoo smalltoo bignull entryi_size too smallufs_dircompact%s: too big%s: nospaceufs_dirgrow%s: newblk80d0ī080\0L00Ȭ0400hard-linked directoryufsdirufsKwG0A ufs_whiteout: unknown op ...ufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qd invalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpage0@00d0uaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_putuao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_fault@1ubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object udv_detachudv_attach111 1flt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmemkmemkvauvm_km_suballoc%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainfltagain2loanzeroloanuopgdA1Mprocuser_va0_disablevmmpeplL1M1vm_mapuvm_unmap_remove%s: kernel object %p %p uvm_voaddr_release: bad typevmmapbsyvmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressguard_sizethread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %dDAAAAemergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! pooldrainfork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slabuvm_page_physload%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.uvm_physseg_unplug%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG  Ubww:w$swap_off%s: swapdev not in listswap_encryptswstrategy%s: vnode type 0x%xsw_reg_strategy%s: swap to sparse fileuvm_swap_init%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedminirootswapctl: miniroot copy faileddisksortswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiodswap_on%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d done 44t2424487p'6734242444uvnfp1uvnfp2/2/2.2.2L.2copy-cred-on-forkbufq_disksortKwG82Adisksortbufq_fcfsKwG92LAfcfsNetBSD-CORE%s@%dELFNetBSDexec_elf32KwGI2A#!exec_scriptKwGZ2Avmcmdkillsextendscallsinit/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit pathַAAǸAָA (default %s): haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d pgdaemonfork pagedaemonioflushfork syncer%s %s (%s)%s %s %s%stotal memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/init  maxvnodesmaxprocmaxfilesargmaxhostidvnodeprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetroot_devicefsyncipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timeconsdevmaxptysmaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrlwpforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetiddumppathownergroupmodeno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionversionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvmvfsnetdebughwmachdepuserddbprocvendoremulsecurityA,@A#7$wx@g`8@O@Accounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptcv@ 2H4X4x4deadcv" """usersystempid %d (%s): %s write of %zu@%p at %lld failed: %d %s%d%.*s%lldcoredumpKwG2AToo many CPUs. Increase MAXCPUS?cpu%d4444 2487p'6734fdcloseincrease kern.maxfiles or MAXFILESfilefiledescfile2dup2@24444487p'6734entropy: ready entropy: best effort <cpu0entropy softintentropy intrdropentropy intrtrunc<WARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) <WARNING: system needs entropy for security; see entropy(7) 22seed3entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategatherneededpendingsamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)filt_timertouch%s: invalid type (%ld),A44(/3D3T.3-3038+3\%3<3kqueue+3 "3org.netbsd.kauth.process13(3d!3$38!3@ 313&3!3 $3 .3.3133133EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY3&3E3!3:AIO/*fexecve*execargsshould not happenexec_init%ssigcode kernel mapping failed %d pspawnwaitlwpwaitnetbsd`pp\dphrinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCprocforkmxforkulimwaitlwpwaitidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated ???A A(A0A;AGAdopowerhooks %s: %s (%p) dopowerhooks: %s done resumesuspendstandbysoftresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx %s[%d %s]: hogging kernel lock idleinterruptsoftintpserializeassert_sleepable%s: %s caller=%p%s[%d %s]: kernel lock spinout Kernel lock lwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %dmodule_builtin_add%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%s/modulesorg.netbsd.kauth.systemBuilt-in `%s' failed: %d moduleautoloadautounload_unsafeverbosepathautotimeKwGAmodunloadmodule_start_unload_thread%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dnetbsdmod_hookauto%sLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.kmod.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d mutex_vector_enterlocking against myselfmutex@y5y5X43MutexphysiodphysioDevices without power management support: %s %s: %s is suspended by %s (delegator %s) pmfdebugeventsuspendsuspensoridletransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classdriverbusPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.self%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: giving up done Suspending devices:. %s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueAAAA8AA8AAAsystemdrvctl**** RVY\c@cfailed to reserve PID 1 for init(8)procplorg.netbsd.kauth.processexpose_addressprocproc2proc_argswaitlwpwait@@ @@ %s (pid %d) changing logname from %.