08Nhi<  Nhi_#t tNhi@@<@T 08Nhi<  Nhi_#t tNhi@@<@TU Nhit`ANhiNhiNhi$h NhiNhiNhiANhiNhiNhiA.NhiNhiNhixANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhimD="NhiNhiNhi (08@HPX`hpx($TNhiNhiNhiHPX`hpxN$ NhiNhiNhiK$/NhiNhiNhi (M$,NhiNhiNhi08@HPX`hpFANhiNhiNhiCNhiNhiNhiANhiNhiNhiANhiNhiNhi!NhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhiaNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi!NhiNhiNhi4!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi B!NhiNhiNhi B!NhiNhiNhi!NhiNhiNhi"!NhiNhiNhi"!NhiNhiNhi"aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhiaNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi!NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi?\!NhiNhiNhi>\!NhiNhiNhi=\!NhiNhiNhi<\!NhiNhiNhi;\!NhiNhiNhi:\!NhiNhiNhi9\!NhiNhiNhi8\!NhiNhiNhi?\!NhiNhiNhi>\!NhiNhiNhi=\!NhiNhiNhi<\!NhiNhiNhi;\!NhiNhiNhi:\!NhiNhiNhi9\!NhiNhiNhi8\!NhiNhiNhi:\!NhiNhiNhi7\!NhiNhiNhi6\!NhiNhiNhi5\!NhiNhiNhi4\!NhiNhiNhi3\!NhiNhiNhi2\!NhiNhiNhi1\!NhiNhiNhi0\!NhiNhiNhi7\!NhiNhiNhi6\!NhiNhiNhi5\!NhiNhiNhi4\!NhiNhiNhi3\!NhiNhiNhi2\!NhiNhiNhi1\!NhiNhiNhi0\!NhiNhiNhi2\!NhiNhiNhi/\!NhiNhiNhi.\!NhiNhiNhi-\!NhiNhiNhi,\!NhiNhiNhi+\!NhiNhiNhi*\!NhiNhiNhi)\!NhiNhiNhi(\!NhiNhiNhi/\!NhiNhiNhi.\!NhiNhiNhi-\!NhiNhiNhi,\!NhiNhiNhi+\!NhiNhiNhi*\!NhiNhiNhi)\!NhiNhiNhi(\!NhiNhiNhi*\!NhiNhiNhi'\!NhiNhiNhi&\!NhiNhiNhi%\!NhiNhiNhi$\!NhiNhiNhi#\!NhiNhiNhi"\!NhiNhiNhi!\!NhiNhiNhi \!NhiNhiNhi'\!NhiNhiNhi&\!NhiNhiNhi%\!NhiNhiNhi$\!NhiNhiNhi#\!NhiNhiNhi"\!NhiNhiNhi!\!NhiNhiNhi \!NhiNhiNhi"\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi \!NhiNhiNhi\!NhiNhiNhi \!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi\!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi!NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi$!NhiNhiNhi4!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi !NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhiaNhiNhiNhiaNhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhiaNhiNhiNhi aNhiNhiNhiaNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi?\aNhiNhiNhi>\aNhiNhiNhi=\aNhiNhiNhi<\aNhiNhiNhi;\aNhiNhiNhi:\aNhiNhiNhi9\aNhiNhiNhi8\aNhiNhiNhi?\aNhiNhiNhi>\aNhiNhiNhi=\aNhiNhiNhi<\aNhiNhiNhi;\aNhiNhiNhi:\aNhiNhiNhi9\aNhiNhiNhi8\aNhiNhiNhi:\aNhiNhiNhi7\aNhiNhiNhi6\aNhiNhiNhi5\aNhiNhiNhi4\aNhiNhiNhi3\aNhiNhiNhi2\aNhiNhiNhi1\aNhiNhiNhi0\aNhiNhiNhi7\aNhiNhiNhi6\aNhiNhiNhi5\aNhiNhiNhi4\aNhiNhiNhi3\aNhiNhiNhi2\aNhiNhiNhi1\aNhiNhiNhi0\aNhiNhiNhi2\aNhiNhiNhi/\aNhiNhiNhi.\aNhiNhiNhi-\aNhiNhiNhi,\aNhiNhiNhi+\aNhiNhiNhi*\aNhiNhiNhi)\aNhiNhiNhi(\aNhiNhiNhi/\aNhiNhiNhi.\aNhiNhiNhi-\aNhiNhiNhi,\aNhiNhiNhi+\aNhiNhiNhi*\aNhiNhiNhi)\aNhiNhiNhi(\aNhiNhiNhi*\aNhiNhiNhi'\aNhiNhiNhi&\aNhiNhiNhi%\aNhiNhiNhi$\aNhiNhiNhi#\aNhiNhiNhi"\aNhiNhiNhi!\aNhiNhiNhi \aNhiNhiNhi'\aNhiNhiNhi&\aNhiNhiNhi%\aNhiNhiNhi$\aNhiNhiNhi#\aNhiNhiNhi"\aNhiNhiNhi!\aNhiNhiNhi \aNhiNhiNhi"\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi \aNhiNhiNhi\aNhiNhiNhi \aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\aNhiNhiNhi\ !NhiNhiNhii!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhi aNhiNhiNhiaNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi!NhiNhiNhi!NhiNhiNhiaNhiNhiNhiaNhiNhiNhi!NhiNhiNhi!NhiNhiNhi!NhiNhiNhi B!NhiNhiNhi B!NhiNhiNhi!NhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhiaNhiNhiNhi!NhiNhiNhi!NhiNhiNhiaNhiNhiNhi aNhiNhiNhiaNhiNhiNhi aNhiNhiNhiaNhiNhiNhiaNhiNhiNhiNhiNhiNhibpf!NhiNhiNhi $NhiNhiNhi$NhiNhiNhiv$>NhiNhiNhi$NhiNhiNhi$sNhiNhiNhi$NhiNhiNhiANhiNhiNhim NhiNhiNhi$NhiNhiNhi $NhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhiANhiNhiNhi0z, 0\I:n#jJ9"M2!D}P9^67eKV ,k:lU_TdrГ:L9z;d{@ 侙~.d@n)A) -5[;~52eV1p'6T0 %_T=YΡP\/ww8 B#vz:g/i x JΡ51{L1Ϊ>`&.s _]Z^ oI agg5$o>[bOhS '2 ^,5Jmuw|ŰnkA*otj?r2Z3ة s*siW`<|>%/O{O lysީYX([@|?AT^ju\ a^ƽ (Skei:)6aUB)-xP+ }g=b;1Ig( 1?mc@s GH*135t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4:"4 (f!f!g!%%(t& LLg!%%NetBSDKwGPaX NetBSDearmv6hf4p@-D0D 0@`Qp(@P`F`F&a03/T@px$$A-`0`` 0PpU(pGpG@Pq`P03/T@0US $XH-x`Q MN h!h1 @`p0 0R0D1<  0S  /S 0S1Y Y9 T P0PUH2H0@3(1*03/T@ 60地0 [* PC PE%Q03/Zd 0 P0 0%$x\$`$s%,p @-l P`@P H厩V`POU 儩P  @ꔌho&P@-@⩌O-`882@4RMt00t@0pWo  XP@tt@( R E@PpR0: S K婨`0SЍ)@P0`0x; 0xS0S P0S S0p WP { 0S;00 0 pP 0s s0T T@;L   PpWn&\w&&0pw&)H0`  BR` pRp RX Xp/n&o&@-\0 %&믑ho& 000/{&pC-؀-`P p0M@ E{ A (? A{{z`P$0  ЍpY@{&%ho&@-@ M00@  P & ЍA-` l1V0zP 0 @P@TV PC  W@@7[0S@ @0;0}P W 0Xp[V p[0-S XdHp 4@0SV  W %/%{&9O-5MpY xIp 7`P` Ѝ  p` 0`$5XP0S 5%0 0 5X0S40S* D$尠D900CS0 @ Pp  @YT `0 @00CS0X0 X0 pQ00p p@300 ;80: Sx h+sp@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `Ap2  pc 0Z 1(#00 H  0P \\P 4 `+X"J 0R 0p0ZZ3r0S P Y' p00 R0S ``0S  0 >(d P <`V k`0 ?oR20S 0  0 0R04P u`P hhm`0S H,` P0Rt00!P {&%E{&{&{&{&{&ho&Hn&W{&{&{&`ɋ&{&{&0@-MM@P  tp  ;0U$C dP TT&ۍЍ08 P ,(0P X%{&Q@-@ TP DD,P $ 0P@%{&Q@-@ XP HH0"P $ 0P@%{&@-oY0 뿕ho&0$/ᐌ'0$/'@-MH@-H^@-Cu@->닖T@-1   0# 0 Ѝ䠖'@-1   0 0 Ѝ䰖'@-1   0 0 Ѝ伖'@-1   0 0 ЍȖ،'@-0   0 0 ЍԖЌ'@-0   000 Ѝ''<00/@-0   00 Ѝ ''<00/@-0   00 Ѝ '' 0@- 00 $0P@IЍ%,0A-`M!A!qX0 p! R0B=0B  P嫤0H 8 R8B 4!010,!0ЍPP l=H0P   0S  0 pP0P      0 3/R ! 7000<040L7D0'' ',#=ژTx'$Qd0p@-|@PtP00 R 0p800 p0  B0Sqs '''0 0 0 /ᐌ'' @-@- @-@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpW0S 00ꜙm8@@-@z<PЍ@ PЍp@-(`Vp80@  03/PP8003/(Pp蟙@-@P`P 80 (0(3/@W P WPЍpЋ'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A= 000+ xpt| "<  ЍO0 P % pHp 81/qp4  ?P p 4 /W0S4 tp0 0 0 0 ";0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0ע004 8pX  FЍЋ'!'̙ޙR/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  P0 0  0 = $0 !(0Ÿ}?LB?@PN3c` D0S%H0}??@3c`_`RP0!!!! d 4 !`P54P4 " BXX P!d4"4O4 " B   !d44O4 }# B  d44O4 j/0O8p<@0! :` d @44O4 MЍ舌'Mb0'Ԛښ(;RU@-@RC- A `00P4 2#&P8P (01/qp$ 㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@q0  Y $ ҽ ꐌ' '%@-PAM P04!2#!8 P0(5/qp$ NP9 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080l0( p 3/p #U0* ,0P/`RP `'m0@-@L M DP  0Q P  lЍ0'כO-M0@S M. 8S+ #='0|0S( 000| L" ! !Ex0x0# #>|0 X9& L%3ݍ Ѝ'|@ 0 Y0 S 0E0VS06  S  S $0S0 600000S60 060 00 0@RlN R0r0C0C00Q0 0S. ,B< ,l(6$0P`p U$  ( ( ,0S 0`"000(0040 0S $Z% 0 BR(0S0U0'  - 0   0 0,0S H00 02 8(nY0 @@X; ? X07* N 0 MP N0 Mp N0  M004 0d 0000 0@"<@ 0@ p|W" NXW% p ? X :$0吣(0s' 0吓(00S0 ,0S#$PU 0 !40S d*\ /\ * yN0  ZM 0 lN 0#6#  |0r$0[P,01  !x0$ ( !p0   !i004 0L 0000@0 <"f01,0S 0`QP T0XUp, ?U0(*N 0  LN0 LN0  L00,000 0, DM됹U㐚) ?U :M$0U㐣(0吃( ?U :M 03!  0 @<  0p |j;' 1kԜ%&+'XߝC֝73<VD]@-pfPP`@@  #NP Ѝ`3MU@np@-XP8@T`@D p MP<opQ<Pp'A-AP 0P$ 0 0 SQ ( $0yP R.h d`P, R2DaDqU`0``000PR 00CS000 O   0,`0CS0000 (00/U R dR8 4TD 0$00 0$ @'pho&t@''T0 S 0SP/P/S/@- @'p@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p@'@'%''p@-$ p 00ho&Q 0Q\S@-A /`@-0S*  0@000S! P| @pP BPP @P ּ0 S@/R/     0  밎'( Q 0@30/@-밎'00@- R 0C30e밎'A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  cT0100CS00 1pP谎'n&G-AP pRpGWR0`0`063` 001S 0100CS0H89  P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  %`p谎'G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P`谎'G-A 0`0P0\ P 00CS0-0 p& 0FSep b1S !0PEP0Cp00100CS0谎'O-HB`0pS85P UB!0SR0XPPP00κPE 0Q0CS00LN!1& PP\00`F`0vP0   P*  0!0CS0P(P*WP; 0堑0 S- S   刺P G剽 o00CS00  0堑0CS00  E0PzP갎'ho&A-ApaV&ʐ0l00EPPFF ,00CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p갎'ho&0G-D0!10]PpЍ0S0  $SPPPPPfFX TVP00CS00 # b0Q0CS00! P1ȃԓ 0 S)"Rʠc0U```00妹P 0b0CS00 E 1Q !@o!S/ %S !`V U 00 0wP 0帡0CS000!000\Q00`PR# !RU``0``00HPd 0a0CS00km0` 1 1S 0S21a0S S`l   P7 0a0CS00>@10`! S:`Fp00  1S p6?a0S `10 BRpE` S`l   ۸P 0a0CS00   갎'ho&.Bx'( Q 0@30/@-K밎'`01S @-0@!S @c@P /q5P /谎'V7@-A0 R!RUUʐ0\00僸P@E儻 |xj00CS00+ 0 @ R,V R P Ѝ00!S KP ^0 Sڰ 0R0CS0000 0 Q  vP   갎'tv&ho&Yj?A-O 0 P0,p W !GpY\ϟYP PP0  nQ pQ lQ 0 S , PP1S P PPP0 nR pR lR 00 S1S P P0PP_PP0 nR pR lR 00 S1S jP!S00P0PP1S 2S 0Sڜ 000@ `PP 0 nR* pR# lR$ 00 S5Pm PPPೃ0S!S , /0S 1Sm cP0PPPeH 010,0,0]0S000@ PQ 0!SP@ =P00 nR pR lR 00 S-0S  . H]3PP1S PP%G@o%G`GooPbVWP 101@PP00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  ;P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PP"PP0 nR pR lR 00 S{1SjP pP0PP PP` 0 nR pR lR 00 SX_aP0PP PV0nQ pQ lQ 00 S 9PPD B 0  P6p PP10S `Vp0VmVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  l P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l Br R0" 0 S1S 2SqW P0000@ 0S0 0`PP 0 nR- pR& lR' 00 Sc1SR1S0!S -0S1S d  PXX 0S0T 1RP0PPP` gRF  R 0 B RA `8@p>A0"S:b-pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 /P00PP2P02 aP P 垵0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& HPP0 nR' pR lR! 00 S1S"P20 2 2020P0PPP pPPP0SR `V0V pʈ0 nR pR lR 00 S]1SLcP0PP RPӰ nQ pQ lQ 0 S?:P0 PPtv&'~B%%¤֤'ho&-4'x'N8'%`egQP000P0P@w _`P 00 00 P 0 nR+ pR$ lR% 00 S1S0!S +0S1S| aWWv FP0S0P0PP1S 2SqXP R$ l Br R0"0 S0@PP0010CS@ Pnb@p @0"S0mPP00 nR pR lR 00 Sx2 00S =PPPP0  nQ pQ lQ 0 Sa0S jPP0S6PP^0 nR pR lR 00 SBP aYⶴ2SGP0PP P6 #-@- 00e ЍЍ/''-0^S0]S0]S S]S[S .0Ls0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0庲P,=?廵( $- 00CS010 [S \S @@P`0 S @ #0(a0CS,0p00,a > L0 0@S G 0(8''@'Fho&J'/Ȏ'p@-!0 P= P@01SE0p0 SS t`P@0P 00S#P0P00 qP0 h0T ľ0 0Q㵰P0>(0 ,(8'X'r'''Fho&JO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00ͱP? 0A0CS0l10G 0P \QH 0 SP 010S vP/ 000S S)00 S [ U 000厱P >厴 t00CS0L00 0`00Pp8 P8''@''D'H'n&ho&0A-P0 0p@ W 0 `@P 0 R00R00 1BQ=@ @P"@p=0"S,"@gR0008''O-@SMpcȳ00 0GS TcsT`0``00P=` \yX00C0+0&SK BR D R: Y J@p RڰP\=ڳ L00C0S @Ѝh20  S  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p 偰P =倳D @<f00C0 AQ 0 T0 Tpppp  OPu p BR   @W0 `0CS0(00oq 0 b'@''ho&O-M 0@P0P0s 840S 0 0 000 (0pP ߍ0P0`#2C 00 S pSN(0Y01 Y  $ P$d<P LTH  B R+030  # _  BR 200S 0 0m 7; 0 0(PP.00Y0 Y H $ 唯P$  BR 200S 0 7 ; P0 (0 P'0 p1pG Y;ttZ ZP<1;Y, ($?00C0SuX   R    P> 00CS000^`W 004 00S xxL00S 0  :8 0%X  Ȏ''@'ho&'ŦO-pᬡA0M0CQ` 01 00C S00`NlЍ2  0P5 P!` 00000`P00CS000  N[  0S00CS0x00` P  P긎'Ď'@''''O-RB0M00bsp 0siЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S [0p0000000CS0C01;  \" \   " L\ B  @      0C LN '%Ď''@'L'D''A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT ᯮ@ 0'Ď'%'G-@p0 PR` 0 P (S%0  d LP 0 ,(y'ho&@-90  ho&O-eGM0PS@pM$Q403/P 60: S900W +%% P8:9?0þP0: S 0S⫾P0: S 0S 0S 0/S&ᙾP7➾0p0o4P- 姅P 0#v PvO+$0P ]D#Py]aP ¡/f:P/`:P 40P+I [(H Z% U8.0. 0:PT9.0. 0.P @DP ^ PT1RP o R00S$ 0SS 0: SOjPN 6  008G=00 04K $8G=00J0SP. Tq+XG DX00CS0 p Pp  pYW cX0 X p00CS00 꺽0S ጼP0SGݍЍ0c ?o2500Ꮌ0 8'h8٧ܧo&.ho&;n&I\\30\\3X X0p@-@P@@DDT ` U H H0Rp@\\3ppX 0Xp@-@P@@DDT ` U HH Qp@\\3ppX X0p@-0P0@44T ` U 8 80Rp@\\3ppX 0Xp@-0P0@44T ` U 88 Qp@\\3ppX X0p@-PPP@TTT ` U X X0Rp@\\f3ppX 0Xp@-PPP@TTT ` U XX Qp@\\K3ppX0X @-ppt t0\@ ^0@\\63X 0X@-pptt \@ ^ @\\ 35S %R R S R SSh -^L^S R 0/0/00000'O-QMTg @ `u @ 0 @0L0@@@ @@D@H@,@0@<@@@4@8@5 SS$\ 剃0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?0$pRp!1,0S d4 @?C000@$0D0p0H0D09p10$p1p1$0S00<00@0#0p!p0,0S 3 @?CZ㸰张 0x#p p0 0\#pp00 \ 0C0CQ0B003/040 0S UYT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " &p P 4 04080080 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$X0[(S0 0R  P 4P0@E00S00P00P00PPS\0.S0S 0!{<0P$0 0P(0 $' (" R P0᧪P000Ѝ0'¨VUUUǨ̨G-@a!80S  PP "spW G <0SB|1!@P 6@ 6@60S5!0CS0 \$ 催  00L0S \0.S0S U"@0S40S t1l"$<0Y?o20S X (0400'@gϨG-`f)P0DL0 嬺P0S$00D0H0娹P0pP〔0t$共pZh4T H0 `F0P 0 H,P U$4X0 s0X00 00dt |  P PRPS W( ?R004(0'R S S S3 L0St3 T0Sh3 0S\3PT#QP30V < 00Ѝ10@GS  0$ 00H00P0L0 0T0X0s0X0 00P0L0T0H00 00P0L0T0H00X0v0P00L00T00P0L0 0fb0d0_PP\0<0Y080 PT0 D0h l0N0D0h0000000Bp=0p$0,p80$00,03000@0-0 0*0p0'0t0$0D00h00x00|000000000D0@P 4 圿㝼00D`0S0\0S00S S S0 30`0St0\0Sh0h00'ht@%n>xh&bX'ܳ %ho&T(80p@-@PT @@\p蠓'j80p@-@PT @@\p蠓'j-L0MSM\0 &+ ⰷp34屪0 "ލЍ 00  >04@phl0l 0 0  ~L00S   Rluho&o''t'$0\ 0S @=ꠓ'ol0L0S/0 0 0/@-00 SM 4@@$;<pЍX0T0P@ CH0@ B ?} 0Ѝ@<'@'T'\'X'P `00CS`0p S00 P0S X0X /X n&: S@-  S  S/ I* S  S%|@=A-x1`@TXPM !X幽@P10S D10S- 0qp'p. *➽@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?, 0nH00S 8'é@'T'''''\'X't's@- *P@@P `TU00S @KT GЍp0t  Q \0 \@1U ,P@(Uϩ''p@-P@Tp0 0C0  $E @C-@4M$3 30S`sV4Ѝ0 0C0{ 0XPS !$0S 20Sm  4 㠒;$pxZ *ʼⰦ0( PD20S 00幼  嵼20S  孼0 : SK0( r" 08"$4嚼10S10S61!0 0H 10Sx10S : S0: S y`x41萟 0IR 1 B?+ 0 ^'Q ㌐op| , *JLN\,A|00S 긓'p'8'@'éT''P'''''''\'X't'1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ 0P 0 ڙ`0SpQPPU% Ѝ  B 10`    0S[  L0  $R,   V 8'@'T'''%,%'410G-S$0@010S 10S,0000 0 0PI0`VGcFBpP儠UG t0 0C0 W kp0S$,  `YpP [`8'@'T'''%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG 40 0C0 W ,+p0 00 S "p0S$,  Mp` 8'@'T''%@- M @ ᙥp ЍT P 0@  QQ  00!T P S  o&0p@-0PS``G*@P ,+P PRA™@P4J bP徺Ƥp蜓' !C-CM@!* `/ /PȐ`T *F 0*pPPCߍw ? P@.w0S ?@P?oP@t&@-0 0ho& 000/ē'@-/0 zho&@- MzP<1ᗲb0S 㜛  qP< P$| =[  ᫳P  0 ˯S ,!0 0  A! A ({{ z0 |嫹p|B00@0 sP 8זp lpP .0S ʖX0;X0XdP 忖_P |.0-S  岖 PXBpPl0S  @尸Sp Y@ē'@Jho&n&>uڪƫѫ&s@-@ `P᯲P0P UƱıЍpU 劲ㇲ\@帱嶱0 mP4vs@t0%mpG-A~M0MSP 0p`E 0E (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@}P-d!)0`~܍Ѝ~,_P - !0 0E~ͲP- ~,G`P- ~,>P0pE 0E~寲PYp  %Q \/0 00EᚲP->$ /0%m<l00CS0 0 /G-\D`HMp 0008T8$8t0000 00 $0S0 V"4`0p Q 30Sa3PZGPZM-0#/ް000 0K|#P9-0`#q/V 00D30p Q   #声P0 0-0"R/V0020"匰P-0"=/2000HЍp(0: S P. S+@ ޱP00S`0:0 03V-V)V q 1X  ?T& 3 0~\P F ;0L S0 00 0"qp,0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U % XPV P 00%''|%h<%@('D%έM%m8@''\%}D00S/@-4@~M0S~, P~܍'0%0@-p@$0l00S Ѝ00 0!0Q ',, `. P0%'1L0@- R8-P 0 0 -'QA('A-pP@` sP@DTP`VA-pP@` BP@DTP`Vp@-P@T0` QH@P 0 Q @;;S p8@P00T@ +(0( -( -0%''s@-R@T` V0a@$00 ?00S 0CS3P3+0 S9i-00@ЍpPڀ;;S" 00 0A!0Q P?UP00@00" _+0S @@Y+0ES TT 0$0N+0SI+0S E+0S A+0S $0STڄ00Q Q`-T( H -"+(00 Z-$0%'-dA(b`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     ۯP000S, @ 00pT0pS 0L Qo 0K$p T0 Q/'0%|%mLG-P`0 P ,p@P"ڰAQ"j Q 0P P 0Y Q*@ ,ЍP P0%'@-|A`MPh1P0S2 S VPLDE,00ЍV0App0 ! 0QL* , P0S(0S 0 Q#6* ) Pڐ0V 0?# l0 ` 0P* 0< Q,000%'߰ 1'<mRO-M4M S0`RX0E@FP@0 0S 0 Ģ00rS '0S    Gdz000 a#0  ẳ0" #ⴳT~4"#> Dᷴ܍4ЍT 2 R - ᛳ1[ 0`#┳#c## 0S1夁0 "#p 0  z 0 #tT>4!D #>,1$a0, 000p0 01尐(0C0X  R,00( ,0$ "$ 0 ? 000 p #4### 㡬T|%ho&'dA(}'A('m'ޱ'0%C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S 1  0S pP (0: S0 0έ p10S10S Pu催P 2 0 0 0S q4S 1 00 0S000p000 S(00(000 P@0S '000S x0#P 0+0t00"P 0X唳0%''@(0A(@(@(A(&'|%LA(VdA(]''bC-M M\ P}(H#*G ܫPq(#*SC$0`SH 0`E0S2*p#Pu #Pp 0 m S( 1**2r0t0CS G)|)p)5)])\)PLa#P0000$2) 2 `ލ Ѝ)&0S  R  sS SS YSP )yS)Dq儁)3)P)P@#P00000S()( )0S0 #P !0P)@PP P0000)P0Wi)@(o0%'A(A(D%<%ײ|% -@(=\zʹٴ/ Po00@-@BpMp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S =)@DT  A 0d#0UPTP&)PV0S p)@X`ꓢ" @2/PL0 !ᓢ#, 03p%d%'|%ϵ'dA(G-鈑0@`pP@FaU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ A P 80| 3/PtPPTT00S\ T(R <003/P 202dA('|%=''c@-AMP/M'@P+ p`pFP/0P0 Uh0h (AލЍT0_"!/0P0 0@0 `(Ě''˶00CS0 ձ0 /0O-S$M00`Y P$ЍP0,03/P00儎L30S,0 TA(@(»0@-M@, 0000S# Q0S 10S P'0S% X0 "?A3c000S&!h0 "?A3c0 AP 0NS 0X 2Ѝ00< *0S p%%Mb;p@-@P`۠P p ᙟP $0 0 p@(f@-!@ሟP 0 0@ @(G-P0`/Sp/M/ @P7 ~P. np /00 eP&  P!00S  P YP0 Dsx ЍA(G-@P 00/S $QP 800Q  GȞJZP>0 0u`0S J렐p0 P$0S@$<lp@D0 40 N@eD?(  A(@(A-M`P@pޟP5(10S Ѝ 0RP  0RP 0: SP P0  ᝟PW ᅞP  P W0 @TA()GX0@-:(4@: SM=0P - \ 00[ P0 pp 0: S ,kЍ000  tr:P/  0 fA-`QFZDT@P_0@!81P @$<sP10SP+(0 0 0 =  "4S `P.`0 e{0p 40Ѝ(tS|(tHP! 00 0ꟻA(A(%%?(O-Z#Q30` @ (tJM Mp4#0CS0 t3tP d30S žP0: S X P Z Z30S 0 "q"8pS0 "X 2P @$<P RPn (4`S42TP PuqPa 0"0 + 0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 Cᘝz @8Jލ Ѝ  r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00A(8A( A(A(A(%=B%/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 @0 X2@ @?Q*@0 0嘠P %P` hЍXX ᣊ  ` `@xZA(A(jA(A(Rs@-Ѝp@ 0@`PMQx08  ̛Pj0 ꐾ?(x0@-@MPP00800S =J"Ѝ0@(G-`QM MJP㠔@ Y #p ⵛP 0p 0PP=! SR J( ݍ ЍPJ8 O= $HL0Q\ J(L0 00 QJ8 PTꧾξA-QP 000p@T+`00CS0pT0 0S0T@ 0S@ 0 dP 0S@ @T@ S P ?(%n& ?(0 0 S00@-@R00000S0@000S `呉P Llp 40P8A(HC-x1lM0@S XlЍC`Z(?="(<p@_WpP00 0000p084 40CSH$0r"60"$ՠ 0( Р4 CR+p ǠlЍB>'"⾠S+0  Ib@(UT}@-@XM="r:(0 cXЍ7@-@Ppp P Q Ѝ0 0  W@ Ѝ0@Q@0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq*-0C\^* 0 \ 00W0!00N0 00N ^*N^*/ P@-*0S@L0 ? SR@C:@  ^:R \000Cs R00 S00 Cr@ T \A Cr@T2  0a0Cs R"  -0C\0S* ^ 02W"!0C0 0C S*CS*80P @-  //DA(A-@((PQ U?-QQpW :WP`0 [?`S A褍A@0:S@0 R  0 `-@(xh&ho&/ps@- `L 0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&!PP@P0PA- 0SD`Pp 0P  T @R p00T0p0S , @P0=0PP @(=s@-@;`P0l C300PЍp@00S S@@PP 0 @D 00@(@-  P>}ho&T0 Rr @-/|%@-<@<=>0b:> 6>2>_ho&G-p p!,@d5\P+p`N0, Z/00 ` "O-lM/_PoY@P= `P0p`ᐟ/00? PGP@  l?l/@p\?X?A0sR  S  R4?4/0, CR 0K?zP< N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/ 4>  ,> > 0S  > 0.0.0-0==P}===|=-=   H-  g= 0@T pPP\`y,  0!-1 @ L< -=@=<P? <;<,<,<,t<,h<,\<,||_ Y P:4Co S Q  S  FP  ! qp 00 B00C2#d v>C 0C0 0A0 B!"00@tv&/A-Q@pW :HNA(M-`PpЍ8":0J840K0CS 2  `>0 01 5  d| (lu <tp @ |qp}  `=/ 0$  4 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$A( A(C-Z4$#0C@EMS$0 30S`` EߍJ(]J(J(J(.0 0~P0<x P J8P0@ P J-1  =0 0 0P J<@ph1XPE SrD1UPM Kr}00 0zPP J}zPߍ P$PP P dP 0$P Px s 00bR cyPA(`@ (@(p@-PMM@ d `=\\  0P UM>@ ; 00$0$0<0 0 0ݍЍp$ A(p@-@C PP hp@C@-0p-S0S( P{@P#lt 0M0` S0 \BPPP00T Ѝ@`ὸn&-@-0@P   m(Ѝ@Ѝ/A(p@-@ATp@0 R P'JP ` `eP`pA(-P@- 00|0 x0x 0 0 h@0S XJ00L0L < ,-$ J Ѝ@ Ѝ/@(0A(@(@(ho&A(7p@-xh@PlmhPP XfP pKi000S   p<EA(GXA( -P7@- 000@ 0 0 0 P0S x7J00l0l h囈 XםTtD 8又0 !J Ѝ0@Ѝ/@(0A(@(@(o&A(7ho&e@-f yzkho&0@-MM@P@Mߍ00/S,DPt'DP =p T8p  0RP 0RP | 000/A(@-# 67ho&C-q`@$MT pp'hAPD 00CS0>@ Pp< @Y@DOoB0S@$Ѝ0P: S wP 0S :q pW H0圀 SH@ R 0A@ GT0 @00CS0,執0 A(ho&n&O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 tv&B(EB()B(B(n#0@- B(0s@-0P`0aW0`0@S P 0R@P@5  GP@-0S00S %0ST P000 R  ЍpB(N(l%E@-|AL ^ XP sr^( \ws1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !"O-p`p됰P0@%Ss0V0&S T6g! c0 00 @ P@P@B(/@-0@!4Mp JT` 0 P@4Ѝ0@P S7WP@V P @0 FAP@$ P@/ @UB(=p@-@P0)SpB(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  ! ,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H Ł T! z! 0  @@P! 0  @PVb'T@@`@P, @ ⑁  B(kBP=O-p`M8P젟찟n!@ j0 X@ 0DS'00^* PU @ 0 e 0DS00Y Ѝ` pUU B(C-锐p`  0BS0p0@SP ! 0 00P@@@P@ ЍB(G-`dP0@S! p0 00PP@B(@-@MP11`PLL0P  IR NRpp =PpEp@@0PS@ $>1ЍB(PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0@P 0,qP@u1`%h%I(N(@P/- 0/SSS00B(0@-@PMMMߍ00/S \I{p D{p  0RP 0RPp@-`\40@P #0D0p@`0_0G0"SP Vp@lzB(p@-T` RpH0@Q 8 1PP /pp@B(%G-pWR 0S)P hjB000000000CS020S @T  |R pR\T/i424b0000@/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 j00/ lR `R00CS0<10S 00CS00W00 pR0S/S0@D00j0@P  R*0000t/S0S P 0/0CS0 pG0S 00CS000>0@;0@80@B(B(B(`%I(h%A-`p0@00yP 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0NB(B(l%B(G-2Mp6r0@T2S@P 0.S00.S000/SS?X20PpTePZ( ,`V ;PP ` .` E0Eh}h@0-S0Sp1@T@dRP.|yPw 0S Uv.pP  `P k 0: S W =^.pPXP pW k0S g A.pPЍl%K( 5B(#FM@-$0Q @ GQ @B(bp@-L@50P000S LTPP 0Ses@@`M 101M00CS00 fM 0 HM0pj<K(B(|%G-@P@\R` V101 <P (P  `I\TQp @p0T \0DsQjSh0 @0 p0BP!0 BS@p@00CS00 M 0@0 @T0S 00CS00 L 0 0SZ00CS00 L 0 L 1 0h1@ @ @ @ @ @pp\@@|%A-@ ` PR 0R 0S SLp0S0 R M0S  LU  LTLi xL Td@00CS00 gL 0 AHLd%B(C(%x% 0@-Pe" 0^B(@-@(0Q MB(@-x0@T   @@@@ @0S @T H1 NB@DG8BG1F0S  1$ Iߍ0A 0 000 0p@P00CS0 0@ 0 00x0 =00CS0 0S Gl GD0FX00S i@00S cB(l%O(x%N("B()B(B(3B(0 @-`o$M 0 00^0SP4P @O'000p\ pe%P 00S )p=9p0 p000CS0(00S  S'$Ѝl%B(;B(C-@?mM000@H0?_00?0,@0P@ '@P0o0`p00dp@Td0hP@0po 0lP@T 00/P0l $00`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0C7S 'x0R8 P>0S900SD 4.000Y0,0(00 0p(0&p  =&0S(7S%00S 0 0S= 8  x=, pp@ P 0 t= jK8 `= <=, R , ,( $P000==0S @U0 0P"@I.P  @J$ 0 $ R 0T@ =lF @P H@P @P07:0P |PP@HP\: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP   7S 0Cs0S0dd)SS @70s0S@P0 Q AqQ9 R 0 00 Q0 -PP -P R 0S0(0(00(00S  8 @  (00(00@0 800408<000LLP7 7H 00R{0( =$0SP007GQhnH 0'000 000 7 0'0'00$(0x7  10103/$0 7 XED7D' 7<' CL0S I8 6 6 @ R[ 4 0  V $vC&@00CS0 al60S ޅP 60S&,0uoS5d6$6T h0 J5,,0( 0000+,0( h"0xE$0(0S,$ h5 p50S X45,0S pmt: %0(50S F0 @0 ?P@ET=0 0<0$0 0C0 000D0004 8\XPO00CS0P40S XP( p40S>)T0SX;O I8 3 3 3 \ $4 03<%)ğ00H:3 0 0S '|0R0#C,#0 0 3 ChI00S0pN0"0C0000NH8 2  2  2 \ 2 (Ÿ00 0t2 T0ST"00CS0 (2 R   02D0S#mߍ910S {0D!SS}1 08 L0H@Hs10@0@0S h1 @0S1 L1$ @0S  01@0s`1 R#0SH1   B  @0S @0S7S@< 0 00S *9p@,0S0  ;,0Sh@ 3D<0,0 0H 0ZE@TP(N(B(O(N(l%8L(B(;O(B(B(O(x%ЮLl`%K(K(-xh&|%d%%RB( C(!K(B( d@B (0Sp0 t0Xl,0 0v,s)DPEG0/B(0 /B(0 /B(0/B( 0  /B(P@-@&P@<0 QP cR   B(0 S0/B(0@-0M0/0@0P @mP 0: Sl  S` PЍ0+mP0 : Sc" PPP(p@-Px@x`M$P)00S \"0`$00``00%!`"$ЍpB(K(@-h@P$03&0 RP   BQ   B(//C-LM\)8⮄8 p@<(P@0` D40 `G 0ALЍ|%A-@P`^kpWU K! 00'pK(C(O-pWA R``%` P0S:S SZE@ @0S(W@  @0T/S/00N[0p0 R00P R:R:RPPP0@DOM!!`%h%C(@-@MP/p P㨐K  0 T@ T9%lp0 @~0!0P 0pWZ0S 0 bT10S -0S )0 Skp @6! h`P T T T0@@T >0DSC(A- 1@PM`Rk0 1000  ;p!XZU p@@ Q X@T@Q@@ 08AS 00CS00 @ 0* 00CS00 @ 0 ЍQ ]@|@U P000K 00CS0T00S DC@A@80P(/8A|%DB(B(NTXp@-P@@Pp 0S%SpP @p@-P8@Pp 0RPp@- @0@ R0S P P\ 0%$C(G-`P@唀0吐00|Up00CS0h00SGC0S0 S 0S00sZPPpB($C(%B(A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @#P`0W:SP0R@P('%vA-`P倀000|Vp00CS0T00SA0Sp00K Z@T`B($C(B(0A-pPS R+`a@T"W p000KT0 @0 0 JY00CS0H00S `P `@C(B(B(p@-P$@Pp0P0@@-L@000@00 Y00CS000S@`B(C(B(O-PM/`@ 0P @@@k (jP00š0 +0S '0S #000V#   P@ +P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @u 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp "P pP t"P R  R {(MiP0 * R; R 6%0@@DB P R  KP@0000S R    BR 9D R5 P3 PP(~%C(x%B(vh%B(O-`Pp$M `x~%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQ4=01 =@$Ѝb@DT@ P  p R   U 01W VYXU' [1 00al 0aS v00@0S v P I>W 00SY0 0 S0 P 0< S0 XK($C(|%P(%p@-`P0000S S@H000 00 00000CS0p00Spp@iB(B(0@-x@M0 0000\0P>00]H 00CS0$00S Ѝ0@HЍ0B(l%B(@-yP 0StHO-`pP@Mdw$P0cS @@ <FpP vPP VP@ 9 R8cS @ O-U<rP3UpPA U=< #P4 <@<T 00S hB00CS00 < 0 0@ T  Ѝ 0RPU DU<R<@X pP`1000p  `F`d1VD0 /PX01 0 000SZUW5<fPU)<U~QX<UxUp Ud UT;}K(jxQ|%UP( O- M$B$RpE0@0`V% VV:V  V /V   BR <` F R  T Ѝx! R  \a[  0000S(?@PeiMP@ @0T ~p [ /R0/S0&MW 0 BR r R  BR    BR  { v h%C(I(l%DIA-(A0S 0PS0 0aqP0S00 P000U00CS00S P 0SRh`hp0P RP000U000CS00S ^C(B(B(C(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `tJ@0S00S=STL00 <0 R0AD1U0 S 0S\%K(K(A-dp`0PS@  R R00PH @C(O-s@0MR02$` 00 042嘀0C y40`SX00 @ 000CS0E0S00CS0 20S H dP*0X00*PdP T P 10S10 DC}0@0CS0d10S Ѝa0SHH Z- Z`* V + 0S4@0  NP B?`F@ 0S 0 0 0CS0s0 S00C0~0000C0 0`F0CS0V0S@@C(B(h%B(B(I(I1O-0Sp0 Ѝ@1匱 100 Z :[X0S @ PxqQ@P P `X% V800V `@`@% T* R" RPP P P@PP P DoPQ` @P@C(,P(C(%IA-XPX@X`P0p00S0p0CS00S C(B(B(p@-P-N@3SI0@ pC(@-QpP0` 0S*00E@P`PP `R@ Ѝ `0P@@0`SP0S0O-0R0@W/00D0x r RP0  Q: 0 R /00@A0P .Z. B/o" R  P W0 P$04C(PRB(0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0$0P p0 P $$ Q0$000CS0H00S 0S 0PC(B(B(p@-@ PTp 0@ @@C(G-` 0s0 SQA0P ؀p R  R+  R B@ R  @ S  S =RR U P   0P  PE0G-p@ Mo ࠀoF0P (oCav000e U00SW-00E@`PIPE@T Ѝ00CS0@gfffI(O- R@@0P-S` SwD! C R  ?So @Sy 00C Sh 0 0fEP0S\00S=SWU70 Rڸ7 RN0QE1@000V00S |g|W|G00S; 0 0CS 00CS00 ~ 00CS0 000 P6pW@A0S 0f0CS00  P6FK Ѝ6\6x6u0000Q00S 6 pR& V(0S0 0S/0e0CS00 w 00CS00 v 0S 0e0CS0]0 600w00000v00(e: 00S 0 0CS 00CS00 ~ 00CS0 000 00~000   0000CS0 000  0S0   000000v4س S030A@VTV@@p30S0@ Xxck 00S0S6 W| XHc 0 0CS 00CS0j0 ~ 00C0Sr0 p0 0CS 00CS00 ~ 00CS0 000 {00~00u0   00Z  r R  BR ~0 0  BR    RJ ~ D  ;00~00Tp 0Sm @!@a00C0S)00pa~p a Q00S T 0s0 S00CS0 0 p00CS0 000 00~00N0   00300~000   00 K(K(II(C(l%I( C(\%,P(%O-`,M 0Y 0 0&0=.0Y0 00Ip$0  D6G5 P,6U $600B0-60S) 0@S*S% Y 0IS G AX  wPP 0@S0%(07PP  0SP P0 0 00/ XC [; @8%$5 @AQ(TK[X H0h0` Y54 0 @0B L    R. "C@@$5=\4T\$  0 / Y 00@@S@$D0[0<00 S 0[0 0 @R# R@@ @ #$Q  3 @P @P8#~@P#K P @P"~00@P"|bTB P%U 000S  0HŸ$pAQm Ux RA00CS0,0 a0 H000P  00B 0C 000PT1 L10AY0o0000U> 0[1 GR00#S00 B00S0p0 G0 B0T,Ѝp U   p  R00SPhTsEO(C(h%l%TI(K(&I5N(lO-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  DP AA  `3A P W 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   s ( R 0BQRQ B  W `   BR  vM v 0ASq Q AQ~@P *  Q @S!~  ;@@ Y  7@P  #  ~R =Q0S 00    @,P(%C(h%N(I(:G-Pp`d1dAf0`S 0X00P0H1 0081 (pppV0 S000`0`0CS0!0 p0开@p   0    0  R 000p} 0p l%C(h%I(`%N(C( @-0n@gh%O-TAT`0$M`FA8q00CS0@0 PP 0@D0R P0 0C0S0<P ,0P0 R"Y 0CN0PEPE0000C0$Ѝ0000C(h%I(N(O-R`p@P[ 0 0000PPX P X 3 0 E0CP00S H D/4(04 @D,0 0D *WC(I(h%%5O-Pr0BS,`G@( ؂  R [ 0 0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y0@FT: 0jPD BU# 2Q0 TQPR D2@Y@FT: JP7 DU0#0 2S 0TS0Q00R D2@ 1PY 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C00000000C(I(h%C-PpM@`᠐> 0嘀00000p000CS00 p0@ @TЍ00pC(h%I(`%A-Pp@.A00CS00 0. 0 ` V.00CS00 . 0 ` Vp``.00CS00 - 0`|%@-@-00S/ R %T0QH0 0Scq o/P0//C( %0    B /C(A-P夀0@000p `R$ 0 `0T @ `  0 0C  S000SAWB( %C(B(0A-P` @0p0W0 P 0X S S0 000 00 0h0 $P   00T dH00CS0 00SA %B(P%C(B(A-bB0 pWcr 0S /---0S@0PP0/^WP2b000r0S\00CS00  0S 0X0#S HW P  @WPb- 0 0p0P0 R R A   BR 0E0CS0000`0\00S 8-H0,`8 Q %C(d%%!l%x%>@-L@00CS00  bp00CS0@YC(@-T T@08      00000 0$00C( %A-P`@000]$ VV |`0P^$p0PS  D0  0000CS0 00SA(B(% %C(B(@-4aM0p0P0V@P WP(0: S$ 0  dVP  ⠯PuV0 00 hVd#T`VL00CS0,00S ЍB(XfkB(A-h@Q0P0`0 PHpP_<0`00CS000SAB(C( %B(p@-`P@00P0#P F 0S00F0X 0000CS0p$00Spp@+ %B(C(B(0/ %p@-@(`(P0SSSp %C(p@-P@0Sp %C(p@-@Pp P0Ppn#0@p % 0 R/% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 H(5rO%A-R0S20SP`AT p #_Upp ""jDP + 1N PpWUp U 0P '''zU qP UpH  Dp,H ^U P UpH  DpzG "00W'T'Q'`H(I(%/l%I(-Q0S/p@-@PP1PL1DP0a 0(00R 0S"00Dt05#0s  0C?o2^0SP㍏p"P GZP p0S *00CS0p\00Spp@% Ao PQPH(y5rOB(B(p@-@\P0P00 CE@00CS0p00Spp@B(B(O-@pTM R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S{22 G!0R+  p  !R-    x"]* 7  0P"R* ,0sT ,/D " ) 00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Z`)000v ) #40  ) )P S#4sF 0  l@ h  X)Ѐ 00Cs 00`Fj&H(%5rO @- 0 S  .^\Q   p@ S0C $00P0R0S pO-PPp10 0%SX P 0@S!!Q@ C$0S 0S  R-S %S +S @D1@YZT$W@1 r9 002#00S 0S 0Ѐ?S   P T"@` V P P Y \0@00SJ R Q !" R @% ?H(.OG- a 0S Qq0l0@SI @ (А0Sʬ00CS00 F( 0 )0 R  0 S0!(H(]K(5rOn^|%A-pP`*P00Stp10P 0S TjPp pPP gP`W@ P1 1@n(`V Q U` 00S`AJ 0 R(P00CS0 '0S 0 0 00S0 S 0 0K(H(5rO|%800S /@-P `H(8 P  /Q 0SZ//H(`060S/P00S/D0Q<0  40 A!0 S00'l%I(x%H(5rOG-Q`0SS@00SjZqP000M:@ 0@C  @ R0000CS0L10S 4q000$100S010000<>00V00CS000S 0S @pWZ00萠y@ 0 ZAꙂ! P00 R @H(B(B(l%A-`!@S1p@!P II%Tp1@WV2 `1N0SN U 0S0PvRPQV 1?piC I#F#060S$ ?#<#9#V<%9%U 0S dPPP\PP L uWT 0 VI(B(H(H(l%%Q08 N R S  0S  P _l%O-`R0pMxB0 pP P Ѝ0S0S "0@0000 0#P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 嚲"S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S \  @Vz   B/oZ"  "0@N(B(H(I(l%x%B( G-pPK@P EP1N0St `>@JQT @FQ>p?B x`㜠@0S0S 0S0S/`@Y 0 X 000 9l%%jQH(A-@n PPT0P 0S ilP@ pP@ ZP@it06 R0S@@PX` p9 0 P mK(l%|%O-`s$M) PPY30oV &P *P xnU pUV \`H3 R ZP$Ѝ3P\ ZpP&0?oQ20S P VP  Q6ZP@@=Y pW  pP 02 QY QvVP  F(160SI\  \@ /o"/ S [ !(\@ Q 0p0Z#Pv@T R *  W R #0PS  R 0 S0C 0 T 0 R00YXcX `Z^ R[00VK(2K(6LH(l%Xp@-PN@\a000 R 0S 817=p /A!0S 0 00E1  S j00P0  Dt@ RQ Dt@@@Q00R00S S0S~00CS0000S pB(%QH(5rOB(<1p@-Q00@S#$P`0SP00CS00 # 0 $0<p 2@.k!#PlP000V0@0CS0800S -pH(^n|%%QB(B(@-h @ 00]K(@-@ ] @]p@-`@0 0 p 0Qp\ PU#00pH([O- 0DRDb@U 0S 4@p@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 pH(l%A-0P@`Tp R@ 0N@T P 0S@@KW\0HU 000000V0@ I(l%%A-P`pp P@ 0 A>0 =G-PP- 0M00S _ou1q R100 0000 S @PЍ~0SE  0 Q S/R C-L P" Q 000S*  RA ``0S:SV@!00S!@K; @00CS00 } 0 ( p0SP0 @00@H(pO(HH(O(5C(N`%I(\x%h%C-@M$Tpp``P A0S 60SP 0P" 0^0v P1U00S^0SP60S .0S | PP PЍP ^Y8 0 P0C?o20@N(l%x%%P%l0H(0S/p@-P000J@PY00CS000S TpP@T` `@V0`0T0@0v0S V00T00p@B(B(l%p@-l@0P00IP 00CS0 Sp@00S eB(B(p@-P@MPUY#p@-=8Pq@-9Pjp@-P@9pA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S `%B(B(P @-(@IM 00C00/`%00  0 00   /`%I(p@-@tPt`0000S0 000D0 00CS0p,00Spp@009B(`%I(B(@-D@ 00040 00CS000S@B(I(B(G-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SGp E  P0)` J0`00B(I(`%B(T 000@0A00CS0/00S/AB(`%B(p@-$@P0 0C0C0p`%I(p@-(P(`@0@D00C0p`%I(( A00C 00 0C0/`%I(-A-@P(MHp@`DpPVP u &뢾T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@80 P wp O-D40!Qp R00C0@R 1 00C0v000`@F0"0 !0`0C0w001 0`0C0v0(PA(P0@0C0y00 0"!0C"  0 0H$2  `!!J00pS 21 냐`00C0@50y0C0  00S 00C002  B )Pp' "1@0Cs0S10`0C0x0000C0p0 f00S210"Q Q 21Sy0pW 0 l0 n00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP3>P0 |P!000P$@C 0Ѝ@PJ0 ,  w0P+ 0&P00 0<P_ >P &P 00p0pv0((0 @ -P 0(0  p 00@0FP%%Kh%I(`%GC(C(%@H(H(tv&EK(Lh%MI 0{P B@ 80 } pL0 {Y0D 00 B #PD}P@ 0 0005 }P' @ 0 y BR '  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q y BR K[ 0 @ Rp 0 B p74Pr Pp@< [ B + R:p%pp02!R1S 0GS2@0 Ww /0W2 ` !k !z@Ryr@pYp K/o}Y" R 0#p0CS0p p T@'P023Qw0  00"0 `!2$0  0G-`Ȁ0@T@@0PU @ 0S 0 0  B/o"X`0p 0S 0 | 0 0 0P%K@-.P0@-2aM0$ 0 10< 010@01|0000eNPI@1| 1Q @@00> dt 0S $Q. 4QG Q ,4  8000<  ,000 0 0 h0 0 0 S00aߍ0  p0 `0 OH0 D0 H00SNS,0㙿 0B(l%B(P%Kh%B(R G-Up0 00 P0    x5P $00pO@*%rP 0 R 03`      0@0S 0 00< P0, RP 000@ 00 00 R, RBP3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 ^00]`0 SlP X0 R   L000`0S0 R Ӻ0.0P 0 R000< 0  P 0@S P 000z F`@`!0P00`e P0.    00PU# T 0S #0@P0@00S0P0S0S 000@Ѝ$00ppP%LjT%l%A-Q@`pQ` @ 0p P0 0W@ 0q R$@@`FR ( X% R"p0 `4 P /$`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0P%% A-P@0 P. 000 `P tpn@`i`@@P 0`0 U000 VPPe``0SU PPP%l%p@-@|PP 0 @gP P 000 00Sp 兽ppP% !P/0S/80 P/0S Q/0(L(A-@Pp`00p` P@-` 4PN0@ pT@é PP ! 3 Ѝ F@P3ㄯは~{ x  4\% 0P/(L(RQA-pP`%.4VU``P``V@ Y3`0 R@4P P2& 0D30 \%A-`P@xpT@Q00C0U U #@P0 P3(L(p@-X@X`0P0000#00CS0p00Spp@聼B((L(B(p@-`H0@TpV@PU P2P(L(|0p@- PR QP@ 20 bP 6`2% lp\%7p@-@pP0 S00C T  D2P 0S2,03O@dA T @0@p@\%gfff(L(p@-`P0 Sڜ S  2@P t0 R@U 2p0S 0 S n2@ܮ0S (L(H(\%p@-P @0Pp @  0p(L(@0@-@ P  R #@P20(L( 0 P/ R/(L(C-(P0 U0M0000p#0C@S0 ` 2@P @2@剮+  V  2  22 R@Ud2T /o"Rm 1h`0"01@P2V0S' `1p@! E3pKP1GP 1 B 0: S1400``!l`P!` `V'oPP $ 0V V U0S00! 0 "1P @$ 0100CS000S Ѝ@rYT  0P`$ 8XB( C(P\%l%  cB(Rp@-@`PP Vp ;$ xC1pPV 81pV "$ 0P0 ppG-` PppW@䀟  OPA p0S T Y  <G8  t20@ ,V  H&T 0S @V@ P|%p@-P  @0p R  0p d0 Rp  0p 0p 0p^(L(\%p@-@PpD0 0RPPp03/0Pp(L(O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P F# N0PsPP jT H00SX iPS10P0000 Sl\1 0R  0pP0C S #  P 0PP s0S( /PP0 RPU /0 500CS0p00S lT0 00`YF0S(L(H(%|%x%H(B(\%B(O-P0@l#lcMhsP P00P# (p,`U4@D\T(Sh 0Ta000pW` *@p00S0SὥP0SV0SSp0sS vS .UPp0+S -S T ᙥ <Q, R: P  1  PT 0 @0SA0MЍUF p p0      "TR 00剫" ¸r   %5S /ps! 0.p0Y0 M I 0H -xh&-H(H(L>|%pA-PQT 00CSPDq12SK R@ 0r`0CS00 `0120<S R 0q0S 0CS>S RSxh R 00CS0N0 - p@-@0TP R R R& 1S# 0 ΪPpR!Q QT " "D0600S0T0S 00S0ȷ8L(B(B(l%@-@P @\ PGPW@-@P ,HP0  u4 aDN(\Qp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `dgA-@|P|p0`00 T 0000CS0H00SAV0S 00S @B(8L(B(L P0  /Q Q0 S//8L(@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: Ἡp3 0S$ UEo]p' W`RUhG0@D>T000 0 00 -TPx0N R T  DR 60SЍQ Q2 1 @$ 8L(I(l%K(@PO-@`P嵤P pᯤP 媤P0@DpSppTPA T坤P@DP:P5@<ᓤP, (4  兤@P@sSa0S 000T $00CS030S L@@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 A`1 R T` F00CS0400S niqtl\|%o8L(B(B(wgx%*DG-PPE o@0p` TUG0S 00S 0@0@000CS0 00S .@8L(S .00 *',*"!0318L( C(B(B( 0@-`"dy8L(p@-L@п'PQ0PPp0C/U00pHp@-T@TP0 0P0 F0 0000CS0p00Spp@B(d%B(A-@R`P`p 0*0PPEUp WDæ0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000V0 000CS0h00S sDP`000C0 0C0N(B(B(p@-@P@0SH00Spp@00CS00  d%0d%0d%@-@ʿP|Ѝ-@-   Ѝ Ѝ/-@- 0  ЍЍ/d% -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`CP$ 0S! lΚ0S00CS0?0 "  v00CS000 " 0S 呾pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' Hd%0Qd%@-@0d%@-0rS0G-p0 P0R(0帐@0=00v=`r`F@VPpPER000 S=S B`` R`ĥ`PG芒@h%I(`%0@- 4@ 00C00 0 0.ЍN(0P P PR00/0@-LP@^ ^  R0L00EA-鸀(  R (p`@pW p0S 0QPU  0S 0S   3/P@P00N(0Sfp@-@kPHUh 0Sp'SPTP@'ĔPP(p@H ED (+.3A-P0`Sp@    3/@PP@X %W  p0@=S0U0 0 00CS00  0 00CS00 z 0 T :|%>O-@00Sp 00P㼀✠`V  X 0僒@PU* ЍY   [ QʁaP`0pN(N(@0 S =SR/=S/A-`P0S=SPERPU@'\0\p!0qV@pT 0S aPVpp@N(N(@-1`0@S @  PPT 0 ` X `廰  `P Ѝ@P  80  00 Gߍ0  0 iB(B(A-`p= P@ 0VPp ᧜PP0D @S= O 0V  @`ЍA90CS-GMP00 0(>P00$0 0  GߍB(p@-'TP`0`<@VDK0V`0 0 p@N(r!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    a$ЍK(K(C(l%H(p@-@`TP000T 00CS0p,00Spp@`@B(B(s@-P@T@ iPP0 P00Ѝp@s` WP 0 @zJ00000 00PЍpN(4A-PpU`A0  Q0L@TP@ 0@00`N( @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =@@B(G-pP`0rS@P W 100S V@㐑'<nT pTW`V 00S )p`V410PU0 IЍ 0`=S3 P& `W000X0  ݮ@V 0P U V000 V 00S  /W P$d`P`8K(;Z@-` pK@P6 0 Q0 PQ 0 0   R 0000   B 0 =00CS0 00S ЍB(5B(A-`p@TP0U0  ˟ S0S R   0 02/0 00 0000N(L%l%A-Pp@P `0`&`PPEPvT eTP fTpxTPW R@V Y@pK(PP@- 娭 fuC-p000P!0`-S㸁@TQ P@ 0@00`0CS0Vl10SR ЍCU l@P=zP 0 @0 0  0 0000000  0 0 00=S l0T 10=S010C0\QP 0P00 ЍB(N(L%l%B( O( p@-@PTpt@p@-P@ XNP@ xP@ IP@4*P(P0 P pVK(00@/ 0S0@/s@-@ᥟ0 0P`ᜟ0S 0"S U1r0!d%*0SX LŬ0 @ R T RЍpLtv&]0@-MMP D$P Mߍ0<$P@D 0RQH0PP00@-MMP #$P Mߍ0$P@D0 SPH0PP00@-MMP $P Mߍ0#P 0RP 0RPA-@`$PI0 0SC P#UA #PPPp#PJ! 0RAB@- 0-RS# 0S0 00t' Ѝ0SX0 0P0S00 040,P$x hp0@-0P!S@M0SPЍ0Pi 0SfPUo U U U r#P7 PoĒW#PL1PEU@P  b  P  P  P  P  P  P P   p0St00@@#T @"0(S0)S0 0 p@-@`P9Pn 0Sk0 "0CSe0 Ho pAP;6PQ`@MTVF@`BVT;`@7V@0`@,P%`@!P`@V@He0S p0!Sp(S0)S0Sop5p@-@PƘPPEP*0U%P 0opMpp0 \0!S@p  p(S0)S0S 嚪pF@-0㜪 x%@-$0$0 00 ㎪C(x%-@- @K R1P\ * 喪ЍO-`@HMVPpF0-S0lSB 4S -Sx ` :@Px2 000G @PmpGW *Pi TT2Hn`0%SbPP`upW 3sS0S`3pV`/ d0SpFPPW1 000 @P@@T`4:p J:P z1lӗ@P 9@PPU0St@ :pWpGhꂜ0 0 ᓓ 0PV 0S  P1r0*Ql0S lQ0@ ]~pXu0 ҩZp ltv&|%0@-DMӶ0   0@@DPU$@0 &  ( $  !!PP@E L,  YDЍ0=SP C(D(p.%p@-A00S 0| 0x 0p0p p@0   PU P@P0P H0H P p0 PpUB(C(C(K(P%(L(%|%d%x%%p@-@G0@v 0 0@0PU@EP000pA d0 R 00CS0H00S p@@C0PC C(\%$H(l%B(PN(B(P/p@-@PTp000@A-@P`pT0   S*0 @A 0000   0000@ J00C \ /p@-@P P0`@  0!S0 0 0 000@0pO0 0  0 000 00 3  0 000 f0@-@PM  0  U  0P 000 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /P/ 000/@P( 0P00/@P(A-@pP 0` V  V t@00CS00  0@ 000CS00  0`@P(|%A-`@pxT [TP'T TG "T Rߧ x1 p\0DS0 @@7T/T@ 0`00CsQPRA`ET@@0P0  aCQBW0CACQ70C00CP@V `R|嚧 ``0 \@RT叧 80 @ @ @ @ @ @ @P(tv&= X @-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0@P(tv&0 0VC( x%p@-0S @0AA00p0@S tPP0 0CC``00pi"Pp0`0PPEEQ0 00p@P(   . @-P0`V) 00J  0 0@00p 0 AdA̦0@0T0 A$AỦ00 Ѝ@P(tv&=  @- P@pFyΒ `?y0P h@ 0\AAღ00 ЍV@@T @ 0AAᆦ@P(  @-`0@T/ 0'R"R0PP Ѝ@ؘ P p+0BP d0000 0 A@AV00 Ѝ,pP@P(tv& G-g`@V@TP L90@`0pF ,~0p@P0@P( XP(0O-hh,M0X0\8P P1@01%ňPp PE@ LP Xp(Wp70PEAU,Ѝ0  000P@`V7 0S 0S\V $`7P00CS00 07 0$ %V0%S@600CS00 {6 0P`ݰ0p*S`p0.S0@*S@pZ\嘥P°`p8弰p@0xZ0WZ%Zo A0Js R %X0J S00 %S00 ;눅\P %  ሑ P \Q \0l\ s00vG t 0 D\ \LQ  b '\ \\ "\  \M \^0? \^0@-000fnrtvaet @P0030  C 1 01Ფ똓`P d` P  db  I Pd  xs0 v0 t 0 0ΰp B`0 0@ 0 弰t0  峰#l cZv t0 O <"0P 00t W 1|j  1v t  j 0et 0^h0P $0'S"S {YX0S$ L v t   0# z8꥖0$P0$ Y t 0e#v t   0Vt 0NVBT0 H @P(|% xh&   )  ( tv&? ` P( & K 呑0C- 0`qMP` Pp @P 0 0p@PC 0p W ) PuY <YgP0P( 0ES P  00S00H l ^YPH0?S0 -S00H0,Ѝ`X < l      7@-0@0 0 X8 TPQ $ P  , Ѝ0@) 00 $  P X   A-p:P008O@P3 0S0 =PP O00 \`cVtݐP 00 `8iVPҐP 00 8ːP( \ 0$00SЍlV幐P 0 0oV寐P 00 娐P v\ 0(0 Q 0SᖐP00CSD `\0 0 0S   X  "(0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+$@G0@-0$ 0d8 Ѝ@-@4000@-@4 000@-@(0(S00 00,0Ѝ`t p@-@cPP$ϋ8͋<ˋ@ɋGPD[`ŋU\忋`, 8B`ZV0,0p0@-@4ʴ80,0@-@480,0&=@-8@D( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ nP HN ЍtH@-aP;Nnt Q@-VP0Not [p@-0MP`0@-S00(00P0 0  PP 0( RT  0 0 S40($03/Ѝp#dlA-@`PpQP-U@QDP00  P5P0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp$p@-$@P0S 00PpP(Q+  0 BR@-  M| 0- BSs^0@Q ^ 40 ? 0 C  / /:P(P(2p@-hP@`V Pp;`HV4,0P(=DGJO-M`pAPU d TP L XP 8 PW $ PU L P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WUP8:TU P  bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU P0U(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?P,s0SSUA #t!<ST[ TZ TY TX TW TUx tThh BPUbЍ0i0d," @T   Q ! 0P녡t0 ! P UḪ ᶪP p PYOWNV]\edjkqrxy  $%+,34:;CBIJQX`"-)^fg5nX 1vw~9@I@-v Uho&@-000 SA 0xyP(ho&s@-@`y000 #S@Pn0S  0@J00S 0 0JЍp0S/#Sp@-@,P$p(0P 00pP(w@-PRP@ p`p 0R" Ѝ-0"S0SO 00SS  00@Otv&@-TPL0 p@0"SIЍP(@-TPL0 p@0"SIЍP(p@-d@P0S 0S 0SS 88@ U   SPpP(p@-Px@Q dIP L0   P    pp@ @  P(0@-@PPM 0SLD00Ѝ000 0AP0 0 %P(=O-Pp`PPM 0S<b;$ , P 0S ߍP/0 S 0S C@s?0P P@ P@0ST WpU: 0S  H" 09/PV/` 0 P(USi@-0S S S8 4 ЍBS$ Ѝg0/7@-lP$ R\H;@ H$0S p (H H Ѝ0P(V(*p@-@P 0Sp@壃0PS 0P0ၧ00Sp^@-铎P@@ D`DHp0S00  lho&C-P`PM 0S00(p/p0 FP" /Q0`@ p0@6P T0p ,PH$0@@ 00Ѝ %P(P(O-Ppr0en `I TRP2!&@828B( $:, 60 28 .4 *#4尀DR D "  4S  4S  4S h  4S hL P0S P0 T0S 8,@8Y  ЍO0S0 a`v`⵸ 0 0 0TS !S1d7  `0TS:3  0Th# (  0@o&l |       BB |!!(G-Qt ,@Q`P0QH 4QP4PQ 80S,00 80<0S#<0P:xPP:qP1 QB"7g`8X0apSwp R lW <0RTPP)0< S4GP0S9`(傈Q :({Q 3@P0S0 BS `a 0p!h0S  0 S* 0Q*da 8Z!!!!! "I"P("#3#Y#"]""#O-;$M p*#bP 0$S & ߍS P@0T[D@lP 00뉔 40ਛR YS< "$0f0Qjf/ ẋ,2S,!R !PP0,21S 1P P, @oP  0 ppdT1P8 P, @P0 0008?s0 R* 0S 0pi P 0S 0 p[1Sv   @1S  f/ M01P P%D V(P(##VEW}}#WEV#9$h$$R(o&A-P@`+Pp %R 0R00000"5S P vL $0f0Q ,E(_  P(V($P(p@-0@zP  P$p@ho&>d%>P7@-@ PT|P0 08P8 0Op0 '; Ѝ0>v(vd>0@?o2P0S@- p`Po|@P j|P e|P `|P@V@lW|PH@T@T p0 4:@@ Ѝ>>>>>v(ud>0@-PM zdP@` p D: 0 4: 00+ +2 Ѝ0v(zd@>>>s@-Q p :0   0  @0`D   _ 0    0   0   0    Ѝpv(td@?"?9?Q??( p@-@PM`PD p  ( 8V V d PЍp (kH( fp ,>: 0 v(}d(@?@Q@~d(Y@k@0@-PM @ kP 8:4P 0>p0 :Ѝ0y@v({dЀ>A-`0@Pp!匁0M00x!p0SP@XBT p  89eP qP p`(,0Q 0$0S* z@P 9QV@ W V 0on0( e_PR0c- t00(0S0Ѝ00* *   `@-xh&@v(|d@@@q?@-P$M 9@P p p9 T ! h 6 ` !R0#@(P(p8 (GH@ @ ؀0\  ` 4 ;$t0sp 0|`l,# PTTUPpAv(wdAAAxd AAAAho&*B[BtBBBBBo&A-PM  @iP X iP 8E8r~  N0`0PS d~0"S U1r0%*VW~  0p0S I~wx00 "R00S p8PdPd `尀p-p0 880vЍBBC1CKCeC}Cv(yd>CC-p`@P Q |7CyPd@ R; +p 0703/ ЍCd%Cv(C 0@- 7v(>P7@- \P@XyP H0 yP400 p Ѝ0Cv(wdP7@- :4P@, p Ѝ0v(d@C@-}(0   Dho&O-` ,M@PpPJ|0T 0$0X,Ѝ h zpT7$ P  kp $0 S T@0,0 0$0S xtYV   W 0  @DEEEEp@-@P0P& 0P+ 8>0P  60P 0PEP0@p@Ȗp@ 0t[@`Up@\U@<屖PptcidyaraErbmngntsEEEE0D S/ 3C5C$1 4! 8<0/z(0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@z( 213/P/z(A-PT0p(,`w@w,0T@@DA?@?@@z(?0@-0@0 (20,20u0P!P30z(> 0R//G-`0(,Bp  Pu Euw@PPW ,20CS(20CS Gq0z(GGp@-@`42SM%^ ` E 82<"@Y 0(2,"RЍp@MK寕<"82Ep`@h=⡕,"(202X"\mЍp@,z(4%GGH.Hp@9 PB 4 R 4\<(00PS<(0 0@܍ Ѝ0HSʈ1P0S -Sq@`a=_P00@@4P4 R 4$A0!HP j@800  0 R00S& l@10HQ4A<00C04!4 BC$ (Ro0S0SKo0S 0S C } 0S C sC nC i ,uPPl`4#pi P PSd   8 H(nnnnnT%'o-osCsQsWs-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @UPxPݍ Ѝ\!rp@P=0D@rO=P0: S0RP00 0PP !P81: S P% S  R  r(PPl"PPPU rPP$0@P<(sssL(ssss@-330P  0 00$Ѝ  tL(t0@-4S 3/ <(@-m0 @(H 0$wmm@t<(@-m@DTjmgmm@@-p PL`@@0 7/P0 S Ѝ 'T00ԩ(O- MM0t6@  @  @ 0p$000 (0F"P;$@ ⓹ ܍Ѝ 03/0P0.   P @$0PS (0S W0SU S U hh_000,0;Wp` $0 Pp g40@0Y0C @4 `V*` g0  0 0!0d4  ` `  Y!uPM J 00 0 ,04hP,0 0S `5hPA pW `Vx5p@P ZD Wp` Y0θ0S5 #z @ 0 %00Q00R00S  000 x 0 S   Z0% 000 0@@0 00R0C0r V B G SE SB `V` 0S 0S_7!@U 000 wwpwwG-0@  0P Q< 0 PP   0`P t pЍ Q*P !URQ 0 l i0 pH00W0p tP  0Q0  1!0 1!$0 0 0( 1 0, X0T`PT  MP8 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0p_00 QP   v 0P FP tyFpP1S1S1US1S 3S3S3US3S, h pP0p* p2 02 121300p0_00 QP V 8   0Pp00S1<01@040  0i_40  QP   0PA0O A0  AFP 4 0R  eYX`V P0Ed 06#++R`DX4 $0S,0,  RT0CcD0"P#10P 0 # 0QL \0  0P 0PdPd@wwwwx6xRxtxxxxxRRaArrAaUxxx,yPysyyyzy@-p@`P~ P00 P0^ 00QP 6 Ѝ U0P< !@ !0 P0^ 00QP 4 0Pwtxx@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |D0 | 0L 4   P00?zUzzG-X` p@xP Ѝ0PZ%V0 01^VU D X0 X0 PzzO-@,M0p@l@$0`P P?pP$P @,Ѝ f 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P  "~ @P@CL0p!S sP0S) %p0p P p  `Z IS L2Q0 2 q "" @ "  @*"*  P0@ S 2"!"0  0@zz]{P p p0@/ //n{e{LzO-`@PpMܡ0P0S Ѝ X 0H sA 0B { / 0 s qp6JP0p@P x q$0`24P 0 00 D+P 0 0̀0` NPk { 0|` P \P0 0 <`P |s{{{~|||M|R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0H}zO-0p` P\PP0S Ѝ$P  qQ 0 @T 0Q\("Q@ PQ A BST" R t D r   0 TS000  R ꤐ0 0 m I?P [P  I BPTR2 Q PEc}}}~O-X`0pM@PPX Ѝ d0Yl0L (2 R0 r00 PܑP" 0 ST;R rH 0/[P* d " 0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 哊("0 Y[ QP 0$ PzP~G-@`PpP0S00S <q/p@q9WP$0S! 0S 0S,0( 0  P0S 05CP  PPpl Q 1P l0p<0P0Q*l0S 2Sl  hTP0P  RQ@0 P 0u~~{l~~d~@-?`XPP@@\@#T@TpW @@T`L(O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0ZQP +P0 Y:0 0 0tZQP PL> 0 P<0T 0B(& O-M@L0Sp<`@DH S  uP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:@d( A-@/pp0%B?[`0S ]0ES PC 1cp@@0T?  C0(0 PK" %/(O-` 1aMV( 0/ SP0 S@0P`,0@@D0$0 0<@D0& R# X0p1#r380#8 (00Y800 QP aߍ0P@<`,0@`D0$0 00 Cp`02# t (APW00q240pGHH04 SD00S    408 2400(000vY800 QP (100  RR R0(10P PPL0sPPt!E0It1@tQUP0U*0" 00 0p  x1S TVP@ 0I 0000@x1`6]PP 1t!R h6XPP 1c t10t1#40L0s]?000w10I@P30 s0Qs ,0RG U 0`$00`P?x51 SzR`\P0S 0S TrlLR P0S02S 0S0Sz 0T2SXTSt!,pQP PP00@ s @ t1P 6D{P PPPPPPL0Is0PP@x1;@9`\P2PU- `t1VS RP@ ta``L0Is``@P !RP ScE7PP0 1>@`PPTE K/T'`bPP05!P6 5P0h00h00U U0@IP0U*0RPd0x1ST0x!4P %4xQP0%8%\0 P0PEd0U03:T8Rr%P Pt!dx1Zb" :0 0t12P0P0$00`P*P(14 (40PI!2S0P0 S0 $ U 00 ` 0U00 000 (@ D00S8 0(00PV800 QP40(R(0 PI (&6(?WUzyr̀4Ձ2YG- p@r W pPI\aPP @Pp $ P}K/^D08QP0Q:" 0PS00  Q pxPh`P 80"8 R 00 05 !$w(Z1p@-@5%SQ%5 %SPQ %UU QQp  0 0Q0 Q 0(A-lP`5p@ @ 0% Ņ@ŕ\(O-POMpP b5S5圢@TEOߍt ZP@ ET PT 5d 50 ! S$5"R$%P0S4dYP  RR @`0d B2" 0 U JQP d d0P Eh0K/0h0 ]0 000310 00 000T0 CT(%,5QP Dd <d0Pa깃(Ã0(݃@-@ P 0 5(0/0(0/0(0/0(-@-   :ho&G-P`p^@0S  0S X| >U TY0S 0S]^@ p0(5:HN-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  A@-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rOP0: S0RP00 0 PP P81: S P% S  R  r PPlbPPPU r`PP$0@P0(~@(ׄ@-"0P  0 00$Ѝ  @(0@-4S 3/ 0(@-]0 @( 0$7]]@ 0(@-]@D*]']]@O-`M$MpP`hP"NX1 b: S/_^0P  rR t]00pPP W <UP 0C P"VGR V  VXPN "P P W\1` 0`PIX1: S<V2"-rPpUPV9 PW002`` 0!$ $PPt P5]0S3]`P S R SwpP`-opP ``!\1 S R Uq5Pk`x%|!0#PaY $/PppU`( FPP XND% ܍$ЍJJ=ESF F F@0/p/p@-P@= $( $(0XRX0X00\00`0ddhhllppttpp@-@ P ===DD=@@=HH=LLPPTTXX\~`\`0p Qp` "[P0@ S p@-0@"!Rc0p@-@Pa=^=[=X=pA-0@PJ04S->CI=->C?X8=9>:>C3=?n:>CF.= 0? AC>%=}C>G =mF=EnF=E~G=X J.X V  $$((,S>,<}S>G<mF<HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqxt<1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,!A2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 PT 0 0 0$ 0p 耶(((A-P` p@?5p0S 950S !SRp.5p0S (50S!SRP@P@A-P`p@ `$P`P00@AO-HMQ M %80< @0|2 0B_ `P?WQ VP( ,P8r 04P`P (0, 0S/(0, ۍ Ѝ10S%  qV 03?00?s0S0?0P 0 0" R?"R0`00m88Q"  P`k =0 00@?003/*  0 0 00 ?0k00@ 0= 0|` *=h050S G&0 0"겅X((`((((`((@-P@p`AMM(e% ,0 P@ N4U0:t0 R0*d C%@^1P F40  PC 1%AލЍԅ@(؅υ7@-0 Ѝ0@-\M`Pp|X @ U0H0T0 `'!D0DP RpRLtP \ЍX|(O-P"M0 M:x6 PP#P3XP3X0P#Up` "ݍ Ѝ?(@X ^U0p06,08"9<Q08u@5ppL0p 0SXsL T0 0S T r000 Sr:0 02P0 @S$00; ` 9: \08%@5  L0 0S^ \;P#H20SN <Zo0 0 0 0(@00$? 'g60 P 0 N:U 01S0 A 00(!( (h h(~ S  ; 0 }/P000 R0T 1A~ P{xPu8 1 t0 1( @( f Pch=@;h@( |(X((`%((O-M`@ ) P0G: 0 0@40P$? 0 52ܒ2Q{ p q Br /s+Q0< ,42匢# 0JR fLpQ 04  0R  @PЍ( 0:1 r0 4 Y: |10S<000D0`1 `0 0:1 010S 10S 0F` `$1{100v10S pm1pi1000 ppO((`%X((%|(O-P`FM M X R@l: 0 l5 RC@\`"0pSh <50S00  000S Fލ Ѝm00 1000D0y4 H0T00X0404QpQ\t`  5P"0S, 4 L000 0 HP" #0000S km0  0 3Y(.P 3  .P0!0K 0 * @pp  0 0S   P1 쒟!!-P Рᬒ L000U0 H t k 0_0X0l2  0Gj0  c000B\00S2jp0!0G 0Gh [ Y0# 00C 4 S 0040\pPAT!)ll1p 0p7 070  k#000C0 0 S (q   0xs00 p ) .p+p00/000 0 !0xs  p000S υ(|(ȳ(`% H0S"00S T p 0S l0S Gpp ЍC^T,P D0 ЍT(($()ȳ(`%υ/=Tjv(0/p@-LP@08100@ 00 .0@0 Pp(00S/p/ጴ( 00S/ꌴ( 00S/i3ꌴ(P000R0SO-p42@ RPMhD R0R0aď080S  C/ S ! R 0C00 0@%ἰ? 0\K\5p!`S 0 000 ?@U (  R8 R  0\0 P3 `0/0/0 0 Ѝ  [ T R  P00 0<00/H(((TȇP0O-@`:1 R0* 0I됑吱0 pSxP P* 0 T C:\500 6P/<# P 1R 0 0/."<0 P 05`0 C c00P0S   0 -0xP 05 T0  05400,00S Ѝ@(&г((T(|(O-0#M PQ P* HPX 0k:0 `\5 00  5@/<#| @2R 0 0/."<0p @x 0r5`0 C c00d0@Lr CC cA30B$ 0 Q,040(0PßP0 8+10S 1 PBU809 ̱P XEʼ0 8/,80<01t!0<S0<0<0Ѝ U: p P\E1EE1`f1U  1 R T` R< ܰ(/? 0XTFV p P Q RF 0Y:P`0 FR Qг(F(Tp(h(|(l(((G-1P 0p` 4   00@ 0S 0 0 80PS `P` 8UH0ZP000PS wJ`4 KQ$,$ (,`(PP8(iг(|(@-@8P 080г(G-Pܡ0S1p00 B?%I PAP` 0@`8@Pp1 ?L4X10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ&d0SBP 1@0  XPP00Ϡ^P0d000 A|(((((((P0p@- P?@3800P 0 !SRpꤶ((Ԉp@-X`0SpL0LP0@1CA0SWU000pO갶((( 00 /ἶ(O-H0MSP` M 003/ ލ Ѝ40 pP裟00 X+0H00@0 t0 /  S 0V 0|30X0x3!0S& h30S3S k0  " 0  0励0/0Z0 02* 2R2 t R<ʨW;000 Q o ! ZH"$J$++P(" 2 " Ry{! {   t R1* Q5 1000S1H  B/oQ" RK h!B0`  W+BLSD(P: 1P0S, P g 0 10S0Q 10S 03/ 000 0P  0p`V0Z <(d(|(l(l`( 0>(0O-S0RMM 00@#4PU( , : SRލЍtt \`(5R<R DP  RSU 0 0 ,Lt0 PB?F2̓ @`@ 00S 03 00 XY8ő @5D0LT 0 a31 Q>P(@@-@d80\P< S0 80<  D mKp@-@@PU DG P @P$0 Q0: pp@(@0@-P@80\U< S0 80< 00p@-P@ 0{U0p81 R0p8@m0P0S 0Sp맷P0SpVQ00S tI0S 0T@0S(p@,5]@(fĴ(|(nrv(@-p@`MiWP !  P0B  p`V' se 00S0H0S 0 0 $|,x00Sll, J(00Ѝ@D&P0S (0`Ѝ蝉(0(|(д(е((0@-@PM \" (Q Q0 $[0ASЍ000깉ȉO-T5,Mp0@P @Pn(0S @P,Ѝ` T0): SR 䔟0Ḱ0 0$刡  !  Q01:` V `3 V `! HP d_2(0`S @P0!S10 0S:R 0]30  `(`\Ő 0\"  ? 嘣 ? F'0| I h3R0Z SZ T3 R #R 8,3 R ' 3  R0\ 0㵯 /0 20 00C 04$0S4L3 2$ 唂 B *02(`20S 0 0 0: S S-  S5000000sS 1 00108m'1 1p Z7 )P 0080X0 ❲?0T @ 0`; 0 + 000A00S 0C600)P( d k 0ˏT0 C c;  뫴 h괶(@(((߉T(h((U `((|(0((O-2@ 0lMp`.0P#\P  ? 嘒 ? ;&0 Hp"p2 0R S X0 S 3 S <@X yH$20p`M2 RpR\tR`Xd   X 1 R, H&00X0S  0 0 %U*L!00ST06 0 S0\ 0㵯 7.0 20 00 04$04L3 2$ @  */0'h00S QP8 PC& PlЍSr  m((T(h((U ,Џ|(д(е(0(`((O-`x2p2PU@ 00U000  ZPp0 Ѝ0c ?˿R0 0g4GC WV@Q TVg0U A0 %00100 @ C @T`T0p0T S @`A 0S@   T 0`9 0 U2 0 L%P 0 GB0 =B`0@S 0 000T000 *%[P000xt(|(NO-P(4Mp DWkW0 ca P0 c0 C003 X 4(-P  4ЍhD+a p00p0S ?A 400 0? 043@030000,T  &C @ @XT00T S @v0S @ & T 0 l 0p0`00WCb 1 Pe (pP 20020SU 뉑  400 0? 0̱ 0 uA0 jAY@"H  10J(Pk 00 400 0? 0 10S4 A0 0000 p0 @0S$0Ye0000o W #$p y0 sq00000 $pchA|((i@-TG ghho&s@-@P `ǰ0S 0S 0 ,Ѝp莋O-tEM` MP00S 0S D+p P 0Sލ Ѝk000S  lP ge30S 0S Q0S LU0SO. 0StI@ 0S`C0SL=0S 0S,4J 0 d sS80!"70  0 " " 0D@?!? 00? 0\@ 0Y@d!! 0R@0 dpP 0SQ "04 0 R0  0"=  0,0S)(04,0AŸ 80/R%78 <0PP0R [0" t0S dPUs @0S @@PUn {$0SP@PPDPTH0S  `姮Cn* l,xl$|0S lTl0p00S0P0$ 0,0UA:000S 0S Ht @1 H0S 0S$i0S d P  P   00(0LP 0SJb RP MPP PP(ȋߋ7Z~>ˍt(/Vv|čO-H0PSp`M W0R0: P p`$"= "0 S 10SQ c_Ѝ@ 0ȱȡ 0 000CSY?00 1> R. Pt! P!0  S D  pP   . 80< 0 @80< `mP0P 0 #N0 S00@ ` R Q\Q\ꝏh((\(T(Џԏ8((Ǐ (00S/p/ጴ(00S/0/ጴ( 00S/s&ꌴ(O-M,M@$"[:[$0: S`@[ ` pp!P" \!P 0 00 0؍,Ѝ0 (!P  X!P h0S !  GP ]0S, C : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S :0S6  0 19* 0S R P0@4`PƟ Z9U)Q900x0 B?+)pQP @90S  0@ !8 0 0P080S, HCN[  Z8Ppx U0 00(p UtxPP0X Z{P h(0000pPP7BPm"$0 S7Q770S3  V0;R0.*h0S+ 7('d0 ( #0 :P |870S !`` #h @ (*60S 0h0!60(%R/V+:<V3#\Q RqP   kPpQ^q U  #p# PE"`:U Pp[h RXPp%Q_'qP tPE! p 10S0A` 0  Z? 0S 1000S X50S 0S 0:  pt ?<$ 0S 1000S 40S 0S   10S0ꊡ  0000 04 $0 S0 0  00 0!kp$000$0 #600S40S 04 PP @ p td3 0R00 0pRLtRPXd00H00XSS/ 0S D30S= \P !/P p2 A0 \00&&`2 0@S0:000S08P40d/<0Q5#fP8`

hd=\ `P 0H0Z0`0A=Pp`1PU 0\I85 @5D0LT 0 b32 RPlh|(@(((((#д(е((h((()(8(G0(Ǐ(p((_s(P(T(x((2QyO-@5pş|M,0S%40A`HDLT T0AX  @5 $00Pxd p 0@, R< T5@|Ѝ0/1b&\% R  P  0`P_Q0`  0oS /  !.0`?00 1> (@ P004ğ %1#\ Q  0  D ?0 g@#3 0R< S< `3ē0S0x0@S 3d0, ; 0 ll5`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  J0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0<! 0P0  ?000Y 0;* 0 0VT0Q@`@ T ^@@`R0@3T5P`1:@P`$ 0@0 00  P ~00VT 1PS P   0R`* A -?괶((T\(l`8(0(d((h((|(P(ڑho&($(U (1h(UO-` @ 0Mp̰̐ 0 0  BRЍ 5PPU  RQ l @ p R RP Q @pꀷ(T(0/O-dMX >0PpP0D1D 0@1@ <1 0,0SdЍ0S @d0,`:0 `00@԰ 0D RpT0!:p`P 0A 0RpS RTtS X0S @Ppv( (P((ho&(|( 0000@/00S/p/ጴ(00S/0/ጴ( 00S/ ꌴ(O-D:M`PV`@@ M$:0S 0P *S *`0080< 0/[ y :P X P )l P9`0S 0S T)YD P00 ,9 #R0p00S0100,0l*(0 00< ?00000800$q 0P @pgz b 0#d0 @0C0T =000S0z ):P0tJ0 S$ 0S '00YP7~`| 300S0100,<0*<'0 000'?0p0pp00ppP*0S  $Pa 0 0$`YPU @p ` yp$ $80< 0 80< 0@0C0 B0 00 0Q.*0SJ  JP  0" RWލ Ѝ0S 80< 080l5 0< S XW0 00$000 ~$_JP 0S 80< 0804 0< S 4W`0 00$`S  Br p Z$y ᴠT$P@180< 0 80< 00C080P<.\SP$ .P $PPcP3P`080<9l3 Q0 *s000JP. 0 0q$Z P0SHp0AS0 Ss p0z2G0S40000P 2 A#R0؀R 00 0[E#R0uQ& d20SX20SL 0 A(P    P000 ,0 0 #R0 R { 0pprR> +w 410S& 5V#R0 š!ȡ0S  0R ؀P0 000p0P``0P00C0Z?#IP8a |((@((4(8(O[ɒ(ѓ'($(3sO-WM M'0ASy0 G GP h7 +TG 9P 07 00@  6$$P 60S 60ԆF6 +X M;0p`06夶0qY0:6 R W8`PaVtPVzDWލ Ѝ!  R1Z 10SI0T!  0 S<1`0 ? 200 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 ^PpA((T(h((U h`((\( (8(00S/0/ጴ(O-plMX 7x2xx00,0SlЍ0S @d0,Pz30 $$P000P㸀@1 0 0D RpT04:J`1 ARpR\tR`Xd00X0\0@SH0 `V `%P $10S  0@P1P 00S  0 0S  Q\ {{00帬 0R  000 T  L 0<6Џ(P(ho&(|(b(ݖP( O-MԏM@PE0!n0 60t0?0SX0S $5St0SVhPWX0S $Yk S Y R,d$?pW\ 0P%T਀X僀 H\600!` 1B`01$dQd0ڠP0C00h01`l0R!B1d0d.0CW P0=SLq QT00H ($0S 0 |$5> *d>X>0S "0 0ꬭS0 $5B111`R B- 100 S L $~0S% , 0帐- 00$%BR0ө`S<B11@%L0 ٪PP  H PP 0S  <PԌ *堐<<0S B0 02d0pA?P0;3A?`0 =<0T0.L05 ;0WHQ RX0>F@ @058 84<ϠQ bh{ S X(,0 Sa?^ @PC l;0S @ A>+@B@  C, P;"  @0尠 \ 0 000 :J*::0S 40 0؍ߍ0<00

! "$5S80(0W8,(2W42,2<0002SV0@ x S0!!~ 4x030 $ST0< T3$2!S\0P 3V=SL5s35 `!~ ?X00S-Z"!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0 3!΍0h0H0DlE ,#0AS0 000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX ুX姁0 8PPK,2!~00<0S. d?/0! ST0T00! !0P SX00ԀYd/p/0 0 //000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S00\04 ^((((PC|((U ܗgJ(\(P(ho&Th('((l((Gq(8 x(=(`(((((($(h()I$5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0P3 L!T0 R H  2 00000 D0FP1  q1*110S 0 020S QL KP 0< ST0T STT=P hFHPt2 L 0< ST0T STT_0" 020Sy0 S\0P S\P BFP 0P S\0 S\0T70`# 02 ppS $S00S0`" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8*!H &H Xp?!D0Y8 0 S\0D000S8*!H H XA-P`@P000T:Ѝ4ppX @ⷼ˙ΙA-A0 5 P0#R%(r`! 10" q0SR 1ܼ0a0  a*t1h10S |0 00SP03Q0S4 L@ 5*< 5000S W0 0p@mTPUA t0UC P`0 0S H P80 0S ((%`((((=0/ᄷ(0/ᄷ(0/ᄷ(-@-  A ~ho&G-P`p2@0S C 0S X|: ᗯU eT/Y0S 0S1@ ɹ넷(diw}-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  㚹@-@M Mq` @nPxPݍ Ѝ\!rp@P=0D@rOVP0: S0RP00 0/PP :P81: S P% S  R  rAPPlPPPU rPP$0@Pꄷ((Κ#@-L0P  0 00 $Ѝ  &(50@-4S 3/ 넷(@-10 @(a 0$00@;(@-0@]000@0/P/00@-0@S (@ (pu1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT8 ((`(d(h(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/x((T8 T 8(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0{H3H3L3u/L3P3P3T3T3o kh p@ p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0AH3H3L3u/L3P3P3T3T35 1EEP  +4K44K44h 4 5- 5d0Bd00000P5P5H5H5=CS>S>h p@ 0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//|(O-t4MP U `D``t``@qvH:4D40ŏ 0 P\dp LЍ ?(0 Py P\IP0S 30S|30S ph3h#0S` \#ST{ P H0S <80bS s*/0S @"\5S 2 2\5" 0C?o"20Rh [ŚT24 ᕁ(Ud $2 ?J(:010S?, A!(Ÿ0#\ P  0B ? 0Sg0S 0Qh 0S |!\5St1\5P l10S(` XA" L!0 0@! 0 * 0S b0 0 00 QH0Ph PE @X* 0R A劸ꬴ((`(p(˛h((((8(m(8 x(T|(((((((t(Nۜ O-8MM 0*08PpP.儤 M80S {9P-q l0: S XH]PލЍ,8H0$hSO 0)00S 00 7̈ 7 8   廤` 㶤8 㰤t8 㪤[V``Z`P`D7V< (P 6Q P ŕ7P0 0Ʒ76 R>0 0p 0<&0|&0P47p0p 60pw>p0 P0p 2S # *z(P *u(P *.mVXZ hY 4[ 0SV?관X V. 0,  ' <0\;P$V$ Q4C ?&rPPe 2S|3%8 S20#"20$#20PB 2SAt000000' 0@a`02P$V20A\2@02 _'2C`' `FbS' 0| 3&H  ?`0P,Tt#0`P\`Q=S/0P 5` ( 2RV0 SSc 5*< 5h3 \30S e0 0`20S 0塶d3 0 S` V 10S0DS@ 0(y2= C ,0"00 00t 2oAp'06# r00S10Sʸ10S0=S0S PB܁q0008 ` 0L%000P%X30,*da *' D10S V0 0t((*(c<((vX(ȳ((ĝ((ҝ 7ZԞT T 2(b n@`>0((ע:(](٠ ġ'(!(|((`(((l(A((H(\(((@((((((7(p(h(=S$0S,  0`<<00P%X30*0 00S [0 00S? 0 >0S a{&PDa 5*N> 0:#: 5zh1q t10S 10 000S$b V1P0a0*Y1P 10S 0 00<cQ6dzP 0\b<0*9l20 x20S g0 0r0S0L%r0L%r0H00q" T 000cH00STFP$c*43@30S 50X# 0 00L40q#  c400cL00S Pc*330S  0# 0 0x4 R.0E q\ `PVR d0SPt4d*440S b0$ 0 0$d0Q,%R0%45 S R! t0040SPTu*{d5rp50S 20% 0 00u(0S xQ$ ]0S< x 0(%0Sv8Pv*N6E$60S |0<& 0 08%<5HSR$ / H00850<SN_Pv* 660S N0& 0 0v@%D5LSR$  L00@50DS%0P|w*770S 0' 0 0 7 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*880S P0) 0 0h P^x P8YQڨ0QTڠ r 0 0S Pi*f9]90S 0) 0 00S/ 2( B0S0QQ&d @0 0S sPpj*4:+:0S b0* 0 0 B0S B0S EFB0S-(Q\KQK RP+00S  E~0 ppV aF!` . R  ` ]B0S72 WB0Sb]<Q| OB0S IB0S CB0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4*<<0S U0, 0 0(=0S 4=0S(@M*P=w\=0S 70lmh o= PA P<= 0S= @PL Y p &@TW.  @?00@1>0A@O@@X.Pd7  &,@>P* ^ P;0.00 0 S 1 >5> > >`VP?``Y (? 00@DT@8 H4L0d Lc B b"30@`P Y) ?0S  r8 H4L0d @ B b"30860S  Wx6p00^d`PT6W@ _86P, P0& 5000 60S 1S x"P 5 5 @Q LU @ 0~pP @@  04 8 1`5P D50S HFDP 0 0  pp30  0 0 4 8 P Ĕ ,0S_bP`0 4?s0 S |0SctQPd0 4?s0S 8H 0Sf@Pg 04?s0W:PP/PQ ̓0Sd%Pe000 4000 Py hs0ScX Pd0 0 0iH;@0S 00 0 0 00  &@0S 0 0 000  0@0S 0  0000 0  0D?0S ppw0p#40  j0  0pq?0S 0@00W0  0 `1 X1Q1Q,+ 0S |]tA 5<00.\!00T!0P!0#00#p RV !0Bs00P :P0S 0@PT0 `SV0l(((ӣZ((Z$((((ȶ(p(LBAL:(ؤ !>n(X((((((¥00S q: S *C   S D00S @-4 * R  S//ጴ((x1p@-0`S d` @ クT D10S810S(巯 1p10ST00S 妯p@堯D00CS0 pP U 00CS0 PPYU NU BYU0 P0  0 0 S(,K(l(T((]n&go&p@-PD0@0`S  0>Pp(qKO-01 (1$100 P 1 P 0P  PPPpp(ܖ @ ֛PT`00 XT V p WP @@ 00p((((ȶ(@(O-@1$M`Hp /2#$`D  ȕP 0 <w  F#(خP U 㐮 0 AP$Ѝ? 00  ?  堕 P 0 0 0?QR0 0#Ϡ?0  8噮0P 呮ꐶ((ԦO-M0P8 0`ĐpP/2#V X[ 0 Ѝ 0|xj@[ ЍO! ?  =P # ? S0@pꐶ(X(C-P`U@ (1  U P0 PP0 0T2`p؀*0 L@D0T@S   8 H4Lđ0Ϭd @ B p b"31 ~0S   0P00`0@T Ѝ萶('`(((l( 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍ((l(p(@-0P@T@TTd pL `l0p `̠V W @ 0 0 0P0@0@00 Ѝ@((Mp@-`P@XMX  ! `P @/XЍp 0@-Q0 H0@S +\00S P<008S0P00(gds{p@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT(h((0 \P/Q/ 0   Lq,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S ^0P 0U`dSTS墕Ps圕PUU00Q A&P 0S ??@}{P`"hR0"00S8 lr003Pb0S* xM0S* 0R0E>0*X4@ 2p610S m0 00S:]P10S : 1TQ `1*X1` H10S @0 0H10S <k: (1P 0*0`00S 0t 000S d0P` 0٪> 0 Gꄶ((l(p(`(t((("((|(((ȶ((@([@((r(ʨx((((O-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\ G2 \P 0 `2 0T ? w0 ,",2 0Ri Si r0S 3S 50u? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*0`00S `* ` `Ѝ 0_S   $  B$ $ R$  B  (H(\(T((h((U 8(`((A-Pph0``ATR y@P<[0S @ 1p0A蔶(@<0 0 1S01/ 0S00/ᔶ(`0 5 /H0P 3S P 3S P///(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 ((((Q/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐp0` R P/! 0p P  C1p  1p @- \l0` xR o/ 10#/C!000P/ @-A`0` |R  /  /C! C!/! !/ @-,Ad0` |R  /  /C! C!/! !/ @-9AphG-@$Q uql'`h$RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP dkP`T `eP P9  ,僢p 0S  彅ߍ<0H(00,0 00004008004004 04$0D0(0P PW[  YpU lSp* `,\` 8  8e ,(f  $f  f f 0,0f0 f ` p 0`?`a8S9Pb 0  0**0P0W D 0* ,d@edACzd@ެ[duϬA-@Mp`;@@ p@ݍ P@00@oT 0 2 "0 O-`M$MpP`夡P"NX1 b: S/0P  rR 00pPP W xUP 0C P"V⃦R V  VPN ^P P W\1` 0O`PIX1: S<V2"WrPpUYPV9 PW002`` 0!$: $ΟPPt @P5C0S֟3]`P S R S峟pP`-嫟pP ``!\1 S R UPk`x%|!0#PaY $kPppU`( FPP OXND% ܍$ЍᆟJ'5F F F@00S/p/ጴ(00S/0/ጴ(G-pP1P0@0ʟ 0  X 3#15`05 à121 R0` }Ppp0a0!R00S X5% 0%# 0! RXh000R T00!ǁ8P,0((0(G((]( 00S/ꌴ(O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S ?00 0 P0 T0SpP8P~p(^F(  R/G-P `$ 0p0@V` 0)@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1A Q `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 Ѝ6J 0A-1àQ`P x0xo Q90Sp@@ P$` pFQL @ @PQ0࠱@6} p@-@P40S:a80Sh0h 1C 0C800S   0削00PP80Sp0 C[C기, 2 ,0S/`0@-0@  L/,j0,0080S 0 0 [C0@Z4( ,0@-S ,0, C@TP H@E% O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00P U0#03?`[[U\@D `0P$0H5Q @O0$0 D 0XR @"!L0<p(08p$0 0H(0 0 `,0`4  0 4 KB@$HP $0 P\40  (00 0LP崟,05S00SUSP3S` $ 0 B@)`UQY 0 00`F<0408p@004`<`3 00HpL`<0@ RS80 0 ,H0PpT`k@P ,P`3Ql 0Q 0CQ <nO@ $@$\Ѝp0,03(0?D00T P %HpL`VW .`0, S24040S@p( D0u 0 P  X Z (2( mBV (H ]`Ԇ400 0Q 80080p0?(00T` 0RZ@p (0. 0 P 80S$1$f/1C:0C800S   0` 0SP THpPL`P@ ӈT@Pl P0zT`@V !pP` T@!g00P0T0$0B4(PLBAWDZ NBAWb,  G-0,0S 0 BP@A`40S*ኈЍ00qW!  0^@P   i@PpꢲF A-`0@c,0Sp0+ CPpzQ H0H CB@ 0$P@DT@ꣲa C-`0(Pc,0S0W Cp@NQ |0| 'B@@PEU  0P !  0 P P Ѝ裲q s X0sC-Ђ0@ P@` 0 00 0P 0^Ѝp4(l( X0sC-Ђ0@ P@` 0 00 0ԝP 0Ѝp4(p(=p@-0PQ @`0P Rp   T0`! 籝@P 84PO3꼴(8(m4(˳³@-,@P,0S "A008(@-,P ,\  E Ѝ8(p@-P@h0h 0 SX0d0R 3?p@006.4 Q#3SRpp|(((27@-0S S+,Ô2 R0 ELh `Q t)pmPCaQ* Q( H<`P 4!,B 5*< 50d30a3210S ϶F0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S ᚶ0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*|0p00S m0 0@S Ѝ04(4((³.`(((8(Jl @- o|O-0p M"##0@` 0$0L4@ 0S $pP t0S@P8# 00" qp$4$eBtUhUaU bU lP5#i0E S0 0p$ @ P80 ( 0 @0S ,00(# `! P P0V &ЍVp FpqP` h pbP `P0V:P0V$ SP p0[0b$$0  ! P  @P 0 S 0 00$ 0S Z(0,  $ 8Kp  @0 S 0 00$ 0S Z(0,  $ 8'|ps  @0 O  p 0 Pc 0 ! P4|xh&д (<zG-p@P` 0P V  ^00 000G R00`000O-0 mM$0P@@`004080 0bW, AW- LW% G8240cW iW0 p X$岌ppH40S ,*mߍ8 4h0H4: S@ @0(008`,0000400P dP 0 0! Tp ⅕p 0Q= 0! $∡匱@P4 0V$0 0/S ʸ<<Y:`ᶄ`"0 <)P0<0$Y`P ϓP< hy ړw <啄V<H/p n/B  n?< n/ ᤓ0Pp < !$o$0 @#0P!S 0`pSpVxp 0S `0S  R  R 0S( m0$H 8H! P`pF0$pM 0$ pF =p>  T 0S ,( PQ S RPQvxh&0zd@NscǶ/EbO-P-@p`,M$P "~p($0S0$020S'$3pM P V 00C 0P0Ne 0M fP AP PP `pP$p,Ѝ`P 0`P ,  ?o  0y0 00 ` p 0Pqp Mp URp` طxh&޷ķ UG-@pPT!p`:D10S:  p o09 6X $$ Ap+ P%W00S $$ 1p YPPU `fV rV GT!P$$ j  p$`xh&cLո @- [o|A-@P`pP 4m\ X候T  @@z 0嶮U  Ao A[ho& ,P/00#s01 0"$#O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PG-(`$p@PP 0㘤I$0 0Q P PЍ #P-@-0  Ѝ Ѝ/4A-0 `$P 啁R%p0@ 0TQP Ѝ אP404 R0/C-M`@ CYP0Pp 0S 0SS 0S$$U7#P0BS0S $    TЍP؀$T0     -#-@-00@! 埃 0 Ѝ@ Ѝ/-@-P 4(Z 巊 Ѝ Ѝ/O-MPp`3@PЍ P uP 4S  0P3T0P$Q$P 0S 4S $KX 4P S $ SGڔ!0  p`000 0 0  @ 0.P 000 00 0 0 P 2 T`喘&P%(0,p 0p$S4pS 0  p" |0 J0 `0p"P` 00P0SWclH׽O-$M@pPTsPP ? 2R 4S  0{$Ѝ0 mQ Q0   RSRQ"  "S 0^000 00 P 0PI4S 0S(  0=0 000 P0 m0P0 <00SS P   0 0`S4S 0$R V P0 RS 0  000/P` H0H 0000 0   H>pJWU7UhO-P$M`ppHL~@PLs@P0C$4d%t(, 0840; Kpd`J 0 S; `;p 4044s p +kpp |p@ H4* R9 : S$$4SB. p $4Sb(d,T0 B. p (d,T0 $$0 zP0p % 0l>$tW|(d,T04$t0dT 0[ (d,T  0p!4S   0  0p4 $  | J{p J\pk 0P PIp  0Pp P IP' 0" RpP5:$Ѝ0 S0jp 000$0. c 0S*+i/`ۍ ")5Ad@\sd@ 3@e @-@P 4B BRP ,p 84  Ѝ@躍Ѝd@@-@Pp P Ph4PS 4 1VA- PpP0T@ `z0X0 t4 Ep( ?pp$$@-"$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /G-`P@Pp 1l PGP` A0 `A00 00mPU:Ѝ 1 00L0@0`\P1 00 SPUho&C$$0A@-P@- x`R@dЍpP P 4 R 0 --O-Pp_o!R0`@tMR(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 P m0 $8P  P P  hP =A-@pP`P 5/p 4 5/p 4 pMC-(00pS4P Ѝ$d@ 0   0d` 00  0 `WP WkO- 0 0pPv|@ጐT`  mP `V H<  0 S|@-pp@-P@`0 ^@TpO-P`,M p@FE>0     R  0  0 pl PU0 (P pɑ0 SE ,ЍpO-PQ@04p 00` ЍP P0S*  E `P0       04 p p#p p04pp  g0s@-S`@ PR0 KRP: pЍp%   iQ000 BR00P0S -s@-`V@P>`l` Q0 ?o2R0S -0S)00 Ѝp-@- iR sR aR p` !p@-P@^P (`tPp Op-Jp@-@T 40`PGPpp-eiR@-- 0 aR bR LR( sR% tR@#P 09P0S`00ap`(a0 /-wp@-@ M\P`P0 0͵0,Ր0S ϐ ㋐ЍpG-Q@`M QP  ЍAP $ypP h6B0 00 ` 0P !zO-$M@`HP 0`$ЍPP 0 0 0 $0Y!<#P0*QQ P0 0?Y S0SXP pY0 P pE04 PU 0pqp $ yP 000 00 pqP ,z4 k$ o$\ $  0V,S( 0 `$4 80p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0PL 4$$   $ 0$$?p6 Gb00S 0@-@C^M E$垏E$$0 0 PЍ0 @tq !ᄏ"`#XT 80 B @vP8sxh&,7HZo0$ 8O-`LMPp4 1D0J00 p  0S& ! R"|!LЍLRR a0BSS0 D1 0S  0P @P   9 $y@ vPట  y T 30 (0@  T !@ 0  @ P@ pxh&|c-*,.xn&>PA-p`(P@wP0 p!`P @00 0$0@-@P$0S x@xO-20SK@0SD00j@ DP 0SD0SA \^<40$ 400#qpp, 804<0YP$ 0I,0  +P bU@qU PH04 87pPTЍ0$$ `Vh0Y`0X0 0000 WX0 0 0S " [ Pu$0 0(000qpp 0 QP Р 0Z,p , M/p p  $ xh&|"CO-C~LM` G@$P0 0H%yp<50S ,3LЍqP sP @0p0$  0+qp PP`0$0G$$*pP0P 00 0XpV0P$0  0 ($0 040FP ?P 4 0 ( $ "2 . $00PR00( ,VU 0Sd% 0哒#80 08 Y :0 U P  0 <0P<0 0(, P00 0 W P (0( S,0,0U000U,  ( 00W  00SWX0W 4ST 4SQ 0S 4 X4 `4\ P 4 "$`0 0S 004 mC $ 0$ R40H Lp 401SD<0S0`01pw0'x4 $r/040s?pp^' 0SU0P` 0 p  U  0  %Ph` 4$$  xh& Ln|g$FC-P0 @p`$M!!t Ph!Dxp*0S00$ P 0SF0SC \^> 0T 00S!Q` b$NP$ a@ P P TpT T  0$ЍP`xh&O-P$4TM⓲(0@xp  8"`B @Յ0P|`TЍ X 0 &`ꀠ @000 0 01R0 0|1P @P0| 0C`l1  00B0 @P0@0$ 00S+0"+ /0hYQ Y 0  0$ |0P|  V# `F0,0( Io,0 Z 0( 00S$EK%U /04@P0@YT Y PbLC-\M`0P  Rxp| %i& @P@0ⲞP00͵@ @    0 09@P 0 ,~0S x 4\ЍbktP `00CS`0p S00 P0S X0X /X℆n&3S @-xMm0 $8@p@ T pxЍ/zC-t2M`PqP0 LЍC-0 4(,%p YW 000 010 0!ppGB 800 0 P 0   @XWF QX9T 3S   PPn8m0 $! P΄ 0p UU Ѝ00  ppP嶄1S1StЍC规2XQ$ @ l➄( p@-@`MMPႄ  |4S xv0S hq  - 00CS 0,!80( \܍Ѝp A!0P0 0 DC)P ;0 P t.# BP%@P 8&n1<HSakhC-MMPp@T hݍЍ0S@ `  f Pp  0$$9 Pp 0$$10o HO/H0 B P @,Ã.D0 B D⺃m0 $8KDⲃⰃ#  OO-YMp MP! @  ╃ B⑃=H0Cr?H@0 00 0剐0 `0T { w   Q 裟l  ( 0 J'f/J0 BF!F>P NJ?l#0yI0TStk/JD3 BF.JF? B9.JF? B2 -0$ 0 0 # >P"  $ĕ n?P0,p >#nπ j[ 0000p P ($ m0$( 8@#.J(0 B#.J B#~J fD@Z L d@TYލ Ѝl!F?˂l!0FH!F?彂 x[ 000080 ^P P30 0 RC2A0 A0A003#0#⒂ 0S 0CS 080` M@ 0~0 11111f?@bT(O-`0 p@lM "``  $spPZg PH46( ssP|POJxU`U HU& WU( AU |TlЍaPEUP @@p @@@@ @`@L}P( V`Ҩ000#  0 no0SP Vx0 V0 VP0=0 @ @@30 S\P4? 0 0S$00O $P 0S0S \^0PU  { 40>S1># s  SP P %`@(VM?X?#P?U`1?`#X3V`3QA ᇁ  ⃁ZPWU (00 ' P pn00  P Dc Q: $Z   P  P X1  P UP1`P00 -   PUL@꼾(1n&ht@̾( xh&#3'7p@-PM@P`4 q<1 0S1L0$00 rp T  [P 00S  0jiR TR LR a0BST plRs0BHhPЍpTep|xxh&T0 Q /0@-$M` 0 0@P!!0 0=00<00;0\ 0:00(0DЍ ppW0`Vpl C-`PP oO@0Sa 7UPP <Py_ ht_ PQ=P  <K=P  (E=P  ?=P  9=P  3=P  -=P  '=P  !=P  =P  =P  t=P X|]P BP [@X $O>P `] G>P PT @<PT _"80x%2x }=P P R0* @,x<P  h5]Ph TP  P $ 02#U: $>P  T@P^ [1 KC t;P 0!xdx 7=P x!0xx ,=P "l=P "X<P #D<P m0$ 8<0S ]P P =P@T0T f00Ѝ-,xh&/g sx~&/,4hpx2o&O--@`pZM*.np :0S ЍO0FS iS:PC>`C$P X P~ЍPP X00 BPU0P 0S tVTP0$$IPQ ] DTPP @TP (0IP=]0 :P $0 y  Q4 *<P 4P?0P 4 Pf B0`P00V00000S 00 0(0SP dS0P,0 S\PP ^pP ^$dPP0e4 ;P 4`P `=P @ ':Pv H !:Pp @0 SD00H0 RL0( 0xp 0,qpT  R$4 "#qp 0p t$4P p$$t$4PpW SpP( {SP$ V&#qSP [0P$0 $^pP$^P&? p 0qpy$p 9Pp5 o  9P 5  9P 5 9P 5  #9P t5  C9P T5  29P 45q ;9P 5  F9P q/  9P r 9P 01S [r/s?`&(Ѳ Ѱ  t9P s/l m9Pu$$s$4P~,8[P ,480C$0 w]pP  w]$$p0 Bqp\& p0t< :P`3C<pP 83< 5C$< :P <P2 +9P 2 $9P   9P 2< S:P $ < 8 8P# 8 Z* 0uZ$ Bp $ jsP$4 "p#qp0$ UsY$ 0`!\R8008(0 000(0 40P0 `$,p 0$00 P00 T0ZXVp0$$qp@y$$s$4P0H00`L0p9$4&pk#wqp[$$r$4Pp xh&- "f,| X~pU. {GW0@-@M P  ` 0 0S(p@ & 0Dtp 0Ѝ0'i2@-SM@P, 0 % %$ &&4 '@p H0P0|00t0`*h 6XB00DL`|`p D Sߍi@i!i@-@   0Ѝ10S/p@-!MPM@P% PA. (01P A!AxyP 0`0?oS c` 06P ``(y0 0A. 00P0P A Axvx0 0A. 00Pl0P AX XA\x0P 0004xލЍpO((fgpt{s@-1PP  <j P 5 `@T ЍpP  00SUV  Ix@0 R !8O-M@ Ptpp" `P"  W  ShPP? SaPPL\PpP SplUPP S PO6P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, # $6P_ 0S\hQY @ rpNl lgSZ L冧X (t0}W 0k0S, @ hrP@ `rpd HQ L 40R !01Sp0S 3/p\ |] 8 Xtrp \ [ 6@ `grp Ѝ&3;*0TtA-p-O@P@tOPP3OIZ`P PO P OP(Y@:ZT @- 7P ЍA-MP p6@P00p`ЍpP  0 rp !0  P7i@-@p @A-P`FOpP00RP@?0R  FA-P`(OpP00kRP@:?0nR  Ft@-( d5P00 Ѝp@-8M@ PS5P1 nNP BR0 Q0s0S00QPP  *O@dXDh A  Q4 PO`MXV8Ѝpi@-@BMM   p 0S 7  /  0(ⓗ(@0S700$0/ 0d (⅗(@0S BލЍ<tv@ lv@i$Zo0@-MPfN@P QP p0V" CQ 0 0S $pʥЍ0i@-@M   pЍi@-M @4P0C p p  1Q0r R0s0, 1p`Ѝiis@-`Pp@ @@O4P0\ j+@P`jP PL ! @5NP, CZ_Ѝp*V7@- P@BpX DHM P<0<( CC2,0 N@ Ѝ0zV7@- P@pl #B 0PHM P808 30C) BB@M@ Ѝ0@-`MpyMP!0P0ЍPP@U ]@P0 H2p7פ0 P@ PPNQ_i@-$MpFMP00$ЍP`\@Px0 0 `pP0⨤P< P`@ p06㡤_7i@-,B u Ѝx}@-000 0  Pop `\@Pu| ` @opl P0 R00bS t^}rU ttPxi s@-@`:PP  =p ?y0Xrp@-` MP@LP O Ѝp P    O  PL@!VDvi 0@-,M@ P2P0 -  p,Ѝ0 0R0s0S 0 $0POPP   L@UDfp@-P:p@d@@BLPL0L. COQt P峣0^p *7@-X@ P|2P00 Ѝ0  p ;DQ@-i4@-M X@\2PH0H+. v00 0m pQЍki~@-M X@<2PH0H-. V00 0M pQЍi0-M $009 P  ?Ѝi*@-@4K P(0(, C'L@V00@ P/a CRWC/A CR=C/@-=00@- M@ 0( 0 p Ѝim0@-PM @P@\P@@⁌e {G 4  XsЍ0@B?x@-@JPP ͢m:`PR?0L`20P.C B00 0st0@`Vm` l0PR/C B0\ L@ @@@@sTp03/`x%zho&////0 L0L0/x%0 T0T0/x%0 \0\0/x%0 D0D0/x%0 d00d0/x%p@-@pP z00p00D S 0A0CSn0$P%>Pf 0@px%@-p0( 0`P/ R/x%0 O-4M@@!2T0(  Dlpď P(0$`!pSp D@T PoS@ڐAP`@ &ptpP`[T000 [  o R  P Q R. 0S $P\(P  1/P fk@0S  lp "SR(0 SL堡\ 2/P W0(ɚ;6e +O-M Mp@p U pP< |( I`P  0Y000 rr/q ⇐ }l[>Jp0O x nlp Q hq vq@ p 0 Q (q%_X[ P`00@0 0BlPq9 0I 08 48<+lp 84Y0Pt0r 0` <04lpLh <Diqq[8H0S )P01tZqH0S>I0S;X`PU 0 3/P:㸢 "rD0r00S:0 0r6r0S X(q   q 03/q ďI0.kpNI0S㍠QP E"%J` 1 `E PIEP @0 l1 LAp 1 LJA@!1 ,p `` #%J`!1 IA @@ |1 A!1 MA@ rpPPU_ 03/P 03/ݍ ЍHhi~ix%ii(58(3i8QbmXO-@PpP  p T G@GPT! G#`P XPLU @1O0S pQQmW 2P.Z  +P' b0P! K0S 0 L0S 0M0S 0 N0SO0`S PPV o (o&@-,MP@~pP HP`( c tp0S hv H.P00@ j0  \,Ѝ(8i(@-P@0 PI+G-@GPP0 :`@ Y㌀ KpJᔍPP  Ypp @ H@@@Y@CM2(s@-@~G@P400ЍpJPJb@P <` [PtYu (s@-@TbG@P0{ JPJ9@P L` 2PKYu kЍpM(A-@'5GPP0 |`@JsJ PPp p4 BFJN@M(@-@ \^-PP0P CyD 0 S8800 >00Ѝ(Yho&0@-M@FPFP FPpFP d0P P P P% 4P5p ;Ѝ0C(7iN7@-@։dn P HnDP  P! (n Ѝ0n @E]`hniA-M`@PK qpp"P  (     ip' (( pt"<@T d8PNn\2PLGn RU TЍ0 P/W@P㸝 $@hp ;Qn t 0R n k)m mPp L`n X`Q$R@m mmLP:ЍAWP\ 0P R   1 m 0 RSmm $ m0` R P U 0pD` PHT8i(i}|iPp@-P`@DP V  E`P 2O`/OC 00pDTp!OA-@T 000`PpJ0 p `@@-MPP00Ѝ`0 00p0@ 0 P IH0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍ/70P 0 , [p 0 @0@-@P N@ \O-`@pP,(0V0S 8TP$P$P 40S 04S 0S(0p(`8P0S$0(PVO-M00q W$0_00Ѝ`QB QE 00 *PP0P XU =0ᡊP x,,,,h4@[T /@P00 D0800X5T (MK( R R["003VP 000 ݨPs0"CQn BQj Qf?5^ XppSPPZ Ჰ  $P eFpUWH 0  FpA 0STt -PPX!0 i8!100#R0S 0o8^@  0YPpG@T 0CS0 0r xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@Dt@S 0q@0@Dt@ T030ZF@UTl +  CPMU< E0 0 0`0A-X Pp@`P 00,20P 0 p 0 `P0O-P`$M@ HpX) P W0  Pp` 0p0  0p- 9pDP08pN/eSnp `|0 Zh P,00P0P,00U0,`(0DN/h%ݍЍ(Ki/+1 @-p IiKp@-d`dP0S s@ Ppa bp@@pP@@ %(O-(pPW` 00S`1 000xSP p<14! @T Z  4P 1! P `IR  B`W    )P Y:WWP P0@DBt@UWAq0@D@W@Dt@@t@@pv&tv&Qp@-@P&00S#0 000xSg`Vppg`   ,?QQ0S p@$$g 00pv&03$+tv&p@-P M@ U U( ]0P0 Ѝp 0TPTT@ !!0P!!`DOPP  @: 0A-p`Pp@ @P(  Ab8@p@-@P`M   `ЍpG-SMMPP|! p\!#͖`FpD@)0#30 Sd0 00#00pH0pM/P41S (0Y CM/ZfXi(Sp@-`M@ip 0+SЍpaP  <   R #} <oap r01S n0/S D i 00S/@-@fO(A-P@`TpP @ 0SP ho&A-P@p `PW\ TOPH0 000  (p` tv&:i@- M @ph ڕ T$P00 Ѝ0( 1p •,@9iH@-(M @p  ⲕ 6&P00(Ѝ 00S D p$P02 ( p匕Tj@9iH@- pp 0QSЍS   eqx/0` S $S HH @S/8 S $, @$/ //PPPP0t S $S $S PP @S/@ S ,4 @,/(/$/ /G-X`@p1!0R x P A^QT TjPD@YZX40PE200G DDJP@- M @pld ]#PT0T 0@ 0p@@$0C ЍiiO@-@(M!  0P p@  ⩔0 p妔(Ѝ_di@- M t@o#Pd0q T pD 08 0zp$〔 ЍiiOA-M< Pp! c0@P "` # 0(0pp0@`@$`<0@PPL100 0(00080, Ap&F !P@0 @ p  :R@00C00 BPL00ݍ@ T0S h@0 @+P0  S 0i8 tv&00@-@4M PCp  d0P % 0(1p9ۓ4Ѝ0iho&a@-@CM`(  TpP 0 P P PP  8 ! ll pz l R噓dlm U#0P 6p 6S30S xc0\P 6vp 6SL<30S 8c 0P 6dp 3Q?cI0P 6Vp 2Q8c8 5 Fp 0S0 |c8 ;pt 5p l /p 0@ PPo@2Q 8cCߍ10S c10S cc0  `0000pycPU0``0` Rڬt1000 0:S R DP4Wc`pPQ OcV pW ,PcUAcH0S L;c b6cc-c`0Q 'c b8i(i:iAH(KT^) iwi8iiiqtv&0@-@Pp@Zb-Xbp@-P M@` QP0 aPp@@p@ Ѝpi @-< @ P(0/ Ѝ @-@ @l P,03.  Ѝ 0@-MP "M\@PۍЍ0@3@ P P+h[P@$@ۍЍ0@z[0S0S1iS5 O @-X @t PD0D/ I zp噑Ѝ^ Am @-X @W PD0M/ }  ]p|Ѝ  O-`MM@ 4M0P4 lPgE7EYPX7U'S$0`0@ 0 0 @`F( 0Rt*P} 0S0'V 0).0030070 0;00@00E000 a(@!!0 P b0 /C BRX      -Bp8$ B2"!0``F ^v E040800IcCP S@BA`p7 0P0a Ua!0@"0(0(0SF a0$ P0B'S$0؍Ѝ 0 0<'S   BS>C'0C'S Q:Ɵ"!! CR   ##9C0C<"!% &S&2"!2.B&>C2"" x&2"!/B Q 0dv*Sz S P&S   2S% S`r 0S R )SS &0C'Sq00 0S 0 tF t0`0( 0 B( @ R `uSG` X>` 0RX 0``D0S4 `0S pe0  `4I3&⩐`YP0  @`p `0S V60x$S0pH@w`0S  q`l`p HcHAHZ 1wq೐p `Fv`Z hav`V L`V'0Sl  g ,Z, :`JT#P`# $PT# P#Pß P 0&`<3J,#S0S cF @`0S9  `4Sb`0S* `뭏 p`0WW   "|0_ W'h/A@_0S LH_H_p  H≏HAHY1ೀ  `FZ0pg&Vp ,, x_I!PX! $PL! H!l P (_41JD  VS0 ,Sx0 i}!!(! $H(PX" "$"("U"PX" v""q"  P Px" "" i!  ! !! !(!0!8!B!G!P!Y!`!t!0@-M TPp@@ =Ѝ01 嬎8@i"# 0 /<%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  ?K;K ЍЍ/@-@(KY' 0S/@-$(-@-  KK ЍЍ/-@-  K K ЍЍ/@-\00S 0  0000 0 6JpЍ$('@-@ XHWWp0MYyp'''p@-pMPP2 P0S 0@P 0 0 00 0XIp DlP@@ ((@,P0P4P8PSi00!031 0@-Mt 0-I@P \+ WELPP @ (@@ 0IP 020Ѝ0@%5*,(B*@-@4P ,'^$PA ^ [5*ho&YP@-d0 !X|!T@0 6p0\ (0000/d,y,,Ph0h@-` |!TD0 6p0\ ,00 00/d,y,,P-4s00#q^0<\ 0000/d,y,,P 4qs00#\,s0Q00/00d,y,,P-H 0:# ^4 0Q$0000/d,y,,P-H 09# ^4 0Q$0000/d,y,,P 4 <# \,4Q00/00d,y,,P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00d,y,,,,@- 0 00`ZP ЍD+H%A-P~p`@WЍ 9P 33MP@ p7@-P@U0  ({BF Ѝ0{L-A-0@nS0oSp@ p{P`\FP&F0nS0oSGPP~GPP'R-@-0 \YT-ho&O-M Mp)9Zܘcx F_ꨰ l P0 0 0000Z  0P0 P4 0S܍ Ѝ 0 @[3IP0 ##Zo KR 0(z 0勰P   -P A0= P  00 0 PV#  0ZP U Z0Sd 8 ZFTp^8[8Y DD0S ^U<<00S SSTp@80 0D@00 h0oQp20S SD +C0 $ 0UL:9S:::p@-@PƛP (0/Spp@;;1;@- WTH;ho&O-p0000@P`ᜐ (,唰00 Hp0@DTq oP0 PsP<姆s8 O3xh&--[=p;P=@-M@A>0 0D@00 h0Pp0S SD "C0 $n 0T=^===o=p@-@P?P (_0/Spyp@u>>>@-  ?lTho&>G-`0@P $p堐0 LHp00@DT oP0 dTsPP)Es  BTA+ぷG-#@xh&?@@@-M0A~H` 0P0 @dPp T$@p@-@PКP (0/Sp p@@@@@- VS@ho&O-P@M P0`TrP"Gp)@20 R. +x   &  x `!p0 *00)0 &0_ PpM 嘅uPfPMP- 9P GP p1g@P UP|0 0|00|0|00|00|00pt`x0 rPUqrPZ,0p0Y00t0V 0;;0x0U3P$00|00|000Ѝ-Bxh&B@`AB-MMJNP0 @PG00 |0{Op0 `0 0N/0 4 x000 0@(rUSBBB9C7@-@P {40Lo SϜ 0 ݄ Ѝ0C@-@40P@D@-@_60P@ D@-@ M40S 00S0?  屄ЍDp@-@PዙP (嫄0/Spp@&D;DTD@-哄D@-8 l0 0}0000000RURDho&7@-P @4P00S\ 0 j Ѝ0Ep@-@ PX0 D0(prPP(ZPtRp@> (FO-@H `p0#H PjLLD%HFp850`FVQ8 52@FP 50S  4 40S 4 0<0074a08:$0000000d4Dt0@90;84giP~04P 04I_0(80@008 0pPPЃ0       +  @   ' B D# R4#  $# R # , @ ( "  )            Zp20  Rp0$000 pHp0 000 L>p0$800 (4p0<:00 *p08:00  p0@900 pp0,000  p000000Qp0909 1R@11r0$0000 00t0,00w0 00x~00007000+ X4 ~ Ѝ%I %Ixh&hDL(D(-P($FHHH(HHHHHH$%A-RMMIN@XPpD`p`00EL y눁H00p$xL0"Mp0KS 04  R< pL04@0 婂p? 04n/`  0:vHP 0 ,PEP.0D P! D4R 4$04 0404040 40$4 0(40,4`044<$@RRݍЍ;$PD(>IBIKIJ@J0Jp@-@P3P (S0/Spmp@iKKK R R @-6/K0@-@MP`p 0K000 MPPЍ0P0 0 0L0 K0P ps@-`/P0@00 KP0 HЍp0/s@-`P@00!  P0d RPPP @@ 0 =R0Ѝp(L(002P0/@-@BMP' 41010 0000000 0P D>< RH00BߍBߍ@o꠆9LG-0@`p8Pp3 pϿ| DV0Dx4<40 8r0o,l<0(000pE040p<0< Dp PvH00ЍpRPN PG  Q(TVtWLLO-$M@0 /`Pp0 @T .V0I<00$Ѝ 03/ Z0p |/P P @0 ` o0P":@ 0 `  p00P LH0@3/pPW/ 0P 0T@Pp 0 0 JQ꠆eL0/A-PMM`p/ P@1L# 4ND0@@ 0@00 0@!pߍPڀ@T ߍA8Hꥆ(C-P[ 4M@@0P` :0P`PT O 00T 0 ^P 6 40( 0``00S0 V0S`0000 pp  jPP0QqqD0D00V 0 000OPP4Ѝ 000<0(LLL(--0M 00H0 @P (΃ zg ~ЍLL@- Q NMho&O-P@M$  00p 0@"@0"@0 "Ap20a0CS t2g@pbP 0p00@0Vp ! 0 lPl P 0S R |  tuOz g!!H1 _P 0S R  d  .z ' p0 r+妰:Jp h 0[4S08pS @p @Ѝ?B-xh&OL-MMNNOyOO0@-M MCN@80P0 0E@%(00 0kIp  0 @qO nO kO(00P( 0dO,/0P , H]O0@ZOލ Ѝ0@SOOOOOOBP`PRP7@-@P W.0Lo SϜ 0 ~ Ѝ0P@-@.0P@Q@-@;00P@Q@-@ ).0S 00S0?  ~Ѝ Qp@-@PgP (~0/Spp@#Q8QQQ0/p/p@-P@ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P ᡥឥᛥDDᕥ@@ᏥHHብLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@PWTQNpA-0@PJ04S->C?->C?X.9>:>C)?n:>CF$ 0? AC>}C>GmFEnFE~G X J.X V  $$((,S>,}S>GmFHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqxj1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ 0Px 0}`0 C cà00d0 PS CQ c ( (d(U _W`(%}`ho&`\_p@-Pl`0@S     ⺼@00Sp0?00Sp0?0p(%d(t0p@-0`S[\@ QL00S000000B0E0p((%O-MMO⾟D`, .%5_Q0uPSi`50fBBp%?D0Sdd/nD? 0?D4'Pp؍ߍ 2@ŒD 0L 04;20d04 0]0 00@4T@:T @:T @9T @ 9T @8T @8T@@04s00 B0`p 0 40S7{ 3 0 000p0  `  Z X  Z0 ``ao,F₻ Ϡ ß\ ^/F222902?"""0Pb 2@őD L 00 /4;2ACA 0d0"0 0 o 0S,2 0r 0` 0W9 (Ap`xSi`10yAA/0`22220&OD0? 0 0430hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0 0@Dő L0 0/4;$0 A@ 0ldh 0@ `Ì0 1m(%\((Ax%%o(d(TO--)MM,0=0?0(8$0@D0D`0S> 80pW:,0 0  0 C\(p(h(((oP@P`P @4 P@  4p@ 3Ep@ d3T@  2SP@ *S 2P (Jd0S0,5 Sx0<0(5002 0,%S0022Q04EW 0QEOxrx" 0 04 0A XEA 040A 8E8 0 4QE/ 00 Q*E& 00Q(E 004 Q|E1 @00T(0D%\3SB1\Cp4WXp\1X0SH]E X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001/E @4p 0R`0 a 2!$ ((,%0%``|((!aJavaaaa(`(5bMb(bTb( c((%bT(4%x((( Q S,QdS18$Q<4R:xD  @0\5?>C0P4p3x00084%$0<0D0t@囀0|00匐XL5P5G   ?8`F  ?  ?| pb pG8#PE0 0" 0 p p4%p8$``05<4Rp`D$11 84<00x 0 08PSPK @δ`@0 ? @`0PP* ?៳@P`(6#R0:㯴`@0$- 00[00 1p&"0 ?001>0[`0 c2# S,Z Q Z3?001> !00   BBpQ0㊞Pp0/2#$ 0  ?wWp1Wp#T0p10G 00E  ?*PPB@TP` 0PW됈  00B1  B[1 ` U"B !!0 R0CQE0E ?P0 p2됈 0 1 B[0`0US  B 110S C:e @P`x1 G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 0000\60S|0p ?HL404P@0 @6Dp9'(=S@00 Qr(7\5?>C0P奁%4tx0eL70(1#T a2!, A3 31 0  Z@`0 04 p { 0H$4  E$ ( B, @%LV.  R*h (r < ( X ( \ $( ?.@Xt@+@B@A.@B,-8 Hu p嗍 @40K p~0 ,p B8d A YZQ !~0 XZ R ŷ{A/  <pW $?.t{ 4Ąß Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423倂r0S.@v됺 z'z'|z {' 00쑟0d0 CSQ c6Rc(+S`P_B @<0 z犸 z'(Ȋ00 (08~+S,KB 00 SP0\h!P !0@ 1@"p0 Q0&㍶0S`@ RB PP0 뀠@t7 j0JF 0*`K0`0S >(^F(cc(cc(n&ht@o&d(hdcdTU `Td`(h(\(d((%dd(l(8 p( `00S: 0 #$B }$0+V. p|00S  s 0=S,0S/0$0 1H@ pp4I<PP04SP0 0R0 S00C0> S< 0,0ޱ0P0hA 0,0S9  p开8嘥ȿ+" < Q \%`R 0  ᐡ! #0@(0 0 @DU@4A }420 @R40 `0```0T0(lb 0 妵p2 I `0 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%RX# R0C00h0$l`0 R#00B1d0 R*a%눃U` p 0 0 0 (0 0C 0(0(0 S 3`R` F $%R0 l ! `(4 p  R2d 4RT T  4P%QXԐ R0 d0 0嗱 唱  0   8 @ ^`Q T|+H0'H ({P+H D|H00S , 0 B2\,^   00/d A! a,3 1 L&0?$01=S,00CU k^010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0 80 C  0C1448000C ST00C@ pd`h48 0 RT*0C14  4  0T: $5Sl0 @0h pp^:S $%S0! !H`$p$p(0W,x0S ,4 j d,04  0,4 $  00`  Vjb0S   0帀0 X#` x0,y 0X\%Ϡ H R     dp 0G g!<X 9\%R 90SP Q``ƌ` $$T0*`S` 0$5S l01` p0000S2dᖯ0*ST0T00! ! P5RXԐ S(0d0 0     (0k00080@ 0hS`0?0`@$00$0ppS $S00S0@Rl倐HGꕉP00@z8p`0x1(4pYU0IX!@@{l00@0T: @5A$\Q 0@08(0  (0d0O@ 0NN nC 01sp0S<=0S0 000S.@>08C0S|= 0Ϡ5,"\Ő\   0 d0/ @ `.M3,00 $ Z>0000P0>0S0> 0,00C0S0 X>0S B>0S =>0S 0y =00@P|:x*,EWP>0S`EN C>`>0S303040404 0#pCVW*DmV.干P\oV.GVh0S  ?0 PS?\5=S,T??^ E?!0 0S 04 } dLĒH 0@ `Ì014 ,$0S0S 04 e d ,04 0?8 04:8)ݍЍSmfG-`RM@Xr rmPP dmP`T `cP P9  ,38p 60S  mߍ<0H(00,0 00004008004004 04$0D0(0P W[   8pU l8p* `l\U` 8 ᴱ 8 ,     0,00  `␱ 7p 0`?`a8SaPb 0  0**0P0]  0* dd@edAdzd@vedd ee+e?eRegeA-@Mp`;@@ `p@ݍ P@00@6T 0 2 "0 p@-@P+P (Kl0/Spep@aeeeR/G-P `$ 0p@V` 0@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@O-4MX0p0\00``P寱0 0,, 0S P 0 nkmS2aSMS ASB0C0`b0CX S0 SSU0@0 0DT dS$ 09R z"P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p Pk0S00 0 004 00P4Ѝ`ffefff@-,@ $"<A9`fho&0@- @    G-@0Pv t¯``PE0 00000BoH0UB?E ᴀ (l(P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p (0P  C @-j co`/ls@-PL@` 008!V  @ljЍp( ( ms@-PX00S@H0`ă5#040<!V @NjЍp(( (-m\10 PS/C-HQ@@MPM`6`@fa 1p P06 0 T:@6S-O@  DD6ۍЍC+ 0 Q 0ˍ14 ^ 3?\ P;0Tê 0+ۍЍ( ((((TmG-hB` p"PPH"i 0F040( 㿔06# R 0 !)i0 <0 0 !Ri0006&0C06 0  B 00C0( 6V0: R`$dwh g2 WSQ( 0t0C@0;7> 0(b S 03S0! ,0*pᐩ & U0B 40P40  0AS (00 0   ,pF0L(-000 6 0 6< 0g,(2200U( ,0 00 (p|Pc`$H% $0$匌0@d0<`LP&32 0T0<<0<X5;<0S<d8 X0<PU ȧPX  B0L VR0400& \p#  @ \ 110B0㮒f0F0&aPeeC 0CP!Pp\p : P00 ` 〬0Z0C `$00SE 0j 00S0 :#*&(:C1\:0 0t:Ѐ707,* 0 ( "*7 6 !0H 0 0H:ΓPp<D 4ZH&?0S\9 R0H0KgL  X&' d  P &X p \ ,p0&s0&$0#0  0vSs0Cp0 0 V0( " Br  0& 0 `ve BRp(0 x0Sv 0Su008@ pp2PPXP 0R SHq SoᮧP@p0S (7L R d0  P# 0`Dd&oobe+@E&0#H6 C 0 ᓔ)6 7|0 BԖ ᄫ6g0CT 00C0CS : Bo47! S>^0S0  C02#&06yP0 0Y 0:YG:e3006`  0(01 0* 0 J$T2  060 5&ȥ(6YB:P0TSL0S d0 \P U7 50SpW,@61 210!!!0 Sl$ ᓢ""+ $0d0$&S: 060& 00.6xG`W0A 0L4#00 0M6pX0SNVPEPUJ 30SB <6W 53PU,CL0S \09`0 q PP1 P# j≪x3606l0H0p0t0x0j008630JPp`, 5eqP 5pg j[260H0p0t0x0?0f&! 02/!"6 QP*dX P 0 l03PPP  rr0vo`P fgP  6 \!PU:< &U":0U:  0 0 h℀(L0SUWU: <p0SB:W\: 0 6P ((]n(n(nno1o%%lo(o(%QSNo((o(p((pepp(ppn&ht@o&pq\nqqAsq"q%A%xr%l( ((d  0P0  W:h  吣  p001p1Ps 0 !GP <`U&`06!0U00 h hRL0S `0  l1#'$/%x16/sH0lp0t0x0'/080&2l0P f $E 2`p,2& 0hC0Df?o2U+duM&0#G6` c2H H0 HD /CߍW?G-`RM@Xr FdPP dcP`T `7P P9  ,/p  0S  Aߍ<0H(00,0 00004008004004 04$0D0(0P W[  .pU l.p* `c\) ` 8 ረ 8z ,     0,00  `d .p 0`?`a8SڽXPb 0  0**0P0S Ȕ 0* sd@edA4szd@sLsUsfsrsssssA-@Mp`;@@ eWp@ݍ P@00@,T 0 2 "0 @-`pL  (@PD00S0?0\ 0S 0 cS\F\GL0 \ gL|0 SDKT ЍE%KUJ%FZO%A_0 ttt@-H D3<<P4@0 ,P3U@0tho&ttuA-p`P@P V0 btG-`RM@Xr bPP dbP`T `P P9  ,-p 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P ~W[  -pU l-p* `Zb\ ` 8 2 8$ ,V  R N J 0,0D0 @ ` )-p 0`?`a8SgWPb 0  0**0P0R r 0* xd@edAxzd@[yxxxxy$y7yLyA-@Mp`;@@ Vp@ݍ P@00@+T 0 2 "0 0-<\   RS  0 Slv& 0 /l)Q@-$ Q:yyO--@MMh V˦0d00h00\00|00p000 0L0$0l0(0t02000040<080H030<00404p 040F00G00H0040P0050<00S00|0000000S00?00H R00S ut0S 2Pthj|0p 0l0- SHd0h 04?i/0*pD @|0@ Sp00% D*P o 0D@/aX@P#*pD +,P |lSl0S 1 : S  R 5 @ 8EPPP0j VPrPE_oRb p1PU p  5P 0P@D 3m`Tbd0h 0 0D0&ᵜd0h QP  < h0@ F⍥0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100p S0T00RS00 R0 R0S0T0y /}0P00Q,QP `R  V 000OV 0`S`SU [ T @0S X0S2|0p 0/>0 D0p{ 耝p`ST(+qpv @@0S ?W01?0#*@0cph X0S*Zp_ X`[ 0㿟ZK Y  Y* >05ZR[:L0Sd P!0SV@ `PXP UU L0 0P U PDIJ6P04!,A$ 8!00 -T0X @9-0S 3- 0SQx <+-)-q4nEQ `F!--Q- ,l0S ݍЍ0/^ &>l02X(`PP \lv'&>C' 0< S0|0| 0$02#l0. Y0000 0l 0H0 30R08 0R000L0L0S0 Y@ $ p0003Q t R t L0 p 0H0( S ԃ0S d(0HH00 (0K-00\0S" Y0( R030"S R&.80S  %p% P  P:( (0S Y0( R00S $4 0$0 Y000 @0,0 0#40+40`00 01@01X01T000 0 <0$00(0x0,040303)00000 0$2?@1c4 04v 08#$0 #(#< 0 0  + =Q p0Q\0S000t0o0 00 R  PT p寠&?  D%po P^ ( 64 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |C೜Q`000S  0! YQ0R0( lR00S LY(0 00 25 010 0P B24 01(00(0S    k B*{@- S-S_ A 8 / eA@00@- 44@4P\P 0B"" p)-@=B')0/p/@-۠ +(똃ho&G-`@ P p墟!>0 P U0 0  P@ G0P\0  0LZ R 0Z U   p)-=Vs@-pP@ 0  -X 0TT*LЍp P `-0 ~*p)p)s@-03S   * Ѝ{A-@p M0 0S P `1 00` 0! 0*))*1 (*g-:*b-A*a@FPVX`F: Ѝ*Ą0@-4M@ 0P0S 4Q 0   R 0  9   0 "0!4Ѝ0@U*R  )   0 "0!R 0S 0S 0  ( 4Ѝ0@&*4Ѝ0p)0Qf @-5#pY)wH@- 0 R* 0s# p@0)P `00CS`0p S00 P0S X0X /X+n&p@-`ᗟ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hjdh`0pPp <10C <1$0 810S81p)%o&ho&)0@--@4MT )AQ`)d)hQ 1)`"R d2RK) C)d2SA t= hk0:{PPS['ΞkHk>[E{701 < = * + (+S  PPPZ) 0 @@@ zj{ k{[+S[@)4Ѝ00B:k{{'*k{\+S2)?@@-C6?Y@)p)%$))\q@-\k0d2Sù&p)@0@-0S0@d2SF`2"R2%p)@-@ 081 P 0%t@ t0 t 0#-S88<8xS`S)?S DS .  <(8(Fy*@0C $K+ C 0BK+ ˅00CS00F@*a0CS00  6  ⟕PK 0@P< 0@0 9 90S9 00K +K  dI  xPK 0  PK.  K     ^PK P 0K. %80  ٓ  B@Pjjd 80S D8   ` *PR _?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?0-I?V$ ⅓ t `PK PP D70S@'0 0C!0R3 70S0Sy K  @PPOh VXpUt0@Pp f pKt@@hP0X#T0 0T\  TpW pDS  0QSL0Q0P@~_0X\0D`X0D S@0S) @DU2 PP P PP<K { 0P@0 K. ,$K>< 0/ #@@dpP @p XI u 0S$0 0C!0R3 40S0S 0P`08P `0z2P c=0,C0 0 S;.000 #+ 0  d0d0@ 3ZGS p 1 01 Q 1 \R \??p@1cE0D H`R(D# R  D#  Z   kY   \0T0S lD00D0, L0 SH00H0H P0S  6A  ❓P0S>$ >   ∓PcݍЍ   Ta ? sPP|A80S  0 P   ` ]P  0 PPxo ۑ` B  BPPj@t0SC 000+ ?L809(0* **r*ho&ʙBJ*%fmxt***gfff.$J[`@-<00iS03S !U3*Px* *@-l@h 0\ 0 L  @4  0   8*"*39*@-`0@Px0 B0PU1 S2P T0p0S 0@ SB8O 0( pu" Ѝ%**Ao&FC-PD1`0B8! Y!R!tM@p  10S R" tЍ000iS00S 00S d `P 0!W @ 0 b P jP000 p 0p, W@000%*t*Po&x**%e`0@-@X0 B0@T1 S2@ 0P   0S  %*G-lQ0S `` @P 0S 484a4qP0 0@0C!R! 1S1 R TP`pȀА U0(@P 0E!0R30S n | X!0S+ @TP` 00 @$ *o&k***t*8*O-0B$p 0Q0US`PP PP" @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@YO P`P30S  (!x#0ES0 000D30S ЍY& 0 X@00020S ?P0  _X0000 { 000S 0@@  0 0@0010S P0 YQ: 00 0X@60000S X0000000S~ @0 0 n RT 0@s0S w@ 0 @$ 0 k@WH00S 0 T,} D(L 4*t*o&ho&'D8*f`1A-0S PP@`D1 T0 :414a PU @T*$PQP@`0S 0D !0R3 Pp U 0S 0S  |P0S0S \0S < l@*o&*8*t**؛0A-0S 夿|P `p @T V @TL$@ 0S$p$00>`@*o&8*/G-!1 RR0堑S s@Pxqx! 0P0:ЍS @L^`P 0< w000W PP@:SR  0bc Q Vf`P0pQ0 _000V000x***o&H**kho&Ȝޜ2O-0S 0b0 -Y1PpP@ 0pP00Z: P0-:p R02:10 R S U+:SR00W 030"S P} 0000 S' @@  W0:0 SPh[ {\ X000P@ Ѝ*o&***ho&C-MM@P Q0S d@p T0:ۍЍ0S T0 <9000@T`PP@p0 & 3Y   000PU *o&*0p@-0S P`t0 U0p(i@TP` 0Q0F00S )@*o&)*BA-p`P@P p?pDorP 0L0 0C?oR20S  P Xho&rp@-/0@Pw 0Pp SRp\*@-8!0S$$ B0A A뛝`*ho&A-`0p0O0000 SPڤ/0>+b P0 P<-P@O 0 x0O0?\*T+%0@-@0 0q0@0Ѝs@-@P`P @TZ TT?0 00?V+"+R  + Ѝp0ho&$0L<S/ @-PT+%@-<p @,gP0@0% O-1@`pVCMv Pap@0DWCߍ貀TX B/0S x V@0PS 0 ?2/ 00S 0S 0S0000崐(h X:0000Y&*Đ0S Ƽ0 0S 彼0 000R*Q l\0S Dk`W0S  `l*(+*o&Th+O-h3p0]MS TT劼PcPC H0@#@00RS $#05 BLbp2"!CzK+KRPP "2W 0"u00RSZ 0|"tjl!bp`"d HKPH"L  Hp7<+b  P<劁P P $Y0?0H @P KPPD  L P oKP7Pt]ߍ*o&*`*x*ɞ% T++%9N *P\*pM..*ho&%@-$@0 00: S*G-@ q `0S+ 5P 00S xP0 S00P R HRڄ00S t  Y`ċP 0 Y00:$00S $t*t*ho&؟NG-AM`P@spP00 040AލG/0 008/P1 00C 0  R+h X 0 { 0 D nT+"L$ho&OxA-MMp00 0/R @`㜀GPP 0S P@ۍЍ D >ᒉ`D @P 0S P`T+Np@-0@ @P QP @p@-@H@O-3tM0 S m눣00RSx3 l3l#0hdC4#SXC#PtЍOS@c 4PL  p+l)F0@`00mAoԲ`L<` L\0@ $XK= hpWW#XQ@P  L<0@(d0PxSiSeP 0)0@& 000 L<0@ Q\n A`O`ٹTDֹL ItЍ0 0C0D10S 0pS%0` S\Xh0SS   *8*0d0S X00%<0P!xaap 08*o&x**`*+%%ho&T+|*#=[**ҡA-MpM`@PP 0pp1d!d@P TTL僀돎 < 0ۍЍ aD D< _pPU  U`k p0P Xa xQR0S p T0TP 8 ?H8 [E.ho&3T+|**Kv@-9P@-L@4#S 0 Q 0#S 0 H@%0A-@P` 0 P0: 0lhp ?r0@$a@00S$`V SR*+t* 0S 0 0/ R  /0S괢0 `0p@- P0@P*D` ?r0Pp UTp$/p*+0p@-P@ 0 P0: 0|@x` ?jr01S 0p@D0 $ P\@P@ p$0*բ+@-MPM@T 0``p/VVP   妈P @T@ۍЍVP @p@-/PB@P@p00/00@P 0S  A-P/p\0@oC 0T@@DwsZU pDP@D+#G-pP߆`04PSp @P`0PP0C0 T`4 $D@:+*DG-頡FPTp A`Pt&0@(0C0V$Q@$0( 6啋00v`PPEPP `ႆ @$@@(`/ᜍo 0`0 @ `P`:0P p0@0 P $* +*_@-@D00$D +0@-S@ s0S 0S j 0S d0 P[X T` R 8dD0&F$ ЀP 0S00ƣ٣#+p@-@`PP|)0S ? 0P0 @/Pׅ^L0P 0 00p2O-2p0SlM ζ|20SHl PP xT PH0`000@,Q 0*` R 0@*@a0Sg@01 $10 %1 08`008<:|0@ ËAA p N/FlЍ 0`0V@ 0 0/| 0` @T`$ q000 0 0($00S0,00S0(0 0S000$0S0400{@0 1S0 00{@*o&C|*^`ho&k*+**h*C-20MS Yr 0 peP0 00;000Ѝ PP ,d ` X8P 4 $  $@0@D1`P P   1RQ rQS $0!SP P0h0 ]P X1 D1H1D10S0|"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t2 R" *o&Ҥ*+ ho&5?ax**ϥ**d*/h%%0@-P ef*$ho&0@-Q 0@T0 R ||$Q0AS@ ЍH0 DCPF( 6%* +ho&K%mup/0/@-x 0 RS T0R H0P88Ѝ S  +I*ho&A-D@p 0 0SP( ` `,P:E  %+ k909909 Ѝ0 +"+R ! R  x EUY0+5p`PlP d<X ( `e ƃ0S F P 00 ?zqp V00S |崯0S 906;#;S T%lO+Xk +h*%t*o&ho&]*t*˭*8ԭ*+0O-t'BM @R MT'T7PP uP P Bލ Ѝ$W0S70S  a00`P 60Sf VSP M JGDA;h]ehe0304048-8<*<H'HL$Leee x x||e9^EeEe:^EeE@%0A(US0 (12222( , 0 4 8 @ D P T | Z40(01@ 0D0(02,020028 0T0Pp00|`P$ 0PD \4$ R> P<(4 R $ R 墮3   p}z`wP t +]0/ဳ䀣 0/00#00 20 0 0/0?,00#H0?\0?d0 0,0刓吃(pX``P 20R000%60"`20=S" " \" R0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h0 aR!S  xx #3 d\ P!0!! ,AQ  ׭ 9-0CS    R0 R R 0N\ \0\x0=0- 9!sl*lT +*o&kt*)%Iho&jǮC-2BMMP0000 00 Qa0S q䑟=0=P  RP!0AS[0 =0p㈁0W`1lqTP  RP 8!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-RڔK 0=ۍЍ|0 p0P0h0d0S Pp 0)ꪧ**T +H**k*ho&*#7HTO-MEMM 0$P0@B@@<hSD 4 4R 4S{ #404P |DQyD$` B D 吃夠PEN␓{D0S[h 04<`#4 "SQ A 0P3/04$!0P+s00@ @"͡3( 0A E6/0@0 GR00 G0Q0'G2P004SQ 0P3/04@EP0 C 6/0@0 4S; 4$`0?0;DC0 4P'x P~ ׍EލЍ `4SQ 0P3/G+p0 G#͡0 0A6/04G+p0+ G4 $  BRPEN0SP @0S1P@0S( 0$00S  B5 0SP D$R00S5 00S \0l 9P tl x3  PPnP0SZ*Tϯ +k*%*:t*o& 0 *M@-@0SS*0O-M< 00 0 80 4 @b  P b 0 @0 0H0@0LP0DpPP:P S  S  S;  S 0 `` p SK  S"  S<60S  ,, (60S 6f0S -%P 050S   Ѝ50S P 0 L50S  <<k  0, 000%`,,;0S40S  Q 40S ( P 0 0 8 Z0 0 0`40S 0 H30S   30S30S  j?HP 0> Z 0 0 8P30S` P V0A 0 ,#0 0 020S   20S620S }P9 0 Z 0 0 8nk20S 0  m "`f0 0 0Du10S 403/ SS !PDZ00 0 T10S00S 0 0 8+(00S 0 4\  03/Z 4   00'  *]ho&*o&*|* +Sx%NOP<+*߰XM!2Np*@ +PLR}oA-1( 0  S !@ 1 1R 4S8 !4q04@0n`P1 PP0S  R-* SR/ AP/ $!0 010000 QP 0PU 0$N %P Ѝ0PB0P;C0d0P70S050 000 @ 0@0 0**Tϯ +$*@-cM0S ttDpCpS0S YLPl~8#044[ \ R0 3s 0500L Pr5"0C590C990C9000{Ppp 0S d2l"h2Q090 9P PP 00 $[ .+%^Op@-P(@P pPp@,%0S R  R Rf0@- |H!+@- ,*0 0000 0 Ѝ|P P P-L ,M0#Q S3#: ,Ѝ |7@-P  Q~,X_P Ѝ0 E@P .dPP oPH!+H"+0@-@QPM @4OT0d@Oo@5_0 0U0! ~P Q T%<  @,__Ѝ0%(Tr h \%Tq @ 0u  @H!+ Q@-.@h0 \!:@:@QR  0H!+|H#+0s@- @R`  |P.dP ,^0S ,^|Ѝp l0!PU U 0< 4Ѝp@,Ѝp@%H"+H!+@-@T T 0( (t ЍЍ@8Ѝ@H!+"!Q p@-@P T p@<  p@0 p@O-@"PTMA@ p @@0@$(@PP EPP - @@0P``ތU\TЍ`P0  EX y R@x   ;y0P py]  ,\100 0S00C00  Q,P p0 4q0 0pk \ 0t`00CS`0 XP0@T:TЍO)X0 X @'n&%$@-00> Ѝ@-0  6 ЍO-@p P4 aT00SP Ѝ -QP  P P ADPP@D`FRPP2@-@0 0 0 Ѝ@?@-Lr _`hho&@-[@-QAMp M0W@`0lq`Q`\0j 6p0P 0#r\0 rAލ Ѝq0R S 0P01 '?t0O7 !R  0Gb @Pq8/ 4/q<T0 <"8<@D@ D Z0R0`G Ĝ8$+hT)+@@-u T)+0@-6S 8$+p@-Poqlqiqxfqm/lQ@Pp" (P6 "2 ,yk$ p@N$H%+T%+@-q ho&0@-h@  0@ 0\Q0CS @Ctv&p@-@Pp00Sp8PU``p840#U :PX0Pp4P8P P XPp`P -7@- 0@P07 0P0S0! B Ѝ0@Ѝ/G-P`M`P o@䠟 T0D 0 S `Ѝp | J ]  ^p!0 l  0`# $C0  .0`  W0BŠP otv&@-@`Pp@"!0# U 0 x╊ph * X⋊>P@TP(?P  Ѝ-,Mp <0"0!0!0 0 ;0[ho&-7@-p`P @XT@ R 0@  000 Ѝ0@Ѝ/%r++wp@-PP@ p0S 0CS 23 0 0ppp@ TT 0 0 {p, ,Up0Spg++++A- `(p 04pЍ P +*W@P  PP 0pЍAp01Sd0 \ 0T2 0`p 0S 6` F$sP `++%C-q@1MS0`o1SP1SeV1 S묁XV ЍCVS 1S  D1ЍCa`V07p0S) S S  nX t@ "V(ЍC   nX   n X t` TT ЍCVЍ++%o&r4 0Q 000/ ++% G-AJM1MSpq=_`0 P&n c4F0 0 F*Zpp 0 S JލЍ;X P0nA7J.H0 0G1$HL  $`000P Pp6o Ls0S8l1!0 m++1VsA-XQp1`S1S@1SFV1 R1SV AV1S A 0b_V8S D@d0S VA+0  p$1S XQ 1S< AV++%o&rA-a0 MSP@ 0P@,+A-8Q夁X@`!1  0 0AS!pRS4V0 P1SV AVS A 0a]Vp6TPDP@XU D*A 0$V++%o&r0@-P@0$M00PP0 p$Ѝ0 R  h&d0 0 1S00 000 0++r(O-\q 0M08@ D @CT Ѝ0ZЍOR`" 1!0  @@0Bp Y lPP  @@ 0 1p R Z ``0T 0CS0 8,$++++dD 0@-P@0,M 08PP 0 p,Ѝ0 P  %!! 0Q P0P%1 08JQ(E @++%-4:p@-`@0M 0(`` 0 p?Ѝp R  %|P10 01SL0 D 1S*CP j!++%GG-@M`Yp2 0S 0 000 (%ZP (P(0U%`(` P@P@Ѝ`(P$PPv (  PP$0 Qp@ЍG(` 0v ( 0C$ S  8%v%Pp㠡v00Y0S Y 0I00l!,:,pH1! < 0(  (`(Pv ( i (V((0$ 00 0 00 0 000  00 0$P 0 0$ 1SDS"!!!! H++O(%Wr^C-M⬀p`` (iW0P0 0000 gYPPQ ЍP@P3 PP  PP 0p%ЍC 0R  $0W400(00 P( 0SQP x0 Pp0!00(pP0Slp1SX`D0S U 0 $PO++W(%r0@-P@0,M08PP0 0p,Ѝ0 R  $0 0 1SL zZ{e[jKZfke[KK{K+Sz++rO-xrMM00`S@ sTPO uP, H#J@ h 6Y:0@@ 0Ep.oTٍЍi  zp  Y  # i "QPR !,%*1 21 0T 1S1!T0 0*T 1!0 0*P_c0 D  @Oc 0 D o++O-{JM M`P@5c03~<0/c0`400pc?c8000S0P0S@pThK+!W 0 0P+4@pW4pr4S U08pA/0 :<0 Ur> r.0 014@:@#TRT 1S- r IR:1t| jY00 ! \ aXz@]0(3p0wG, AT, T|pG y, T, S뀀pG  y, S , SpG  y, S,t SpG  \y,P S ,@ SpG  ,y, S, SpG  x,S,SpG  x,S,SpG  x,S,pSpG  dx,LS,<SpG 0x,S,SpGX 0 '^,|S,xS 'HwQ (  gYX'0Q00S? 0YS; XQ;X PD0f4EH01HpL001`00pD0 pMpL0X10@sXp&4 0#Q0X00Cs 1SL`fX0@sǁYG4 0BrYPE pW.- ,?/C4 ?pS u,R,갠Z 0 R(0 R pP f 0 0 0P3A7/%00D0 Jލ ЍY@ 䄟 RH 1 H0pH0S# 0 0 @3SH  &O8p$W"RZ 0 00@0P0@3A4/`4IpY 0 0 @3S 1R 0) 403001lP  02p 0040 [*Y Ig0 S P40Sr0 00   $ $  0`p`08哫*0S P   B ( P R0X0,( 0P$0 ,( f$0H0pp p0p@  !H0pp p0p/;㨀H0 H0ppf0 Sp HpP  H0p"W 0 0H0pH0pp H}p0pH@P0P p ppH0fp 0H e++0%(%++r +Dd.+t6H.+L%-O-`qMܿ=P`V@P U#*0T?SD00RP.0p0x809p R  `1`SH~2P`  d00 14Pd0 ,&@PP p'p* 0XHPt'wz/+!ho&FfO-pM M`;pj/ p P@@p p p0Wp10Z?:B0S ~ލ Ѝ00WU@P @Pxq(0IT*20Sa00 0Z0@17 0V98 Z RP _1Z. @ZPZ 0p V㧉 0Z 3P u_Z. pZeP g_Z. _KZZP \_ 0Z. _C|dedA/+0p@-M`0 0MPPi0@P\ MP Ѝp@8P  0 0P : zЍp0 S C/p@-@PXP`XV pp@bZpO--|MH DP@0/Pʬx|ЍBN`0P40  4Pd Y  H54MU U U;$X0@X\6X01X00SX\U@Դ0@ 0S0R0S<0 0P006 P40 p 0`00Xh*0SPX ?KXT4S00 P @4S00 P,4S0P P\0S\P @ 000000! @\00 P@@拟40(@`$@,@8@Y;*@0S (0T0[S,0Dt$0僄  c 0`hp| $0 @;`ps ` h4J0X0@kX00B~S0100,4PoH0S 0D SE p?L0?P0<0S- 竸z0相S5X ?W \00<X ?0W {{' G0X T00{W0T d80, 080$00$0L00,0( P0@0(0Bnr 001 00`gpT X?4 $;hWp G? !4 ;$pHp `0 00\0  {{'00p00{0h X$ʟ 0KW` 0EW 0 TI Y@D_f 3" Tɚ;^0SR,0T$0[ე0S(0僤'  pL` 0p``p $;hp $0@S"04$;pps Ep0h `X 0V `0 V$0P@S" 0V0 X80S,0rd$0kფ0S= q` 0 pp3 (0h`4p$;p' $0pS"04$; pp (= A$,9 A{ {'{`^/\00 P  J(' A$,# A{ {'$0XpS"Ǐ 0{qV(0 0 PhV 0 PaV  \00!Y@@-\ ho&A-@p4S`  #PT0DPEE$UX  WPV00WP V0-04 P $a3MDPE@D0+ p@-P@Q0 i 0 pWP@ R 0S Lk#Pp 8G00 0, 0p$]#%h_+< ,Ot,p,l,Z@-2400S (0 0 pp _+h_+b4+G-XM0MS0 DpW,Q`@`$$Q0  N+0AU<P 0 0 ۍЍ0 000nS ?S aS ppS qS x0  0 d00L0嫆0 8_+_+dh_+rn&z+pv&A-X`0S L00S 08P8@p0Pp00z+_+_+_+@-@L0@?2@00Sg&,0, 0S00_&_+l_+_+ ,5+C-RP`tM  4ş4@ !Q RP ğE R`S +U0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ LZ 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+E`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 E00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =tv&pv& , ,,,h_+PA-@@P@T - @P`p0Sd \0 @ FP ,04 0 0@A%h_+ ,t,A-@P@p0S0P0`x0 R ` R0T @ 0S 4 P@` l, d+_+%,OZP@-, 0 G ,P@-, 0 ; ,P@-, 0 / ,P@- , 0 0  ,h_+,P@- , 0 0  ,h_+(,<P@- q, 0 0 q ,h_+L,_p@-PAM C0@ 000 0S0! 9P7 0S40l=PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0 Q000S0&AލpP, H0 P @0  9P , , , ,O-1M MP+ p4 1ݍ ЍPX$9P @@4@@/ ,XP_ 40S d_P 4pPV / 3Ps垏0S30S 3Y30S7 0a@P0 |30 0l3 0# T30S0%Q03@OoB0B&Q 30S  2` 0dP0002`P0 0R " R `2 T" R E@P L2\"00<2 0H (20S%W 2@OoB0A% Qo10Sk 1pP0001p^, V 0PA0S0-g,`V 咟Q 10S 00S2 0@P- 0! 0 000| 00S% Q0@OoB0`@b%Qx00S  `0 0P00080` ,z+ 4+l_+<_+_+ , , ,_+_+ ,G-JMMPp 70@ 000 0S! M8P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1dfP* H1 @JލЍP @ ! 8PJYW#P0ʡ zW0S 屿@$00 R000S00 'l0P0<4qp P0ST00@ , , ,,h_+ , , 0 0 0 0Y , 0 0 0 0O ,C-KM MP* 2 Kލ ЍP"7P @`2`R@\2000/;RP 82 0S@(2Á- WP0 Qo` 0S 10S 1 1 2@P x-p1@d10S x4PT1 0pP 818!00,1 00S P- 0 0 0.>?0T p orG&t0h@Q00S x0p0OP0 00P0pH嶾 ,z+< ,,h_+ 4+_+l_++ , , ,_+_+A-PAM N) 0 $Pe`P0 0Gꌀp @G Ax @0 0\0@@H;@C0+|6PAލ0S 0 pP ,Xh_+ ,P0@/|P@- )0$ 00  0 ,h_+Pp@-o@P P `hP XP (pU ,0Q0  C0 py|h_+0@- 0_+ ,P@-( $0 00S/0唀 ,_+h_+0@- 00d+ ,Pp@-0o @PP0B 0S 0 j0S P (0 0pP@tMP<FP B4P(00 ,p ,|h_+_+0F_+ ,y0@- [ 0I_+ ,0@- Q 0VDd+ ,@-(@(0 F 00S 0 _+l , ,0@- 6 0y_+ ,P00P0SA- $(0 !0ЍPAaq0S000+0S 0S1000PPP00P ,?@97`0H 0QD084 ,_+d+h_+y|6+_+0@- 0_+ ,0@- 0_+ ,P00P0Sp@- '0 0pP`P@wP# r0P n30P xl00?o2`SP@8 8 <00S000 ,h_+y| d+d+*P00P0@-S j' 0 ЍP  4P 0vPd00}S`00S T0T(0HdP 40 0, 0( 0 ,DU_+h_+\,++0p@-PP0000J8@Ppp dop@P p@'1@0@ 0S 000~ ,Ld+h_++P00P0@-S & L0 ЍP 4 4P 0 P 0 ,,0@-M P& D1 Ѝ0P0! c4P @1@y*7P0 /@Pg*0@0 S 0 00S P |P `@l0 Q\00S  L0P 0gP000$0P ,z+ 4+,_+_+@-Pr& 0 ЍP 0S t 3P 0S0TxP0@rP ,0 $ 3P ,,G-pQ@p`HoobpNP>10S|1ЍG~T`pE8%& P1 Ѝ@j5V@ 0 001"T9pX /(`P 0S LPj05|0@0 H> `T A9NPppTT TV@T 7@P <P 0 ЍG; ,h_+ ,L[A- MP% 2 ЍPR0S"N3P 0 1CAMP 00|S 6P xP 0|M@p1l@C) XP#@HQo`010S 00CS 10S *) 0 0 S  2P0 T.>00R   ]tp!"Ql00S  \0 00P0040@ ,Lqz+ 4+<_+_+_+@-PPM M&%@p1@ۍ Ѝ(`6@PC@@T( &Ia@P@F/SP+R=00S p|00CS0 {U0000 ( 5 l0 0 (P(t@ ,}| d+h_+|_+00@-MP 0$ `1 Ѝ0P H!E200CS0,P@/0S0PPP P@aK ZPT0S0 @ʴ0@P @PKK DPU x0xO|T0S 0H @4K -P (0 1, ,h_+_+0p@-p@P0 p@K$\0\`0XPS 0S/0S0p@| $?00p ,++h_++0p@-`@P0 p@%$L`LP0S.0Sp@({ 00p ,+h_+AP00P0@-S $ 0 ЍP | 1P 0h PL00}SH00S <0<{00P 0 ,Ve_+h_+l,P00P0@-S # 0 ЍP  T1P 0l@PL00}SH00S <0 {0,P 0 ,V_+h_+,p@-MP`+ ;@T \P.+ ;0ES+ ;@ 0 ۍp,@-Ph# <0 ЍP $ 0P  ,@-PM# <0 ЍP $ 0P  , @-P2# p0 ЍP 0S L 0P 0S0,8  0P ,Pp@- # <0 p00@PP0 Pp ,_+&10@Sp@-" @0 p04@PP,0Pp  ,_+<Pp@-" @0 p04@PP,0 Pp ,_+LoQP@- " $0 00S@+ ,_+coQP@- " D0 <@0S k0S  ,_+@-0@-P000P0S z" L0 ЍP@ 4@P@$8I 1N ,hp@- M PZ" 1 ЍpP! /P 0"p`1` z0S@1D0 0S 1(P%P0 0S 0@T 0y%`D@P H d@ ]50@ R:0 @ 0@3/H0T 00S00% ,qh_+y5+ _++ ,0@- 0 , ,0@- 0@d+ ,PA-PPPPU㈀ !00P@lph0hPy00`0 @009T,0P A9 , ,h_+ , ,7@-PA 0P00my00 Ѝ0P!0P%0S0P 00>0@0S 0 S  @>@00+T90 S +<9 0 .P , ,h_+|_+l_+,, P@-00?o2 P C!0 0@ 0P 0P pP 0H@XR0 L< B S00Y&0 _+ ,y|_+h_+000 0@-S0 00 _+H_+ ,_+000 0@-S0 00 _+Z_+ ,`+p@-@Pp@0@- 0l , ,0@- 0y , ,PG-uR@`p]P\T- ,PPgT`( ,@P`_k$g$V; W P10S- D1D!@1B0S 0(`PKV1P1@W 00S 0 0B0S  +$ ($t0Pp0@PPl6P X1P H,P V Ѝ_+h_+|_+_+_+_+u @-s0 ,P@-< x0 pSP \00}ST00S H0Hx@CP 00 0( 0$ 0 ,_+h_+ 8,++P00P0Ss@- 0 Ѝp0` 0S P@P 0Q R   L 0Ѝp@w$Ѝp@ ,,h_+ ,=[vPp@- $0 p0@P0Pp ,_+A-P0 "0Ѝr0S2wP70S10S 1~w@a0 ` 70封S Cb"c! !    c#A P0U0C00CS0<\T P?00CS0@8K P7 (! -PS0=p00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S ,Xe+h_+_+dy+dy+di+n&!CP00P00@-SM  0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$U@00 ,h_+oP00P00@-SM 0 0Ѝ0P | s,P 0(qp L0@0P.O) 0,0S 0000 ,h_+xP@- $0 P ,|@- (0@P0 @h_+P00P0A-S쀟 00ЍP  ,P 0/`P PPP 0S0P=E@:E@@-p 6 D6 {6w00忿὿ ,UP00P0O-SM  A 0 ЍP  +P W @P@ 0S0@D`X-|0P 0p60hph`h@Р0000 0@0C p ,U , ,_+Pp@- 0 0p`@PP |@P P@)p @ @000 (0@ ,4d+8d+h_+A-p`P@Pd0 A\P 00-4 0 RU Ah_+_+@- PP   R Ѝ@P  HR  @0S00 Ѝ@`p ,*%h_+0A-p`P0 AoP@PLp @AmP ʾ00 c00 ,h_+3Pp@-O H0 p@00Sp@000u0$@$P0YPp ,,h_+D_+q0@Sp@-/ d0 p\00Sp@L0Lt0@@PP806Pp 1 ,,h_+v_+ @Rp@- l0 pd Rp@T0Tt H@P0P8  Pp  ,,h_+_+O-MMPPQ  3 ٍЍPʴ#EEf*P c@3pY 3  DP`@)L50p㓄( @0S (30@ @c0S000p`J2it2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )b40 +C`0S@iR0@S 0 F)b40C`P1t d1 0S x10SL1h`10S ,0t00CS0.  E k40 03/00S 0S 000CS0 S0  )tJ4z00000h0 tY 0pS7 ,dy+Xe+h_++tv&_+_+_+_+_+@-@P 700P 100P+00 -d0lM _T00S HD 0d P,00pp_+_+h_+7+-lM@P00S H@ 0d P(00pp _++h_+7+A-@P p0 0Cs0S13;B `=P@ 0 B RQ@  0 0Cs0S13p@-`@P:8P , 0S!PR x,p@l|,}*`~(P %8P00 0l,ቼS!0REY]Np@-@P w00PU A FPph00p@-`Pp@0P< 0.0Sp h0 S Ѝ00S 0C @pP2(d+`P/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Brtv&G-pP(P SR@i  =PP0   =PN0 0010S / 7Pe )`@7P 0PS $2` P):`7P P)P :7PP000S`UK ޑ0S 00S1 @RđR0 d3 T<P0 0 U g)d)a) 0 011 0Ѝ @P/) `I2 0S000@) 0S S St0 0S 0`S@.)H0PU %),P|d+_+{_+y - BR0 R  P R 9O-@M M tPE$@2<P0DHLP0(,$04D (0p0,0DHL` 0 0S 0S X 0S匒@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;^G@P d4P T/P D*P8` ([000S V PU@ /7GV@0S  1P @0U0C?o20S b4pWp 00C00p0Tp pW H1pPpUP 0S 10P00 $ 0R 0;00EE+ C1Z0<03 0 048s)3 x30S7tZ   (@+60P0 $3@@(:60P@ 0 @ (0`0 @h0 `0PPx P00@sPS 'P Y0@ 0'T00SPeU 0S} W +X0+X0+X0XP+ 00!0 4Pp80L YA+ P00E>0000JP1@@DcT@@/50P  00+L 00 08 04@ 0R 0S00}Sp0S @0S 0S@0P/FP0Y8<00 @Cz_+c_+d+_+,_+_+ ,ho&_+O-kMMP|dUZύLHD`\X1 !>0P`0C6xQ0 B?(p8 DA'XH&La\&PQ尡V?Ⱑ0E?oT20S`dQ 0S lPVV 0S#UU?0Sx劐|0s0s0s0s0S0s &X?0S0 /TEP&&?0S 00SU  0n 0 /x=0S !~ P' Uu8MD-6>O00(0SO !N('P$/>N0 0 (00 9Q 4t=0S2@=P R( (@@-0 Rg@l7?P@<0^ 00|SZ >\00S;0J\0!QK\ < < ^:k,/p;`0S00X  UL k ;/ 0S 00S 0P 0S} %_=o`аcpPp 0S :yD0PUL=Y :I9pPX ڷp0SU 0S_ d+0 00 P#P %3P  0ix!C_/0t1p1l10E?[/ p x10l1S 0S tAT# 0S iz>P d 8[V K l0ȍl00S 00S P p}_%tQ:Qύ[000D!, H!i8 P!0R PP000A880,10i/10P`P VBy08 ,@PP0S8 , XPU`P@Tv  p 0q_0pP7/EPX80S PPq/@|'- l-00S @Pq?/70S00?o 2h#P8P0 P60S P 1S$ P 1S$6vF V=P@3 )d-\60T6sP 00@T < AP 00@T  < AP 00PP ON`UEP< 'r(P<50S2P@T4dL! S&QQ L&R H&pSn `40 WE:e0 0- 4Dpul 1& U@05 4@T Q?10/N,0 @ L!&Vv40SlS`V 8 PY= 0 %0!%p0S0A%W%1p@00S`a\ST0EP@0S 30S 3 ,@@ %V P30S 3 ~@ %T ,BL%.&pa⳩ 20S $35l`tR0D0`0#@ D0DIP> 1pPP`@(PPi 奪0< R 1000@ q#@pP`萟(@b>0@h0|! D0P A@ pP `(@@0S Pp@(PP-ࠝZ  0h0rPc ߌh1Q00S 7+4_+ ,o&8+,T`+my_+Xe+dy++_+_+U (d+d+$d+%tv&\*gB1_+FT}|1 T 8d+: ,_+@B7+_+_+ah_+G ,_+ ,_+cP> PG 0*S0 kQ<0-S8 _QP00P0,0 /R( *R0 K0Q@(0000S!0 01S6gP 0, yd0?dyP 020SyP r"` P `P t2!m Pn000P }P P ` B"qoP<0S S WO D<0K/CR032 V 0S|"0 0 3W5V6ZD Z8 ,p#2Sm#<3Q0SQ?0@0!3 (SQV3 T`H0SH40A {u00P 00S0xsl4 r|00 P 00S& 50S004 ;j(0st4( @ 0QP `thj0S050o5|2S % R 5 P 5P P P EP! 55`0Əs 00@T@ @V  $P| ?0 0 m 2 @R ?0"0C?o2? >"0 "0A3c0 S ;S0 VL:P 0 R RT L0SD0S00?d'"0 40< R /$ $ T á @"͡<἗<P p"HRL á0 #PPW#Pp0S0S}H80SH#@P pЦXT(`000 R0PT0% 0 pww0XppX0 Xppp tm>tP #P U 0 |pWH90S @90SD90 PPP0p`5(p 5 P<$ P@+40S5V $ 0D  !,0XD S00H00S+(^% 0S 0 S     R  T!$PP$p 0 +@P$p 0tp9# ap{0tSS 00   |00Bލ Ѝ@H3@a 30S VW@@cA +2 0Z WW T 20S 5V  R x" R " R W WSh2h <202fW @2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F3(9+ < ,(d+`e+_+,d+h_+de+\e+&\ 0h0$<` ((0d $r 0( 3?$r / &<7R |3a0 R0S R3(0s0?008'pP30SC97S00000 I0S   0?pǞ 008'/PL2 0 00 00I# 0 %5 "p\ 087P<噞 97R] Sȁ 0S [Q0sN0010S ;70:70?70>7='<CL0S ,0< t1, )9P!1 R  < 0 !0ZP 0S 0097S|0 0S [[X  S\00000IR(9+_+_+Dd+H?+\d+_+h_+_+_+_+ d+_+ ,de+@;+$6l@?+<S@-2Bp`WLM LЍ@H HpP=  Ap7 0001r1 0S<0 ?!tq(e(00 Q 00SZ=9Q ='/?@#b!"/@p 50S 50#S 庝Pq00+0(60 8pp g50S c50#S  pp 90S0 00 0 0LЍ_+_+(d+Mbc(9+0A-H`D0 82Vp  R`RBR RB`2b  Q  ,T 00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPx40S4Ov^m 3 3K g^ Ѝp30SCP RPHd& \3 4LS P@04000 3 )bQ nP@$R000 0R0 0?|PP  HP L@P  0 2$@a.2P0 S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S 0 0S PU P 0S 0S T01SQl $0  ,p,,,l,_+h_+ ,(9+Ĉ ,<:+L Ol_+0 00S,  P 4 440S!@@\4@@0Sh4@s `TP@40S 4040 4 (h 41S $ R 4P 3P P P CcD0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c 48 pcU|,00@ 100 0E400@ 180030CS,0"p,040q402P001!P X#<0S <0,3/0,0@4Q4@m1 R0P00 SBT1#"0 ? 0!$$P400@0 0 0 48 p 400@0 0 0 o$P0 fw0#a@#D ,0S <0,3/4_+_+ , ,_+_+l_+h_+p,l,4<:+;0SV 080< @ t+ RD00S0X H0rPLKNH<41<S$$2+P $00|S $]P/$0@/0SR /0 SN $ ): 01RS 41S $00-S0S |: xºd:$ d强D0S $ GߍQ0S : <0s^@0s_JPA0080SY00S]9 9 h9T00$0S  T$ T/00Ph90S /0 S$P$v/0 S$\P$ 90SD8Q0SPPP?D0S!0S' Z+80S F(P  8d(880sS3<8  08Pw00S  -PlGfS000S||P 7 H7 R0WAT41SWn$8*P_x74!(07 6 (0p(0p 0: S 0&0&071S ' R 6P 16P P P F60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p(x$Q*$ޖ$00|S =@$g6((0S$ @54! 85 580$ 厹((0S5$巖_00\%p00(0q(0P5P001!SPLd.0 SE480S 80(3/0(000L0S04 SDQ  40S 8 4R qp~ `%'0$`x03pr3X@$Ps  0f VP$PD0S s0 0 @ 0(@mP`\ T0(0 00`PP sZ,pJ P @`@#0 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ -400-0 SE1(00@N -,00(00@T!000t 04Mp@ TL0Da0L0 TUA @(, cp%P1 O1#JX婕@PbL Zf*X00S 0=<@ (0S 80(3/0_+ ,_+ ,_+_+l_+@d+<:+#/+"+ 0"%+?;#;0@#5;DE "0@S(PY $2@V0TQ@2QML"0 P EP A   Ak{H{7{jI"dⷳZ` f 0"寳`< < 4Lfp 0#៳0 @0S  P0S S dh#勳@p#d0 S30ppKߍ%U[0DEX@-)T0@ R0 @00S 40 0,ppҬp)@_+_+h_+ -$M?0 0 ᅭ$Ѝ0-4M 00 0006)P4ЍO--pMM(E|U " p4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S 0sX0S (P 40ǜ,40S` $1` $S 06 { A0( A{{zdWdp0f0#IJ3`3Q-AP "AQڗ`3`#sA0 f2 ⥲` 0 ß R#3SPS0r 1D0000fm/⊲0`  $P(0 0SZP=9 =:k{@2 AP09? A { Q 5 P;!%#3[QP qD d 0@ f0 !I1`P0Ft1p Rf P 1*|!3^2?^01!(0T!P0'H1 000ss0S"%+0!gU6 `0Sf `|0 0pp`MߍY@.A ,_+(d+_+ ,@ N  ,P  ,S  ,Q Y n  h_+Td+{   ,@~   !P P0  A A k{I{7{Z`0U~0P  嬱p5P<<`-g0  嘱`  咱@-'@V'@p@-Bd00` pd00CS00Qp ,P P00 @R0S"P7d`Qd00CS0*;p "P \Pd00CS0.p000S8A PA p0 0 `VJsp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 S"Pp@ ,% ! ,A-pp@`̜P@ .PPP œ@P PE uP@OoB@ ,O- U0mMS pDPd &0S mߍ0P.0͵14PPd(0P/S SUpE P\4PPP P,$0CS0 p, P P P0 PsdJ!P P !P d0ppvP 0? hqrdordp P 0Sd0ppWP0? Rrp P 0S0S di0 P P d00CS0p`2`P P Q82<0 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 p P`, ^0#S^0C0 hqP\\ `+  ,  dy+,    G h_+x   tv&di+dy+ l_+Xe+@-0 @0SEP  P  0 00@ x0 l-P T0 L$P 00 ,P 0 tv&qv,{00CS0 Sp0 S0 p/1A-0aS0P0>P3U  P 00.S Pl`1h \HT1P@  D(P00T,!,!,0 $1$ BU 0!0@p000 00000P0 0p0S000P0T h0h0 @U t0P$0`O d+_+he+de+h_+l_+,,p,t,,`+ Ep@-@P (0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p\e+_+,,+d+_+_+`+l_+Xe+ H0@- 800S ,0 0$ppҧٿ_+_+h_+JTd+A-@h$Qp0S `0S pp00`P0000 0S p`0S pp000080xT  ($p_+\e+_+ ,LO-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ -B>4P/S + +  P rpVp刑0儁00g00000000 0S P1o@19 k70@ R 100CcSppW00 0S 0of000 000妮 k$RVo@oPPT{ P00z+_+ ,_+ d+jlz_+ ,_+l_+f ,de+A-Q0qS0`00@S Q`Ѝ0NYP P %o0 R 0000@ Pl00}S0s00T 0S$@,M d+_+,h_+de+tv& ,O-a0AS04M00qSP Q 1M4ЍPH >P0.0t8P00`P$ PHP@1(,!ҭ2 (A 1 0  ? ȭ@, !P 0 庭@ AP 0$0cqp00P0}S0s00U 0S(@<gM I d+_+, ,h_+ he+()de+{@-,@02$ №PR,A-`Pdp @P  @P 9@@-@P+ 0A- 0p0@S0`P0LP㬀" P 0S 0"S x0S R00`P"S0"S0 00+ d+_+ ,4+de+0@-M M P F  /@:Pۍ Ѝ0Ph24/S @ P;0@TP/P8:O-@pP`V1@@P`3:p`Ek0P԰0Y/  0sT@1PSZ 0 10S 0mL0 R KT0S*00 0>0 Ѝ ,h_+@-!L0@0 <ppxpP0 0SP0 0u!@Ѝh_+ht@ ,P  R @-= Rx000 0R/`0000/0S < S0C00S/ S/0C_+_+`_+_+@-0 000 ◊0S R 0Sd0000S b0Cs R@ S0 Ѝ tv&pv&e7@-@P0S 0t 0p0ᴥp\;X@0S 00@ 0,夥p( Ѝ0@) Ѝ04d+8d+C-@\ᄐpA`\P ^T1:00"\ \ L|9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!_+,+++/A-p`P @kP0  T  `00T  _0@ R   `FVp`00CS0 XS PpTD000`000 T00n&G-̀P`.@0崠T3Jp Y 00@)ax0@P 0HD00< P 0 Ѝ診+?h_+n&_+_+O-M M@ P" 0<`0  <3P`\ ,"P # \_   [ 30S) P Q PUP 廣p 0@00002F."P |"|F6 F@l1ލ Ѝ {pp08\ ! np \020(PS @ ᖣ(0, 0/(0, WpQ0$S,F␡0I00S y0h$Q000SZ=9Q =*/?@#b!"/E p50S 0#S [0AS  \0 0 PE0 P0-p 0S s0p 0 psP0\ {A|P_<00;Hd+=P(d+Mbp@-@P<p@ǡp@-@`00CS0pP0 @ 40S0`00,0#S V &00p0 PA-p@`pP0 @ 0S0`000#S V 00A-@XP`p)P  $P0S !@-@P @-ofP'@-@fp PP@-Pq0A-PhMQ@00 00 T  40S P 00 P 0 0 0 PtCcXY 3c0S 6@3@@p  x tP phP@ 0S @P@    R P@ T0S @P@p 0SIH!i0 S9 ,0P 00YP12 qCA 1 PP `00 @T   P Q0 0@T  P BhЍTܧ[8P@ T 11@T 0P 0`VPP)&000V0 0 0P@T{Q DPd+Pd+h_+_+ n& ,)+l_+_+dy+Xe+16+_+_+++7@-Pj 1 Ѝ0Q0S 1 1dP !0 CRxA R Sh10R P1P 0S4S,1 0P 0S 10S 0 0-@@P m0 @0@e0 @_0 $@Y0 )@S 0 00S 0S ,_+,<h_+g_+_+d+j_+_+t,p,l,(,$,,,L,H,,,_+00S%@-@0M,  0P0S8g @0Ѝ0@_+-A-/@-L<,80!R/P$0<1s0S/10/,&j@-3CM000030S3@TCߍ| phP D038#1S0!$R< 03/3CPQ@RTA 00@S@b+BbaPP❣:P @00S 00,S 00S0 @10 3/P00000S0S 11 03/0S+000`0 P0 0 SWy000 6PB0h P00 Sj@^0000S 00,S 00 S00S 0 ` 103/P D40000 C ,000@p` dP*(,,, ,}&,,%,j,,,0-,@-( 0 x |,@- 0,,P `00CS`0p S00 P0S X0X /Xn&C-Pp@  l1s0S `l| ԛv0S b 0嚢`V   Ѝ,&|,,@-1 p( P@ P 1ЍX0/LAP 00B,B(.&ho&36B0s@-@ U1`s0S P0S  F HB@0 [0nS %Ѝp`,&Mh,Op,Q@-PMP TN P H00S@0\A PЍ @#Ph1c ,&i}@-@802T S1 㖟x,D0@-|AT 0S L 0 &,@07@-LAP/c0P00 M Ѝ0& @-@0S S S 0 \R0 R \ @ RC-P@ M?  ? p ?p` @〡QT@D0 @ЍC0s0 ,p@T*Qs00!L%.G-AMMP`PxB  d2d `2 aT2 Pz 0 04Ry 0 0 m 0R  0 S!Rs`$Pp@D✡0S1  K1 0S00SR&@@T  T @h0<1<1s0S ~ P0\! 1 24AލЍmP0 SS  S00<1s0S Ϡp 0圠0CZ יZ <'0 0 @,,`,p,,,4,, &$,h,0@-EM,P šP@P0Eߍ0 ,PU ٙ י řҙ x0 <  TP劚弙 / &O-``3MP@ pHHhD`4#,(3 $xUPE >~Pb00CS0%p00 R0SdP1s0S6 P#hP2x2l1s0S  Gꟈ10 PpP1 Ps0S  P pC PXS,1s0S 7 P 0 S 1s0S <1s0S l1s0S 0x0`1  P1- R @0/ U 11s0S WpG'}P`<1s0S0 廘 ЍS R   RjVP0 Uq 0QDD`,,` 4,p,,&,|,,+h,$,?p@-BM,\@P3L1 Dy$!<1 刘oPP.`0<1s0S F} P00 T Bߍp .}@`⧰UPp0>ifJ<Ĝ`,4,p,,&hh,$,,Vp@-BM5,h<@P3X1 PA>0!(1 $PPO.`1<1s0S | P0B0  Bߍp |@`=UP|@ԘјB<⭞W`,4,p,,&hh,$,,V0@-@hP4MT}P 0P,,<<0  e a4Ѝ0,r$,0@-@DP4M0\ 0P88 0I4Ѝ0,r@-M, ,PF A P 0 001 c1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍u&`,|r~|,@-(@ $嵘$ @官,{t zt @-@.T1@!p@-@PPptP p0@-AAM M^PAލ Ѝ0PEPa{b/0 hPPh1LA`1T@  R00$!0<iu {+ϖ@ U 0S S 000  >Ty{   T xd(l  10D0 S B/o" R  0C&,ho&,@-MP Ppmp p刖l@PL\܍@I, H}P ȗ܍,0 < ,,&p@-P McP'@e?o2P0S ۍp@,P55-` `HPPPۍp@ D` 5壜  ۍp,,1p@-pP!P h(@PpT[⩝P]8p@0P L}l1s0Sp0p@b),&,p@-P MP+P/o"P R0 ۍp@",Sp`t@P\ۍp@讜P l! r R< < 5B ,=ۍp,X,_DF&w@-  =:ho&O-P4M$`4~`=@PȔtȴ`0 `4$$lp0Z$ dQ Y  Q|x$0l E P0\$\40X4L@4( 0$!PS pP ؏U Ut @DOo0B#10<13 B0lS010S P   Rpp< ᷙtS`S FS4 9S/S0Su(#a0CS00 yES2[ PlPS2P Pu  PZ x PP[ W|2 @| P[  d PW  @PD D(2!00=2 1 0 060S1/ P* T*%,00!0 0 㐡20,P  D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/iPk0SPP54Ѝ,,$,,<%xh&0,,(,,< ,o&!&|,ho&Y-% 8U].@-Y ,@-@M h_ \0P0 0D0@10S O 10S0S@ЍP  00S'0@Px 0 00S/0S "00P0P@0 S090 ,p|4 ,0,,,} t A-U`V7P@f@Pt.p_0Ph% /Q4 u LwpP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,qP004@Ѝ0400/S@~P w w w P\H[@ 0SIxQt0S xp=0#xp;#s00S: u`P`|` R  V \3Q 30S t: huPX3c0S 2Q P o2: @uP 2 : uP 2l!: xuP 2 : puP 2 : huP t2!: `uP T2h,!: XuP 42L<r> 04Ѝ0,&@-`0S@ ӐPq 0S 0000q20\ @u, , s@-0Pl00@0p`h R R  l R  T8北03/@ЍpQ P&d%,A-$q`AQT 0SP yၵ@PP0000F0P ?P0 8P0 t1P  dd\0H@H  "  \ &,2 7 ; @ D I ho&%,,0@-1s0S 0P FŔ&,(0@- #@0 ;p,,h,p@-`BM P0@0 S0`01s0ST01y0 嬗0Pn00x0 BߍpB/ BR 000P y0001h,&>!,p, 0?o2 0/&H-AM M  ,r,  00000P0000@0 яPڶ0 đ ďP0SS WS BS 0 +崏P  Vdq) 0S 10 S0Y` q1s0S ؠ0S Q  u   |P Y 0@^S00CS00 S00 P0SS`,tD ,,,&,p@-PH@P@pP P P @& 0/@-鶏o/A-@PP p 00CS0 `V PPP0 P00XA;% 0S P0000 !0S0R 00 P!@!_!A-A`P0E!S qp"0!0P0CPSJ0 `00CS`0p S X0 X 0P"SP, 㼖0SP`0P0CS`0p SX0 X ! |X!㡖t0 0P0 P000P lP`0"S0T0A$8U0 0P0 p,n&H!o&l!o!s!{!@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 }!A-x@P0 =`P`PP2 00pPF 0P *V @P  @0S@0Sؼ<$00@PP?P PPP P 0!SP媔!,{!&!!p@-@MPP\1 5 S@P`u00u0ۍp0 @P 0@ 0000S Ty   P00 f ($VP&!! ,!p@-`@;PP 0 *Up$8Pc@p!7@-@P PZ  R ގ ڎ@T|) Ѝ0(R( dQ0PP O<P K(P ,?#f@xt yt C#,0@-@M@G 0(@,0 0 @P ; Ѝ00,x0 PPPQP0S ! p00@SPQ ,&,@-ʓ (,f#,@-@ j d|mP | 庌0P3P x塓t埓h F X姌{ 9ՌЍ,xt yt ####f@#p@-0M`5PPS 1<1s0S |rxAx} 0 9 0D{ <p4S,Q( h,0F R ] Y<P 81P` {0(0S r=R0 00FS0 x'h%P0Ѝp\XTP D&#,o&####,$9#$ $$$($5$@-0 @7,#-@-Ps㝐-@-Hs0 R   ЍЍ/,-@-T0 R   ЍЍ/,A-ARp`P@1T ԋpP7`@DO-dM@Pmz0P 0Xfz0P0 0 880 0(P400Pp`,@@0,@ T R3 U&T  (y0 (d(0宋p ` Z0 000_o 0,@ @,@0RT ZPPU  w 4 JR  (0 R 0S0cM| K| 0S dЍU 3 ` 0@D(0,@D00(0 RR 0;0@D(0,@(0 R0@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80!(6)PP () R  8 %Q  R P`(0cplh`8@Ht  D  $P $0`000S(/( 08 40TU (0 Q@D0T,@(0UT(0 Qt0(00@DS,@Tw$$$T$$$,$%!%'%c$=%O%a%w%%%%%%!&O-lM($x`xPVpp78@ 00Roυ p  0<0`2 @@000p 00_A@P r.@P CpP@0S($+P @ zz [lЍH<`@40S( ( Pl  , SCp, 0P¯4 0<P$0<P<  B,$( p( ,0RQ @(S<`@ 0@P%<0%8s00%4s00u0 0'<0'8s00'4s0P 0w0/ $P@w$@&S&Y&^&m&&C-阑p0MS@0P x`0` 00qp@  ?sp$k@`0 P V00: pppppW0@ @ ]@Op`6t0` }>?@h@ Ǐ00 S @.  C8 ƐЍC0@&&&&&o&A-MpᴊP`ЍA z0@: SPPT@w`P00S 0 00iQTP1 p P PU0DsLS<(    &', ''$'O-0]M-SP MPP50S ]ލ ЍOv/f]ލ Ѝ@p )P$ 00S0W0S H0S` DwpP : 6@pt0* R\ D RP ᠈PP,su ᬈ`P ᤈd0v: S+ p< 3 P@`*P|3x  KgP pd ` 0 0LF0 00 0S0S`- LP``Zv `0S 0 @BP |V :P `z{ R j8MRK pP Z }P w!1Z[  0 H.EYp`l: 0S'HQv00 0l!G P: b W 0S- χpP  弾W ]ލ ЍOxP-B· 0SɇpP P : R S00 R0S ជPPdST},@&'D'S'e's''$' ''''(8(r(w(n&((0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@ `P 3FP00S D00S  40 -F!NNgXᮋ,([,\,,D&@-tH)@-vPp@-P^@cwp 000/0,p@-@P0-S@@p kGP0Tpp0p@-0@S`@MP0@ [ P@ЍpPU P *m0P0p&0, **@-@P @U#00S@ 0,p@-@PPp00Spp@ 0,A- `pP@P000 PP0 00*3*@-@P P0P00S@ 0,p@-``MPU= 0S: IP1 @@?T.   `00@ C m@ F00 *S ?0`? XP10EE>P F`Ѝp4* 0@-p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@`,,i,@-P X00S S 9(,0 @ T `,,p0@-@TI0 zqp0@ @}01p`,,i,p0@-^ 9 @ 0@&)60 P@ ^@T`,,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/`,,P0001S0 0/|&7@-P R I0 0#0 Ѝ00R 0@!"0@@Qqp Ѝ0@>?`,,,0@- 00Aqp Ѝ80098<@ q|/ 00\ /`,,A-p`s PP"@9  @0@  P09   N 09 r`A$,`,,@@A-p`VY@  @ @ 0 gnP0 0y0 }T 0 0Rn0@A `,,$,0P /`,,\ -P0S0@  / P2:1S0BS /C-@,QM@`@|0S1U?:ЍbS7 .S6 00C S 0  ?NP k>cS@U:`>0@0CS000000C/  0?NP @@@l,,l-,,,p@-@P 0S`PpPQ P@dPQVL">P0S  p P&&,A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SUP@u0C?o2l,,@-XMnL@DM@M<M8MTr,3,!4!!!8!!P>P >P>P hP [,,p-,|-,-,-,l,,,N---&-,---,-.-Z-a-j-tv&o-u-{-- 0p/l,, @-p 01SP0l  Q``kXR @ !P04 (Ձ0T! Wl,,---,- 0S 0S 0S 0S P//////@-@0S PPPT0`1s0T 0 QS0@T0 R /!0 R0S //@- 1@P 0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0,<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@l,,0p@-P@P QT4@pTT@DQ0`VD@S@ T0CQ @7@l,,@-\@PHP8P,00S@-,-,&[,&@-\@PHP8P,00S@-,-,&[,& Q p0/l,,P7@-6j Ѝ0P@VP @ $QP r0ll G0`T! _PP <0X!$0T(0 0P--,-l,,@-@MP@G-,&00PbAA0CPQ//DA-RPp `@W@X@Ѝ`NP@h@P, PP@@.,A-P ` @Pt0 pP \ L@P  A8 $@'jT b2g2w22v2p@-Pl@P TPpDPpp@ U p@Pp222O-MMp 0@P! InzP0: SP `iV   AP  @PP1 ލЍ R R R00 P P @I P @P PP 0"SU T 0S0C0 7/  HAP 0mS 22&22&2P 6,s@-P@` 90 00 BЍpp@-@P` R p0S  `@2@-P`( @p0` G Ѝ.,@-`@ (8R808Ѝ 8 0 CS  8 0C 8.,6,p@-PQ@`1 0S S 0U P 0U VpP0S d $0Sp@ p@ p@Rp&222 $0 (((( 80( /.,& 0( (( 0( /.,&C-@;㼀`p0S Ѝ @P0S 0S 0 ( ((087P 0 "PP 0l-,.,7@-D@P@@00S Ѝ0 NP.,@-PP@X9F`8 R8 R8S Ѝ 0p 8 0S08z7 80 8 00S08l7.,,0@-@M0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS 0`.,,@-P@`8000 00C?UR 0 R00C8HiЍp l 0P 0e0S 00.,,s@-@8 R 0S0` (0 RP 08 80 8680S Ѝp0CR80S 20S608.,,p@-p@XU P8PE`V` D0(  p8Soppp.,&080S/@-@.,p@-D@0S PX. 8P 0( pp.,&p@-|P`@l0 R(0p0CR0R: $0( mp00.,&7@-@@P@P Ѝ0 AP 0P$ /.,0S/0G-0PS`p@U @0 pP0@@@ X P00gf @ P00`[,P R/,@-4@$P(0,0P  $8 .,&O-6F0p`SMPp(h- (R008(h8! 0S0S Ѝ0S08R00(h0PZ08U0x88S08"PPWP $(ĕ?o02Q0 P`Pڈ%0@S0 eP 048PЍO0480480488080 Szx0488S0S S 8S0S S 048804880S W048|048ЍO048ЍO048n0488S 0S S8Sb0S S_ig8SY0S SU048~Q04880 S80 SGrp80?08<0$48X5(pPWxpG(p V(PX  PP GeH80S 48PS8P e088( 0Xl28Q V 0\48 #Df  00 Q XPP@30S \0S 0S4x3.P 6P d3Pw0S CP T3Pgܢ0S(80S- 08E0SeVYP0SeVi0SM /Sr *S1 S S(P%UJU!$"0ES00 "6;P f0Z 0S :'0 c!707S iS U U[00E.U S``dP eP PP0S`>0S P0 HP zP >P 00`P iV\0iS 0 %* 0SZP0@T_U0 ,0S U U =U Y\ PP6,P,,i,,[,7,40346,3644,4H[,&x&>V35[,X[,[,5$[, 5[,[,&-575E4M5h5,55546455[,55$,K44566, 6 &M4(67,[,,X8,[,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,YP& 0e`0,0^0@0S 0! P,P 0S_-P *a0ES000 *P *0 /E: 0*U @U !U<30S 97R0 <430S07S ;07S 00#p#u.10@S0 @007S9  P 0S S30S PP d0Sv7 40S] 3#0CSPwd ;P $0FcS00 0 e`!0 S $0!R0)?040S  /0 S 4%0!R0)?0 ^!R00 !ı50S!R0 !R0 0!ı{ x 5r 6!R00 !ıf(60S!R0!R0 0!ıT !R0s)?0H60S 60S >`@0 S 0/70S y0 S 0  6!(gR00 !00E 0R eSd0C0<0S d 0!0<0<pP0hiP0b`Q 0!(8 S^Pf3IcG\80S0Se=H @ \8 D 8 H 8 pP- Q,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ır ` `<0P 0P0 0!ıP *P m P !R0p;p; 0 >P }0P0 0!ıPs !R0;; 0i0P0 0!ı=`P \ PPXC=qpT 4< XP0P0 0!ı=`Pl A0P0 0!ıP 5 3?1<`P4)P #!0`0,`LPB(P 00,00  <=0=0S:P V_@H- 1 0 q)PP U U ?V]!P0> ^PP U U o!@0 NPP U U G!8>0S %L:PP U U.P$!0P.% (P0 0S .00S>0գ?00 ϠR0  B  ? 0 S /00S0?0գ?0/0 H 00 `? p?x?0S080k>00S/l-,@-@0 S!0O-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0D80  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 l  80 \P o] [0J0Cl-,O-pZX& RP f`P|` P [ ``F 0R@ 0R U *0@S0S  Pp56p@-`R P@ Z0P @@@ 0ppM-@p M@p00PCu RT0Ѝ` `?<P ?0 `P?p<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 \[,P,7,p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#b 0 DPp@{T ^gP 0S0^  PA0dP fP pip\[,P,7,@- @ @6, @-p@u+6,76 @-p@h+6,W62G-pWjPP{P0`%jpЍY@P 0pRqpZ i j?SZ Z0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*p,6,|6p@-p@`PP ;O,;0XV@` `:D Op *p6,|6 0 6, 0 6,7@-dP@ PP 0S  P Ѝ06,Po/@- * Ѝ6A-`QpP P P@P%U0P 0 P l @YT @P 6/PY666@-~|0p pl 0hP X 0D H 08 P0 0@$&&6\ 6 7(7;7C-P1M0SL @10SH 410SF Pp` Ji0@?oPU20S@ _P[e@YXЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P jPE%U@@\,X,`,G-@`M0PSS00/ @ R S"\R" :R R DZ Pp P 0H3/0S@00ЍL7P/@-mp J' q)XЍ00S @  d`)\0PT T F' 8Nqp d7k7[,n777O-@2`vP,PPPpᔠ唰0SWpV  S P0Fp@ U0 PPUP@ RpP SpP& &p@-@QP 0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`< PPp@pWp@/ 0@-M * srp@  , PP  000Ѝ0$,6,400S/@-$@P P@[,$,@-@P  $,P/ @-p@&&0@-M@%6gPHg00S@(aP DP OP AP dP oPi|0t00SЍ0  g0LP 00Uqpg00@?(,78X&a8O-8M0S 0S p0@S T z P 4X ЍQ @o Pp 00s pPPP`dnP\$ hP  pPPP(d[0S P``40SWPTYPQ ((@'#PP3`00F:P0`0 2P0`0 *P X ' CW0 defPy% 20SP `DP  @' YP \fY |2 p` P2 O@2p<20WF,b(2P 0S P (fgP11P %0S (y. 1X P P Ph1 VP10S V 410 (0 qp 000Sp 0 (P = 0 R  [ R 0X 0P: p X ,$, ,v8t88[,86,k7,(,],[,,,8,,X8,8&@[,i,&8P@- 0@$,00@-=P &@6,88A-P`XpVVPU@JTWgP0i, 0 $,@-yP@ @0 $, 0 $, 0 $,p@-P@@P Pp@2pp@-@`P%PpVU p@ Pp PpA-@Q`Pp [UUUG-@@` PР @PUЍppPU7BP U8p0ShЍG$,@-T0@0S @y$,0 R/%R %R0 sR0/p@-(PPp@P@p7,G9G-`dJd@p00CS0᭛Pu U   0DIS  1T.Up@P0 P00@-@,P*G9A-@y0 0pR`@0S00 R0R@@0Y`P0S U  P@00& &O-Mp@G`@ P!Q[ Z@/P[@P) 00p00 0MjЍPP P K PT VPAP  TP00pWp& &9A-@MphPPPЍAʁ@@@s`H0 HPjkT H᳁@eTЍ999A-PPЍ0S `p@@@SPP D 0 ` BiW hcP8Twc9@-@@ 9A-p@`P@0S P@0S0# CV* UR@ R %S0P f@# CV* WR   R %S8 P0WSJ@ ,$,C-EMPPEߍ@ 0@Mqp `,bPڬ嬐P ` P:T0S EP @  k0pS`P  @P@l-,[,C-MjX1@0SGp0@QSP? HcP ppp``s0000 0p0 0hgS+0`@0PU H`USV Pᲁ0SISЍ H@S@,9 &&90A-0S@`@+P0L h@ p`PS@SS,9@-@@P ,P o999@-M@P QPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` `P TP <2#@ ЍP PP  0 @h R P RU @T ` vv`aP @T@P@T 000d0@P<`.@0SxR|[,,:9 :90A-`V8@P'pP0 PЍA"wPt`@@@@F0 `g@R>R@9RT ЍA藀Ѝ,O:Y:-M bP  @oЍ0@-@P0MSP z@QQ bPI @Ѝ0@T@0: S [*@`Q[,&&@-M@bP͡0 00XЍ0@-M0P@ QbPh0 R\P0 R\ tu p0St00Ѝ0$,6,6,/9@-@P P0@/R@-@ (0@0TU#@8[,@-40 R\00S@2@#7,[,h00S /pp@-qp -#qpP@ QPppd,,@-P#P3#0 R/  7,O-q$M0S@P`0S\0SO@yP`@@100CS zDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000] 0 0000000P0 000`0HP$Ѝ8[,4[,,P,',X8,O-M<`p@P8@V |30Sp30`So`V L3``F`V`utV-,0S 300CS QP ""cf"QP "z"0S6 U`+20"`Px0X 0SJY/Y @ P\"VD"0 <0 ut (20S2"0 000 V0 0 10S*P10S f*qp@PZ v"Pq"P<1Aj"P  !qp 410S ?"P ЍO0G0 0 ЍO!V utS 00St00!20 0Q*)@P7ut`bP,[,[,[,D&,7,Z,[,x&:8[,d,,[,7,H00S <0P/000S $0@///7,[,[,P,'G-(pP@,`oP"V 410S(1`V``ut 10S100T T0 00!*`*00oᨂY Jk)qp00S@P W ЍGi!Vd V %P,8[,[,7,[,O-M`[P P @/P! ЍO"!qp@PV00SЍO0Ak!P0 00@WЍq!pP@PT p 0Z qp0 @Pd,,P,i,A-p` qpP@VЍAu   0@2Ѝp@-@4P0SPpPqp @P,0P  P/H&0P  P/H&@-P@p@-@PptP0S 0 0HS @ 00C0NNp@N  B 0$,H& 7,0/ 7,G-`@ qPU  uP9 Y* NNU&8~@{0 "0XPP00040000 (@0@000S < 0P00DP   0H& 7,P/P // / /00//000////0/0/p@-@4PPP %N4Pp4/O-M cDO {rPX  0 (<P  0'XQXQ> 00  0 'P*Ѝ=ЍO <O-P@4M(0X0 ,0ut@5 P4Ѝ40ST400 ?Q?(~'@PPp,d00 0sp P6zX  ` ܳV0+4 jp` P P@Pᜣv V{! `FV@P,0S0 \3Z0 A'D30pW0= 0$} `P" R $0 S S`) P P  `VʏZ:~P `@T_A[ x20S  P0 O (0 S  $PQ20S 0 @ 1 R00 SA@ P Pd p 4ЍO V  P0 0PA R TA0  Pp``@P41`!Z 0 0@P_ V V@P P P P P@Put 0 0@P_}l00S V V0 0 0S t@P`0 [,7,d,,i,X8,[,[,[,[,[,7@-P@P ,0 R  000 Ѝ0X8,O-`Pg `2P\0=Z* !Z' <Z 0J^S0͕ 0͕ 0$]v>Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = Z* P+Rz( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP MP P 0Su p0P v&$7,)&vn&vvvvvv{vvtvYw$0 RP  /@7,0 14/@7,0 Q/P/@&@-04 ,    00',',',',G-P㌐剀E@EPT`ppP FT F  !  F F @`匀@7,A-8p@0PS` 0P0aP @7,@-@$ 0 @z@7,P 0 R   /D[,p00S/p@-`@mPPPpP 0S8@pPp  [,@7,zz@-@@ZP008SPl0 0m  i;D0&<&8&4&0&00z@7,zz{7,7,7,8, 8,P/0/@7,0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00@7,7,7,7,8, 8,C-餁P0@SpM`$p`xx!0 0 0S]0@ 0 / X@P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP[,[,<[,P[,@7,h&`&L[,,0P$0 00S000/[,L[,[,P[,p@-H@P0S0000p01S 03&P@7,7,Pp@-`0 p@X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP l-,@7,',',',',O-`CM00dwvP1S0& 1S8 y 0A# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S u 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[90 `0S$ Uz% 0R 0Q0tP 0C001萄 S vI  0@7,<[,P8,[,,7,d[,A-p00PS` HP ` P }80@0@D@ 0@0TЍ[,@7,,p@-P@ 0p@2A-`p@@PGE$1S 0P $@@\8,7@-8PPU p Ѝ0@@ @ Ѝ0[,0 (! ,!/@7,0(! ,! /@7,P 0@-屿P/@7,P @-@P$0堿P/@7,P @-0000/0@-S@ Q+ 0S \Q@AOoB@0Sp IQ S Q0 0I0S0000Pzp@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010vS00# pP0Cv0q# 0dc F# F#)w 1R P@#1 PR0(d0 d0 0  0U*P0C0#0B001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0cP 0S0C 0Y` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh jPd  0 ЍG(_V` P V10S t! RS 0  m_PP %P P0 PPPP0  B01S0R4AB>v@D pP@DT0CR0S*A8A@DvP  0 )0S pA[,@7,7,7,7,7,X7,[,[,l-,[,@&&{t8,AA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S a00S$1R0$aʈjPt` F F)00x$<0s0$10P0 0S $@7, [,[,:,l-,\8,@-(@0S =Z00@7,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Ո0 0C0S Y10S0 0S L G5 EhY 0 0R  5x00S U d00SX00S D00SX    @7,,h[,d[,<[,',',[,<-0 R!  ^ !0@7,04/@7,0 R 00S P@0~0/0P 0/\!4 0 / B  0/@7,[, 0 /@7,qp/G-p`@P[pP 儐u U 0 > 0W 00V@00CSaP -P 0P8@P@7,i,PG-P0P`oPpЀ@ 0@D P  V 000U00C0C0y Tʌ%P 0 BJ 0 Q@ @D 0@DSB@7,i,G-p`P@0@@0W  S #R0C00C0Ѝ PP   ? 0 ppGA-0PP@q1`EP q 0P 10@7,G-1@l`Pp0XXqp00 R00STDP0pT@,P,@7,p@-@ppP P0S0?p SP@&@-p 0@&80P/ R/0 0S 0 /:,00 0S/$0$ R :,[,({7,A-X@ 0S0dS 0p(0,`P` p U` 0:,@{X0QH0H 0.4 00/ 0 0:,:,J,A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0:,qpO-PP10SPU @PP0⼡p`@` V  RXWA 0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@PPAp ` W0 0K0  0`qp @TP[,:,i,P0G-`p|PU0  SXW@ U W0S P)^P @P P`@V0 0 0 0@00qp0SP`4Ph`@W 00 0@00qp0SP`V@:,i,G-`P@\pတtu00V00S 0SP@`P@tu TUPP,G-@Pk0p`Ptt80@ p 00 0`Pqp080Y{:,i,800S/,00/PP//0[,8[,00CS0 Sp0 ST0 p/O-0P-SP ~ | z Aw ]LpLPL@P0S,Q@ 0S 0S%H@T =>=}LLyL2sX ? =   0 ) ЍO;`P @|@ @_ 0A $ R=t{v{x{{{7,~{G-@P $`P( ;jpP[ `~   @yz  0Z Pp@ ;p Tt p@ k   40 r p{{{t{v{7,C-`Gqp pXqp@@PPP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   S,hZ,HZ,{.Pp@-9 $P" 'P= P !srp p^P 0 &- &P 6<06 pPtd0`@P\0 L0Af&P,@m_006p|$,S,{P,hZ,G-@p`dP4T#0 5T Ta0'0s000Pp0 ;@6T` P'0S,@-o0@-MPh@P  " srЍ08!P ;0 00&$,S,@-HP!sr@l 0! 0&S,@-d sr @@@60P&6 ;0606ЍS,$,G-6@PP`j>T6k.sq 00P6 x;06PU pj;P0PPЁ  GP S,$,[,@-P ,0 0R  $, |l0@-0`  ^ @^TSa04S '0s05S #$,S,0@- @P0 QA6R 00S,G-pP@P P`P;`;p6W @S,00S/A- M`pQ@qpp6W @ Ѝ 0 PUP4P P0 nQT[,&|S,*|,|@-  0mS Ѝ 0 Q0 @@P 0 S# > PPP0`0 S  Q0 R pV`PPp :p00P,17@-PU0P( P@ Px0 Ѝ0%00S@PP _:PCX:C Ѝ0@H00S< Ѝ0@ 0 0$0 ,|,|X&||| 0 ,<07@- R P(0(@?@0 Ѝ0(&P,@B[,@-P M# @0.S 00S Ѝ 0S 00 00S000^ @ ` |OKP0@ 0R 00@0@$|(&}}[,+}M}T}<07@- R P(0(@?@-0 Ѝ0(&,@B[,@-P M# @0.S x00S Ѝ 0S 00 00S000 @ ` OP0@ 0R 00@0@$z}(&|}}[,}M}}@-@PiP  @ Ѝ}@-@PP  @ Ѝ~0Sp@- Sp00S p@t ;l0p `iP p@0qpP@ 0p@ ,+~Z,[,P07@- S Sl0 Ѝ0XP@T0PP 9f@ Ѝ0@80 00c )&)&I~P/L0@-0@S 00 $0$ @[,,,[,X~P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P8 Ѝ04@P,0  0 10 )&(&8i,)&[,Z~0/0[,P/LP @P/Mp@-@PN;  !۽P0UxSJ}{0@0xv6tkrp@0\~)&t8@--0@dS!@S1 CR&0C  R  0Q0 . Ѝ@A C#R  k Cr Q 0Ѝ        @dP @;|D[,+F|RO--PN<M`00P@*0 S  ?  0p00C/  0?pT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ t8,p&t&@-PMP M 0@ݍ Ѝ@` @70Sp0 - x@ݍ ЍU X>7 H,P0Sּ(6p&lt8,t&Z~wy|P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000 &&@-PM 0  0 |0  @ph P 0S>000H ;0Ѝ004@P uǀŀh[,d[,ĀP @P/g 0 /,P/00S\[,0/@-@0S:X[,0/@-,@0S0 0A00ЍP[,0/@-,@0S0 0/00ЍL[,!0/400S/(00S/@-qp@@[,$,P@- 00@ ^S00S00 Ѝ00 (&P@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S\ 4Ѝ80D@0P0 00 KP8[,4[,dj0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R  E C R    C R  S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  j|x||$[,Ɓ800S ,00S 0P//[,4[,8[,$0P/0 0 0C/[,P,8[,A-PU  @Ѝ`p@P|`V 00S0\V0S 0S`@W oP `@$V00l[,@-0S0*00 0J( Ѝ *  JZ,$@-Q00P 0R C ЍH@- *dZ,P/0S/P 0  //hoP@-/j 0LP/Z, 0@-L   ЍZ,A-`@Pᶼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @Pp88 0 R @@-PJ &$PP 0@s093@!+P0P0h0 P @0+S9P 4⡼49P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0Pxd   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0fP.00S Z,[,,,~@-@PM @PU`p0@ uSЍU  j  B U Rz  0H"00CS0 U0S U3/U@`x 0 AV00SXS^U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 P W 0  0S00S000ESU U U J 0S0nPS000 00SD000V T;7,Vp@-P`@ֺ000C S0 ` 0 Br ^ ST00p pS 00 000S/P/[,[,@-XP H0H@ 0S0S  0  03/$@[,x& 80S/S/ 0CS/$x&O-@pM0Q 0S [; 0S0 0 Ѝ`V$P  ]0P  AAQ-P $YQY0 0@@Oop B0 0S `0 0S Wp0px&@-1P(P0\(&/@-0M @20S4UP 2     `A2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  JA2 P!2 R@ n$10P@ 000 0  R  RA0 @000S T0 0S T \0!PL 1 10S 1㪹ꁽ0Ss }0#So @[,[,i,i,:,t[,(&d,,(& [,@-̆[,@- % Ѝ@-P`3`@@@ᨹp0 `8G Ѝl@-@3P  's],G- @$pP` 0 )!0 @@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 {@ЍMb@B40@-0@@T E@P  0 (&],7,@-@0@(&0$R/ $徾],p@-@`0P`D@0 0 _`0P 0A-`pP@ I<%] 0$],@- R0 0S20 P00S@^o p@- 4@0P 4P}p@ X00S(мhd0`l`P}ļH0@븻(80@0@S p@ 0 ],p[,',(&',,7,@- 00 Ѝ}7@-@PP Ѝ0@(0 0  B~ Ѝ0(&p@-@PjP ļ%@aP s800S ,0 QTp ,7,@-@1P0pSQ kB000@ KU'Q0 0 R0 ?o2 `E:P .W Ѝ<IP ނ.`.[,Hi,,Ɩ@-@P ͂.00o/O-|MpP @`< 1 Y0 \0ACX 0s0^YP P0@ 0   W" !Q0S|Ѝ@00S0/0 0 0PI P00CQS 0 XH R 1 @^AA0 [,/֖p p p D00/40@$0@0@,a,P,800@-00 0^ʎ1C0@ @P,,a,@0@ 0 C\1/0@-ACL\@c0P,,a,0@- @P 0000CQ0@ P,,a,`0 0 P0H0@-0^@P C0/,a,P,<001P/ R02:/,a, 0AP,0Q@-@ q1!0sr T0L1!0sr $0A Q ,a,P,A-pP 0RX@` P~-y00yvt 02C!A`ЍP,,a, 0P0PP@/P,0 :Q Q .Q 0?Q  \QQR/ R//A-Hp`ᣲ0P; R@10C @C" (,00004a,xp@-@XPqp00T00S 00CSp@肻@qppP,@- 0 C Ѝ@- < Ѝp@-0@PS b0Cs0Spt 23p0PjS BS bSp0mS tSpp0000kD[,p@-hӴd0dP0`@S;EʴǴ Ĵ4@N⿴b⻴p[,4a,(&C-U0`S$M@p`d$Ѝ:S/ %S .S 0 pU@0S0S ?S \S0S 00@ 0X 00~xX@KXBX] DX. @4LH,X؀ PP6qp@40S(4 .P40S P30S qpj P g P` P3 qp P) P04~ꁺD P3(Xq 003BH@6Xg Q0R 0 Yqp 0 O|2MP0t2t"0 \ P B B? 8<qp20 PP01P 1011c1_1Zf+ P \1R0  0R0:P0P P[xy 0RQ z0 ع 0R0:0P ˹lSA Pb ] PPP$0jP4a,Q8a,ܖX8,$,R[,(, 8[,P,,TX0(&H0@-@@00SOoB(0(01x 0 [,[,4a,(&(,0l(& p@-PPp P$R@ @Tp `$@R@p\ @R @T @R \ p @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P *00@p@-@PT `0S`0 # p`㜲0@ᘲ0000 S`@@0@A-@QP` @$ @p0W0 S 0 R 0 0 ]PЍ %*P 0`0T X0 @P W*0T0 ᶯL)`[,Hi,A-`pV@  ` R P ( ^QPR(;P" ^ U!R ( ^ P0 0 Q P$^U $CP 0S` 0 00`Q!PQP "Q P \U!0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-oP/Hi,A-`PM8@0C0ppG4 Ϧ AXЍ H/o0"^ R  ? 0Q 0( XϦ@`i,O-pP@$M0P`@0L00SF RC L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 00L0`00 0C=P$Ѝ@Hi, 0   /Hi,0A-0@S {PT(`V0(0l00S@`p l(`qp 1f뉵@00CSx7,Hi,,,P,1O-`wv@ 0 0РS ЍOA00S <P@Đ00CSR$ ЍOVqp O 0ZqpV Q P8e@ Ѝh&,,`&7,P,p@-P@T 40@@@ @p `\(Z(@Hi,`i,p@-PH@U p@^Qp@(0?o2(0Hi,]i,p@-P@ p0 0P !U@pi,O-M"X70@40pz@780<047 @*70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00 `$0000x60(0, rs  T0000S (0S0 00000S0S$Ѝ00C000 L0H " !00 000zy+  0Sqp* qp0S`600 00S0 @ y40S PIUPe U 0G 3Pm40S 4L HK0x4Pt4U 'VPR \400PL40S 8400S0R0S P4L0SP}`9}P L0H3PPU7  T  qp R#T0'`L0 `    h  D0RPD0 T 0P@TX\P& & P ` @ PUeP  0 `hPp`PL0 )P  000 0`0 L0$00CS$0P20S t000 0`0 L0u408 CPPI h0S8 Z5 ` p J!` 0C Q00_0p 0S0' 0P a 00o0 0S0YPPYP(1Up1~& |&0S0$0`P0S 0S < @B X0C  BSp aoZ0Yp0pP0,P,[,,[,8[,i,[,4[,Hi,[,[, [,[,i,[,X8,7,p@-P@  04P !U0p P$@i,p@-P@ѷ  0LP 0 Up PS @P@i,p@-`@V000P0S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp p[,h&`&`i,[,Hi,p@-P`wU 0S0P@T 0P@|0 pP%@㙭0 00000@pp@%0P00Hi,7,@-90PPHi,O-P3@أ0 404M`p 0P 0 X0`Sp$$P4Ѝ0  $$X0X8< rq ut00T00S04\0^ut 200@_ut$0  sy00 $0Y0 @$Put00V 0S 0$0(00X0 0$000 P#srG RB R 0A0P 00<PP7 0 Iqp@PK a%ut \0@P100@_V `p000/V0V`p ` p @ P0X08< Z000rq0S Z0 _P 0  5qp`p000 040.Hi,7,0@-MP @tu :0 Ѝ0@- 0( 00S@Hi,[,h0p@-@(녿P HP0 pp000S(0Spp&Hi,[,@-$@$0S000{ @Hi,Li,[,O-0 ,M"0Qp 0SGPy pC 00#  \PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(09P2 X`@PE\qp@P[vU@PutTXPJ1\R0 0#Ip HBHb0 0 0(0s0S 0S >20SX` 1``FxZ@P 0 @PX SiX12`[@Put0`V@P004S S S ᢩ0PS  0 QP04 叩0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 C)&i,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c 0PU Y< 3T O5PPA Ppp̦@ ɦƦ @@Z 0 p$W R!l N@ L!T<"0S000⤦P ;04P S@ _, Pp 0S 1T OP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U0`00002i,)&n&i,tv&0@-@፧P冧P |偧P l|P \wP /P/)&ߙ@-@PDP P@O-x1M0S" @`0 ЍOsPp000 0 Ppxy@`Ѝ00S 0 00S  0P @``e 0 00f0    0Si,i, [,[,0@- LLPR^0S @T 0 Bi,)&0@- LLPR^0S @T 0L Bi,)&0/i,0/i,00S _/i,@- HP .P.P3@-0i,//@-L@X 6p0 PeS0PЍi,\ QR0* /QS QQ*/0000/@-@P h000000/0S0C 0//0@-  0#A3@0@0@- 0@SPR? P &*`Q  ө$` PЍpA-`pP@T@  G-P`"F$@p(, kQP 0$ GfFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0  PЍp  000@@0 0 0 0 0 0<A-^\^ ^Q}[\9[^V ^\00]QQ$ ]Q0\[Q`.FqQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00lšp@- Pd00@S S R 4@D@R p@0 @ tv&ۚ1C-p`QpR@P0\`0Y 0 >)PA \Y R T R 0 0P@0   [R .0Bs0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@ 0 R Ѝ{,@,00@-M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00@O-@T0tS bS rS aS @{S000pW` Gp 0S0QU 0VP 0 0 PUP(b`P i,x,5O-pM>4Mn0  PIW ܍4Ѝ000Q 00  R Q  R  R   R @    0S 00@0p00pS 0S @P#S ;S Q0@0 P00 剘0P QP  0S @,SP0S 00@sQP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q -Q ,MP  <,0 \\^ ^00\ APP00;Q0I S 2QP0S 00@:0S00)+p ca 0S 00@0S 00@00P0S 00@T0S P @0S( X P 1@( RP0U0 uP  P\XX $P I0Px $^P I0~0 , 8 SR0 (  \P 7哎00H00 PP R00C0 0C S000vPW,X, `P0pL\RC [D Qx␸0S <,00S ,, E 7P00A IP 0(0 [^ 0  0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00ARs0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y: E30"S YK  0S 00@<,0 [  RR , S 8x lN3 0S #)p p  U@P IW[ 0SD @;S> B8O0110P\SSpE ND  PP< , @P 0S 00@00 Hp_0H p Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 02 ._p000 XH 0S  Rp U'_   GpYP 9)0     呻!N1 ! 0>0 $(69 09909 00k,tv&s,JTu )&gЛݛ-_{, {i~i,{,k,_3X}t&̞A-D@`@PU@Tp00S 6NX0T0/ND0 0pS0(D&Pi,x,,,@,<,p@-P @N000P @p|*&@-@N 0  @0|*&0p@-PPUph/@P 00CS0Y_p Ꮓ _p0 _{, A-p`dB R3 RQ R P$0SV0(  R R r/$0P ,7^P0 P0!@.PQ$00P0PT0, IPP (00S(0 #R nR0V ,0 0200#0$0,0$0^( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0{, {,@-|@X0  0S 0S00CS0^p XĂ0  {,G-D`X0pSM00S 0S }]#3X 00X 90C\ `00d0崃XP 00CS0 Y^p X参X !pP0 W0 XPލP3 ]p0S J(08'P 0''P  p4S 9(\+0p0p4S \2PP ]P  00\0'Ptp0`0d0S00d0000S 08S0i (P0  ]0  0@ @\00S +[+' P0 \+0M+0JI2_P(J_0d!H, P8Q*'\ PP l]0-P\a ( p$p&\0pp!& 0`PS(00-PX30 00,0\`0P l000S SP@  0  lB(00(03{,n&@ |,(|,F(,o&Ox --AMM@A> 0$ 0q,0 @0 a\{,{,--M MA>$00[,( (  0sۍ ЍЍ/{,{,@-T`@PP  0u"pK0 m" Ѝ(,@-`MQqM0S000@03 0@H0S C 0\ 0 0S S ` 0埒l4-@P *0 , P\ 0勒00ڍЍ,,|,|,<:@-@P  Pt[ `p\0 P `P 410P S x [ Ѝ,,C]G-pA唁!0`PU , R:(,UK0(0 &U# \U   0 R`Z &R\RP` , R:(,2K0(0P    "pr P qu PE ,  R:(,K0(0   ྇ 0 ,,tv&A-@P p0R`*JW00 ជ 0P P 0O-p/MlO00`PЍ080D?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0  P0 R h>0R*SL>0@o!P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S8=0@oP 0-=0C>S00 L0 R: L /J `0pX00c0S<Xt<8 00 \\04 0<0S ",H0SP80S4PU 0`  E→P0800A E4 堆0T P "0 | 004 0x 0 dd 0H;  400{ 0 4;0R, <0p 40P 0S ;P 0( %P2S 0` HΞ:0C0 0S0`V: $ 00@ X:@0S t 0,Y  H0$P y0 H$0噞$ [0`V: $] Z` 0 0C 0 xP '0`V:P  `  0([ p  0P `V:`:0i0(CE *0 aV :X ` 0 0|*0 SD88 00 ,h04 0<0S Pb'0801 0 P&80S"g04 0ď<0S  80S04p  G^`P <0 00Fpp40<  0ᤏ<0S V 0400<068 00 V04 0匏<0S L0 R: L H `0p^00p[  R  Q 54 J4000  P 04`Z Z Z000 G 0Y0 00 V~ Z0 0RP  0X ?0   PQC p0V `XOdH0p0<Hp<(0000S Xt04 0<0S p P[ 80SX0sF@$@!p@0 $@XQ0 0  0p V0`0  `?0P  0 RS0 0 p0V R`0 0 !PP04 0!4 0P }!P"0 000S 00P80S0s"!p 4 0\!40P $U!P P R0@u0`pL<0p<80S4X ! 0`Rl0#0V*0000pW(p0 1(W0 \;0H  ! R 0dzP 0 pW*0$ ("1 0X`xpH0`0h<Hh`<x0h0G0| 0l(@{,,,\,k,|,{,j|,o&*&lht@t|,<w:D, t&,<0 0R0((Q 0{Q  k,|,p@-@P`Tp0wS {S sS 0p P 0 DW0`@p P `ꫡG-`pvEPPU00V01@ R  ̈PVAGKWp0!p!Q <0As\S00 0  V0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: pP 000BS Ṽ,ǡΡp@-P0`@T P ʗP, 0S)0 0 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@ꬄ,J}- 0@-MMP@P  P,V p4$V+  PۍЍ0H0  BR Rp R' p/n&ho&@00CS0 S0 / 'n&@-,Am0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@`괅,0-01S ^00oS^ P0\ S0S Q0S Rr P0S0S0 s00Q qR  `-,0@-  `Ğ\ @ T\    %R    贅,`-p@-TA0 5S <0S -00$!<Pa0U&!0! R8  (P  Ϟ0  ,P  ƞ0  4PP p@㎁00\P ZP @ 媞00, 夞P$$Sp`- , ,ho&p@-@0` "T  %td lP`PT p *P000ST @n&ho&,@-@P ΑPn7@P @0?SP@ ⻧p Ѝ/㒛P@iIP 0S SD4ꗚ0S00gT4,9V@-g z%{"땢ho&@-0@<TQ T0B0 e%0001S R0Sd0d@(TPT T@0$ @<,H%T ,  @ ?%괅,ho&`-!@- 1%2"ho&7@-@P3  ᮈ0S 0@T %00 Ѝ00"S sr@-@P  p SЍ.<0A-@X``# ^p "RG ^<0d#N R 2*& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,0P01p,,01//00/00/00/00/00/ 0  /H,* 0  /H,000/400/<00/E00/N00/T00/c@-@bt,00/@-@T, 0  /t,4 0  /t,< 0  /t,E/00/00/00/f00/n00/v00/00/ጥ00/ᖥ00/ᠥ00/Ქ00/ῥ00/ɥ00/ӥ00/ޥ00/00/00/00/00/000/sO/gb@-0  0Ѝ@-@ +@-  ,r0@-%R  +@-  ,k @- 0,, @-,(0@-% R ,  @- @- 0q,t, M@-s, @-  r, (0@-% R yt, < @-  pT,< @-  gQ, < C@-^t,< @-  VS,  @-  MS,  q@-D|, e@-<, e@-4, e@-,, @-  $T,  @-  ,  @-  R, @- 0,, @-  T, @-  Q,  C@-t, @-  , 0$S00 @-, @-@D⎒P d 0    0@-0 |1假, p@-P( dP& <PV 400C`F V$P SuP4P 0CP  @@PLMp4P P0S 400C`[zk1SR !0C B/!?18A]!NRAPN P  ^Aжq0r0xP00S11A)zP`PxP@a@1S020-(PJ @$3@P, #0@S00 2P0CP?P <P>P P2P 0PtUvP tpP1a@ P tx1S'ʰ1 @ P sxP o00P1 RE40S 3/P8d PP 3d P,ЍPR0y Z 0SpW 0m 3/pg P 0`u@ P s d `[xd00x00AM%0 b02P 00P000t^;xc ,ަho&M}|-tv&|-Spv&R 001/,P0 R0//,O-p`*@PP [ ! 0P @ Ѝ0)00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,P/D0 R/0@-A1 P [c@< ߊ,O-dBp0 W`@4 f0p 000孀 Ѝ0P@P 0S 00@ [& 0 lP U0S U000 00 `[0S lP U000 [0S slP U U0 00U P0IS0SPPXl0 00cl0S ^lt0#?C S {UPU  h0Y!0Cs0S( 23PP PEgU,,tv&VUUU @O-$MH0[S0P 0L`}Dp< G0Y0 0S 0g vUePkk  l@` 0l@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0ekX 2 Ye 0  B5FS P0{ P>  PN P P!VUA`E DAq@DP`0d dd@`"PD P AP;  KR !   ` D0q0@0!P`1 V0p00@  \J`X"w`F`FV0p00@  DPEp@DU`E¨` Y @ uW@T`— R   BZT0S 000 0 0u$ЍO0Y S ,,tv&ho&A-lP`Pp `k@k@0T ]`P@ P P,,@-P@p 00T0*  p@Ѝp0 00 0l` 0@ `p @t 0NP # LA&,,h0p@-P@XP0Ps H` R : P 0S@@Q@puLA&,,@-@|=,,0h,,0h,,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@&@-@&@-pP@`M,0 0( 0 00`Ѝ@- Ѝ)O-M P`@p/j@(jUiT0 0aPm 0@D0PSX 0SU L00SQDPPL00PT]y@DO@W <p yPRWpV`KЦo`0 S`K0 0o@PD@0 8PT0 0P&00L00$T <Z  o B`t=`;`Ѝ00D R00S 0S ᶂL0X3#PpSujoP 0 o똰CUC(b+b t<r}0 EGncP`C# # # -MM+ 3q+L p+ +q+0p B?P  6>ۍЍ# # 0@-@M ␄1@@"#P @  qP A0$*!PRU)QX[&Ѝ0RL00S 3/P 0$003/0$*H@P3P/[P+W@P'@P# 0P)z 墄9!z  0S 0_ Z'P ?P4o0m%()00,,b# # |-|-@-@M 0@@Y>#P* =@  q9P 00*!R00$Q )g@P  0S 0` 5'Pi%S()Ѝ,,O-`M!  0X#*0S ` 0 SS 0~p0 S00C `@~0 S:PP@ B pQ %S0S iSc %S, dS b0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ ! T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 totv&7@-@ xPU  2 v>00 Ѝ0l'P T H  v $ 0 [(,# # $ $ .$ p@-@Q`T8080P00S0S   0p@\3,L,?$ 7@-@ 'PU  uJ>00 Ѝ0PP x u`00S 6H 0EB[ꯃ-( $ L,F$ X$ k$ ,$ $ ho&s@-8Q`@-7/hOUox ]b~t]"bz ]a2bf]3Sxd 0 Aii@Pxx2_ 2~P #>=\\ pwЍp|-$ $ ho&$ O--}Mp@` w 0yp 6V  0S  P Rv  0S  렵P t됅P tdgpPU Pg TvTP0B? 0 H'(P  L=PP  C=00}P}P: @  |: {:0S w:P s:D4  3 ~w 4$"0}ߍ4cY3 34C0"!03140`040&2ыҋ 0T40   T(0P500  @>"!!0#  PW  XT 2t 0S l2P t, t<10S$@0 U0 <"QS 1P t 1 zR0W$2jD1@T   @>0XCP0@0S@ @  0R0SQ ᛬s0S  )P 0 [\vk0  PS $2 ,$K&ptbt$ f@L,,% % % % !% R,$ $ 6% <,% @% d% k% % 0@-0,MP0 00 0\PPP@P DD>@0Q ,8e ,Ѝ0@*g (K&ho&% L, -O-iMs?!00 Z(P 00iߍOЍ/\AxO `PD1P 0 / A"`P z[p 1P@' [PpT00Z&;U0P 0 " 0GSW 010#S W00PprP@ P#% L,-O-p0MT@X   p$pg `V  @Q'U` qPPzPA@P :븤H E0ZrPU m0'SP0U*S / ፁP0 0oX/0 0P Vz0@ 0 0H0 tPX1Z nmLp`PUQP( w2S022SP0220C2  S xS`` u$00 00( 0`,wVPMUSP PPV  > 0%S @S B* B~ 0.S 0 0Z{P1Zp@P] 0A0 0@༙ R3dQt00 (i@0 0 (aP``q0S  ZV0A 0E?oX20S `Y]^$Yx^`tV @ x 60S. {`@~Yt00CS0000:%P0S V$0S  `E3jQEdtWU "^Y=^X LYxtfG0ЍO Ѝ/% % & & ht@|-n&& & 0@-CMl6(PP 0S .Qo@P 4jCߍ0 Pj T,S,G-p@ 圀PB`AT:00Y W ,/Y 000 oP EQ 0 ( @tv& & A-`Pp p@ } ,pbj P@R,A-Px@xopl Jj0S DQ0Q.SP @$ $j jT,'& S,p@-M 48PLP   j 8PLP  j p@ ( } j PTU |@ 7$tP i 00 ` q$@PЍp i iP!iR,%ip,R,8i(,)& O-NMX6Q >MJxxGt`ێ,Pz0尪S *x W:-8 4e0 w=C$ C/e0 iP400w0 gyP40  U Ur0YR? ;/ 0lp @*<: R0 :P'P P 0X60,0:(P<I0.̟   0/P `d< B 0 0u`````WPp(00ۮtl= *D00lq0%,ݍ<Ѝ>0a Xh x`P  xP `;{ 1sS1lS8+2 0P%QPH 6VP8;x`Pp},h*0x*0wnxP\8 0\8VW*0yU *0z*0}\8p*0|wX:U :H*P0Q4 4* Q9ʟP \ʟW^ x9   +9 @H- A)0p 0HAkp p=Sr 98)a0dd CP 0H0 H0Akp ( AAY`P( 0[Vi nPSUp`jvC {! J{H p00n`<T(0~C`<xP P( xP <xP wP }JAwP wP wPg0:4LP '0\6S '0&`P b4x lh`$'[7S0  '6p& PX6 ATAy0\8^P P & 6 jP `([:4S $ 5YP 0: APڴ  VF\80%8\8nPय़` cg { jlP0%08P  Qg i  XlP0040X%S\880\8P 9g Q0S %8P t*g B `1lP000S\80\8$P0S\80\8`: 4S3P h 0@?S X@P D3f 0{C:$P0R#R#p$|ßRl#hW%RL# 2M  !0S2 P 2@T zNvL HHB* 0G~0S t"dw0S h"pmSm53S5 U\ "R?0ⴂ0N?C0C `.`0  0F0`_Px9A?FMێ80I,07>E`I00x P"H pQ0S tWW5S (!$iorXvlX60S`0 <I_W4& ,p,& ' -' -+ iE& 3( ' ,,)' D' ' l' p' ' ' ( "( ,\) ) f* * * * J+ P+ + ' P,+ ,U, p, , , ;, P 01/ & , C-pP@,MuP3S0 ` 0`:00 0`@0`00n/00 Pp 0P/S/00 0 /S 0/0 0%R  @ 0 `@ 3ߍ, , , , A-`BM|@ouPlP3Sp (pE < X800`0 0  3PBߍ, , P,T, ,@-@ @,@-0  0] P @0@ 18 0/P $  ЍP,| R,,, @-0@XPL0  0@6 P | |0|` x0Et@1P0/Q   P 1 0/R@0@ ЍpT, P,, ,R,P,,@-M@D?RPtP  d d0 D00Sލ\0\ \P L0 (0< l0, gt, ' P,Q,,T,,, x,,- C-bCMX6S P \8BPCpt2tB0S 1\6S T1L2L"5 1PP4 1,B 0 HE:4S / "=:\@gU 00 /:4!SU *00 0 B$!qgGA1@P@+ 0 aGAcG aGA 0S  !(!0S   ]3 1P\6S @#U F3jCߍ 0p Bd@ T,0- ,@+ +' R,K- P,P- ' \- d,|- - S,R,- ,- . - . @-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%phЍ0L0 3/@P 0 @P  Q 1/P @ @t@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T q p sP00 0S 0S0S$ЍP P00 S  sS, R ,0S R : 8 80R:P3#///A-@M`M9p" *0P pB Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTT(/ 1S nP >8%0`> @pԠ+ pd ␿ ⌿ + $0@Y 4p <⎽0S 3Sj Tt s s0`0? `p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(Pn 0C QX > 0 0B,0! s!4吀P0#0` ^IP\P fӾP ,0!4!k`~0#``nD2P  @000@A0"p860N?P0S J` rKR r0`0K?(081l1~$10 100 P@a C 01/@P00pЍpP@00003/003/$Am=1 O-`UM MM.x0Pep.p QiT,CfD R@[@,0p%SppW ~0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯N℗ 54, Q~W <S P7h4F>D0C207\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @ t00, n3E "w\5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$#@p00,0mS` E`40S N?,$$d4PUX4 0}108T  A \ "\ \,10!,1 101$14141(8H!L1 1$!0L1H!,儣6$1(1\),0, 1401$141(!>8!A $$!ŸR   C^{Xy ŸH#0Ÿ$1P00$4; x2P >{\{ Z$10S0$10MP00: 0 [0H55S Pg $003/$pnkPM pQE!> ,! 5$H0@;S 1 HPhP? );=S; $10A>@C418!<100S/ @_ 0bWQ!!10b/n0@P,1014181>@C0(1}1S0}1$1S p E@,|-n&t Z/ K&,@,p,,0 L,1 _PP$030/0@o//BO-P@ MMAT0*!Rp0)A`T0 $0   P S Pp , *'0t$0 x`$](pP H4\,# ܍Ѝp 4]0Spp0 P0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0 S "S S/ Pp  R <,pmWP00P0)|2YP0 T P& 'pP 0s 2&P }d0S "88 ≈O@d0S !8\0 @S !8`0S !8X0St! p!S0 80` D]L0@ O@\0S ` R !8A8 FD@D~@@x@9D@Dq@2D@DjX0S0A(@`^pQWppc  ^,T2 X/ f^2 1 w2 X / 3 ,2 2 2 2 2 1 1 2 2 2 2 2 2 3 1 D2 O-uM0M*QU$e UB&&@&d P Z &0 0 61T Q ލЍ3 )qW nP7 FP' P  @aP' @ pH0X l40:iP40 ] P QU Z@D`@ 1 p PCU   c0SJS   : 0S #S 0P000P FQ\P14s10`#5:\#\S /%5%;%0@`S D% % (_spp`0 0 ,0S T0 S00 P0p0SS 04  0xP;8.5/P>0400S8RT0RP S@" SA0 0 80hP80P QL ,0@8aa<th<0X !L! 080$ 0 40d( `5 S/  S" 8Q0PEu $PF_ MhP005S0+4^EX04  v0 S r0 k$똰0,h3 L,3 3 4 54 :4 ,4 ]5 0 q3 h5 5 3 / 2 1 &3 13 63 >3 E3 N3 U3 a3 i3 4 (3 2 X/ )3 X4 4 r4 4 &2 O-@BMTM) Pp ` @PpTp$;PpppPP@BލЍ D M0j@0@ M>0 $04@(8 M>0@00P@<DT@0 OP pG\0A00@3 0 !8, A0 $03(408@00S0ؒ; !}P  o6 0@o/b0 !!/ḕ,10/dp@-@4P0 `T1111p踕,O-P@p`ԐԠ԰0/ C !  !0  P"h00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ踕,D ,  0@-P@M/.g1, 00 0d0@00 0T0@@@@1 0 000@P,pߍ0 ,O-Pp@`4M 0Sp%P `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   0Q R  T0 0P  P  H   4@R,  8pT  TX $ `\ ( ` , d pA- 0R 0  DQHa@1QRpB   !LAPAP0 \A0Q     TTAU @@긕,7 7 O-PBpXQMU<2PX\1S2n\U \QUЍ0C`1`1SW`b001PS \1 X;X1! 0`1Vle.0X`0 T1VX " f\P6 \ ! f000: S.X1 2 \1`0u0X1`a\P 0 S 0.S =Shp ` XXnPT SX1, 2 $ eR긕,PM&H 8 p@-MM`^P;oۍЍp,P@P+R P*+hR P*+R P*P nP8 8 8 p@-&M@(D0H`P4 f <0 0=5a P (E4(E f_\ <@P ލp8 a8 b,I8 L8 O-p@MP! c0   0`嬢Y p` 0 0*P0SߍP X%]P0HbP0 a0CS0S  PU`08Sڠ0SP` R SY0  0 a00 pp 0T1勅00 0s [+, plY 0 @00t00 00S 0 yCP0h!R@O O0㏐ 0S* ?0!CUa0 ,p\X8 c8 d@edA ,q8 v8 k8 ,@- D@01SP@ 0S 0   긕, @- @-G- T1  D1D1Gq(01M<0P@T 4W Ѝ踕,4; PM&@-@<v0@- 0 Ѝ0@- 0 Ѝ@-0@M/0+0  0Ѝp@-P<@0/SpQ T]Pp@TM&@-0P  P,T,C-$M@`pPP 01 QP) 0 PP0P00P l @`0PP0L`ySa00ͅ0݅000͕0ͅ$ЍC; A; 8 : H,,x,R,d; >; O--,M`t[$Q@pq[ pPe $QP@cdT10S@ `S[PPEUN TT0 (^_$0P0   @B$0VSS00Y00S 3[ P E H $Q0 0$0  0 "$ VRR   P # 2R @D W`0@Q[ `P$ Q@,Ѝ;  G-p`T@PPU  hPP 7/zGw11PpO-@ M$`Q`P Ѝp0P 0`0 VSSTP$?Q-@- 00Ѝ Ѝ/Q -@- 00Ѝ Ѝ/DQ C-@`PM MP`' @@EpD F83V44CV]DAD Vc~&  0So 0CS+PCS0)  0 0S8 0S r0S 0S QN@xUP$ 0 X]0 H@o@2P 0,b0C?o270 姟0(H0Sލ Ѝ !7qS [P5S/G B !F? Z@F o@1P0  0L x'  0S 0S| q0Sx 0Su QN@P  00 @!P_F? Q. Q3FNnR< oqD< a< 4< ,,|,< 8 < ,PM&m8 d< 8 ,T,< < < -MM P  BP  ۍЍ< -MM P  -P  ۍЍ< @-pP( `lP! %  ` 0 S0  @XP00QP E@TTЍp7 = = |0|+R/ @-h@|+\0 P0D080",0& 0踕,$= , ,,,,,P@-@ e@0S,p@-@PM H(@]000H ,0@@04P,P4h Pp0: S HVZP cJ _J܍p,] 8]Q @P@Pڤa. <PT8|1| B\p85<QDQiE H1 0880F8PP  QP00S nz < R t00 00000 00l0-p@ m( rt(0S!t,P= P,Q,,8, S= ' ,x,H,t O- 0CMSP0q `@q0!`m.0`SPW!000d @@3/@P CߍW! 000TZ 0SaX 0 Z@T W  00 0 [ B0S l00S \ 6 P0W0 ! !  000P,R,v= ,~= = = = 8,= ,7@-PQ@0 SS <4 000] Ѝ0 2S<0 = 8 O-,UMP$!4Q 孈 \#ß0/SbP3s0ԃC0`/Vd3P Q+DU@c A@ lPKZP D@C;@1 U `lP~fP$ 0RP 2P 2`.$o^ 0 10S 0S5 0 1S10S MPpG #1A/Q!0a d!  R R` 10 1000p\R `01S RB  0 P a0S  /SPR  Uߍ` 1 03UW U@P@T T`8 , > ,TM&,3> l> > > 8 ? (? |-|-> P,&> = p@-Ph`@TUgpUP`P  p U&= G-pMMdpp@ P DAvD2PPC P1P  2PڍЍt D$vPl DvP-P  |`P -PPP00 0 ,{u V tWP 0=Sp  K @PW  P P P\hP rpnd PP9 = 3? ? ? 20p@-4 P@Z0 Pp@@-G-P@p4 Z0pS R p2"4p0QSP pP`p 0S!40Sp  Z`/0 R/@-`p0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ P6ZP  p@c@-@ (@A-P@p`p0S 0pp RA05#h00P200#X0S00Q #"h0Php P#"4`V000S 3/0Q #"40P4C- 4p Ѝ`ṼP᷼ Ap@ Ἵ 1 #᳽ /᭽ 0;pW@C߯ d@T  L VPM1P `-P c@? ? }D8 2@ p@-PMM`; p  @p ZPPZPۍЍpHp@-@P `Y` DP  0QpPp|d zd@@-PM Mp;P `{p  @0PPP UqZPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP0x,,%B |,OB $B gB G-lF`0pSPhM^Pz@Q0S r8Q0 Sj0Q0Sc)Q0Sk\"Q0SGUQ0SHNQ0SIG Q0SJ@Q0SX9P0Sa2P0S$+P0S000$ R$000 "0& W40SU4 QQ00Q00Q00S 4 ehЍG}( P0SWAD4W>0 P Q Q+=3003 0hP0 LhЍ3003 0XP0300 0$p3 0HP0 0TS(0p`@ 0 SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@g0 # S8Z P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 tH0L0  \H0L0@ DH0L0E ,hЍG!耟SH0000 #0PpG0  d :/ 000(00x, X% L ,b0  * 0ľ P  1@0 B )R RD*PQ0R r Q0CFS0TR000US0a0Ѝ@0  ll&*PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V F @)P0 /S`Sp`` [XtT00U0,`00E ,XE ,\E ,$B T8 T, 8T,(,+E O-0MS@pأЍ`  &W0@ 0 P0S% cS2 %MS) CS, GS R 0aFP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-СOMM P#0 P0P<0@0@0巿0P(0` 0H03/00040 00!6 0R 0  0(3/ 0Ps`` r S08 H&a0<&PQUa`v0$0800s0,00&$0TBIp(`DpWP0`0T0d05R0h0:` `pV S1` z`U T)` rPU#` lVU 00 00PLetrpn4P0@ X000\PS400O>=C0D0<004 0E$pUL0 R  |He0 000D0H0 F0+HL0S 7pGP 0S80Q00`Q0S 0L0 aA3/P 0`0` 0%003/XP\p0E0 7#`@0o?5EX` X 0 Z0R0 `<0S@00 00S8PX) a`v0"T$0s$0,0-TI0,0$0&$0倒 XP 0E0 pE0  0D 08 0D 0 .p0`00d010` Dl0h+XR6+N6ᕿ Y`*pV 0 LdU 00 0dLd0 8LdH0+,0$ Q00Q03S (0A( 2`Kkp 0 `%D00`P3/0A` X`Q4VP04`LB(@OލЍ X 0BZ0? X 08,eE jE sE ,E ~E E oE yE xE E E @-@! 0$   0 P 0"ġ0S 0$ O-Mp@( P,`|1/0@T0P5PZ0YP0 0D @p0D@Tp UYp 0 D X00 $P $ T<000$08900p@3/ 0pXn0%WQ@XcXpF0Z0 0唳+Dtp BpW000 0Cpÿ D0BpWP啽0W000 000W 000$0>,~E eE jE ,E E oE 0@-@M0@L0 3/P" ! !XQ 0 0 SS@Ѝp@-`MMMP;` @P G $4 yMލЍp{dЀ@-@P DDP 4 DP $DoF F F p@-0@ 8M! 0`P@@ 0 ⊾P8ЍpCPUJ0 00  0 qP@oC-T1M MPM C  01/@P  0Q$AHL Q>0 R 0S rP P 0$003/$q,#0pQ@-slr #"T R0//s@-(@T@ЍpH0P0 w003/@P@F/@-tM`P @0P p@>@(P  90@Tp@tЍT0@ "Tx0 Cdd0d p `P D 8G P,G G ,G G (,H H /@-@@G ///@-0@Q s̻@7o?0 \ 0P000@-@4M0  DP0PU?0 00U00 0  04Ѝ0,//A-pP@`VT0S0S Xk@PH0P$1U?0U00 0X0`p@G ,0SR00/p@-@P><0P4`" 6D0# A@$!p,,A-<`P@1@Pp( 10 A,@-SH @-+p@-M  C0 hO0S Y}PL@L`@%U 0 0 ܍pcaH t,H 1G-1MP`@1P!t1t1t0ppl`PBL@DD0 [㻺8ߍ ᑐ@P L]A> ?@P 0=S5>?A@0  [@T@  {P 0 lUP6P P LG6@ UA9:H H H H H H H L,H H H I 1A-1@P`p1P!P0P0P`P`P0  @!64 gL,9:%I I =I PI p@-0M002 00`P 0@P @T 1T 1TO/11 ,PO/11 Ѝp{I ;R 0@- MP o謌,@-CMp P@B<P ^`0 0p"0SO/11 Cߍ5S| |p pPd`X 60S  S(A1 1t,I s,,I I M;߹Jp@-P@`1 1  p,1p@-P`o@Pk0 p@KJ p@-P@ỹP wPN/1 1 pWJ Vp@-P@1⫳1(1 _P1 1 pfJ V@-㐹@OWJ C-@aM.pATV PS2PXPG aߍP sP @"080E0$"uP ",2X , < 0, < IXN?1L0 0!,P Px1x10 pAPphaU U UL10$0PU@4!44+`A,ppP0S S  @oA 0` 0P@hP0@H7 A6@7 0 0 0F& 000 p @,Ld,5xJ J J L,TK =K 9:U&,,s,t,,|-|-i Ki A-`$Yv@P Qq-@T N SH啪P( 0 ;!P  0<74 P i=@ᓶoЍX0bl D%0 0P K K L,K L L &L fL h//O-c@T Ѝ@T@T( ^& L U[Z [Сԑ YZ PUPE P P$P@ P$@0"/,O-0P ;pA-@D`DPp0S2T00ԗ@"T 0L , 00S@- /,p,C-麋X@(p,P0`$ 0АYĐY T  T:\0WaU|U VP P 0U Ѝ +V0  M M M M @-@P$$0 = @M 0@-0@S0d Ts0"S  @0<00R( T40 ,,,G-lP0`Sp@;S S 2@1+1:X bp  QBp\T.@T&RQ0000(Q $9p Q 0S T vy* 0@1 00 0TRT0T"1,{p@-P@u@op1O-0@SpP`0 PQQQS RK0VȰСr0 $P 0 0"00=0(Q $9p0, 1X#Q  F vQ 0*0  R [ R pR L0L 8C< R# Ѝ  W1Q:`0,N p@-P@P0S!U 0E p(0"PE0U055403 0(2#p,,,40@-0@SiDP0@0ӕ,L C-AP0`SW!U 0E p0쀟@SV  Ѝ 4 U(@0ױ`P `4p00 0@0=Pp\0 2H p8 `0P (0'p(0,0`,,,xN sh1A-0PSp@` 0 PQQA S90 < 2r 0 !Rv?000 V ! (0$0X3,00S0001RPp0S0 00 0W1S` ,P@- @`00S T ]㹳Ѝ=O-X0MSM0 @;\0@S0 @@`0Sb0/ @@d0S0G @C@h0S0c @J@H (0S TH80S 8< SRS80S 徰7, 0HPASTPPKPeq @8@i`P)~G2 @ `, \\00`0d U.0h NX JŸ;S"@B0!,00@0?P@_oRݍЍ 0:S 000a 1\0  0 0 0 0C0  ;0CSLLPN N N N O O tv&$O (O O O O O O-0TM$00 (00 40 0800p000@,0 0@<00$$ 0!$0 0(000 P 0ST`@`DPQ 0[ [ !1R  ,6 [`RP`XP` P40(S80 00 $ 48R0$0 (P 0XX0S$ $ `P;S S2P11: 0S DW 00PA`^U:PU2QP0 Đ(Q $6p,0S ! 0S E ,vp'<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQU0E"1,{p@-XP@0S!R+)r00 S @ 0N Dp,O--BM MXt\0 @P 0P(` ; Pp/Bލ ЍD0 P# bQ 0  0 d!pPu0 00!$0`4X00 0Fv0`F;S :P |屺PV +RQ 0P \Q SC0Rpʩ0S R2 S - S/ S0S0000000`0 0 P 0S  & 0 R$ ?! 0$ S0S 0$ P0k edAO O-DMhPl`PDЍO@P >$6#Sp 0 4P` ;#S04p0 d00到`0\ h0Xb P$`P`t0 (0KH>000 00 00p;P @-`X0Sg0'. C8\0@S0h - C`0S0i/ Cd0Sjp0!. 2Bh0ST0k}/ pP S 0&é ЍN N N N O O-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q r@ 0 @0R0 0p1/P @$,P A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-)@P`p1S 3/`V@Td0@@T0P0S@000S4000S(0000AOR ,$,P b p p@-@4`4P0Sp@?10S 3/@$, ,0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 ` 00//00/00/00/10/Q@-@@@ 0A0003/P@ Q @-R C-B`0SPEM;0=30pS520 St- 20S &20S@20S(20Sk20S00$ R!000uF 00$ $ d 00qp`ަ@w0,s0pm `t80t$4`@ p!0@ pd40 000 f0,0ad⯨0$10D0\$10>`\0@ pd0000S< p0 PÁh ,`3 000000 000 0 0,0p≥p` y3d,0eΥl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV $"P2Q \Ѝ[Pc00SZ 3/@@OoBS U@0&0010@!Rl!@!x@|@pPpt@t0S|0X*@3P PQ 0!@x 0T:x0S@ 2åt@OoBL@|0xT:@,AS ,, R IR 08  , u6 ԑ L,kS >O-UM8 ST44@`[D X0P(0 RpP(僥 UߍG0P,0jw30 40S 0RD 80S:(1SK1<00J ,H!0L\." A 4T#H@; $` 00@PPH@T ( (0B"2 ,0!P0S 3/P20 SU@0%0cD0`| p2R尦1@82PU?000X N 圦 ,H!!L䱟H@P0#`P`T@刦P ` J*@ G*0D*000 0040刢 @E 8*   0 : -*0 1ῤ"*40P1:> ..P@0 000000 0000 0(0㿣p` D⟠D0S#, 5Q7ZTX ፤ዤ(剤,凤v 䀤 ,$,IR  noG-/0@JMM`0ᘳPP+KP& 0S" 0`"`!p/0P T` H 0@T* /R  PP/@zm+ P:/?0 `H⸴P+0: S pW/>00ꨠ t!>PJ>0@0/S0@!培+  SP`+ P*2P 0/S`0oo`bS M)pJ)0&000 SV+t P*+ P*Pu/@ q/@`JލЍS S S S @-W*@-M @/PЍ(0  в@P Ų P ܲڲP:00p R G-`dPPp X`p#@P Ѝ0S @ pE*P0 \ HpLM P Xp0 @ WS S S S A-tM `PXP HP4+³@P@0 @ ⪳⠳@P+JJ.0˭+Jx~J.0L㼭LvP 㵭PP|<m, ᬭPPs+J^0J.ᜭPPcr+JN JB`F ᅭPPL[+Jl7pd0\!0J>IP 0.hP UT ލP@[+JzJPPp0J.C@+f 8P h J>1PT S T T T #T /T iT qT }T T T T T T T W&S +9T >T GT QT /00/00/00/00/0@-0@4M#|0$P 0p'P\ ɷP0T0670 Pʣ @P  #4Ѝ0,U ,,O-AMAd2 ,000PB,0 00000 80s0`0Q, p $  ?(0 $0L 0s$00 0$l5 h%T` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&L"@(@@,0S:((0"PP@0@00 +0@080s=0 0@( VY 3W|Ѝ#ȡ!@&(⸵00T1 0P%X!00 ص*80`0000Y9(0S` ` 0 RH03/p`0Y80s Hȟ0Q 0 0 0  BR0S0pS 0Yp08 r  *   * PU0"0U  YP R 0S  !p0    P P 0$ PU$0Y0 0 Ypp0 PUYj0Y) w!P%:p0 0 0 00$0 0$0 0pS 0pW !pWZ 0 p 0P Z$0 0 S&I0 0S !0  !2 P2S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp0 0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S LP 0 0 , 0R 0R  `R  "P` "P 0 Q ``T R T  R X `( 0Sf0L0( 3/P <00S D0SS000(( N L0( 3/P 80<00S (0, S004 Q 0 `( ],0Q G0Q0Yg80sd 0*0 PZ 0WYpq  !QQ 80s 0  00UPpp~0  R 0S  F p 0 0 0 # D,`V ,,Y U U O--`M,p#@PVZ pങpPU Pp0Z:`PU`J6ERUB ||03 DK$00#h R 0  80s0`F`pHU p i%h0S 00  80spHY pPp V%h0l0 0L03/, 00Y:pPp咚p0Y0P80T5ЍO>p0H03/,0$ 08RPP0$P(<00WP:< R2*p,0, 0$` 0S `0S< $`Sp $ PR( P`"PU` P0 Sa@D S Z0S 0 `p8P0VS:00S40000040,0(pWq닟8`0[:pp8`"p0< p 00<<) `8q ,0,( 0L03/0 0000 0V `V0$0( 0S `" `V`P p0o  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P0H03/s0@08P0D00Z}*p0 0 `<080s_00\ <0 0RV04 @ RD0 0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  v V00 400P m۶ Y ]D,! 0 0Q4 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc ʛ00040$0$00(0 00 0S(0  0 H3/P+ X$ 0 03/p6  0L03/ pPpP$0( 0S pP" W00 40 00040(0$00(0 0$00c<#$‚0  0  0H3/P0`u 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S~ P0 P  R0P0v 00040(0$00(0 0$00c<#$‚0  0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0 $0`0(0d0,00Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8P  0$ 0S0p0$ p  Spᢖ`P 80 p0R:pYP Y:PpW00 U0#S p`Ѝ L0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0hp` o!8p 40U 00 0S 0P*p ` !_80s0 L0 3/P 08400H0, 00,0+$0T00X0pPF 00 80sh p !P=p@-@P(M6@(0S⻕(`,`0 00P0F0 P P`0(PP,(Ӗ(P(Ѝp000͒,6(ǖ0,`(P|- @ R,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1X!S<1\@17H!L0X!\Sp(0 ,1P"#0{@0$'8s0 ' l0 W %&, 080000, 0 0ٗ0՗80000  0'c.0ŗ0HLH0P (P0| W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000pp 85P,0ڑCXpW* 0GS0.(>P C$ 00S H @3/4pGWp @ 0L0 3/P 00S 0Sp003/J0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0^Q  01/ 0S 2 ;C$Є  0<Pl 0 Hp0  @D@0 ᄀX60X< Pl,0SpP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0&P 000,,U p408ȿ , Կ u6 U Y U 0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002  Ԡ`0SQ,  R) 0 0#Q! Q0 2v<{# 8 0 r  1# 000 S   4 1 SR0r01/,!0 /,p@-@$P x1SP 003/p@ٓx1֓P$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0 ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0I⭒pK܍ЍI≏+R*<o=(02#8 ;c&@@t u-O-`0@PMM,0h1h0p 0S (0 S> 9 H 00 0 <0.%#@~40kP`0V,p0U 0000000 0 00000000p 0Sp`ލЍG/ᘒ,0S*< #0+,0B#X0S000C0C0000S0 0,0B$P,t u@-@-k0  !<$10(10,1P001.@-@W0 0! 0O-4M\T`Xhp(0P  咕"\ @,@;/,P R7P ᕑPpK $p WpF2  0" ( 00 0`ᢎ ᜒ(04ЍO/P4Ѝ[;0p@-@Q* P 0 P40 Pp <0dp@PT 80 P@,0 P00 pY '(Z )2Z *+p@-PBM `@ 1 2 V` Pߓ 0\P֓ RBߍp`˓P00Sœ0`40Pp`库80PS<80  4X0S0!⠧@$妓 0 P垓\0 `0S ⊧ @`卓d0Ph0S z@l0S p@p0SH f@T`it0P^Y 9?VZ `Z AdZ BCEp@-`M<P@M   1U%P 0DPK0 @0S  P  L8PU@- 0 #P% 0܍p(0S p @h,0S H @D00S , @$^Y gZ / C"\0S0 `F` t夅0p⇞ 0S  H`,p WV o$ ጅ`夑 0`0"  &ߍ@呑 0  0S  f `PV 1 `S0N  `t 0  0S @0S @b ߍC<0040!00J@0Fo$ 0DL03/00 O0S !00{D` 0S H (D8`Y0,p x Q0X 8 < RFO     0@ /6@ 0  m R0_| 0  Y Z Z Z Z Z Z gZ Z Z &lZ Z Z wZ .Z @-x @+0 @0p0ГdJ @奄Z @-D @000(0,0000廓d5 @各ꐯZ @-hQ`0@sKMP!   01!S=0 Kߍ0 00@ @@0̑P(@UTpp (`0 b0  0`0`p峑}:Py:I1P/S L(⌆0(0 00)Y0SvU (!   0S `P0 1f00!15:%  ZP p Q 0, ($!` $ GP^ 00 8a4Q101T ,T-@,H[ ] ^ ] Z ] ] 0S@0@-S@00 0S/X-$^ O-P2EM 2@T P0 |2P p|1S$ $P| 003/P 02P ( Ӝ Eߍ$0 R P 01/0P 003/P A10SX PaPE  <0 040000,00800 忐pP@3@0S. $P+ 0 x0D 0^ (^ ,-_^ ^ $1S/pp@-@ PPx1`S^P0x 獅xA唹Pp0@-@\MP, ($1L 00T0@0@00 0000(00 0P$@z\Ѝ0AX- 8C`/@-08 S $0 0 0cЍX-8CA`/ 10@-2cA80!0CSM PU 1S a{/㑮P 01T1PP1P D ś8 8 B0R  Ѝ0 0  00 0 0  0  00 0 0  0  00 00 000x 00p000d00`0,,L,^ Z t-L &8- P+-  X-H \  @-M@P `00T20S'  D P!4 00 B\ \"00P0<  4 0 !+ IЍHPH010S/  V PP)a 00 BQ Q"041$0 000xpP0` 87/0P0 00!`0] U=00S0  " P* 00APU PU000 !̓P^ X^, Rh P$0⿙ ".R>,$^ -^ ,] T-_ ,\ -C_ A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0,-,-,-\0p@-T00P DPPp0AS@  1SA~p,,@,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"(,l0\ Q0/\P ^U Q0000@-(,0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@Ep@a< (@ (G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P_ K_ @-@PD  |0 ,0C(080<U 4<0 0 0x`0 6/Ѝp@KЍpH_ @-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $Ȱ<   <U Q0$^P 0|! _|Ѝ0,a@-80@SP`4Mc00 0⒖P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0㕋 _ _ z_ _ 0p@-PQ0M0@$ 0x`0 6/8 v`Px1絀x1a1S0C€10Ѝp_ p@-@P 4xP  [Pp0S@}p eP HPp0S 4! B! PP  3Pp0St` ?P R 0  Ppp$^ _ ] _ \ _ _ O-uM Mp, Z- H0cS_ Ce0SS{B0S ~PBԒ0S{IJB0S{2 P     P x2@    PP2 HD     P[ 0x0001 @@K @P @ PHPP< ,@ h@ ,D@1K 01R010|100P P 0~p@  PB{$ 0S10$1S 10 0Suݍ Ѝm~PaHf~Pk_~Pj1S |!R ぁ٨P #W&,,- ,T-,-,-t-8-X--- T ,@,@-@ያ00S @P,/` @-@PЍp$QU0 `P PP> C  01/P ,00 H$L Q>,80S @- 0 /8` m G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  R T P $Ql$00S U 0 |1 08ЍpP ὮP P Q i ᬻ P ᩮ  mP ,A-Mp}P8  U`ЍGP $A003/0 R   01/`P 003/@P$a0H03/0 `WFP2 p0803/PDA 0!! `b8# `00  3/P"#"#00 03/p p0` L03/s +u` 0SWp`@`C88 0U 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv u 0 |1 0=` 8`  ,G-`RM@Xr PP dNP`T `QP P9  ,fp i 0S  qߍ<0H(00,0 00004008004004 04$0D0(0P 3uW[  <pU l6p* `\k` 8  8Q , R  R R Q 0,0Q0 Q ` ލp 0`?`a8SPb 0  0**0P0: ' 0* ` d@edA` zd@Ma ` ` ` ` a a )a >a A-@Mp`;@@ Ķp@ݍ P@00@RT 0 2 "0  /O-4MFpT(t$ ,`&X\p@T  0 YY 0 0<R- R 0Xppͱ @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0upWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >t!4000㓛#000X    t,-( [: yT  ZP ؀!\R 0 0 B@0St 0 ?0@ H0 0S4 4 0a d yd|dtv&d {dЀe 2e :e Ce 0$\ (00t S S  S00/Q 0P/0S 0S P//!R80@-4 :CR )r0@/Ge  80R*@-0M@"P0 0! 0! P0Ѝ/00S/,t\p@-,P@0S0S< 04 p,@-@0S,A-pP@0ST 0S` @ P<0@P`V@,s@-S@P ' dvP zЍp<kP za`P (oPP )kP` NP HP(  `?P` D@ 5PdMPP 0SL` P %P @0`0@0se ze e e e e e d p@-M  vP ڔx @P"`  xЍpM0S 0 (q PwP xe e e e O-@QMM@P;.,@嚱pP}0` F┈pw p-00p$@ @Q&D0S8 CR0 [m 0 ⑂P[0D04@T.4@0@T50@`T$00 0 G p P P    00wP  p$ pp00#U؀w@0V  00# l#C000G `#APQލЍ04 040RP8< 8<0RPv00 S 00#PD t0P #xP@p Y #YLP@k P # xP0'% D00S00 D lأ0 S 0 0 0 `Ł@0x0#Q@#000@10 4㮁d@e f e f 8f Rf of f f f 0@-M 0r 0@S( vP\lxx0P @8]8 P$0$  B@5Ѝf sf f @-{s0SЍ@-@M sT0  CR$00S ЍwA-pP@0ST 0S` @]P0 0=00<00;0\ 0:00(0DЍ @ppW0`Vpi 4l G-pP8M@(P2 0S 0( " " 010 020 0008Ѝ70 0600500400300100000.00  ,0 P #00R R R l `P P 0h#(00202000Xel i p@-`PhM" P@0@$00| 0 0(0 0P0 0@00T00T 00T01T01T00` (6/UhЍpi 4l O-PM@8 SHo*@PT `PVr``PT\0(Ѝp!SQ0P ؁1/T 0040o O-DM 000 0 0 0 {p 00@4p@T0@4p800,00  (0$ gp ,08<\`?! (0_%"T0$ P_5#$<0_.8̅P R0^W  PSuT h"?L1 0@LH0 R p ? 0 /G$7@ T S@``000 00  0 p  R02# !"8 0/RSYL0 V`0 0P0pZnYXDЍ,/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    ;pЍO-`p @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p,-08S^:/-- p@-@ 0(  P0R0PS 00Sk  ppM-Pp`NM@< Рvp`0| p ` 000 ;㤣PP <zp9yNލ5y q ydG-xM` @pᜐ堠dP" !0@P 0S PU 0 R=H!H0 bBC00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZD   lYZ  $q q q q O-p@PBM M`/0;P( 0P@0P0iP) Y  $;$  %f P!14"S5 0S~xto@ U01U01Bލ Ѝ f0P0  e?XY$0 0I0,i?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q J @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P峦ɜ@ឦ@Q Q' Q0PUTi 0"0S0S0@0lgP P `@@=02s 2 02@F @DURX A- 0MHd l1lR/ fCPAg@P( T00z 0R`0 !?020 2002p$04 pKh0Ѝ! 0S" $0Q00 L03/P Q 0D Q 0 SD S003/p >-P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T i@ `Č `Ȍ `̌b` ` p SČpȌ` 2aaa0q1P gp`T8B{P08} ^\ 0Sp`82S04@11111111108 q2aqR 2@S22G040TP 2SX9T0S  q O-cMM00 QP ,00#.;0P 0`cލЍ0 Jwp \6X&`RS000o?00@ , Y 2S 1S,2,/ 0@0 Ḁἰ  &      0S@p!?⩻D  0 AeD U <  cPWbV S@ P03w P0dS 0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝs ,G-p0@P8HL041` \ S ^ ?Y R  0\ xX0?Pࠡ࠱000^ 0 G/,>0@-@0M 410810!b0 P0u0L b0 J0PU ! 5/Ѝ0,s @- 6Gq@ %p@-y@T 0]  wtt ho&@-<@0sWp(00pp_0CoX&I--$M?0 0 p$Ѝ0-4M 00 000DP4ЍO--pMM⸤D q " ` q|4 0 Pp0 PU00( 0R0PU00"R0*Pğ p$PD0S 0s 0SMߍ0S @P 0_3圓0S  1u|#HS 06ᶩ{ A0( A{{jodVd`0k0 #u32Q-AP AQږ2"cA0  k2 Bu 0Ÿ R#3SPhS0 10`0 L"k u0  $P(0 0SZP=9 =:pk{©1 AP09H A { Q 5 P;!%#3TQ0X A  d 0 iJ/ Ru 1 @P00&0` RdP* 2"%+0!@U/ %u@0Sdx u@p0 0 ppnY@.AI-I-J-I-@v I-I-Ev I-QVv ?w }w w w I-I-@~w w !P P60  A0 A k{I{7{Z\0U0P  t`d@<<P\fp0 t@ W/t@-@w@SRG-@  700pP ąP:`X:00X0 tPw @-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  SPtv&p@-@Pmp  `m@mUb700@pp@-P 4`mp@  mPm@p@-M@ op$ ЍG-`p@T2 P  PP0IPE GPP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝw p@-P R`@0 @ n0 00S  UP3PE ЍpA-@Pp Yp` j x0W0 xW0X U` 0X P 0 h0@ sЍU  0 P w w w w w @-`0tM0F?oP2p @BpWn -npmMn@`mp h2Snp L0V#4 - tЍ^nh"Ampp@-P@P@!npJPppp@-@0 e l0 S " 0PUPUp@]0S   0 0S w]u]0S   0 0S i]g]A-p@PMU `0S@PE7  0P00ۍX700#S @ Q@BPE@C0 00 pL0S 0#S @UX5x @-M@ H 7lp8oۍP  Fx p@-d1`0SM LЍp@r@>  <P  0 !   kp0 S ~09S E1Ѝp0 S   000 00P0 PS @ \0 6 p@%  Ѝp@ pZx x <p@-@$`PHZPp0 @ `P0 002 0pp@-SP@`xM  OAj0 0kp@) kp$  kp kp  kp  P  D0  p(AxЍpt kx <0 0 s@->@P`Dp @ p0 p`$A L01p @ 00 p$AЍpHx 8p@-@PqP  =k01LpP`qpR *k0#18pp@-pM0 p @: kpk@pЍO-QMMl700ۍЍ   Z ` @`V j@pP` @-`RH00 ЍPp@0STZZ@PT  Q*R@00 S   0 0S0 S *ZP `k[i[  00000`0 @@P0   <@-@ @M x L1p@-S@T1S"d1S,RU6lRUppbV7l0[lbp1C+[L10CL1SP$[0P11C[T10CT1SX[0X11C[d10Cd1Sh [0h12,P0C2bVZbp2,P0Cp27@-@0 PP$ H1 0D1<1-@80@ CB Ѝ0@ Ѝ0Q@-@  ;  biP p Z00\# Ѝ@ Q @ ,0! p-Ѝ@ Ѝ y Q@-@  0A  iP p ,00 Ѝ@ 1S70|rZ XP| 01@ 00pAЍ@ ЍLy @-t0M0@Q0$k)p Ѝ  ]y oy 081/@-@d&P0S  P 0800L0S S@B%y y @-p@\M Q t0 e  p\Ѝy 0@-800@@?L P@-@}p t10cSt14l Ѝ@ @d 0 Ѝy PQ7@-@  ,AU _ Bhp @ Pi Ѝ0@ P 11P,|1@ R  |e%JAQP x`00CS`0 Xp@ P0p ,A Ѝ0@ X0 X Ѝ0y o&n&p@-PDhp4p@ @ip p@hy y A-P@ ` 0|p8 , <UG1% 00 0 008 , 81AL y z p@-`<1P:<1x1S0p0@Tp 0S   ʌ0@-@T 0S @G-`PB,H0$:0@   1000  qH$R $2/ 080P040>0S0&0 GPp P W  g603?0 0S %/0p@-8@` Z40 :0pFP PpP  Pp%pp@-8a hh81981@-81m @ $!x1P 0r!   Ѝ@d%P 0 $!b Ѝ@ PU%P 0$i Ѝ@ 0| 0Yp90 , ,P5gp( ,hg0,1 Ѝ@z x z p@-@d <= x1P %p@  0S #PUp@z y @-t0@SPLM 0$Q0@ 'pd 00 p0 `P  LЍUxP @ x P' U` H10D1z z { O-@PP 0p4` R ( 0 08   0 0 XU HP  *: 0S 08   Ѝ${ 7@-@P@0H!D Ѝ0A-鸀@x0P P ЍA E 0 ` 8 0 0 0x1PU 0" 0SFP ЍA? $0080S  p, Aw p p@-| @-@@O--M`@0pRPD@T0Ѝ  P R+W& 080 C !0   Y0800 =X  R @@ FX   6F| C-MH@  ЍPPm q`0 P  , dpDP3 P P5 P; dBPE PLQ KE @p'   Q0S000 0X00 ! @p '@D!\10B0H1x7P @C@xM cPʅP| | | l| J-| | | @-@  A ,{dp SP<1 ,,~d0,1ЍPH01<1 Ph6} } k} Q/@-@  0S@C-q`@ !x? @P00@ 0S Q  9#0 Sx   0@ Ѝ 0 pPpV @P 0@0PET t x PP 0S  $0$0> R>  **fX  0S /@0 S   000x1  @  0SP L 0K0 S   0rt} } } } 0A-M P0 0E0@!0Edp !00`+c`pEQw07S 0 S X \0E 0\!`1 `Px1 ,ލ & R PpgP0 S   x0 ZpP 0PPUTxx jx x1p  P  0S 0| 0P} ~ F~ } Q@-@  pSA@h)p07S@Z0 S 0VS|0S@C[~ A-`R@p@M PsP U f700 @ЍA*P"R 0S 0 r>XU%  *P 0S <0 *qh p  <0f !V>P  *@ЍA*@Ѝd~ ~ ~ O-P@$MpM eP  EP 00A $ЍO6Pw /1P000 P`PP`VP`P    0PEPE 00[PPIwcSPPP P003#Xp`r 8118100x1pW*  bPx1pF 81181kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY Dp 000 0S 0 0pW81181$Ѝ  P YY  p A00W0 0 0 :0C WUx1  0@  R @ [ TP W @(0Ƞ0 0 0  UB U  0HȠ0UB 5 0S W xxv0P 0S 0``W`ʁ=`0 xx~ ~ , xh&@ @ z p@-@>Pp0?R02P?00F,003?00> *> 0Cp耼p@-p1PSM"`! #@P T 0p1!qV Q 0S X.ZOP <S@tAtЍpp>0S <0x1@T l1S 2  @>0S@ %`l1S   0 @ P 0  @  B.(0T#p l1S 갇 4 0 R/ 1/$J-/A-@P1 SXp0R> C.CqP 0`0S 000S \ \ 0 S   00S000@00P10 paU0NPv Gˆ 0P@-p0pi q 00P R0 U  v p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P@a p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $T1T| *Y@1@ CrC`01Vp(@1% CC0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@!N@P0S 0S0 @@v  ʚ; @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p, 0B0 0p"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ v P 0)@- k0PT0/v P0@- ^0T0/v //P@-$0$ M#08D0v @-,MP` %1U0@0$00 20p@000 0<0S ^p,Ѝ8010C>SH00@( ( 03(00@000 0<0S80 p @ v Y@-XDN@P _ppO@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p ~^00C08OPU 0`0H.O0HPLPU0 P(P0P0V00 S   0O0 S ,  0 O0 S 4  0O@-@@NC-@PM pb堂T0SY 00C01@0S D3/\2\C/ X(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0S/ L0 S* H彠P% HLH0 R |Q    00   CCU 0 HXK0SP'p0S| `ЍT0t0S 0S   ,r Q 03/PEU[ YW$J-v @-8 0"z(@ s&p@ t@Ѝho&A-`M4PspM ^0 cp@ %]@ۍЍ4F P P  ӣ#P@@#C 0 ,$@4   ?PX&ho&-@-   Ѝ Ѝ/@-MMP`@p0  ec P 0pۍЍ萉 -@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/X& 0p/OX&@-M M t \p P@;00 dSV 00@ۍ Ѝ$P0p 4NdX& 0/X&@-$@@yO4 @sOX&p@-dP@]; P4  PP   ^OT V00ppX&ho&SO@-@P8B>-@M@-@2 p !o]p !h]p`@-q@ %\01p \01@X z]p@-PM@` 0  0 Th]p 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MU?V0P0\ЍU6700@ p`R00 PU B0>000 <0N  ,> PP> *ꚉ @-@T<@Q/@-@Tb=@0P/- R 0 R00^ PG-`P M0(0S @  P P P: `P 0!00 0   08S0 00 Ѝ080 00S # `pP `P{0P 0iS.S  `Pk04S 040:Stv&0@-@PDM QP@T f00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-"000Q/Px1P/$0/@-@M    @0 [pЍ~iO-YM `F/@H9X0HpPpYߍ0p/K 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 ƍPAT1S@\1S`1 ⸍P5\1 S S R@L1SP1 ⧍P&L1PC_oSRPU@P04S 0s0P?AB@@$P00SLQU rIPPdh1 gP Pd1U\P H@ ` l 0[$0D  Hc `0 S #9X001H \0[p X0 RB000S0 15S4 S  CR.T X L@@RS! y r R02 > 0*81 000S ^p S 0 S `@@G0?H0p 0P0H0}>H0 @000L0PPP ̉ ׉  i4 @Z A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@Tv00 Ѝ R @7Z}Y-Ȁ 5S @0s0 50A % 1@ A  + A+": A !9 R50,@-`p}@P@ Ѝ ⛛0PXIIp Q,P ~}PPꀋ @-`RpP$M 0S0U00$Ѝ/K@P 0 00 0  0S dU ^6P P, T/00DU i6ꊋ O-`@0p"S0W"SpG` Y PP u700 ЍTUYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R  T0 `T 00T 0T 0000 0    00 PP 0S& T  =0 `P0A\0SP0S  =T PT0Ph tv&P /0 S S /S/P0/S S S/0/O-M ^|PPЍO=>`P ЍOBH@Y@S   pW4H<|PP  ?P 0QA00Ѝ=0@S. P( 0S |@P H@j`@fG0P 0 @ 0 0 @ @겋 p@-@P G` 0SPG$` PP(0S $G0(0$0p,e P,e PO-@/4M10C`pXPSh00 pHU- :`Pp $=P@ ⶙P7 7  '$ !0P`0@T\0S @U0 @2 0H050U( H0lh>0P uG0 F@PA t014ЍEP 0 2pA 0S 2POG01@ U  CUH070 0  p  P! .R8 Y 0R77@0U   0pP  H RU H0@1S{@H000|U P0H0r ,0 00 0 TJ,0S4 a f|U ,0!00 0 n,0 S L Uv <1F80w40b儒000 0 PPP00 0 P  p@0  @P , UH <180w40b儒0p00 0 P{P00 0 pP  0@H0:0H P 0<0UH# 0S /V`P /Q`P00 V /0P0 Q00<0000H060U ,0 00 0 I,0HSL  Ah 0A  ap  P 4p@AK0  U xU ,`P 0SU0 pH0 50h x050,0 % 00 0 p,00,Y`$ UPPeUp700 5$'0 5'@p 0 .  0 p P" H0@40U 0S 4S 04S0:006S 06S090 PU- ,0 00 0 H,0HS  U H0P SPH0;00H090U ` m`,BpP B`P 0%Z C>$>0g47S90>8g<7S:8>@gD7S;@>HgL7S<H>(>A>> 1`P>>1`P>X  P T0 ST47,`0C47<7,`0C<7D7,`0CD7L7,`0CL7O-MLM`h$ 0%=PTcxP E3&7 E0 + 0+0 0P70P7o H0E00 0:00 30000% ap cM +8 0 E 0d0 E+ 0 P#Z 1H@\0Y,<P0047r(޴P @5:q ؍LЍDYP {PB0 D  D 0 0<D;P078247024,0<'哸 R48=@,0D'哸 R.@=0H'87l"L'<7@7D7p"H7L708 _p0  9@0S R R P\R @0@ R $#P0 00 :?op2 000S002p0p@p(0 DDP 0 0# 00pDP P0( % @% P:P4 Z#d hMpP"(, ,0@0S 0 S S0P\S  @ :0p  PphqdqPd p(0 P$0S P $(0 P 0S P Ppp~ 0 0# Pr Xp0D00D00 0  0d 0 S E:$ E000Xߙ P @J-@  ئ   7 0Q//Q *///G-p000@0P ` P Y 0 0 `R:S@C@3@D"X HGU( IG'A-TpW0 %T`@V0? C.CL0LS @sP LIX X| |00 S HH0P 0RS 贝  p@-P 3@PpQ+<@-p@-@Pp PPpT0 p@1@-0@nT 0@0T0S0@- eB@G \ T0A-p `R0080810@: PP?W0A U t0  t0 p@F0S dp;0S <p? @U4 E.P P @$T T0Rt0t 0SdPt0 t0 88YPT0$0x x0R Pb@EP0S @ꃟ A-`P Pc_3@T ,T0pSH@p@-Q Mz 0 zBT0S0e PUx x0 BPc_`8@P  0 8 O  Ѝp \ ȟ  G-Pp0M $    P  I@81A0 81'P  0Ѝ |B Ἷ@T|   ᵿT0 R0 0800, P T8[p0SS90SSɾPT0c | `P 7 R|0   P @T T0R88lPY0Sx x0R ኿) ᅿT 00XXKPR P T T0R88:Prp0VS pc_ -@TG %0`SS-90SS)<LPT00S8 00 H*: S R  H p 0S 0S i@vT 00,X ݾ@P    ) = F Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-40;  0S K/00` P@-40QD  0S 8/00` P@-L0}O 0S So/00` P@-H0a 0S Sp/00` P@-L0o 0S S$0@o/00`  hp@-@Q0 eCRP0_ C|C0`S0 SQ 0X Mp@p0 p@`0 p@ޠ { 0P@-|0| CwQh0i CC P R !P BR #@K@  p@-PP M0 O0S0S 3?@c@Ood@T $S k0@0 Ѝpd/0@``Q 0000P 0 CC` HJ-0 'A-0S00@Pd` pW 0/0000Pp 0 CHJ-H nP@-<0<.Q(0v CB!>000` { @-@QLMꈡ C-`TM@ P `cp) 0 d ````d1pWp0`V& c @ 0 F@ cT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0꬇ -3@- P bp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  pp A-0Pp`@S:0SS 0? C/C  RS* R0 $*`V1S* ⶈP a 0@DpR: Q  ơ O-A 0MTP` 0 zy?@PA4@081 0S  wp 00FPȀ @P ;P 6P 1P ,P 'P p"pPp 0S T Cp D61T!R 09p 0;1#3F00&&*pа L0S% %S  p H p P p $  p  pw P0S t0$0Q0p < pe x0Sz08!K 0x1ZspLp M ̻Pw p@ X圼P0Td tp1  `p+ %P %P0 x1`Y@ p X00SXppW0h 1SP >p@4(sP  >|p FF upp%Lx lp~ 0S P |Q MZ T  Kp  r"BKp P{ Pv  Pq Pl P P X00S 0Sa Ya FVpa5%P `V%R^ pYw0Sb   ,pl 08!hpRcpO0SQ   8 pV 08!pAMpPG 1 R; 0S  P9 Ѝ 0Sp pqã  z Ƣ ΢ K P [ V   * 8 C L a w f - V r u p@-P@pp p@RRA-P`@@pL0s  S$0 U@ p@@@dW0S R H R U p虢 Q p@-P0U@S 00p @ P@ᘹ@T:ɱp/̣ o&@-P`1pSMAT  p@tЍ \ߺPЍ@!R 0, 0 0 :p@ g@aV 0 !Bp@zU`P Πp}0S pD00#40  HC< SP 50( 'ѣ У   A-PP 0S @0p 0S @@B00 S U   ^ @ .S0.S*0_S-S```&00  @R"0T0 0D0tv& @- @0P PT00Q  (DP `00CS`0p S00 P0S X0X /X@Jn&p@-h1@SPrgPPE @p 0.SSPP XP H߹P 4͹P 0  .PPߤ p@-@P'Uc 0 H0 tH0 dH0  TH0H/@,8)0& (#@        H0  H0  H0 H0 ~H Np@t IP     $ , 3 ; B M Y _ i q x  o& 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pPYp  0B BGQލЍA> 0!>0 0B Gp`0SPE@Ep 0S:0@0D̥ O--,Md`pP. f|`  q@P1 0S  ȸP@ ¸eP@,P$ X]P$0X21놽00,Ѝ P,P, R ᫸P,PE0S h R* 01f0 5$ R, R 剸P  5$ R R ,Ph!@P !!! P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@ؼV00ЍPWμ"0$?S 0[ PW RPPUT  P70 ᮻ.0 I@0 0IU:D X0 0 `TT  DSPO-Pp0` 2" Y*Q@ U Vw700 Ѝ$@@P`Fp  a00U V 00  P     @3 \Do   ' T/T$+\T0 U V@@U V\$0@00@@`FPpU V @`Fp~tv&ߤ C-QM MP<p`8p< @<;pF `FpX V=ip :4 FpTG    0 Ep P; EiP E/   Qލ Ѝ   p20V00T2 0@E p $ @pP0P@T*p0S4 p`@T*T 0 `Fp @ p T @ /r JFpu @ /r   2/8Fpc @@ 2/ LH   .0E/5PK E/FpE 0S @00S@%< Fp5001     A- @pTPM 8ЍR` R 00P0S 0 -0 0t0#0Q0 R$ V0B  00 0D/ O-4MX@p 0S\`d` (0S<0 `p40 4ЍO 0  ,   tHp0,0 ,0SPELi ,<8p 000 *_,.4ЍP V0 00 0V0  壵 0,pgp0\!00}) `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  09,PG c J k p@-P@`P 0S P$`(0Sp,e P,e P x 0>0@-MMP+ fp P0@ۍЍ0;0 C"@P +P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@g@T   ጸ0x@ `DPЍp`Vx1@P w0>0S *-P PU@EP PTP[`X/0P@-404 Q 0 9 C/C @Hh  A-` (M900>0@SP  0'0x B0epp ٷ0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0>0S ߸0xhPT깰 A-`|VPPFPP2X@p`Ex=,P x倂|"x20 強V0  i|20|2@-`@MpP! X (T (ԣX( 8p=PU@ T700@Ѝ ℷi///p@-$aMY@U 0]  s*PPЍp 3"Qp 000)00=p^p0000@ 0<pl  00 " 0<p< p 3h ư p@-QUp@p ;u,0x1p@p,@->`GMV 0P0Gߍ@PF/ 9  0>l0 p 1`0 DF?<P> *0 F?< ii@-@MP4@ $ P P@Ѝ Q@0@-< C⓵0SSP`///0 $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  P  Т P<p 0 00S p,Ѝ08i(p@-@MP , ` ' ⧢  (P_<PЍp:iO-PQMM@3@ C&T0S(3 CCpW 3  CC@H`"0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0 0FT0T(@)@@Fᣵ@  弱 T0R  B  @ Y? H1F0FᶰF @T0  ɵYI @T0 0F0FᶰF @T0  XP ᮵UPPEPP@ D$r 9p`ݍЍ  =  ⓵YI @K _ r  C-`p"0M` 0$`  0B,pP @T*Ѝ`)PPA   0*,pQ0 S *@ ``T*x0V*A00*T00V:0 (P|3P@ (' Y 80@Pꊱ @-`@DM pP@  Ŵ  E!> U 134  R2$ $@0 sDЍUi@i@-|@QM  ✴00p |2 0"x2:Ѝ@-]MM`@FP#F9p PP VR 000S0S S SS wR0S HapVPS CQRS 0  Vxpb@P V$0 Bp 0S$H` / ᯠ hh:p 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0 H~!>50H \03:p\60S 201S hQc0 0 000 0 0p URZ1S SN F FR]ލЍRIx@P= @3 03P0 0- H&)@9TY$0S! HM PPN0 g0~Qii@ @-40 000 0*Ѝ䬱 2S/2S00/@-@@屴V002@-S0@0 @@壴V0002S V/ܱ A-PM`p (PBP'@P. 0LL`08p0 ,!`>7pPm0Sp ^9p PU0S 2p 7(@! (⋟( D9p | P=9p 7/PP 29p :&P Ѝ@ qB@ lBpBfB@O-@p`0$M00PU  70S;P  0P0S P弱 00SU 1 !  N0P00 0P0 PPP0PU:000y $Ѝ@-  8 ЍgBp@-0M2S`P@x (⻲VP@0 \(8ꢳ00ލp@  B-$M^ * ! 6$Ѝ@-@7 '@'@-@pp R8p`~B p@-A^ TI00p``0@D^9"000œ\p@Tp0,p/0/Rp@-00@ ^  0s# R0ppP0QRO-M@@00`1Q V00ЍP0p Q :8Q@SH 딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C (&P 0 B0 姱 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S8Ѝ@-@\0S u\0\0@-@`q0h`50`0@-@08$@0p@-800@P >0S0&0T0'T0x1 RpR 0S TT0Q  0800 >0S  p@ p@-`PK@%Pp00,000S00 /0KpcScO-@GMpḀȐp Gߍ0RS*R?  0 000K C$PP d0S  GRW ( Q  R p(Qh 0 00> 0200BS *⟰0 370 RS00 Tg K4 $ `BP0`  D\W Wd\ h00 P h7 ?$000FP@Dp$P DPW0S <0S @FT60000<0 @0W0FS 800006 S0@0 0Gq2!31 0 b %R  FR0+  %A C %0 @W~ 8    FRp2   0@08 R  FRb3   0FSW 700 0 02@,0 " R 07 ,04'R SH5 FP%*p9SW (1S 0 F0S=00(  ⹯(100@0S W0 2S 0 FS<0 0 " ⠯ 20@W081 0 Z00 FR P0@  2S P K0 FSQ0Y0 0 2 0000Y00 @  3@W 00  ^00FSt0p0p@x 6S 0`FS^00 &A A 60@wW0=(, "r  P W: ART ,00,S P R:(, "r   PW: ART\  ,0  00D0C0W0 0FSL900000@ CpD 4S Y 0 FS8M00 $A Ѯ 40@B?S7? B?S7s 00PD0 KS:KUKe 0 S0P0"1P j0F R 0   ᥮ @@ 08 q#S [  cSc25F a 7@-P\ R&@P\0S x0xP08  Ѝ0P 9@ 00=p,8(\&z @-PR1 !`0@ 0p\ 0C R1 00 R0  06 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000000 00wp0 00kp0 00꯳ C-@PTM !P@, 000`0001iH00 P00 븀x0`  (#0(10: P  P( # 8u@  ' 0ta P( ``(1 (1  0(t!p⑭0 +"70 (P 0 >``v`| P( `"(1* (> >Qߍ 0*   &   0@-p M$M0i0PS` 1!pp1p@>0S i p ۍ$Ѝi@ 0 7Pp  81Q50 00pP P(  0 n&$ G ] @- 0080@P PU@ 0S@ `P@Ѝp 00O-IMPpPHLL `PR @P0IߍO"0,0-"600 02400` 0 p00,0 PS2 V30$a2@0 0 !,0T:0 ` P :U@PIߍOJ@:0 P 'V`` 0\`0T~:0 8`u:0 Pꉴ @ G-@pPQP,b,`2S#PU`,@ ,x7P`~7, Q 0S ,9$p7 P,`0ȴ RG-00!`p@0PT:p T  X ⢑00U *"0 |pЍ0R0   @90 47p 9  7p p@-RMMɬ000PS`B S@ 00 0pۍЍpd p -p `F0D9, 7p V @- 81SsQ S0 00 0rPЍ 0SHDPD3pO-04MS@ h@@ `_0P o0 00 0 IP |3 00 y0 >PX3 0 0S0@0e;00T0u @P0n 00 0 #`Pe 0 $ ( _X]'pPv 0$,0(,8 P@ Z0!   Q*"00pP 0$00S  $0 j0(0p,00t0$(,8 WP@0Sh0` 0h0 l \0304Ѝ 00 !0 pP @ |Z{0p$00S,0 P@,0$S  S S0t0n0P !R "R]p( $^([,8X P@  O-P0M040@`0 `2''`pp'`W9 pW6l0S,0S`,0r0v 2S`,080w0v 847S`,0lr0v p"Rr0,p802 Sp0匳0g47S 08 0` spߍ0(000 `2(p(`  `(8 0 Xp (`_ 0 Np 00 `2,ep 7 0 ;p,7 0` /p'0z0,804l04 40pl'0k@0!04,0" 40 p]`]`d`k,0 !P !404ǜ R10 `"`P' 00$100,0G0 ` 0 X00, }R0SMaP 0H ` `  00,p6S  ,0 !P !0 `"CP 00@ 0  0kp,`ꐪ& 7 I [ p  @ p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@.p-@ Ѝp ` 0.p )X` 0.p  ೨00; U100.p@-p@`P81/(080000'0S  0R  dp`L Ѝ@3@ 00pA@ Ѝ@ Ѝ詵 HO-`@p 0帀SP$H` 000 0 0 `00`0! Р80 `  $6 0.0003H081y H ЍO<0 $6뜳 000H@0Sp3H000s$8040o6 HS 00008 R#:kg{{'{z40S' zkg{{'{ z0زS+d0S( $0P$h0!A6 00R::kg{{'{*zd8 S zkg{{'{* z0$6 00H0S0ST h Q 0R<0S 0S11H000s8040 P14 P18 Pp10 #\d00@0S0i ,W0.0 0p 0h`  P0 S/0S00H} ? P 0dh0 ЍO Ѝ ?? ӵ ޶ ص  ! A 8 + A T A-@PT R0A `h0`  | R 0i0lP 0S <0S $]5    .p0 g p pp0 00 0ppH0  u00 0$0 F#5 FAd0h0=k O-R@`pP\M$P X0 #3P 0 RT0|00 p` hPP. cL0S0 0@S@0#/L0} W}?I00uP X0 "2P 0 Rzgjzzz{T0Jd0S  $T P $[ <Y y& H" @"p  $P(P Qn,  0  <  @ , D  0H  <48`LPPPTP*pZ HpS 0 0PPI  p0v` 0h10 p: 9E000|@0`0v) )P00 0\ 0`v :04S 1S0810 [p  xX @0 4\Ѝ7S zDط ޷ CDC, T a =  @-`@pP`0 )h0X $7S R @`00 , ` 3 0 Ѝ@4   k ط f p@-P@ $ 0 00L0p@걸  p@-PUp00CSp@0@ $3  (700i0L0p@Ѹ  A-`P@ p_J800 a B000@ 0<0L00A8 %  Y4A-P`@ 0h 0R0P4 081HAvp` P 081( AP    ' Ph0h  B @ 0d 0 P $A' Y b h00h0 C-p@ PR0  R $ RP508Ȁ `3  i@0S PP s P0  lH81P00  5 000 0 0 4Ѝ00 000 x2  4Ѝ0@껹 0p@-8 `R@   P  8P AHp@KPpp@ p@-@P (h00h00L0p@4չ  'G-px0Ѐ7 @P81 0S; 0 S<$G1  0 <`U0  @ R 0P )ЍG 0PS 0 PD0A U0 00 0SЍGЍ X cSc( E ] y 80p@-800@P  Hh00h00L0p@$`AF\iꓺ \/0S/0> d0S  0R/B. /괹 O-0M0000PS@|T0`Sp 0 ЍOu> R*NP 0S 07S ǚ ǚY  S0  X!  Q 0 S:500 0p00 0  ЍO Y 0 0Cs0'0S0 S0L0 x p    0 P 0 0 (;F0SY0A060@ 600 0p0 0  `P  J0 S 081\wi@D6P P0S0 0<S<0P0Ѝ 0    0P 0Y6S700S00 l00 0EP Rl532Y@0KSK?3@%05,0 Y0S0   P   D [ i0 x4 @0S Y0 % 2)  Br  Br0 0 $ 0P 0   0 ]Y 6 0 g |3@S R@00Y$00D000<081(300/ P0  P( 000Р 00 0 0P00S* SP 600 0<kPx0 0S* 3P   pԠ`81  000H 0 000 `0`0\0S   0!YP9 0 8 R @\1ЍO_Y 0 0nY 0 >0Sv00 00 P0sPg0 2  ps @ 0ЍOz. x ЍOg Һ  / ? Q ] h x | л 6 ޶   & C p@-@l PTP. 0 Lp@ `D N\P d  p@s`$ G-`Pp 0x1@TT 0S R T0S> R*}P  0 E@꾼 O-4M@P)P Q0 4ЍOPE UPp @RL RIUD:paV@ U=:$ P3U0:" R-   P% 1S 0Q00R0<2  rk  lP -  0_4Ѝ0 C 0 B<ؼ p@-` MQP\@M   F0000x >p 0S L A@&# ۍЍp 0]`V \@T) $A- p`@PpA PUP- 0 HA 0S 0A \0S 0AR _ G-0 ;M0MNp`p Dd`8ɞ0 P480EL80H8$0ED80@X@8<8 ` B@W0` 0E 0f#p$ݍ0Ѝ`x   p@-@PT ,* ((&$@x1S0pSq W#02p Q#02 022p R Rp07@-PX0B @P 0S.0>8 Q0'Q'+ " B r R "'    00 Ѝ0@?}t zgjzzP+S, @ 0| Ѝ0zD p@-@P0( Uph0Spp@ O-P`@T Q Pd0S r 0  0d0GP0BQ 0S 0P 3,  0800 |#  帀81- 8 0 $ 0R0hd`h08 R0 , 00C0 ;0800<0  P`00 ,0 00S $0 pWp1s00 2   0P C @R 00pwpWH0H0Ht0p꨽ Խ ӵ 0/@-0P s0 @Rp@-00p0`PQPE@ `- @d@$,b p0P @-P 1S P/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScC-`x1TM@T. 0S pW$ P # PP@0Sh0S d0S4 Ux d0 0S PPTЍ|0d 0|0 00Od0 00I090 ⴗP] ⬗ PU9$0 00 OPP 00# d8dX ᄗPP ⢗|0d 0|0XxU" 38PP | VPp|U0S P 8 P  JU` 0P < 0$Q S "  Q  $Pp h  5< 0  `{pP; t0<0t00 00 80dxQY X~ P U  ߖpP ȐY $0% h  5< 0  )0<0| ^ *Ͼ p@-PP1 yC( 8p`K01S G0S C0S ?0S  (0 @T 0Q0 PSP 0vU d0S0h0d0p@  p@-@T PP@0p/ G-Pp`P@Ѝ0E @P00 4 @P 0P000000 000(90  %$0 P pEp(0 Op0S <z0 EP  0@R 0 0000@@S ` I @-@T PQ0 8 00*:SR h0S dP H` Ѝ$`  Pdp (0Q,0Q   `P #800000( ,0BP>0S  0h dW $0Q 0h0d`0SHOꗿ 0S/0S/   O-MPH0<`R8 0@xP00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs |@UЍO4 @PЍO p    @@0 0'0 $ Sӿ ` 0S/G-P@M T 0p `x00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p T PI 00p0000 S0 @00:S 0S @\S000@:S @PJ-tv&0@-P:P@A0 P\:R \:\P@\\ @R0/0\& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO0E`VK `0P0E@ PP 00pCލ Ѝ@@w ;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S  p PP ;000P p 0S#0 0 03p8`@Z + 80P R 00SF I@ E@ 0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D h 0SQ Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0> P0@DJ`F  0S O 봘 002  @ ` P D,0~  ~,0@PE P0S ,$ D0A00T* PP 0P:SVrPJ-0\& @-0  0 Ѝ@-(@ P R0 0PJ-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ w0Pv Ps @ R Q0;#P ލЍ w0P P 0@PR0 PP U L#P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  PJ-tv& p@-@PDp@NG-`= @P@ d Pi 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY~0TS @ ASBC\ 00bC|^\ 00:0 0 0Pd 0:SS0AR0@A P Pd p A-p= `P@ d4 PPd0`F' 00@0S @Ad Pn Pd0 :RRAS@A ~ P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P }!PhJ- G-A0SRPp`ʏ PU00Ѝ P00CS0aQ Pp0 YY( ÑP O, KP P00SW  R00S 047σ,P R   S@T PR   R hJ-M-! pJ-@0@-0S |P dPhJ-Q-@-@[P08GhJ-p@-P@PPpPPphJ-@-@FP Q 0@87ST hJ-Q-p@-@ PS P@p p@-@P * 0@87ST hJ-Q-O-pWP`@P @ ЍZ K P PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  օP00CS0FP Pp0 0 / h:Z ᤐPD 08 ,P P00SX00 S P P00S  P P xP \P DP ,P$ :gPQ-$ ' 0@-4@0P  PQ-) X0@-0S ;@@0@00DJP0DЍPQ-Q-@-@`0P0`Sp 0`/P PP ЍQ-@-@P08DQ-p@-P@PPp3OPpQ-A- P@`pPЍ0 `(0P84SUP @Q-@-$ 000B;P ЍQ-A- P@`pmPЍ0 `(0P84SUP @Q-@-$ 000B;P ЍQ-@    /0A-P<<`0@ <0p0D0& SQ| 0@/0PA/A/O-@PD֎pDpG``b0Y:0z  Z# 0@@D⼎ 0DA\0:Z: [=0 S: p `$ Ѝ `pU-A-@`Ppᫍ J᥍ D៍ >ᙍA 70@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pyp TT0 op@ Ȉ<0@j40 4/(00S 0TЍ4\& U-A-`@ 0s P00p0pGWp0PP @P @pT 0@@PP @U-p@-@P?@0 ?@0R:@@pP pU-@-aM$0Sj Q1@ 4/1@A C"+4/%0AS&0  S00PpDU7/'0pS(0  S)0S*0  S007/ ,p0# Dn7/ p0# Du7/ 0p0# D7/ 4p0# D7/ p0 7/ `w0 6/0 P5/ЍU-4\& O-Q<08@0(00iPR @p4`,@48pT:(㙄)<0( T:(㙄)p@0(pT : Ѝ  030IP@`(48p00 D3#00@ `@4<08p4  b "0 0, `0@80@;00 4/0SD0 U- 4\& p@-@0`,0DPSp1S@U-0D0P/U-G-0DAMHPMU-`000PP, p0,0v0@00`o`SLXp Xx +po A>004@ptpG0SkX$0`S Dh0ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00]\\>9`D| <50,`\PPDpAލЍ墈pP lP 00PpWA C9RQ  0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0h0 :/1, !mP 0H0U-4\& @ +" , PV-hV- 0H0S/U-0P /U-@-DAP|0`SDM)0S&0S S fy0P 0P@ DЍ pW*P 0 000徊0ppѐ@ `0p婐X0 7/0S /0SP 0 P0DЍ@虊U-hV-4\& G-\qPL @0P12C001b5R 0 0&0S  :h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00P0S0PS ݊&0S,P P,@GJU--!\  0L0#0U-@-p0M  L0@31 ^AP 0C! 0ЍlⲉU- @-L 0 0@11D ^Q       U-A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zᘎ$0 HD@,X#1010 2R01   000 S" V00 S 4 ЍA X 1(410~X0威42 GSV Q`ЍQ0S sЍAm`\c  Z; l @l%0S Z )d0@0U-| A-Q`0MS 00S` @P9 0s$@Ѝ ᤉpW   @圉廉0p0|0S0S @Ppp00FV@@P 00T l@忈p`W 0S:S* 0d 僉0p0ppU-hV-O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1⾈h L0C R P!050%Pd @T: @ 奈0 p[L0CY1T*Q@@U-G-qT0So:\0`S&; 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  20B408@S 1:X 0@D8C 003 c0?o< @@D@  ᱈PP  ψPOPP 0 @ S :    b01"!00000P00-0PU-4\&A-p0@@ `P PP0`0P P@l%Q *0S  ῌU-$00S:@-@@RU-@-PP` U(0SP@P )@T \0@T0 4/J܍ 00'0S 0 $( @tЍpU-4\& " O-$MPpPeE00U0SXc )Z@ D3@名<3 4/W(0Sp0eWD@XU0XZ5 0PPW00 # 30+*[@C@dQS: BL{P5 KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@21 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   %Q   ᴋ0@P0'0S 0 H0p$Ѝ*0S  U-4\& PV-" @-M@pP0aE(0SWTP )@T; 0@奌0 4/-0#880 ^P0Uu@P  d'0S 0 x( @EЍr@P %Q|0S0S Pꌌ 00U-4\& " O-@QpL$M(0S@ P zP'0S A p$ЍW %0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*HD4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp勅<t`0<0 0 pP ΅PP% 0   D  弅%T#2QZ J*0T00S  DULP )PU @0@噋<0 ;4/"PP갋 005U-" 4\&PV- @-L0@'0S 0 00 0>T Ѝ@ЍU-" M////D\&/D\&0p00/tv&0p00/tv&0p00 /tv&0p00/tv&0p00/tv&0p00/tv&0p00/tv&0p00 /tv&0p00 /tv&0p00@/tv&0p00/tv&0p00 /tv&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/t&` pg0 0CSp0 S PE0 /p@-P@,`Pp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0p000 /tv&P/ 0S S//0R/00p00/pv&0p00/lv&7@-@P@@P 04PSPEd0 R Ѝ0] ^ a ho&PQ 0S///|\&03P 0 /x 0 ACP 0ABs0P r CoSPS//O-MX@ @ЍOSQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!`PE`0r>T 04SJ:`\H㌱  ᚈT  QX ( Q   u ⋃ Z P   ȈT0`[?oT20S@ @ @0R @T`0-@0S S @0V @ X 1@@V X* 00`00P 0 ` 00S00/7"hv& 00S00/! i& ///@-@H)@P [( K @B{ho&4 7 -@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P @p@-0P `| @P  \*. Q  Rp R  (  p 0 B tv&|V-qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00u Ѝ0S/1>3 !/0S 000/|V-0S*p@- @PN P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!n0`A-PRp `@{P 0!ʆ000A-@P`p쁟0 SV1 V00W W0Sc0 P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA@ A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (qM0PA , (0 ,Pt&pv&lv&A-`P P0PS\ ]\ xp@BX T 0| PቀPp\&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00|V- 8 0 s000/`Q'Q!//tv&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0n0 "0 00 0W|V-p@-P@,`P@tp Tp` Q 010//` ,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`t&pv&lv&O-P 0R@pM @z P&  $s P 000Ѝ 0@  KPP ЍO 0 PS@  0 00<00S*^Q0R08 ]R00-R ((g Q* ]R -RS\T0]Sh-R0 S^:0S006000S80S 00000`d0xS ,ZGV ,0Sl40Si$0Sf<0Sc(0pw_  0(`c0 @`F p@ gUj 00C0e-R [RS :R =R| 0S: R 2S0S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``G0 O0I~P   0y S0<R$ JP    wP  $0  0$ 峠S0hS0`0`0-S]S0`S0`0= 0 S:0`S0`00S0 -R[ QX]QU -Z00  YJ 0S- Y0`S 0`00S0<Y00 Z0S  Z4 0-JP / {y400!0ⱐᲠ40  =P0S 00100  0P  +P{ U [ 0]SS0<Z*0 P80 P <0 S P p`v`00勰P00 0  EB#ЍORZ =RW ]RTR :R ]R007 t&|V-tv&pv&lv&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@tv&pv&lv&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xIPu 844U\ 0CUUt0SU 0`B t  | 0D OU &83U N 0  , 0000h30>@0S* *Q2  0  B  BI   B0  B=Ѝ 8 0S 0S 00t200}PT\QR {RO00r0PS;* ,R8 Q 6 2000/ ]U0 R  !   p0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \h V 1L  0 S *R \R )R003 0S00000+|V-)>{^ ]tv&@-0@``P?Q $0As R % S 0 ^Q [Q \Q 0S Ѝ{Q |Q?20V:0S00500 @0` V1@`(P G0 S*0)S  ) V 1L  40 Sf:0S00p4000 S**@?PQ{PR ,$  "!,Q 0S 00300\0 0S 00300?P  *P 0 B5  B   B0)  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0@20z`o ksi0V:0aS0`000<Q >Q q`x+P {N &   B 0  B  Ba  B5 "X A, k0 `S0* ,R-  0000< V0 R   0 S*}Q00@ R 0}Q 5000S 00T |V-tv&^ ]0S G- `M pQpG ypL:@P 6W: ЍPEPP P $PPxP @~P 0uPP6    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0>FP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 f  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S* P8P@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U! R0>P P PS 00 00H0@0 @000 0 R00d000F 80S@ 0Q10CRZ/TUUkWpLW|V-Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0|P`t&pv&lv&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@t&pv&lv&O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  TYP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(tv& O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0, 0(0 000@$002   0 X @ Q  0 R  R  PZ$P  (    R    ``S  R  Ug h V pt p r _U RQ v   _V R up  r   _U R w v  _V RQ ppX u0] v  r    _U_V QO  X 0FP|u  p $ V    upv  w( ppu  v X pX wX0wq uc v _VX 3"  Q$,ZS (  `X S 0P&v u _PU PRPU00000S 0R0 4Ѝw`Vw_SwPu4tv&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0800@ 0 YS  D>31># R 0800@ 0 Y_  DS S- S* S( @` PS 0e800@ 0 \Y  DSU S S 0>#0FϠ2@P0  @P0  0P P 0/VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  TP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(tv& O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  OP ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E0  ?oR20SpG pGP x0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0/PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  MP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(tv& O--lM%PQ0u @%Qp ppm        Q 0"RS. 0 YP,Q 4^ 8[ <``F0 0`Z01S` 0s vQBo \R 0C1!S` `0#j0 0Q[0 000,@4H80<@ Y PP 0 TX\ L0`n Vd 00 S`FY1`0 0 0`,UP XD0S 0 0D0,E`PD00D0 0R < 0JS : LP Z Z `p4`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$0 0D0,PP5DQ/*0 F00,`PD% 0 00,P0HP 0000 0D0,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y*,Q 4^f 8[c <``F0 0`Z#01S` 0s vQBo \R 0C1!S` `0h0 eEt& 0Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S7 0 0D0,`PD00D0 [ ` 0R< 0JS: KP Z`XD0Se 4P,0@P4  p4P (HP $lЍ,0@ 0S%00D ;0$0 0D0,fP5DQ/*0 F00,%`PD% 0 00,"P0HP 0000 0D0,H0SPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80S 0o <``F0$0`Z"01S`$0s vQBo \R 0C1!S` `0g0$0Q0 000,@4H80<@PP 0T X \ L0`lV 00S`FY1*`0 0 0`,7P XD0Sc 0 0D0,'`PD00D0 0 S` 0P< JP:$0 JP $0Z`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$0 0D0,4P5DV/0 F00,`PD% 0 00,P0HP 0000 0D0,H0SpPHtDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPppp pnpl-Ѝ///@-) // //0p@-8P00@S PpaP pV-7@-4P@0S TP Ѝ0P V-@-@P 0S f@P/C]P0 0 0/ /0 0 0 0 0/////0P P@-  / W- P P/ /0 S/ 2#0/̚O-,Me`pPR0@X$*$0S$00f 0Z0000\0 0 0 R0030#$όZQ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR#  0 B 00Y00S  00C 0S000b 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SB0 S H$0 0CR0%2 L Q1000 S 0!03 BS t0 S 0 0iP $ P @ $0S$0C[ 0SW 0 0,Ѝ 0R3Z0B\\00S SC @PTP>: 0; $ $ R20fQ0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ { {Ѝ䴔Q0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`&X0O-M@0p`W PV P'Z P2Y PyX PV P:$  UW Pr U  UV1  U UZ  U UY;X% h UT 4UЍZY!X3  U ,U  U <UЍ wU $qUXVZ  PЍOlL4dL$ O-@Q0M0R0`0P|$0x 0 pP R nRk a BR  $  , OeP Q DIePL Ѝ3 00>eP~Y U000T0003 0$0+ePNY U070T070H ePY} U000T000 PePY U000T000YW U080T080 oR 0dPT000U000v ~0 XdP 0 4dP 0 `dPjYL U080T080U0 tdPz 0 dP 0 |dPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t bdPYv Y0 hYdP 0 RdP H P(  0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  Wp, 0 hp@ hp@  Dp@@@dh0 PhhPh0 P0hP`Ѝh00@O-1M M(@PDdPp \"(` -p (-pp^8 @D;@h@ 0 0Sr pءp 100 0`00p@, ` )@-0p t0)0x ]P[P 0S Rdh001ݍ Ѝ]h0S 0F\ R Pp @0`!@DD4 [@ 0 0 0V   0X- 0p,R 41ݍ Ѝ"p FtHx @ 0 gt0@-P@M 0  PKp lLp@ P I Ѝ00 0Ѝ0@A-@@0s/ PP0P 0!p` ``p0`0gppeX`p g``Y0`0g 00꬇p@-@PCM0 /WP2 $,pP@ ` @g0003t0 @ 2{@P0F0 {@Fy\0S VS00 SCލp|@@0SYg@d00P0@ \ P@1:mg?00@gg00 @}Hp@-QMP4@SMZ TF /WPC QP0s, ybP!@QaP 0`"!pO @ 0@]qpF @ p> ۍЍp+0si/0p0 +IRf@0P0@  P@1:f?00@kp 04f0#S5p@ f00f@f@d}}|%@@<|@-sP`O-$(X,p.S`P@+Wu00Sb [0 0yKP:[$" 2Q%> !4"0x"3S20*rW00Sa [0 0KK P :;! "#.0P@AQ#Ou0 {0Qp w{_ .K P :;$" #0P #[0 0KP:t' 00{S' w{P c 0KP: :) #0P@AQ#O[0 0J P :[y'@w{ 0JPy: )Z@0S20o2" U%> "Xw{U J P ]:4# JP0S20S2">" R01Q"Oj0S20YD"""""""""""p@-@M@ TP, `S 0S1h! R 0SL[B 0407+Q !POT d!$ *0C 3S00 F< {{~P 01C /AFPV$ 0P  [ `0% [ P$0SP (Ѝ00Z`F* 0C!< R Q!h! R@, Qp0(0<lx0t|`t0p,0x0lp| (0G \9`00W1<PSQ_ }Q) ^, S*P008$ 0P 1<`@(Q( !hQ0Wp0(0<lt x0|@t p, x lp0|@( P 8$  L A!h! R"0, SS:p0(0<lt x0|`t0p,0x0lp| (0 00W\P<Q`5 LS 0,^0F <P0A  0=R@ ;@ %0@Dh0(00(0000,00,0  F 04P S F"x  RQF#0 SF P\0s F`0d   0 Q0*0^*{ r0s{P T80<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS $R" :"  R#Ό01"?!x"0w$00$0s 00 0o000k0S <\ }H NR LX \ @0DhT 0Rk{{AP{$hE` &0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dS0 {{ {{{{{{`0{0{d 00(0S  R $ R Ÿ\ :6Ÿ$4&60!$ 0Ϡ! !>0T"!!!0C 82 P02@.3H0/#0Ϡ R  " RD#L .@0L  ?8 H D<00 0#!/":N6@ 4$&60.$ 0x.>Â!!!0C@ \0RDL,"΃0,ώ #1 HL  LH @00SP0D 0 0T 0 0SZ{00v$0S"xl$0S"xc0$0`P0@qpL$""""l'.%Q(\)\²0 4080DP @V:($^0Q<P0L 0=RH FH %0h00c @D0D0@YD0@#:6D 0 0@ . 0Ϡ.>! 0!!!0C" R 0L  Ό D"L!Q@X?#"  ?00 #1?B! H " H D0 L@0S 0\ 004 0 20DP :P0 0<R$0h00c 0D0@YD0@#:6D 0 0@". 0Ϡ.>! 0!!!0C" R 0L  Ό D""Q@?#"  ?00 #1?B! H " H D0 L@S0 \0#i0  0C0  BQw $0 h00$%S 0dR  Pe@D \DDDQT&@0TP08<1  \0H Q00000S<PT8< F ! 0 F! 0 ! 0S(0S <5@0P : c 0D@X0D0.:@6 D0% 00@. 0Ϡ.>! 0!!!^0C 1H02 >0.D0LS@/2"́ ?0 0 #1?B!  D0 @0SHL 0Q 004 0F000$02p rp t t   0 RR  0 & F% F RQ#u!F RQF# &f(0S@0$0D00{0<\v=QqH NRL0X\r@0h@0D0D0G0 000$0@0$0= PT#RN RK  \Q?% 8&<0dP(003( :60 0!$Ϡ0! !>)0!!!0C P?00.!?@ /" R  " R D D0 @ 0#1A0H h0 0%L00@0D C00 00S ^0  $0h0 C0000S ^  0@D h0 BQ0 $0h0  vps; 0 *R" O-Mp@$]08l0]0W`0 T' 0 2c1 0嘐0 0<APP/ 0v> 0`0?d000P0?T0 00#?<0 0$$%"P˟$@ 0000  000T ;0h0PM 0TP dP> P? $`Pj0Sg Rdʰ R `ʸ R \ 0 0` 0`@Sdp ?O$@T'pET0}Np0`@dp0M]0@D 000000 0H0H0PQ0l0X0v^D 0h080P0 PEt PQP0J4 0px|PUpR[S S  h@p| Ux Zt 0Sp0Xl0 Rh0 Rwt [[8 P0:=C 0p00@t0p` VPw x0S \0t0p00@ 0804p0 h 0TP  0| 0ȟx0\ Sv. !0#/!! !./ŠϠ B ǟ0S ,?.Q!Q00#1 ?Xv.C BL\S|  Qxt Ptń\ 0 qp  A 0qp `p V@P0 ?oR20Sa\00ߍ 0X\0h0qp@p0 T   Q+! !pS@-NRp* h0 P0,Pa000 `0  ZR 0`S 00@ \0h@ r\0S 0V0ZS dh `Y0hP0? T0P0h80? <0G0h@0? D0>0hH0? L05X$`\TZP M`[T00[0S@Tp1ß"bZ2*:##c2S$[0S- \TP)h<#PP  hß嘐dT0CL30@p>[0h00 `0@4p P8P ? /( Rß&0Q 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 EMqp> @p(pdN[#00[0S @㼰p h @p[00@pߍ輰[) [[ʔ 0Z0Q  s!P ZT00Z0S10(` #ΌQ0"c01 2c1@TeZT00 ^l)\P(\ ףvɻ %I$@-@ Lp  T4at X00 R 0 R 0Q/  /  `Rp  DQ 0@-0P S@@H  ^0 S  Q 0#0S0(0/QH  Q j.0 0#  Q/8Q00Ɠ\ 0@-pPo> 0@" \ 0 /PA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPOA-\@`@DP pH@P0& P @PPtOO-@ M `P< p p$0n@0PP P p $ aP pP0S  Ѝz T0 0V ES  ?0`0SNDA-pPQ `@Q *P 0@DDB(000S  *Ih@- M`qPPp* MY 0 0@0S AY0"S# 0p000S0 07/ Ѝ,Y0"S1Ds`0pX000S @ Ѝ1Ds( HHP@-@\ Z@WO-PMU@`  PP2SPS MPW Pp B `Xa `L`@  P) 0nS: P= IP0 0Q Q ~P P 0 IB"S0 000P Ѝt0 00 S Ѝ0oSP  ZxF(O-BMM@p~X0d0`  0MP:HPP  8MPn00RhP PC @P`J$ 0 PP&p S0P0 0 PPp to@P" 0 t0dSPkPU0 P&p`  pw  0USP~ L@PP0 P pM ŞP PX VW 00BލЍP/U ` P np:W0SL  CP C0H0PP0 p=  BW00 X 0CPT! 0  0 0W00 X 0BEW  0x 7UzX00,W00  0BPW0p0 @ 0 PBvyW00 @ 0BPl@8zd@L\-{M 0 { .PЍ -{M 0 { PЍ >-{M 0 { PЍ ?0-,M 0 EPЍd--0$ S   0/ 00 LLp@-P9BU@pV? $0$`0 6/pKp@-PAU@pV? ((0`0 46/pxDK@--@P 000l3/(J@-@P 000l3/Jp@-P?oU20S@p 0 0 P5/TJp@-P`UV00P00S@p$$ 0P5/Ip@-P?oU20S@p 0 0 P5/Ip@-`Py@PpXV(0(@0 p@/4I`p@-PR@P p$$00 0B3/pH-@- M  op@,,000G3/ Ѝ@ Ѝ/H@-op@  000G3/d0HG-- M` P @J0Sp ЍU4400 MP@:/GG-- M` P @0Sp ЍU4400 aP@:/F@20!P (///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ /////xhXH8(xhXH8(@-@$ MP#055050%A0!0%P$00$0Ѝ R/,0p@-S@pP($ARp$0S*> $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@Y PDM@p, fTS@ [a P @O [ [8$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S>3 57,05  50Q,0g 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0YR#00C RL00C F5$0qS<3 57,058`0,0= A/of[" R  :AoF[P  f[ AA0@ \QS,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQj p`0t FQ)Q* AR  bQY fQ ?R0@SP p b7rp@S B:p: C cs3<2080 S ,0 S,3 5407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ= 305 7,5 0 ,Mb@0f`N2$0?Qa R^  2! a, A0! @ `3 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@ `0 _P$ P! QP3 ``` VRQI[  R `S` 0P0`\ P\=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`S<3 57,05 50,00804Q,3 547,5 5,y ?R0@S@`0%#jo%#jx%ju-M{0{0Ѝp@-`PM0@ 0P 4/ЍpO-PRM^  `WpP+/a@BP L0  D pp Ѝ@0S 0  D pp;R0S Ѝ贠 0R0S(0D @p0D @ ppR0SR00 R00l` @-$$@M ЍO-EM MaX@P+p `E#= R0P@(T 0 R0P@T 0 0EAP < <UEލ ЍQ00Eލ ЍQ00@-@`  pMPLP, /R 0R rR  P    P@0C uЍP  rR 0rSX 0 @, `0 Ѝ@vlQ 0 XA-`@ p 0P/S /7RP @0 Sp 0 S 7 DPp@-IMM@`PP p 0: S \0 040pp IލЍpQO00@IލЍpQ00p@-IMM@`PP p 0: S \0 080Dp IލЍpPO00@IލЍpP00P-{M 0 { PЍ P 80Q 0 08080//p@-@P PP` b PP u BP  p@1+PPp--00 M (0  ЍЍ/,P --M  Ѝ Ѝ// -@-MkO<@P@ 00  0Ѝ@Ѝ/ꌏ,0-@- M@{OP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$K PY P@ 0 @VYP ;OB!,Ѝ000:Q!0P00,Ѝ80p@-@P(M  ' (Ѝp0 00 ꜍,p@-`@P Opp p@p@-P000 0 (M` & (Ѝp@,p@-@@ @  `  @PNpp p@k,p@-(M@PNp & 8 [(Ѝp@-@PP P  ,M` @Np & A,ЍP,C-PP,M/  @` p`FV`R V @`0 @T N ,Ѝ00 0:2 0,Ѝ80p@-@P(M S& (Ѝp0 00 Ċ,p@-`@PSNpp p@p@-P000 0 (M` ,& (Ѝph,p@-@@ @  `  @P+Npp p@w,p@-(M@PNp & 8 g(Ѝp@-@PP P  ,M` @Np % M,Ѝx, P $ Q80 @-8M80@08 Ѝ880/LL0000 0<JR 80880Ѝ/hP/0@-@0@0 M0S 0000 X0R |0PP h00)CR0T00 Ѝ0DEP0 oD,O-3M0PP 0 @|0 `0Dp@ P P00U tpp0 0C Z 2ATT00  RF LD@D T]:[ 2 0000~`K EM0 V0 W8 \2ATT 0`Fs 0Ry ,M 0  0 B0SH M0Ѝ0 V  0  M ` 0 0pHX;0S2 0 Lv 0 B@ 0 B  BL`FtY  0 B  BL 0 yz L 0 l0S 0 Bc00Ѝ 0 Y]d 00 ,p@-@PLppp@ 0RS00 /p@-@<0<00P  @uLppp@ <,808 00 Q0R00 /,p@-@`PULpT T   p@pp@-@P\ \  ` @8LpTT  p@pH,O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` lBp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ000؁0 00w,@-@0@ 000 @T AP80@080@-@P AP80@0800-M  uЍ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U P`? K͌T wP? F͌(Z eP> F͌(1S RP1> C͌ X @P@> JB͌8W .P= ̌V P= ^B͌`=@ 0S078d H0P< `P P  P P P P p PL Pp(, qP P`P (aP Px PP'( Q780D0x100C40S000C,0h0Hp0L`P$w$0PQw ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @CT, V   @@dqXhP 0Z ټPiߍ P 1 S  ,00 0! 1S 0D 0| 0S@p00P,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PȾU, [000 P,0匠0Zp(0p1P0@`@P_P`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0嚿0P@@X1(@P0咿0P0$001T0勿0PPP1 PX0僿0P0000|0P0, 0pBPBHPP@ 0T8`<@OH Us,` p@PW 0g1pV@10P00 00Z00 :Z,0W0 P ܰa[@@PջP  Z @pV @@ PT 0P@ UfT0@0p8`<T4 ! , <B B P $@0p8`0[/To0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PƽU,0 V0 @ PqY0P@ `PP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR 0`0 0 0[0ꈰ  0PU 0P  0@TP0 @  0Z 0^ύ @  0`V 0 Jύ @  0X 0Q̍ @  0PU 0P΍ @  0PU 0,0$ 1@,  BU00p@8`< ,   , 0 H T0封.1D|Q >p@T[ 0p8`< T P H00 0R_ (0Sk ,0P0 P ~8XC h!(0ST L0!11 @ T p @儼T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@.!(0R1P@PB0P@ T  0PP0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @T,000 @,0,0Q@ 0@1>PpP`㣹 Pp W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `»V,0 0@ 0 `Tq$0W1`V W  0 X0P`}0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a PpU,000 P,0|!0RP0P1`@0P`. V  0 @ P50 0R80000S  0p8`4{!*prQ>{ R 81 R 0SЍQ L0 0 0PEl0T0Ѝ!f,Wd<0l 0̃ S/O-C@p`ᜣM[ +ٶ(p( $W㌷0CS0SL3㎷8ⒷP 3 0/# {% 08:x{rHȲ pŸ堒圂8ırtrhÃqlr(rdrq\r`PrTr弁qLrxrDrÃq㷵pp<㲵^㯵v㬵8#㩵:㦵0'㣵#㠵0z# 0囵H#㘵p-㕵-㒵`_㏵|㌵o㉵pㆵrヵy〵z}{z@|wh}t6A-\`'^`@ p 0\@(`V(PO-8g887M`  `P `0ǟJҭp 7 000 S00 U0S}`p  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0⛴ $Q B q/ 0 ;0 匴p4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3 `h pS 83003 `Y p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#^ p SY p  0 s 00bR40 ; 0p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 ɳp E  `Q q 4 00 0q0cR  0 ` Ѝ 100#?c p; 000#?c pv/` 0 `00! 0/ 4 00 40 s 00bR 44 `PO0pA<QT0(  0 + 004 00/$O-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 80m-P0@P@P@p@-tQ@PK8P F8P 6P10S. (P:  p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@Sp0@S mS 0C;S P   0@S;Co dO-0lvSp@`MTf` `ZP T0 ʍr `r 0H"R (0$00 03S3PK T$3P  0XSڈ%$ |%T 0p5"00`4S03`00S5 p0S2 4S, 4S 0t25W】匡Tp2 1Pm 4p2[& LAT# `P P @፰ኰoH5S4S 4S0?o2w44Ztx2 PtY  G7P3[x2  >7Px2?;~0x2W  47Px278x23Y|2 PV x3|2hЍ0 D p$h l $ <%$(JYi 7P Z 7P [# 7Pp2?;~0p2|20P?0 rr 0H"Rp2[6odcτ00 0#d#lm0 p _F?2? 0p2ͭY?w 0`w b2nP`0  0 0#`p@-D@D0@Ppp (0l0m 00 pp"`p@-@0@P:#Rt t# R- # 0pp&P`p8:p"$dp@-@0@P :Qld^p- pp#P`p  :`!$dp@-@0@P:#Rt Ó \ "R-- , pp#P`p:p $p@-0@DPSP @p (0008 <@%8 pp ,@-H0H 0@0:#R#R"#0:@-`0` 0@ :Q Q- :T@-0 0@ :QQ σ #pp]Po :@-0 0@ :QQ σ #pp5PG :@p@-0 0P@ :QQ tà Ãpp#Pp :hp@-0 0@ :QQ σ #ppP` :Qp@-@0@P:#R  #Rp @8 %8 "R--  pp#P`p:pp8 :D$,@-<@<0@00:3S 00 \ @-8@80@00:3S00 @-0 0@ :Q&Q)   0,0̌,͂ $  $ "p"p#AP`S :Qp@-@0@P0ʃ#R(#R+ P-0 , 0  -0,$0 0$0X0 R0pp#P`p0ʃ#Rpdp@-PPP. 0@` :QQ! “Tƒld l pp#P`p :Qppd0 0 ,0 0 ,@-@ MZk$qQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#cBP`< 0 000:P/t@-0 000;@T0T 00:3S 0@-pp e&P`/X0X 00 :3S 0-pp@- P`/$0$ 000:#Rs/H$0$ 000:#Ru/000 000:#R s30/(0( 000:#Ru30/0 000:/dp@-P0P`M0@0 0ssp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp4ht@A-RBP0@SMq QP 0S `[ 1 P00ppI1p0 Q41 1`p0V0S  d100V0S  034pp% 03, ppG/%ЍP  QÁP 0:|   000 0000 ` 0@}000Hht@,`@-,@@0Sd000Խ@-$@@0SU000蔽@-X@M@ 0S Ѝ< 000 0000 0Ѝ\<@-h@M@ 0SЍ |0 0R  (00 Ѝ n0 @-@B@2@P$MQ :cVT0r3ppp$0Saqp 0SO1p0S@ 0  B0*1`00|PM 1@ 300 R 8 C 300 X30("0 O :3,pp4 OP`$Ѝ0`00|P @ / 0R` 00 `/00T @8 300 /,h0pC- M P  CV L`9W<0`00:3S \ ) Ѝp   0 000:3S/I T0T 00:3S 03@-pp#P`/t @-<0< 00 03, ppP` @-808 00034pp#P` 0@-PPP M* 0Q0@00xP 00 02000*CF! Ѝ0|P H00 020000*2! Ѝ0l h/0@- 0 @P0:R M# P P&tP 000 20 ! Ѝ0`P D000,PP Ѝ0 h0 000: !-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@TpT#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-儢Pp4S-`0@PP3@ 0 00p) ,h4, [ 0 + & 0 ^ lЍB0  9lЍOE0O-:$M$pdZ0  r$ &PUv P0p 0 p  Vp(:0PSH7 0  ᄡ@P$Ѝ0SH S4 SpV  R+p0004S$ЍOAp @0S S SpU  +p`Fp@0SF0Vᨀ *HVp P @FXp  +p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ %TP/ { @p ` 忠PPE @0S 0  ۠`PЍ` D 3 P 4A " 2Ѝ @0 CP0  0 /X404 000S :P /<0<0 0 0S :P /404 000S :P /p<0<0 0 0S :P /,404 000S :P /-DD 0\ ʌP 0 @-|0| 00@T 0J#4R B0pQ 7@.P d @@808 000S :P h/D0D 000SP:P4@//l000 000S :P /L0L 000S :P @-p @_/A-0 00pW* Z3$SP! #R`@4Sp`3@Tv AjB0tQ 6A&.x-0    p000 000S :P [/dO-00 0 MX% p `P 0 ᕟp @ቜP  0 P剟p@ 0 5@ Ǟ Ѝ@ P  P /p@-JP 3S P`4`稞30PV增  0s3 S 0_P 2 $R 0X0S 0D3 20X #$04p03ppHp@-jP F3S @P4Pd30@Sp@]A-`Pf JSU?sW< @P3$S3 SW*0N, SsH0S0 WP3PSSpP4S{pp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `P LTL VW PT VW  P000S<080 ў0 0 xO-($Z Ap`P፞P@8P ( 'T2呞P* T 凞P 0 ' @00 '0WXT P  RX8 @(  !(@0x @-? p0   0 `T1@A pP`U@  00008A- Q@PP% pW# 0 0S0,000 R   R   R  P 4`T `TX *P Q Sp  QW02ܜp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S ZP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p `pH0H 000S P@ ?# Q@ 080// ,(0( 00Q0/,(0( 00Q0t/,p@-P0P0 0@R` 0 S;,0 0D | 0 00P0q|pI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPYx0 00,p@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CM0 00,\000S  Q R P (!00//Hvv( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  ЍTupuPt(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0 sO-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`DpĒ `| sp Ѝ@0 S RQ Ѝ,3P d,0,0P 00X p  ``F , B,(`aaA0  T p0D`4P  Fp`,004@ 0T` p0Du@U   PB  0SQ 0 0PC 0$ 0\R =@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP ,PQ8 0 /$ $\/ P/PQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ETpL @10 0 QT$ D 0R U EBp: x0 0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q谿,PQp@-P0P`0*Â$ @P uT00PU pp 0Q̽P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0R0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4zڌ`@Ps |{툰 {Pp,p PP0_ Y4% 80!S0` ``pX08 0 T``0a$$ <@0H0|08 @!\08 `0d0h0l0p0 Ѝ֍P4- 㵌P' 0*Q- Q80 SpG V P  PʫR Ѝ َ׎Վӎ@ Ѝˎ  A-0QM@PP(C p`QAR   B P1 \.X) P$,P?PP H0 DH00R00D p0$`P!b@0SЍPЍd@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI ŎL1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @ꌵx$0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0謳,@-44@M00 MЍQP-D00M  ( @05Ѝ串P8 /00@-MN  P@N000 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AAO-DM(0X04 ,00S80  S l0( S࠳ࠣS࠳00CS࠳h ^@4 @D,  p04\00\0T00S@t80<80808080ql00s0SK0Cs0p008 P(@T ^700qQ000, ,0 (0q`0s0S#, ,  P(p@@^ @P8@hPuPC ^hP4@N~@t@~PpH~^ ( npH^, 1 00T<08 <`! 0!1a S 1  0Cs020Cs0Sq 80rD 0S 1 @t@PT 0uPs08<` 00 000 h00 h (000 0 000CQ00( @ 0 0AP8 h(A^ (  h   BQ 8000c(0 pRp 00(0 R 00SX 000 0 1$ 0S0 !1!0$1Ḁ{0Cs020Cs0Sq D 0Sp1L0|100 pC 8000` 0D0 !L| p. 00MDЍhCpPp4p 00 (pQS 00ã080@0808@8p@@pDЍ [P [M 80&PU0,`A0s0 ,pNq ,p  B   S ^030S@;A-U5P`0%@00?C5Mp 00TP 50 05 0@0@0@0  00P P50 0@5 0@0@0@0  00P 40 04 0@0@0@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0y @0;@0  00P L30 0h @0:@0  00P 30 0W @0:@0  00 P 20 0F @09@0  00P 20 05 @09@0  00P <20 0$ @0;@0 004P 10 0 @00@0 00P 10 0 @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@000 ̧~h\|x0@-h@h0@P M006S 0  Ѝ0(0 000  Ѝ0@v갡hp@-tAPQ@`7 Q`1000S 1Sڸ0  @T @TU p0 0X pp1S1&0C( s00B0Cs0SBB 1Sڸ0l0 00:h2P000S j @T 0 00x -M 0ЍC-P@ p$P `?LH\/ ONI ^pGPE ࠡPJ@$ @ 0C@-B2@`P0 M@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0Tx0 @00P@0 Ph0p PX0 0L 0` @08@0  0pPh|~x~\A-@`PpiTV,1 @ 0 @A O-/dM ?, 0L00*#Rt,/@ T8  (   ` (`RU(080@80@ @ ?0Sc,?@8? 0@000D L00  0SF (@@000h0S80@0804 L00S8>, 0(0\,0!0 s0  S^LPIL00"? @ t@T,0Q0@t@T80(00S&L00S= ( R , LP S800,0 1-$00Q$0 0\( 0qQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00ap 0SL01H@804 0,0000[,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YpH @ R T0 00P P 00 SPR P)!R00S 00P ɟ`V0 0CSp SqVp4 0 AS0 S P0P ` P R  0R  `9,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sj9, 0@000h0S(00S8000S3 80 ;8, 0`V 00Pm0 0CS<0 HDh D<0NN Œ Č Ȍ N LL\oɟ`VWY8 T0V T@00D R 0 R PPZy ! YR  pY $Re  0E0 p0]   0E  @000$R , 7@  a@000!R~ 8x6 8000Vr00C000C0'P6, 00S?0X *1h"0 @, 860H 0  8 0P4, e `p$t00S000 @0p 1P11qWX5X0 @00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꀄ 10&0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0ᾓP0P0S^L L00S3(080 w 800  L,,20 p`dЍXL008 0080@080' R d1SdЍ( 0 0=x \P1, `p0, Q0A0Ո8! ,\PY @@YP 2P0@, QcJ   8@,@ APX@T `P `pFEx>$r=<4(43242hPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0}8 0.00@ 0C(@ 0 0800  } 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pe d1Sb , 4@  TP:X X@ P S@DT H HH E@E0 0: 80R0,`0C 0B0X00@P `0 40 0E00 PU U R0 R  X R RR)0SC 0 R$  9, @` 0  `f@0 0p0 `Y00P d 0@` 00 B0X P0 P<00 p 0 P0+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`rUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` K0  `@0 0p>0 `00P  .0@` 00 B0 "P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 1@000=, ,>@ 0`C000` @000tW $ v 0 U@`= 0 0LfP4Pj @00 pWU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`*UpH50S0X0S* 0 0 0 0, @p@0 0H`U~0 0 0 @000jP$pPd:hd(p@-P@PPM/ 0`0 R    80x t00 0 000P 0 Ѝp80 @000! B/ 0C?0Ѝp,{0 00@z,C-鬐M@P 048! \` d0hlp`PpPi80  D000 0 B0C 0/? 0ЍЍz@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  8y0 00x, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `~Vp`H|0P 0@PUpT` @~T @pp  ! !@-@P@q~T R/A-p0,SP` @T @[~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S P$00C$0I ,O-:z0Mx*p$P( ,pP H*00\c S@@s  nRXal HR @@i`40IS0c0@T ^OoB@TP AA  RR0|)\ 0  |  bR\ H)` R&8) R! CP'I@, 4R S[80S K0P0$ 0B$0X @C, 4R CPf S ^\ X( 00Q 880, 0,4(0RJ0H 0@0' $P)0S700S00l0S# 0 S , 40R#0l P, 0S 0P0$@P$@70 RЍ $70( U$(00 SBFf@`< & (00 S4$&P0C (00xP0S  P$00C$0'@`&  T60,@(@0 R 5060, 40RpfF`@ 0 0, $P,04 CS (@Re 0 KRaڠ5%0 p p @d% 0(`Z ᬰq`nR `F%` V ,00P0S 60P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z p<40,04$!,1010y d 4`000P ^$ $@$#@ P(@h0 Ru ,,Zq  P+ p# J d# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R  P $@@ lP "  20,  , o40 S _ ) @20$ ܀(B@0S t0P0$ 0B$0$܀ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  >0P0$ 0B$0@,0(A@0S *0P0$ 0B$0 @,0+Dt+*`d(*)HD)4)))(4(('''('&&\&X& &$$$l$###""(8"""!O-lsl3phC@00 S M 8400040,c`(,P Zm34@3`0T&#0C S402PK袟  ?0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS /P 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 ^@P,P  ᷮ@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004PhL  dhLXl\H@- ,(4 00@-  ,(4 00`O-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0d0 00 08QD0S0l%R h%R /!R!RtP/P//0c 0 000 0P/bG-MuPp0 5` 80s3  S̠`D Pr LR!1S85@450 50 `\Pᴖ 40 00P 40 040 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q _S~VZ]9 Q gSf2 Q PSSVi^* Q j^S! Q k^S Q gSf Q[-S 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  YDPUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf SUc\bh0\1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //\̡1P0= 00` P7ʀ :l“3\0 /@ P 0000CS0 00000000000000000/[Ġ@-@P@M&\\ Y #3t P P 00 '000 0vЍYh`P -P\P Y͌# /Y@-00  |00S d d0 8=0!D00 R 0X@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\ h0W@xZ0 000:h/Vp@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &ЍplVhT02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R R, !p@ '( V@ Ѝ1=00QM0SJ\1p20lP10 0O0剑Q:20h1=00Q!0S0p20 00 0/0剑Q:20t 00 00`0pU0!Q 00pI0!Q T Uh0 000/\Sp@-x0x 000@00CS0 S p0 S P00;pẌPp04S0p@-0CS@0 S p0 S P00pᜌPp0p@-,0, 000P:v@ p8Rp@-P0v@p0 000S  @-@J Q P\,Q    @/Q,0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0P`Pp@ W uP 0p#0C S-0 00$Ѝ+T0 S80  +2 0@ר @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p  rPP+  U  P `X(0 SCJXC0 0(0C\00C*^$ЍX TP P  D0|0ap H0@D002 T `V `tV `` P|@O0 00@L,p@-@Pppp@p@-@80800P  @ppp@K,O-`6lM0@P,0 j Q 0pt`Pa Pmq0P0[ W   0<0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0? 0005 000p`P0 @R  <0T R8 2 0<00800C?80otP0`FitPY00` `t, t480pP pjK 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!p! Bp G" RX :     HU pG< S8 8 (P4`< @p$0,0 1400H0@0 @0 0D/PU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0? s2, 8 P ӦI000 0P8p0i08 k800C?80sP0pGS00C0`FQsP00C00p000P0 0PS08 B! Wf 0 0H000尡pG WD0|0p^rlЍ80< p` 0<0T pR0`<0 yPo 08CrlЍ`{7rKH0 00 WE,p@-`@Ppp p@I G00 ?D,p@-@Pppp@ 2p@-@@ @  `  @Ppp p@XD,p@-@<0<00P  @ppp@ C,p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``CO-ԑMS D@HP 0S p `@ 0Z  @ 4/ 0[ 7 $[0<S<0.S00#10>OP0 0@0 0}00 P00 Gr R0S0 0?P4/ZXЍ G\00r R0S@0p0pP4/pWBćPQ# @-@ RM !R "R pPĜ\  00@bЍ/0Q # @-  MS S PpP$R ,@8Ѝ/@@-0@,M @ Ѝ@-@044M0 @ Ѝ>0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LN!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   >QO-M  m EPP@ 0 p % p 0 5S p/ Ą`@Ḵp,S 0 0  C@00 S  Qr%S+0@ GS0  %@0iP@0@ `fv` 00#1.Q0*Q 0S @0 SE^0 @00% d dP00 @0@00 S*L0 0 r 0   0 0  < @ 0D@0 @00 S^/o 00PЍ0 S0^ ` 00 @@D"0 C0 0 S^ 00000 h0!@ @0 @0g0 S!00sp pp00p 00p 0@p p0, T \0@410 0rp 0  0@ 0ppTp0 S\R W' I00 S0   m  00w0`f Sv` 0S0\S 0 Sa0 00 ;%p%c%+%c~T~$</>p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp\0T6l\A-@0MS0D0@!0@P0S?  0 !~|!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0ЍP5N{gA-@0MS0D0@!0@p0SE : 0 !^\RN  L !0 120B QP `0 pW$P@TP 0nS}PЍ"0ЍЍ3kL4z>G-`0MS00! 0p0S[  0 S`1` I $L0!b!bIO4ቐ გ1c1cL0 0#3cl 10B A(P P)0< X" pW $@r0sSP @WXV @T lPPPЍЍ\2-?Lx*S0 O-TMplj`PN ,$  b0 : 0j @P 5 U000P 0:Z @P 0S  R 0X F #X =X =P 0000pP, p W&Zp  00Y*S k`P V30  SZ l0S l0q,0@  0otß $ 112cA112c B LL00#0#pr!qpC 0N0P0q0pL@B P@=rH`@X 0Sp  k 0` k@X0`0TЍp  0 "$ L衟‚  H !1 2ਁሂBP㈁L 00@>pm  0 `1` $L $$H0!b4!b Lƒ1c$1c 0L 0 00 壀((!h!b!CP㈁ 0tS0cS0Spp~G0@00 p< p0S `x kv|, Ng8kLs>-?Lr*S@A-P`p0\ %\0@pS sS lS P0\UUW *000@1CP0PCV` 1E!00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@AjP 400@,%,`+P p` H˟,@ 0:ZAZ JQ  0JPPp0-00 >Z A0Js =R* =S00 C?QRp  Wp1PW -.R0 XZD cJqQ   Rp~ PA0JlRpY PA0Ja0Js Rq11OStD00qߍ|I@[/?hP 000406hP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, T*R 0 p 40P040 P PPp1  \1SE 0C111SB Z0! Jr 2( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a d7@D!&J0AqVZ ຠ `OT` a 1l!01ATe @DAAAa0Js RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RU 1h BY!r #P`!`1`Q,*P  05p^ 40040i10Js Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S%   ?R ;R P0S %S0 01S2 0C11AT/ #Q,,*P  4 @ , 40,0PPp1BA0JS30J1OS!l!011@00@`5hPv 400`,Vp p2)h Pj 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT> `V ```&``VP``P``ý`@oobP``V s``@Q AOQ AAT @D1!ZAo!᪢Vp p2gP 400p,PZ300!J.o0 0媢'0`0#001&J0GZ @po0`000 00-0 0|@V``pT@`V`pO@`fpK@opG`@pCoo@bp>*' p V8 |-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/ȾA-PQp@M 0S XD fP (`V! 0v0+ V T 00 PP0T0j 00ЍT Em 0 0 R T 6T|\/P0S T`@  $Bxp 0S R s0r (0 000ST001P \ p0 (0$P |\ p0 0`TH,۬8֬yyxyXyyht@x`x$xxw0R @-M@0@S  ЍA-pPP U) @`TV 0PS |@P0DV  ~P voA-PR pQ 00@ `P % TP NP |#H0 ES  fP  0 000Q  0 R0 R   Q PAuPP0 QV \`Q  0S  0 S o W0C  s0_S0S  0 S Q V0Cs0S PUD 0$XPFPF " X< $0 Ž20nP; sPG fPY P?oR20S 0 0qQ :%eP NC!ePJ<ePL5$ PP -f$P)f dP$$ W PP?o2?    0S V P(C-p|Q@x!P`M0 { P 000S8 @ЍPP Hp  0[p R 0S 0P@ P@ @Ѝ 0 P LPP+ P *PP004 `sO-M Mp:S$0S:S@ 0PS:S``E[ P!* ) `0  oP 0P:S ۍ Ѝ@ۍ ЍC-8B82M@M0`PpP9 0/SH W@P S0@DeT PI A@4P 0 ۍЍCD0P  L zP"0 @\ۍЍCx0P 0S/S P @eT0 ۍЍC0  PۍЍ p 0dYX H0H 0 (04ۍЍ,0, 0 04pXponnlG-p`@P  Y0@dT  OP @\PPP P @T  @0Gp-@-@ M600 Ѝ@ Ѝ/< Ѝ@ Ѝ/@-@ydwdud@sdqd od0md@jd 0p@-PS@:pS cP!pb @-Q @TnR  sR) fR Q \' sR R\  Q  0 ^Q  R Q A- @X p`fS@X P0P@0@nS sS@X@@ 0 0S00@PA-P% Ppp R,R    0S,S@B8a`P  x tm`00ppp@@G-\rp@`PP 4 pWV*nU< sUZ fUH0D Y+R. @bP" H0D@pH0@0 H03H0nUp@0 H PL sU: fU% L00L0 @[P @P a 0S0000Y 00 H0@ H00 (,00H0@, H0@0H0(H0, 0H0 0@ SH0 $H00H0$$PH00H0ꈋO-M xPY p qpX` j`0( 80H00 `0P@^  P pY  X`   R , R < R! L R* JЍP   f, R P   Y< R P   0LL R `P0 0 @?0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00A-`p PPU@R [aP !0峀0 V00pp   0  0 0P_O-`0@ $M 0&P p bPpUP5  Pc a0P  0a pP|@P PH@@aPa $Ѝ ~aa0,P pU 0$0(0,0# @ 0S00sPa PU Y  @RPU  @RPU R@a0LP@U@0D0H0L07 pfS&p @P" PU!  @0nS sSpY@@pp 0p  0 Za $Ѝ(T8UH3U@p A-Pp ``V@R ]`P A0峀0 00P00 0  0 P^0A-P pW@`R /`P 0` 00P 00 0P^0O-LM<  <+, , 0XpP |q@P0|0`P 00<ZPzT 5P1:PzP_PP p pP V 0T 0 , P`4 ` 0100#$090400S% $ .S  ROS> =pP 00p`v= <00P5 P 00 R,P `u`LЍ#a@P= pp`v ,0 S Q0S Q0TS 0 0000000 P0(-Z80]80 R(5`PLЍ@0@SI p@t`00 0 0f0 ^PYo (@[ 0 [P p;  )\[  R-Y %\^[\= @[0P0&0GS1v  0P (Y0 KrQ40E K/RS  [@ [l&,0  @ 00@,&,0  M pM00 DTD0 0S)P Pm 0 i 0SZ v0 j 000  00 n0PB p (^801` Q  Q 0S00  p    D00 ?[}$v 0 S00P0@ P  0BP,  0  80o Y80! [0@B PT@@p' 0 000 0s0,P (a@p@tkp@t< ,0 Sg Q0S ` QF'\RPeT` PP0 x|400 F((ᮒP00fPp@t0n <00QL Q 0G R0 x S!0 0WP680 M00 0S00 P   0pd0  < ` 00 00Pp P0 (zyxwpwvlvvuuP/$P00//tv0@-MPo0 0^\!1l!1"b2cNL 0@@0#@B!A@C0PЍ0赁Nvg P0`0K?//up@-MP40 0nPel b N00PEK 28@0#AB@C1dPЍpkL$u>$0P00?//tp@-M`0 pP0el`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$C!d!b8A@C1BPЍp-?L*Ssp@-0P0M`2X@P 0Ѝp%\, 0 0S Q20Ѝp訉G- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00<l@-@P \\\ \$\,\\,00!R  !蠫 001/h 001P/ P/P@--@P X@X0@0@0s H PJI HH @HLp@--(M C@3`0 @@PR  k{UF{{0!00 (ЍpPm P 300 U  {kUk!00 PS ~P 0300 U 2 0"P  0cP0z200{kUk 0P PA  0cP0wʜ200U 0d"|2|2"P  0cP0P200U 0 0"P  0cP0200U 0 P  0cP0100^U ! 0"1"JP{  k0cP0Gd100U 0I B \0cP0f,100U 0V"0"dPS  I0cP0a000U 0Q"0"QPP  60cP0ʜ000U 0u"d0">P  # ??L48GDLąx`0cP0Y,000U 0 0" P:  0cP0t00I? 00Ō0U"f P  0cP000E?{kUk 0] P  0cP0!t30A?{kUk 0t P&  0cP0,300U 0"3"P  0cP0o20t0U 0_"2"P  0cP0ʠ20l0U 0"|2"P  {0cP0iX2000U 0Y"`2"Ps  h0cP0:200y{U{ 0 qP+  V0cP010h{U{ 0  `P  E0cP0Aʌ10W?U 01"X1"MP  20cP02D100uU 0 ;P  0cP010S?U 0"0"(P  0cP0Mʸ00\0U 0="x0"PT  0cP0p00P0U 0"\0"P  p$؂@h ԀGP0cP0Z,00@0U 0J"D0"P  0cP0p00O? 00U"g P  0cP0ʸ00M? 00U"  P  0cP0%10I?*{kRF{U{ 0O P  0cP0D30l0U 0"`3"P  p0cP020d0U 0"3"xP  ]0cP0ʴ20\0U 0"2"eP  J0cP0xl20S?U 0h"T2"RPe  70cP0i(20Q? 00U" ?P  $0cP010d0 00U" ,P  0cP0ʘ10E?Xk{U{ 0 P  0cP0P10t0U 0"$1"P}  0cP 010 00U 0T P  0cP0ʼ00W?U 0s"0"P  0cP0t00P0U 0b P  ~`~~}G|}0}||D|{{zzPzyyyydyTyyx0cP0PP00\0 00U"& P  0cP0Wʘ00d0U 0G"0"P6  l0cP000l0 00U" tP  YnP  S,100 $101U"u"00 Ch100t10K?Q10G?c 1U"_"00 -10|0100 1U"xM"00 100i 2U"?"00 2080{kUk1!00 30Y?300 x3U""00 X30T0L30N?? <3U"i !00 30p0Z 2U""00 20U?20R? 2U"!00 20`020= t2U"J!00 h20h0;\200P20C? 2U"!00 20p0200: 1U"r!00 10U?c 1U""00 s10H010K? T1U"!00 ah10`0\10h0; 1U""00 O(10Y?z 0U"Ts!00 A00|0E00`000G?*00T0s00(0J \0U"U!00 #00h0000 xxdxTxxwwwwTwDw4wvvv|vlv4v$vuuuuutu0>$ R'4000  0p@X>0U 0PEt@T$0Sp0  0@p>0U 0PEt@T$0Sw  '$   0   0s  0@$ pR~ph=0Uq 0PEt@T7p0pp@0=00S[ <0000CSU0S5 < 007s@ Q<0F(0 S0(0@< 03p|<0U0 0PEt@Tw0Sp D<000<0LQfD0*;<0\0T  0T :L0PEt 0@SBU 0P0,P0` 0U@@ 0070  Q 0SU 0PEt@T 0S 60> 00H70U 0PEt@T:0D10*D0 @D7qdh0l[ X0P#$U 0PEt@ 0S\7s@D0l0[$X6 R] ?0S50>00$60QD[I U10[![h )0 PE C0 ` 00D0 0CD00l`l Pv(T% UI 0PEt@00Rl @Dq0^ T 0 $ R40,0000 400U"  PEt@T   !R 840d0U 0PEt@ T:H00*H0; @D 07|;  0$ R D #  $ R D # $ R$# 0+R D U1![ $Q ^ LQ0Q 0 ! B00  0D PE B `D R000 R=0W U 0PEt@T20G?o20X$0S 0   $L2r '$B0#22cR0S 2000`20D10 PM;7sD@D10 Rp  B0 D  0h10)@pUc 0PEt@T$0DpSp  0 @Dp+kUJ F$0S  $P (D0 S2D57[U0  0 $ $ [PE`'0? 00??Hba6?7?8?=?>?N?P?5?h_J?M?\H?A?L?TZYXX(W:?;?0,( 粰*@D7p$R t!B0$ P0l00X0S>0p0P0?0X00 p0tP 40> <@v 50>050 7?R4@0p 0T 00p"p50800h505l 07^[PEt@TU*U~0 C00ST 0 0006Q0 0S @0p 07s0D@CqP$0(\$ PEt 0@\-U ؂<606L0 0s0P7s@Dl 0@D'qM0@ph0dlh70r؂7sP0D˂7{D @C 0` 00P00X⽿p0P0tp0 (0$P$(0, 80> 0080 0sE80>SR: @3 0@|0-9@0F@ p \ p T d \ h P l90>(w0S90ALp@-@+PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  Z W0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04V0p0 p0 0 0 30 Ѝl0Spp l0@@@ ~밨S???̥P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-`Vz@ 0!(3/PPw 8pWG  ( 0(3/pP00 f  @T 0  d!P S>0R`*p  BS>00p0 (08#8pPoRS B P T W B T p 0Bpp00  @T 0  d VP S>0R`:oRpS. 0A pp $0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰeX 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00p;J\S10b60s0P0X 0 C∀0S 0X\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 240%R00S0000020(0@0,000@(,04@080 00 0 00C$0 B U@\ q W3> BJ  p Wۄ2  B37RN q`36 B Lq`36 BC@g  @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  \X8@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\j \b$`\``$(@$$, V,(`@  $$(@$$, VpLF$(0$00W\(0`@]mCQ???CX@LD, 0qR0C0s0\0@0qR0C0s0\0/O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0C  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0V00S8#  #800#"0 @w8cB 0 0 0 0 0 S0 S00ӈ R01q 00  R000 00%*W6: &R \ R80l0 C 0 B 0<L0DC0C t0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC i060@D0 0!1 0RppRHQp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000&Dc-M 0 BЍA-PCUo 0`0@ 0S@  00 0h!(3/@PR P!@ 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 Z, @@ UL DD P&!K0 0C006& 0&;> 0$0;/O-Q$M R0 t 0S!q"$!@P`p,ß  0+0* @$)z0(!y0qx0aq0t0@AP1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ 0(@0S 0P0Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4@H QPQ paQ"$&P%uPQ@D"T% r  Q% "r Q Q T% "r  Q% "r a Q d& "r QQ&T% p!T%$"C0S |0!qS"$!$ЍL!Q1C1@`pv @\ A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !& A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !& p@-@P Pt`t`@P  !1Ē   0" C  @pPp, p@-@P Pt`t`@P  !1Ē   0" C  @pPp 0@-1@4P 0,C @$!0 RG- pph Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G.7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq(R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/xU/0S0`0/ /?@&3t56@-S k>@@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pp5 DMP[Q @!M080I j\PĖ PĆ0\@ CSP$ R(㨆 pPp 0Q= q[P$尐6H0C6RƆp 0€00@ jX0@PQ- 0ඟ0 pJ`{P09 `;ST`+0HAX{T4T+ pQ}Qp0Wq 20|~6{`0,Z`;p HT$@P;0>0 0 0p˾0S01Y0嵏  0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00Q0 0S@\ R @02^02N00 R0@\DЍW@  xP 01LY 1R 6 G2#6pP^p N0j 0=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-M\PPRf!   `0  +M @Nk@^ᶰZ἖p S 1>@0ny SwpFP0N`ppP`p%TPVPeTEtp漖0@P0dy Swp @0`pp0`p#406@D@0cUSupNT~F0PDt@`@`@@0P#4``0F0d^~p@D[pF5 [0@Q p[ ` Q^kp徠἖0pj9Ys0pJ 0 00#4 0编0iQq0 `V0἖pW 0@S p`W0@T P`㶰[ Y0ʀ p ^C @0@Pc UYuP@ 0PpP0CPpP%TPV0PeTEt@ S6`F3@Ps0kp0p0@0P#4pp06[@cVd 0C`6A0@Qe pW `r 0@P9pd Ws0 @p0@D0p0#406@0cUSu0 TFP `FPDt@k>p@p@@P.pp[@nVd N` 0@Q# p[20@S P`㶰gtwp@ p@ 0T0 `W2 @p0@SЍ༖N~C[0k@6 N~4[@k0F| P`㶰00@S P`㶰%0@S P`㶰0T 0 i p@` 0 `aO-ʀ6MS 3003`003k^0 0300300! A@b9 Ts0@p000@p#406 B 0c^&6S0@ 编0$` pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಀAph>Ys0H000#4060cWsw0 p0@sW `D Br @g>Ts0=@000@#406pGp0cR#6 SvekN&0Pn2Rs0 P`0`00 @#4PP0&N0bQq0 k0&Ѝ 0&;p0v7 th00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I( , &&+A-@ k΀`P s0! Qr p p "$  aS2s Ak> u 0  u0#Ġ  <##4U0 0 ੺000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ MJ, R 0Kp&]EP+(+;0N  q/ ! R7@P j   Q& R \3 "[k. Z0-q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦| qk>0#40缦0j\3s0 J Z㼦yzk>0#40缦0j J\3 Zs0漦@|qk>0#40缦0j\3s JXM⼦k> / ! Zq ! 缦jR!r J^ἦ b _ J  \ P+R +R ,RE R  Q ,Q3 "[Q6k S op3 s0000 #406 cPp 0Ck N.V6 0G. 0S0 0xS0   0LSZ=00IX  && Ѝ R3 "&][Pj 0 ЍO y: Zs0漦)@q:s::s0 r :s0q#r 0{  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P p@0 C`0@%>TUT @%P (%/@- MP`p)@P @   #>p P {- @P  Ѝ 0@0 Ѝ0@00@a-T  Ѝp@-P(@P @庲@p 00p@-@(0P 0婲000 00p@-MP`(@P @ @唲0 0=p %-@Ѝpɸ0@-T ¸@Ѝp0p@-S P@0 C`10@=T 0 p,%0P@p$yara0p@-S P@0 C` 0@b=T 0 p%0P@pa$tcid0S p@-`@0 CP0@==T @_pp/0S p@-P@0 C`0@"=T $,0P@?p&$p/yara0S p@-P@0 C`0@<T $,0P@p$p/tcid0@- M@ =p  P Ѝ0 Ѝ00 0 Ѝ00@- M@ <p  < P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ <p  < uP Ѝ0η Ѝ0ʷ0 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@P8$0PPptcidp@-@P,$$0P p00ploobp@-P`@P  :0@s#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@% @-@@B @-@@[ @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@~@@-@x@,@-@r@C@-@l@Z@-@f@sp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P`T @P  0@"pp@-P`B @P  z0@"pp@-P0`P. @P  f0@"pp@-P` @P  T0@"pp@-P` @P  B0@{"pp@-P` @P  00@i"pp@-P` @P  0@W"pp@-P0`P @P   0@C"pp@-P` @P  0@1"pp@-P` @P  0@"pp@-P` @P  0@ "pp@-P` @P  0@!pp@-P0`P @P  0@!pp@-P`| @P  0@!pp@-P`j @P  0@!pp@-P`X @P  x0@!pp@-P`F @P  f0@!pp@-P0`P2 @P  R0@!pp@-P@""(0P p 0P 0pgntsp@-P`@P  /0@h!pp@-P`@P  0@W!pp@-`P@!<P pP U patadp@-P`@P  0@-!pp@-P`@P  0@!pA-P@!X0P p&'`P  P `j)gntsp@-Pb@!(0P p0P 0pgntsp@-P` @P  0@ pp@-P`@P  0@ p@-@R 0@ p@-@PV!$0P p00ploobp@-P`@P  0@ pp@-P@P 0@ p@-@x@ @-@r@ @-@l@ @-@f@ @-@`@1 @-@Z@@ @-@T@] @-@N@v @-@H@ @-@B@ @-@<@ @-@6@ @-@0@ @-@*@ @-@$@ @-@@. @-@@G @-@@^ @-@ @u @-@@ p@-P`@P  0@ pp@-P@P P0@pp@-P`q@P  0@pp@-P`@P .0@pp@-P`O@P  0@pp@-P>@P  0@pp@-P`-@P  0@pp@-P@P 0@pp@-P0`P @P  0@zpp@-P0P@P 0@hpp@-P`@P  o0@Vpp@-P@P 0@Fpp@-P`@P  M0@4pp@-P@P 0@$pp@-P`@P  +0@pp@-P@P ^0@pp@-P`@P   0@pp@-Pn@P <0@pp@-P0`P[@P  0@pp@-P0PH@P 0@pp@-P`O@P  0@p p@-P=@P 0@pp@-P`,@P  0@p p@-P@P 0@tpp@-P` @P  {0@bp p@-P@P 0@Qpp@-P`@P  X0@?p p@-P@P 0@.pp@-P0`P@P  30@pp@-P0P@P d0@pp@-P`@P  0@p p@-P@P A0@pp@-P`z@P  0@p p@-Ph@P 0@pp@-P`W@P  0@p p@-PE@P 0@pp@-P`4@P  0@p p@-P"@P 0@|pp@-P0`P@P  0@hpp@-P0P@P 0@Vpp@-P@@(0P p0P 0pgntsp@-P`y@P  L0@3pp@-Pi@P 0@$pp@-P`_@P  ,0@pp@-PO@P `0@pp@-`P@<P pP U patadp@-P`C@P  0@pp@-P`R@P  0@pp@-P @P 0@pp@-P1@P 0@pA-P@?X0P 2p"`P  IP `$gntsp@-Pt@!(0P p0P 0pgntsp@-P`@P  0@gpp@-P@P 0@Xpp@-P`@P  `0@Gpp@-P@P 0@8p@-@Q 0@.@-@R =0@$p@-@0 P $$p@PPv!0S q!p╪j!0 @-$@@Q!P 0R @-P Q /o//(  P t0, @-H⮭ @-P Q @ 0ft0 H❭g0 H▭ 0S p@-\@`@@ PBPpP p@{ x(A-P`p! !@P  n`P pp jP` a U @# ##ꄮp@-P @`Pp2P p@(@- [!@P $ )0 0 0 A-pP H!@P  0 0 0 P7!`P  /` P((0 H @| /@-@P Ѩ@ k0E/Hڬ }-A-M `V $P0 P8@P pP  0P8 EЍAЍ/ЍAЍ/>Q/H⫬ U @-@P @ $0E/H⓬ }p@-@P x0 0 0R0 P 0P Q q" p@ppp p@-@P `0 0 0R P 0P Q O" p@pd P/0 0 0R /dP/<0 0 0R0/P///8 0P @-od  QP  QQ  "/d P/ 0 0 0R/\@-@P \0 0 0R  ( 0P Q !00$ P/00 0 0RP///p A-PPM /o00 0"P R Ѝ R0 0 p`P 0 S  R L  Y/7 P` "  00\ | p A-@PM 0 0 0R ЍQP 0 d 0p`P 0S `  PY/7 pP` !(00 [?-HV` ; P -/o<0"0 0^ R  Rf/hP/D0 0 0R /@-P o P/D0 0 0R /@-P yo` P /ol00 0"\ R RP Q [ QS /\ fP 40 0 0RP A>/ fA-(0`SM.P@U Ѝ P0P pP 00  0P+ S(P0S0"Q00+ @P \ 0 0 0 @Ѝ, gP  !P P 00#0 0 P 0S S R/P/ R0/@-@ dPȼ갼p@-0(MS/ @{! S   P{ T6` `P $P *(ЍpX  (ЍpD P {  46$0\ x `d H $ $@-@Ⱖ 蔻@-(@@l⭥dd 00 S 0 P :\03#/S 0 P \0///A-P``%B{@P :6(pP  )b@P !$ ᬥW@$$0 x⋩@ M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ |Ѝ00@- @PM  @ nЍ00@- @PM  @ `Ѝ0@-@P ,0 0 0R0 /P/0 0 0R / 00 !S R!* R0*/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //P $0 0 0R //xP $0 0 0R //@P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/P/x0 0 0R / 00 !R0* /-  ^ :P/x0 0 0R / 00 !R0* /-  ^ :P/@0 0 0R / 0 0 S /P/x0 0 0R / 00 !R0* /-  ^ :P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/P/x0 0 0R / 00 !R0* /-  ^ : P/@0 0 0R / 0 0 S /P/`0 0 0R / 00 ! R0* /  \ 5*/@P/`0 0 0R / 00 !R0* / \ 1*/P/h0 0 0R / 00 0S00/ P %:/XP/h0 0 0R / 00 0S00/ P %:/P/P0 0 0R / 00 R/! /`P/h0 0 0R / 00 0S00/ P %:/P/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/ P/h0 0 0R / 00 0S00/ P %:/P/P0 0 0R / 00 R/! / P -/o<0"0 0^ R  Rg/P/L \ /  JQ\/\P/L \ /  JQ\/P/P \ / Q/S/Q\/P/P \ / Q/S/Q\/80C-M`000 00Sp pP Ѝ(@YP+ A) 0Q xRK  P p'*0 00 0S  P Ѝ P p:0"Sꯧ0"S qp  0 00 S  ꓧ0"SD O-MM(@PlD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ P 03/P 00  $ 0:/P 000 WPMߍ 0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-3KM `0 0@R @@@$@@@(@0 0Cs0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RႂP0/S7 0(00>S: SA 0S p03  0Bs0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8? S =SB0"SQ0SN   0"R "R RAC$ >R<0ȯ G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pm \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R4\ BR   ;R<@{  @d0 8~"R /R 0oP 0 +r  R:Y Yy*     SP(0 Rh \Re  uRa AP [ +r PW6I0 r    0 # <  P,!*-"-  ƠP  * --  (  " "0   Ĭ O-Ÿ M @ 0Ds0S<^QQ@`Q  0>S 0 T @P (0SP  R @  ЍT" T& @gP0 S00sP  @P T gPy0S  0S` T HG--PM؄`{@PL ,&pC `(pF 0F fppSp>0? 哉P P&u&  }0 `p r(Ѝ00 \0mp``(|`Ѝ &s`Ao/A-PP -P`p @ @PX@@@P p40,p0P4080<09ꀖ@-@ . {T@-(@@ V4H@-@@O-4@T p`, P @@D¤@`T P礀Qㅑ8080 0nPZ PZ P謥  @-R 0P< P 4Q ,  4)`0 0A0 0:, p@-@M4 00R1SP,0S@R 1`V, P` 0 03P 40, 0C40P" +`ЍpS" RЍpЍphZ<.0PPj?.0<co?.0$$N?.0У y | iA-P`,p%@P W 0 !,@0`N,@0`C-`0@SPpMF  P4 00Ѝ!0 .P ,0SV |!0 v/P ,0S(0S00  0iP 0S?0S0"S`0:S W0}S "S000"S v]P  WP @X 0 @aP $$w?{/0;t H X , 0p@-S X  Q P@)0@#p`0!.0|\ 0S ,0 00@-?%. 0 4 @-R 0, B4 P @ 00'>/0o?/0븟  O-80M@ Ѝ@p` CPP @ ` @Ѝ娒  <uPP0 4004QY  4 ,R\ 牱Q1v   P 0YIV  B B!,0 P 04 `<0 04 <0 lP,UM<U7U+Y& xx @y aP  !PP( o 0,S<SS8 vPh @ <0P0`<04 y<x !⭆,0P IYP  |,d\0\02.0&LW?/04?/0TtT 2t X p@-@PP 0S D  Q <0 0 p@`0/0мě p@-@P 0`0V6PP d d0 0  0@S0<  pPp `0/0ɝl< O-0@SP MT p}`40SP p `iP@ ЍLP P 00S 0r  A> 00/PY 10Z/ @0R+ P$ [] P 09P 0S P( Hqpc0` ЍO J P 0  03/P  40R1# P P6>/06c 00C 0 P l`(@yTT?/0@+? 0댻D  @И lt X \@-@⯙0,S<SS?/0뼇ė PG-V Pp0`WSW@6 404 S @  S3 E000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<<-B> 0⌜$$-F> 0ℜ밷, ! 7G-PS @- Y`' T 0p 0R   004 00R$ vP r 0S 0 GXXG>I.00D,0,S <2.05눶 1̔ KJG-PP' 0 0R"#4=P 40S @,0aᄑ1p !  ,0`p40@T:8 408  `0P 0  Q@-P80080/ᨴp@-@P80080p@p@-@P 80 0R@ pP4@p0p@-@P \0 0R@ pP`00S@#:p@p@-@P@pA-PP 0 0R4 p`40S @40S ,0P@ `<A-@P 0`0VpPp0S P @T <+? 0[@@V蘲h A-PP /o0`0"Q@@T @0R p= @P @T 2@+? 0$ 0P T@- ^ 400\@,/<2.0 4 0P o@-p@ T\ @\400\@/<2.0 @-PP M 81 0R Ѝ`@80  Ѝ@ 8P 4 0R S *,\$0 B!p@"400C40<00<0``K.'> 0➚HHK.M> 0▚00N>K.0 0⍚,t uT v4 w P/?o0 2 R0S/0@ S/Į0P -?o82 ^0S 0 S /tP/0 0@0R/(P/0 0@0R/ P -/o<0"0@0^ R  R] /ĭ A-`P @PBpP (0SpS0P  pAT-`  `O-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L d⻙X% XP0@#r 1/t✓0,S갔z BAA-PP 0 0R44pP 40S @,0a, 40a@T:8 408 mpē@-P80080p@-@P 80 0R@ pPR0@Opp@-@P 80 0R@ pP>4@;p踒p@-@P \0 0R@ pP`)00S@#:#p@hp@-@PI@pp@-@P 80080p@p@-@P8@@@pp@-@P x0 0RP`40S ,0AT p@p@n?/tӒdv aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@m@44?/t♒ ?/t⒒Ȑv u p@-@P H0 0R@ pP`F@ypA-PP0 0R@`j4P%80,0!qW# P P ,0P < 0@ 40< GA]AA4?;.t9n?;.t2`t lt 0P -?o82 ^0S 0 SD/<p@-`P pP@P (0S p@ ꠍ  ꄍ0 //@-RP0p0 w O-IMP  @T p `0 R 2/0RX P Y  9/0  p PP @TL0P ⵑ003/Y@ 9/T [RT T @T@" 000Q 1/0YR# P/0S% 03/P& Y 9/4R@TL0p ud0P nIߍd0p eh0p ^Y 9/Z 0 03/(0p MHv Hu ,u u t t P0/O-@MM(p NT 000 0\0+`P$  T%0 `jP4 0@ 4/@P`P@003/0 `OPMߍT00 0 P 0 $ \00 Mߍ((0 ݐ R00r # 0/0/@-@@OA-pP`PM1 @T. 0@0W   WT 0 /R C 0CW /RW  W0 0 B/Q d!0C@T@! ɑ0@ 0.0 0w  R0* 0 0Pcp@  U 0P7q@㛒Pۍ薒?00@ۍ S0p PH^p 5p y0P@ r  p@-R 0@S PR:   Pp0P  , 0T90( D<:p0( D$;0( Dpp p p p@-@Q PPpQpC-0 MS~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ&㼐Q P&㴐Q xPPU a/U`U"0E'S0 rP\bP ]P PU /U\U fPnPtPbPUt 0  O/ PQQ 8P(0F/Dp0p ,p (p o n Dn 0S p@-P@ P@p 0Sp/p@-@QP Q  PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@>0Q/Dl #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@>Q0Y/DȎk 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P p@>90-DtTj cA-PPa Qpp0` XpWW@PS  PL <V`p p0 8/PP`<`nQ P P 0S 0P P 0SPT T /P P 0 Pi ~h @~p@-P@PP  1P(0@{#@p yx011/A-\@`pP \1S 0 €  P 1P1 `p P 0,0A0 4⼍B`0 4ⵍi i @-@^ P ^%QRS  T00NQRS"  TŒ 00Z0 4{h G-@R0(M0QP P 0 ` p Pl `,0T?o20S00(Ѝp`0 h 0     Q /0     P /0 2/ / /    \ /0 2/ / /    \ /p@-@PP`(M/ 0S, R00و$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0V P0V00(Ѝp@ R 0S V00f 0Q000 00/@-@zp00T000n@-@T @-@T000 000S/@-㊎計p000 000S/@-zhp000 000S/@-j(p000 000S/@-Zp000 000S/@-J訇p000 000S/@-:hp000 000S/@-*(p000 000S/@-p000 000S/@- 訆p000 000S/@-hp @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#C0CB 0 01/B001/B0 01 /lB0S@-@1/00/p@-P0P0 0@0PS` Pppㄍ괄p/000 000S-/@-r-Hp@-000 000S/@-_pAo//0@-p@P M , Pk Ѝ00;0 ivt` @-p@M D WP pЍ 0;0 Pwt@` 0@-pP@ M T T T > 0 Ѝ0, @- Ѝ00:0 +tp` p@-@ @ 080 ^t d` p@-@PP $P(Pp070 \` p@-@PP (Pp070 `` p@-@PP $Pp070 h` @-@P  Y.<+ < 00;0 ЊD` @-@P (070 Ê(P` @-@P $070 ⵊ$\` R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pៅ80 0 @  0""048# /UUUU3333  \=p@-PQ@t : Sj E Sd0 a Sp0  S?0c0 r-w-!- R00K <Rx  -   r-w-L  Q5 $Qx-1r-@w- T" T T-x 00p Ss0  Sw0 S?0l0Q s! R0s  tTSS   S?0b0A0a0-0090 JZ O-0AP@:  pP? P?  IpP% 00` 0@T% JP0=S AP` AT BX ! ʼnׂ<0>0  00zZ C-@X2M0 LD P @0H P@Lh p`XP \@`@d@h@l@X徊pk p 㷊p` n{{n{ P  {-p[ p0 0S04@R08@<@@00000+0++0+y@1@00 0@0 00ᆃ+X  "ꔊ0S kp@ m i   Ѝ oЍ @q0 0 P J FY dyX O-PMp 0GW"S00`0v@P-TPg +T@`0@ ǿ 0  n 0 n P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ω00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 ⦇UW p psW ꙙT 00 0M0Ѝ6t3O-PMp 0GW"S00`0v@LP-TPg +T@`0@ ǿ 0  *n 0 #n P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R 1 "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $چUW p psW ꙙR 00 0M0Ѝ6p3O-M8@t 0 `PT =uL 0 `PT 2j`nTO O M M TM 4M M L L @- M|d"{@{ @0S H @0 0 |0 30Ѝ  @@/jLjK -M{(,{ Ѝ 0 0 9/ mNA00/` G-@SP, pE`J_/Q# Z/Q JLXP0 S0C0 PY 000 ⹄\K O-I,MQ@p 0L R^ 0S 0) 09 P0S009`0S p) d)d  X)X    @}PT0+0CP I @p  q 0| 0  0C 0B0 0 S00Q?0 0X0-SQT0R}P0-S 0 !000 ,Ѝ 8 H 0@00q p 70  ,Ѝ01 0 B0C0@嬧 :Q 3 0+ B RTvP 0& WY :R 0S00007@0| | -Q000 6$  0 0R& 0 `=$vPr A 0Z @P @` Pp@T Pv P2M v `  Q Q 0@RTZAgv 0 Z Q! 500S 0:S   0Sl5 00+ C :S:Q ? ,Ѝ0JS0 S P0S,ЍATPX `0 WW 0S 0 MTPX` H0 C 0S dH0 9,400S 0:S (  # 30 h0X t;R0S00'X03 00S 0:S W d30 0+ C~0|  0S /0:S  X 010300 0 0S000200S 0:S 20MQ 0O00P200S 0:S hRZ< 01 S0$0002100S 0:S I00C 00!S0 0 00+ C H0 ᄂ 0S lh0||10 v4 h08p0 k88!0 00S 0:S R000+ CR@@q 0 ! 10T th0>h(( J J  p PI p t @ tH |F <E _E `E E D aD D ,C DC B PB B ,O-pQ ` V 20 R" P@T60崢 R01-[@P-T@PC T"hRPP /tPA -@(t0P  :R9 20 0S " 000PP@:T0S! 000100S 0:S 1 0d?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S e0 0uP00P0 0 R0 hVWST0 _OQl0l 0 ^d(lpA @ \@ @ |? h|? X? ,? @-@P @ 0/0 / 4> G-P @p0#03w0q0W`@DT@!  แ 0R ! 0 #P   GZ0@ pQP@-pp M P@P `P% .{0 @p{0 PP  Ѝq00P Ѝj0`Pb`_0P`YP 0 0 X~"V-0   X"Vp@-@PP` /o"0p@ JI040 $; @-@P 0@ 9I0A0< ; p@-@PP /o"p@; %I060 ; @-@PM 0 0RPЍ000 `; 0 @p@-@PP U u00QUPQup u00QUPu00Q0/0 : 1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P R$}P0开D00p 00$`,@(P0Rs 0 A-P`pn@PB 0U0" V W- p`Pp`P|P, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`P&00yx`|Tp@-@PPM% U 0`1S ,0S $0S  _pЍp4<80 ~0;0 ~7 7 @-@P 0S# t0 P @0P &0 000 01 1 00t,0<0 ~굀 0 P7 p@-@PP$ U 0`1S ,0S $0S `Hqpp4980 ~080 ~6 6 p@-@P t00CS00 Ptp);P070 _~l6 --M  RGЍ Ѝ/ -- M0 0F ЍЍ/0@-0P$M R0 PS @'  S%y 0   B040!  ~$Ѝ00y L0 000 0 PS@$  5 5 5 X5 P 8000S(/00//5 4 G-PRSQU 8M4p`2 YL\ U8   Q Q  2  k yV @P  j .@ryPV$!1 0 40 30=8Ѝ@@(4P 0}Y) @P@ PU zP 0 0  | 2 n  =y @Pd@P@XX0( 4s} X0m}'LMp<L`4 ;4 3 3 3 - M ЍA-tt1 0!M@P0<80P`J p4 41p4DPP !1 0 <8 309!ݍ0 }  @ 0PpPP@T Cn` x0P8TPDzP @T@Ὄ庌,0,0 |%'KJ5 5 A-!1 0!M@P0<80`d QPP 14݁PAp4t1 pс0P5P  0$0(0,0000@ 0pp剌PP"@T Cn` 0P8T寁PyP @T@0S  TJL| d0 0 <8 30!ݍT00;D<0<0D {|&xI D4 3 H`L3 O-ğFM MPQdč@`ᐤt嘄 T V Z XX ( 0K0;d 0P0S  0KUPW  0 LP(00bP  $Px Ps$Wj ,Pj(,|bP $W , V_ #3 0 d4 30Fލ Ѝ|0 P3Ԓ M"yPyPi /~P@@W  QRC0Sk SIT" W?@Y/ 70 Z0 IPB0 {TF0 {V?0 {Z8x_0 {0X!0 W/60/$0S㈀X~ !P  0-6  W?@. 6 NKr%pE~FhGE1 0 0 X0 00 0 / / y/ zx/ {T/ 0/ . . . h. P. 4. @-PP1 0M`P000@P8  {T p T0U0P @@P@ 0 0 0 30'Ѝ|/000U00000{P 0?s00H]?a/ z|0@l|@$LBA, @-@P @ ~]?f/ z , O-HHǟ M Mčĝ((ĝP "48 80S 0St $0S{ (0Sf IPD@PHh0  <0@pI P`6&@06 0!>0t6@000}?, @p0 Ip!  Pjb|00S# ^|0=SPX PUPVPU bP@`K|0#S< v@T <@00C@06|0 倀0 00 05,P%%|00]0 @0 00 4P 4 n,0$z>g00$z8g40S@00C@0  0p@D0 T !6* 0- M Ѝ@-0 0dM@P0\00p`    'P H0 0 \0 30 dЍ(T0` o xH O-/? 0M@Q000T 0SI X@@P 0\@?P `@ %   " P l%X!;d \p`D@lA @87lA$d @b 9 HnM aLP,hPpb!5_T`l`:b.͌6o+(d! P% PPbQ tP5_l & d!, p' )``d!" x` 6o* d|@n,4O-p'`pp%nQ $pPp pnQ%Pp !7( b n ]>a,$bA!(@bA$͌e!@M l 8+,`&'pbq p)7 +0).)&,o.e)8`` `e.d)` !6o) *"( 4*" *(((e8P*/+ $ ("*, " 8 0/" *p'*''`$pdq p dq' p, o& o&o&$ `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&4`_?`/%/"(`!) `0!,`/"!! g1pd,)_%0 !_%:_%`PodQ `P%P ` n o],daa@n!o`,o po&po&   $M` oe!na  `4.+0`+(͌..`dA. pea$ `& `l$me.`_l P!_O%f _%)_% O$_%,$P_lQ_% ,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )`o.o&.o& `(p..4p0p]j oaa.o&$p!!, o&o&坉o&eQ0`ja% `&pi%`mj n篃i.!_p /%,/"_%$p"0 _%p/% _8 f!.iQ " _p%4((p_%(_%p`%fQ 珃P%-a P] b./f!`a!( "/ "''?a1,p8!++4/"/"p/"< 0 !!!m@e(!&f1e1fqp?0 nfpn10}e$Pa1n1a?f1?8@`O#?#?#]?#O$(`0g1$a1gA@?n1@0 .0<`,,0 ,`.e.g ea` Mςa ``e `ςmg 4pd.` dςe Ϡ p_, p,_%p%

pmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8 +LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$bge( p苠8fd.  f+d,dlʠeˌn{( pe+n{'pXP`"{d{g ,k+T`h+, dh+" h+APfjAkkAkP%P4]+AAA`[`b*Ln+lK'@n )lK$@iMXhKg"hg.h 0ll;Xd.dˌ@nˌb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Ckp7Ca;}d{0lK(0@$@dJL0nKd;f0h;'0#0;l;ae <$ k+* g$.ꩠk n8hnˌ P+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-Pp 堑? 10@@i00T0Y?W@` @@@`VVT(@T(pG   Gc ` c`i=V0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@Wc ` hQ- 00 R- xB@-d @4  R  *4 8/  x0 S\ R `0S Р@- d@ 4 *8/!0œxB /*(0"8 /:$& /--M  Ѝ Ѝ/0  0c 6 R0 00//@@-Mp @6b`P`W P0D>S 0!3100 0bЍ>SD 0!3100&b00"b00/-p@-MaP@U@0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, ,  |  |A-@PP`p; =U( X0ES  S0 +0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0X0+00+0`0p@00(0]0 _00 X p@-PP@F 0a `0RuSpWS6X0CS0 p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D B_ I@ O-0wSpTM 0@@ 0`004080<075 0(0!a @(:a@T%X7(P0p000000G @ @  0 a0GS00 `00`0@J`@PTЍ+W = W0 -S0000 0` X B R  = G/oS"!"   ( P:0,P` ,` R, ("@P0 @(偑  ( 0S# (p W:,P`p ,`0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,Pq`` ,i` Rm, "@(`0`FP`(`   q`(=W +0G?o 2R0S$ Y,PF` ` ,^>`0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,P!` ` ,9`0S,0(`""`FP` @(`傑0X0 0!0($ KR; I?I00 KR<I _0 @$L$0`0S_0"SB  V*(@ T:,P_ @,_0S(0,@0CP@(@Ty (2-+ 00 ` 0TЍ'pC  001]0 ]1]0 ]oꔱ1Fs_00(0UpJ 0Xp+`-@ +B XR R  +B0 -R +R XR 0 -R  X@P`QpP0]0 H]~80o0P A]  p 0@-@PPM 0{ P@{p`Ѝ0 0:0 ]  P 0 @-]/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`OP+ OU PU  0   P@P PPr_P `000p@8000^0P(&^Pl p@-0P@`T @T0rS Ppp@P0+Spp@ܚ0@-2$M000P0n 0Ss 0P 0N 1 00S$Wp@2 P! (W0rSB 0 P0p1 0  T1 P @00S5$Ѝ00oP0T X@\4 ^@V0 00S  Y]@PI0 P0p< 0P$Ѝ0T 0 [8@0 [$pp k Ѝf\0@T0S hR\00PKD  088l0x ZpdddH G-`PPHM6 p 0 p@  p@ HЍ P 0 p p@  HЍ\0S @X@0>0 Z=0P R@ꐶ O-P4M@P\px WnX0S1 `00 S 5/040 00!S5+0$0 00!WbW0^ Y\ X00Uh5Sd50 0 0 0 0@0` P(0`0s 5`0D0$0XU 0S30`jW ,A 0`UVW@P ,(05#K 0P` X $ 2@0 8$*&  # #. B@T$0#"A $1?"!":  #  0 `V4Ѝ3+00 00!m|3/00 00!e`30$0H\.d0La#0L0|2pST0, P `@!;UP 0`V ^ @P,v ^[X"$:600%$0<"%>!!!0C$"0TP%"1 #1O"QX00 0" 0$0 0?S%D P @ Y`1T101! T$?01>! R01"_0`A(0l10X00`d(00@t`dP(0 T  R.1@$Q5 0A`X0 0A$0PE `0P 0  `1`190T dYt8H0T d Y~`8  GzG\ Q(\)\ ̳ $ SQ Ȱ O-PP@` Mo Tu V| p0 (T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @@0 <0\; \ @ p R@p\ p W R:\#Yp 00 vXT80 mXVllD0 dXzp,@ \?[*!]- ܮ  p@-@PP U p@GHT0` ;XU((h0` 2Xp@G EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` PP0 X= V  0s0S0 0 Q 0  ! 00S-*_oRe`V4P" U  !Xxxt0 WT\\0 WDG0 WY00PL (  C-1 M0 M@P040`P$ Q? U5  0s0S0 0@ $03/!1 0 4 30<ۍ Ѝ`Qpp 0oWV U G0 dW0 \Wtt0 TW P0NWD40 FWp\ C Ex D@ O-TTƟMM HMPč pTDe0] X@ 0SG VN 㰰YUZ0U@@ R R0 0C?o2 000RU$00 S0E0@b0S0000SgV $0+F0D 0@ 03/[o 0@ 0000,00G(0 03/P     0S00 * z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ P (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  00s0S0 P@T  0s0S0[X04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0J  2/0S0=  000.SP _ %P 0 @J~P? @ c  2/06G(100+$0 00 `P0XX0C/Ur0W R 0D00 U0S0 UV0 U0 U0$ 0QSW0/ 0 0 @  03/0~DD0y딲p* Ԥ / d @  O-\\ßKM MPčp`Pؔܤ; WB UI YP \U /\@ @ 0\/\0 V'"2 0 4 30KލЍRZ/\3/00P/\V\% p80G/=UW0G/4UU0G/+UY0G/"U@Pp PmP 0   R  O 0T/S 0: S+ S 0 0 0 0 PX! +0s0S0 0@ (03/0S0: STq*/00 R0xPxP 0I/TG 0 TV/0 0RD mԡ n o@ SO-şM5$M 0`P000P 4 QD @0~S<   pH 0S/S;RL 0B0 4ZS 0H*0; P4S 0 0CPR- IR*0S0;R# 0X @H p S    hhh*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+p@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S  s000-S]Q q0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 DY0 [0!^0  @E  p4` L0P~ H *; P 6010Q@@Kp0 \SU 0M/US0K/MS0M/FS 0l@S0TM/;S@7@5aT?**[-]8$ ! \ @ O-`QM@pM R W T   DTI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(B 0SV 0F0C  0S0 0 @ ]RR ]RR xdd0R/RX Wf@FU?R/tR\$$0R/lRR$  ؖ p@-@P`PM( V/ 0  0 S /0{S 0\ {\ P 0# Ѝp0}S0S Ѝp@T0.0RV40.'R%T 0 ĕ A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ| \R@ @R@ )\ L 0 R+ލЍ0[/Q\@\ p@-`P Pp@0T1@D 0CPP @T* 000p0]/Q̓ 0S$ -*S ?0Cs\S0 P0S Q 0S 0 0/p 0p@-0@ TpP"TC ^ (a`00 0DS'0 00@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p@ @- ! a 1 `0 QM MR050 ṟ 0 0 5 30-Qލ Ѝ ,p p@ P 0 p @EO0 P@0, P 0$4m ( 0l5O-0$eP`M 500S E@ p#S" R0 叭P$ 0S $%P @ 0SR0SЍt `p  0@S 00 40  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000 cMP  00#3R0000 4QMP 00#3R0 (# 000  A0$00 0;p P2P<000S[ cOU_ `'T7 0 0 30Ѝ `s?0l0` Ⰸpp  PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S# I BqQ #S& H BqQ #S% G BqQ #S> L BqQ #SS M BqQ #SI N BqQ #S? O BqQ #S8 D BqQ #S E BqQ #S F BqQ #R 0S:U 0p0S8 Rh BD{nP `0000  00  X$   840000   $   30000S0 @  # 00   pW p[ pO0007@O@W 0] O000S O0 0OY 0 ![ }O000@vO@00f@p00,(@ ((@(@00,0rX X[  ZPk|0Sy[t+N_0 >MG0S;!  1A0@ @\ 0P 0S Pl\10\ 0P 0S Cl,10 1P0P!0 $ 0 0xS}0S y00  00 00001@9GP`V} XV} UdU| (U| TT|ThT{ $S,XSSz RRz pRy 4RRQQy QtQdQp@-`@@0S P Dp

02d Q@NS pP@J0V0  ! @T3 0 Pc/T @0 $ @@T S0T0g /6970]Sf /Sj \Stz $o o @0P@-@ P H 0 Q 8Q$?o2cl l p@-p`@`PCP CP T00pT 00pH 0 pl O-0Ÿ M pc P   ټ ׼10 230Zߍ xPT 0 p H  jP 7 R @; 0`  0P ˻P& PP 0 pP 0 P0@T*p@ 7G 0 pP %H - R  F poO-0Ÿ M Vpc P   Q O10 230Zߍ PT 0 3p H  P 7 R @; 0`  0P CP& PP 0 pP 0 P0@T*p@ F 0 pP G - R  mmO-0Ÿ M pc P   ɻ ǻ10 230Zߍ hPT 0 p H  ZP 7 R @; 0`  0P ỺP& PP 0 pP 0 uP0@T*p@ 'F 0 spP G - R  6 ktkp@-\@0@`P@ [P0S SP 0pe p@-\@0@`P@ P0S SP 0p\e p@-\@0@`P@ 5P0S SP 0pd 0 00 ?h-H- M 0 S 0  00\100M0 R0    R N8 00 0 0 30KH Ѝ/Lhg-H- M 0 S 0  00\100M0 R0    R  )8 00 0 0 30KH Ѝ/c`gf -- M0 0Q'--M  --M  A-pPPp` V Q @Q PD@h0 0000Af@00 C(80 C0,fa a 0P R   0//O-D'D7 0(@04!50;:@p@`&``4 3V4X4G1Y01000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C J@ @-p A J@ @-p J@ @-p J@ @-pPP `@-A00p@-@PP  p@010 }?R ?0/R//R/?0S/R/P/R/p@-PMP`V w@T 00Q@Ѝp{ : { ~'p@`($ : 4L4Q 00 R ~3,@-ZA00 0S@d30 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`v:@ .6P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍPP @@ @ 0(@$0HP(POO-pϟ 0 0XP(<Ѝ 0 P(000U00S  SG 0$`Ph08P p`C P9 P[5P p W R0 0$`0P 0p`C P9 P?5P pW R0 (000@ 000@(X(P(PzW0  GS(  +S{ -S 00 00$P P䅐ಐ/P:U X$P( 2c2c2,,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pP90  P4P7 p9P  4PP+ 0(P 0  R9,0X0!0 B 1X/0 00; 0  0P(10 ,0 c0,@ 0PS,0(111v>C 0C,0  !/"b!!A0,0 X0 0000 0 L: ,0 @:,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(I 0 00X00 0090   0[P(X|X80   0IP( =0 P( X 0P( `8 ,, ,0 0CXP0(m000y 0 P(_000k 0, |,0#/A!b!b0C P0( G 0 Br0 S\0(0Q0X09@7 0 0P(@ c0 ,Q 0PS(, ; 0@0?2c11!, 0 0 0000X60   0P(X ;0 lP 0 0 S0 (0X(P0 0 P(%(P000 c0 ,P(00000  R 0s @`0PPv0 P@ `@ @a0Ka1c B  B0   0002 !/#b!!"A ğK/"bP 3 :bQ # 3,P b4p$ ,  Q000000&0@ 2?3c112B #K?###cR3:#cR#300#0010 !, 00C0 00@TP2 R0PR00D0PX$`p(P$0000PX$`p(P000,P !/#b!!0"A K/"bQ:2bS0#03|" 1 ,0 B00DRd , 40 00N(0~0 S!0r @WPO"  IPH 0 40N~ Q @(P0IPq 0(P00(PP @ ACLC|q \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0 P ( 0$0:0 OM QJ l'H hH n$I4F P)\(\ ףD C C A Q .10PE0,P ( $P( Pd#/"b!C;R, a2ba12TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @\ 0 @V~XP( 000 SeXP( 0000@>0S; 00@70S 0@0 H,0 0P P(00, 0C$0(w,^2000c^\0M0c$P   0P  P(00 , 0C$00(0P @   0P ,  p#P ( (0 b$ 900 0M0Ѝ;A-1@0QPHP P MO Q&t10d0 P1$\Pp P@@ 8. R(!  v P`-U! Ѝ0 P0  $ PBa @ ` U;T 0 Ѝh H  0! ;00< ; *; h; \; P; gfff ; : @-0M@ ?0P {00Ѝ@-0M@h0P n00Ѝ@-+P@b|p@-@@1 00Mp0,00`@P< U2    P00Q Q Q 奿 0 0 ,0 30 0Ѝp 喿 p呿: 0 P;@0 840:0 88t,`8t,t,9 l9 p@-@PP U 0DPp P @p8070 b8U880 Y889 9 G-pP`' X- Y 4V @P0PES  R  D} 0PEV R  RS0@0D@ 80H0 #8XI@0 88 `8 R@- 0BAs @Q 0CR 8@O-錡PP p MT WC 1@PH 2PH  1p`J 3(101S Y2 Ѝ010P@1P* 0 0P 10 0  8= 0  8`D<0 7b1900(0C0 7256 6 RQ@-M @PЍTT 9@ЍЍ|9 00O--M⠁ Mpō@P`pG p1PP pH @\AIX0 ^00pt呪0 Oͪ00 T>4 q@Ѝ0,  (@P + P |0 0 5 30ݍ Ѝ\0D0 7900@90083t3`24 0   M Ѝ~1--M  Ѝ Ѝ/ -- M0 0~ ЍЍ/O-鈒@P p`M X X00?,*00P @ P 00 00 P! !  D1XPF  %+VP WT V[XPVppPpW` B 0`f`0 ᘪpP `PED8 0 6W`!00 ! 1 00, ЍƬ0XP C0PP00 w, Ѝ 0 U6`XpPP V QpP `P00?0 =6e,1\2 1 @-@ M=,(0S2 )0 `0( `1/qpPp0)  0 0 PUR <0PU#, ЍPPTp 0S  0CP,700Pp,@-P M+(0S: )0 "p0( p1/qp@`0/  0 0 @ToR <0@To+1`V ЍP@T` 0S  0C@o7T00+700+p@-PPD (A0S5 @Tp1 Rp00P0 P 0S P0֫ 0c0(ѫ 0P0 ̫0 Sǫ,P ë4P 8P p@踫HM@0 Z50Sp 0K0 P5eE. \. p@-@$PPᗨQp@萨@x @- @@ቨQ@胨D p@-,PP| R@up @-a@P`ME P 10p00S `  0 XR` ` 0@@S6  V8 CR 6!0A0 S0Q^(:ЍV   "Q @^ #R.S(@A a  00C0F0 4 "^ #RN^^ N0 s0Q@,*, 4  R  *4 8/  0X\S 040:8 R РS /MexB@-@`P\6LpL0ppD尀 iT   a'+ @-P`@`60 ~A-tpP`@P( T.  r0 SSS$v S00 S 00500000050 #4T40 4|%0 0  00L50000  8 70Ls0 20-V00 ^V00;\ 40000 00B0!0000LS 0100C0 0?V`000 00000 \ \ 00| $40000  70Ls0 0 k", 3010CP;\ cP3`b0D001~dP0m R SXf\Q d301K00 P \> =\H \: 00F00 LR0h0100C0<" 0 0  Y 00Ls0f" 0W0Cs0_2 F0nR$  \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00Ls0! 0W0Cs0 0 #\ 0 0 00Pk 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP@cP'dP<00Ls000Ls00<00xP00s'* T+ 4+ p) H) ( D' O-`RM@p , [3 X PE 0 0H P@0 `D4PB V0F3 `  [ 0U( 00}?7.r2[?7.i2 0@SS0T 0 0@D0 T0 E0 ЍR400Ѝ S I400% $ p$ 0  00  p- A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@50081003/0P !p0 $@ н0V0 00 R (ߥP000P3/0P! U  R  SV  0ST֦P000U \/>3h L, l=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@00810 03/0P !p0 $@ >0V0 00 R (MP00 0P3/0P! U   R  SV  0SDP00 0U D ľ* P$A-@P| P,`Px rpPh  00^c<!"#b!0CaqV8 X p.PXU $001p00S \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(㫤P` p  0000St崥P0000H0003/P 0/>3Ht=\A-@P{ P*,`Pw rp Pg  00^c<!#b!b0CaqV8 X p-PXU $001p00S y\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(P` p  000$0SP0 $000D0003/P 0P,X(SR: G-P0`00Sp 3/0Y @IOP  T 00 00 Y @IOP  T P00 D0D 0 p`P/ᔸT@ܷSR; G-P0`00Sp 3/00 Y @IP ҥ T 00 00  Y @IP T P00 D0D 0 p` P$/xp4 O-PPM M Q \ /\E ήP*P:p/\ p P/ `K`\n @ /RR.\)  B R}/0  D00  I p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/R_0W0[0娐 !uRP-U  *   RW  /0/\0#p0 @/R0 X0/ ލ Ѝ @ ލ Ѝ.000 X 0/ ?    㖢PH000 0>00~000y000t0?00o000A-@P Q P`\Pգp@P شP`V Q00"S ᣤI000@p@-La P`M=  )00QP0<P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P Q 800  / 0 @p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 - 00 - p  00/p@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D s-U(P0D j-p  O-ȟ M MDčpĝP$ 0x 0S 0S 0S t4!S S 0K0C04 8 0S:SYD H R0 0  Q!0A00M@04@@0q( 0:S d) 00UePaE40D PT'F0 :SS008$ 0:SS00n4 0   4    ( @-0 00 x-H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 劬@ 00 0 0 30KH Ѝ/8 p@-0@@LG0PP0OpP TO-@`$MllPX20PX 00 0@`QGP p W  hP G  pGpPH0 S": '$ U10 r 1$4S1!$6t@ 000H$ iH0S "<100S (!1 0 0 307 $Ѝ U r 6pP Р ,dP 5SX0(, VT00#    i#PH vH0SZ, t$ ˠ@-(@M@@0CPЍX  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T 'P0 0# 00Ѝ '0Ѝ0-$M  00 0P$Ѝ0-$M  00 0P$Ѝ0 -M 00 0 ӪЍ  0/C-<< sMPPp`/ V5 @X0^00pAtA厘0Oʘ2{ PP0P >TA{ 0 0$00 @2 t0 0 1 30sߍX0G0  %V<H<0 %A @Hx l 0   M ЍO-ϟp/  M # P 0_ We 000!R !X P  P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS  000P0C0 pXP l@0 0 tP 0C PSP =0 $$W H0 $$a`0`F p0p0S8@0 FP, 0P0CS0 0000偼0S0p0@0 0 *P0 0C P0 S7P 00 pj0p0S*P 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S` 0bP P` 00 000050p0S 00hʠ@0^T@pp,(0$TIQ 0', 0$ 0 0$`-QU ]QP0 ` Q; @$00!0SVp!p3@`0 0X:P0X00 ỚP& 0  B00  `$0 np PTPpG@0SW `㔚P 0@0080偼0S YP -00SA0p00p0S00 5P 08pG0W]p 8pFWp!> ᔈ m@(0H0p0+0AMS00 [m0H000CS0d000pWH R0XS 00 0 (! 0        0H 0 0(0 B0P0000F SK*N0 `p(@L0V'(0 `@C8@ 0p>(00S sP V ,$00SHV`@ T@0  R  R=  0 BV0 5 RGP/0pH  R{ @0H  R'  `V B   H 00 0S!P HX A 0p0 0000P00p BH H HQF@H  x :   h  \ x p `pG00P0W0S`J 0000P T0$@p@00Lp0X0 0P00( P5 0  B0 0  ! 0夗p P p/ ᢗp 块0S $0 PS0pS`F V 㻗 P0 0@00^P ($@X T 0@0 0c0StP [($@  0(v00 E,i00 @V1$  ]R Rt@Pp00@0 0P00r$  ($ n4X y@P0 0P 00p,004@iP P P  P Pd P 0 $ 000C,00W[ 0$@(k ` @vV @ ^(0R0BH0R 4P-@0 `% V`p ,X@0Vp@H0 PH0