*s to %s reboot KKK]UKKkorg.netbsd.kauth.processcurprocpaxflagscorenamerlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememoryusememorylockedmaxprocdescriptorssbsizevmemoryusemaxlwpstopforkstopexecstopexitcoreschedcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x rw_vector_enterlocking against myselfrwlock`y5y5X4 4Reader / writer lockcrashme_sysctl_forwarder%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashme_mutex_recursion%s: locked once %s: locked twice %s: initialized crashme_kpreempt_spinout%s: disabled kpreemption crashme_spl_spinout%s: raising ipl to %d %s: raised ipl to %d, s=%d crashmeselfdebug_crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s crashme_remove%s: unable to remove %s from sysctl panicplain old panicnull_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabled!!sigactsksiginfoorg.netbsd.kauth.processAD 0  trapsignaleventswitchpid %d was killed: %s sorry, pid %d was killed: %s sigexit 1sigexit 2pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) sendsig: bad version %d proc_stoptraceh4<44WARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s/%usoftint%s block/%usoftint_init_cpu: cannot allocate memorynetbioclksersoftint_picklwpwedge:NAME=parsediskdkflashhaltrebootuse one of: %s[a-%c] %s none halt reboot none%s%lluswap dumps on %s%c genericmdmd0nfsroot device (default %s): dump device (default %sb)file system (default %s): ?use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured root  sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesleep@4H4X4x4kpause@4H4X4x4 %pWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU\sched$4844x4A  ( *$/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_lookup%s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content version %d type %d len %d: %d end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings %s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destruction/%d@%dpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone J5callout@4H4X4x4calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system todr_gettime%s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! todr_settimeCannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcntsbsizeAA AAA%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%ssched4.4BSDnamertts acl_posix1e_mode_to_perm%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %dconfig_devdelete%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachrootlocationev: %s %s at %s in [%s] deviceparentcfgmiscbootstrapautoconfdetachallconfigintrconfigrootconfig_finalize_mountroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namedefaultlocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported swaiting for devices: %s done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-registerAMA^A%sconfig_detach: forced detach of %s failed (%d)detached root device %s not configured detaching %s, success.failed.unable to detach instance initinit rollbackfinifini rollback not configured unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected range NULLbufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcpu0%s/%unist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testkernuserurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? corepkg1st%s %s has %d %s siblings: %s GAVE UP %s first in package: %s ureadc: non-positive residureadc: non-positive iovcnt   device-get-propertydevice-enumerate-childrendevswbdevsw_attach%s: block majors exhausted cdevsw_attach%s: character majors exhausted readwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorgeometrytypedisk-infodkopendisk%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%c%s%devcnt,%d/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extentextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not found hashdone: invalid table typehashstat KMGTPE kMGTPE %qu%s%c%sB Bintrlistaffinitynointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipifullWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS AAA A(A0A8A@ APA`#Ap.A9ADAOAZAeA@pA{AAAAAAA A@Akmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %p~6}6klogmsgbufsizemsgbufD~6~6d64d646p'664runoncepercpu%s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) poolpr_phinpage_check%s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u pr_rmpage%s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocatorpool_init%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s pr_item_linkedlist_get%s: [%s] page emptypool_do_put%s: [%s] page header missingpr_item_bitmap_index%s: [%s] %u >= %upr_item_bitmap_put%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pBjfqTqVX`bCd ݻ*,,,,,,,,,(null)0123456789abcdef0123456789ABCDEF%d[% 4jd.%.*ld] |/-\%s: table is full - %s %s: table is full %s: Skipping crash dump on recursive panic panic: %s autoconfiguration error: mismatching pserialize_read_exit()pserializeexclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificx6t6btallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehashvmem_rehash_start%s: workqueue_create %d static_bt_inusestatic_bt_count%s/%u%sInvalid IPL: %dxclowxchighcrosscallunicastbroadcastxcallxcall/%uposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_poolS7\F7M74M7HI7W7hM7X7aiodoneaiost_process_singleton%s: invalid operation code {%x}naio_process: invalid aiost state {%x} aioKwG67B",HK:=h7e7q7o7p7Po7iB$t7r7o7h2 MHLENm_copy_internal%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]m_pulldown%s: m == NULLm_copypacket%s: no header (m = %p)linkcB8888X8p88h8888Բ88x8888ȯ8Я8`8unixc<LF90BcLF90Bc=LF90B888м8`8888888psemorg.netbsd.kauth.systemposixsemmaxsemcnt(B822h2x28H822semksemKwG̾8,B9;=?)'RAAsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %luorg.netbsd.kauth.networksopendfreesoinit1 %d88888$888socketnetioAsbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lusbcreatecontrol1%s: message too large %d mbsonameacceptmbcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataBBBBBBB Bunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadsendspacerecvspaceinflightdeferredunpgcuipc_init %duipc_usrrequipc 479`69X>9@9,:9>929,4969d79@09H09l29X2959809@J9d39buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_statsz9z9ncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table ..vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultgenericfstypesmagiclinkstimestamp_precisionP2B3B7Borg.netbsd.kauth.system#lf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../machine_archmachinezaurushostnameosreleaseemulkernel_identdomainnameostypeuid%uruidgidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags BB BB%s: failed to start extattr: error = %d syncing disks... giving up done vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system ?root file system type: %s WARNING: No file system modules have been loaded. Supported file systems: %s no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncdelayfiledelaydirdelaymetadelayinvalid specnode type: %dILLEGAL!B!B"B "B"B"B$"BUNKNOWN]"Bd"Bk"Br"By"B"B"B"B"B"B"B"B"B"B"B"B"B"B"B"B #B#B#B%#B.#B7#B@#BG#BR#B[#Bb#Bi#Bp#Bx#B#B#B#B."B3"B8"B="BB"BG"BL"BR"BX"BROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd) %02x %slrulisthd %p %s: vflushbuf: not dirty, bp %pvflushbuf: dirty syncerACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADVT_NONVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFS@` !.AS]issymlink-target$B$B$B$B$B$B$B$Bufs%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %d%d syncwait/ : :4 : ffsnfsmfsmsdoscd9660fdesckernfsafsfstchgfstcntfstlwpvnfullvnodevcachevnode cache hashvcache_reclaim%s: cannot reclaimdead but not cleanvrelel%s: bad ref countvcacheplvdrainvreleholdrelel%s: holdcnt vp %pvcache_make_anon%s: cannot lockvwakeup%s: neg numoutput, vp %p  *,.024vn%B(:::::|:ĝ::2X:::Џ:ȉ:4:xattr-listsystem.user.security.trusted.xattr-namexattr-val1B1B1B1B1B1B 1B1B 1B1B t1B1B `1Bl1B L1BX1B 81BD1B $1B01B 1B1B 0B1B 0B0B0B0B0B0B0B0B0B0B|0B0Bd0Bt0BP0B\0B<0BH0B (0B40B0B 0B/B0B /B/B /B /B /B/B /B/B /B/B p/B|/B X/Bh/B D/BP/B!,/B p_size (%llu) fcfs%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dkswap%s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS=B[>B=B`>B%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfsEFI PART%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC (s*K>;]AB2IчHcAB|nQn- q+cABZIчHhAB|nQn- q+hABSFU0eChABIчHlABIчHpAB-чHzAB-чH~ABSFH0eC쬂ABS'@ )ѸAB*1@ )ѸAB1x )ѸAB3Dh&ǛAB=rGy=iG}AB|nQn- q+AB%s: wedge named '%s' already exists, manual intervention required %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTmsdosswapffslfsraidframeccdcgdhfsvmkcorevmfsvmwresvntfsext2fszfsfictitiousmdidlefcfsD;3couldn't establish power handler %s: cfattach_attach failed mdX;d;;;0;487p'6734X;d;D;0;4;42KaaaaaaaaSV8;4<;<;T;487;734/dev/random;;,;;ď;4;p'6$;4J3/////91?~~~~'~~~~~uuuuuuuu;;;4444487p'6734bpfCB;P;;h20;`;<;H;2maxbufsizestatspeers_bpf_mtap_softint_init%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterKwGT;CBDBsuŇ! Ȗ" % ˊ 6 C Α Q ՚ ] j w{ MO 7\bpf_filterKwG;\EBbpfops%.*s/%hhu#link#%hu]:%huif_%s: watchdog triggered org.netbsd.kauth.networkifnetifaiflnkstifwdogsdl%s%dinterfaces%s: could not attach sysctl nodes sndqlenmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged UNKNOWNUPDOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. ifaddrpref_ioctlinvalid argument to %sinvalid ifnet multicast command: 0x%lxether_outputether-get-mac-addressmac-addresslocal-mac-addressThe multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooksd n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ey}vr}nd_set_timer%s: invalid timer type pfilRB^jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG`BgBlBoBrBwB|BBBBBBBBBBBBBœB̜BМB՜BޜBBBBBBBBBBBunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs  gnts==P===,B3B3B%s%s%sstring"propstnge 5B%llu0x%llx%lliBظ==rbmn=H=|==<=integerpropnmbrЦe(Bstrtoull%s: invalid base %dstrtoll%s: invalid base %dB>Bp=Bp=B`=B=B=Bp=?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelRpbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif|H,XVLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersaveSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchanSIOCS80211CHANNEL%sSIOCS80211hidessidapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragIEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableffs4.2BSD%s partition type is not `%s'Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point*X[r3i| 1 c     userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s @AAwoCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood O+ODOqOOOOP$PDPdPPPPQ2Q\QQ%s: #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: %-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s UGHRBD M@dmCLS1@2plbunspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %8s %s PriorityCapacityAvailUsed%-*s %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c zKzmz421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)‚Ƃʂ ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYɻɻpclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGSD%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machinezaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy||||u#||z\#||xn#||e#||@i# }}?j#'}/}>k#L}W}^#k}z}y]#}}=l#}|[l#}|Zm#}|o#}}|Z#}h#}}h#}| i#}}o#}|{[#}~PZ#~(~|o#-~(~x^#>~G~`#V~d~a#s~{~b#~~_#~}c#~|c#~|d#~G~p#~d~q#~|r#~f#}s#"|s#.|t#%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula2.%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalida%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF Zd/sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSÓ͓ד $)-6AFKOS]cgosy}unknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%   "#$%    "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmd%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700modulesbasebase32etccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s UiK=WC1Lecs%zu%llu - %llu %s, %s/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS  '-4<AINSW`kpuy}͡ݡ//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD11/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s%c/dev/r%s%cr%s%c%u%s (%u)fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sghx=  MUa#I q%] }M9Y A[I-unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS8?DNXahw~ªǪ̪ЪԪު $4Pݵph%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %s%s%sUser answered no to destroy other data, aborting. %s [%s %s]%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------   "#$%@//tmp/usr/var%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s%*s %s%llupartman%s/%s#`###rrwlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s%draid/tmp/raid.%d.confwCould not open %s for writing cat <%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sgpt destroy %sout of memory0-a Ľν ,gpt %s %s -b %llu %s%s_%lli@%lliNAME=%s/dev/%s/dev/r%sr%sStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs  ',15>EJTX]flpx|<m٬U+aŭ۞͝ i9Y}CUɟGwindowsefibioslinux-dataappleraidvmcorevmreseredXX``d itTz !biosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLSFH0eCAGSFU0eCQ[Hah!IdontNeedEFIej(s*K>;tx|nQn- q+|nQn- q+|nQn- q+|nQn- q+Ͼھ|nQn- q+=rGy=iG};Mt?mWC 3KOO'yD<#*=(2<YbBRuoqrFU3Dh&dl\ M}-@Mjy֬-чHÿǿ-чHܿZIчHIчHIчH %2IчH@EL6 %?aQVS'@ )Ѹcj*1@ )Ѹ1x )ѸST.qBHo6֯i/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/%u%s (%u)%s_%lli@%lli/dev/%s/dev/r%sr%s/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal error%d%d%d%dPXL1q[ټǼ5a! mEE)]ymNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionP WjA #usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s| %5lld %-3s V %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA ***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiB-%u %uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x ?%s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu %c\%03o. --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms pollrecvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: unknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)%s%s (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Host UnreachableDestination Port UnreachableDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededFrag reassembly time exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr1>, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(%s)(invalid), invalidNode Information Reply!), %sBad ICMP type: %d HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid maxwait time: %sBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -s%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP!%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initsplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog)b4c;dAeEfLgXhiajikql{mndopq*rst+urvwxzyABCDEF GHI!J+K2L;MCNIORP_QgSnTsU}VWXZ146"|~}&27>CJRW]cix|HN!1:FP\o|3m 3m k k (null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt_new0addingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedEl El rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deletek k link#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt lo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)if_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s)+ BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %sipv4_deladdr%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- = = M M : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc5 5 : (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B."% "= "U "q " " $" *" 0" 6" <" B"5 alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~X",3\"&.e"*.n"t"z""""""" "@""hLHASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiescs_pathp/X/ bc_base_max0 bc_dim_max0 bc_scale_max0 bc_string_max0 coll_weights_max0 expr_nest_max 0 line_max0  re_dup_max0  posix2_version 0  posix2_c_bind0  posix2_c_dev0  posix2_char_term0 posix2_fort_dev0 posix2_fort_run0 posix2_localedef0 posix2_sw_dev0 posix2_upe0 stream_max0 tzname_max0 atexit_max0Unknown error numberUnknown signal number%m (%s)88`888L8888888$8[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d ,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C025J.0tcr>q Tunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist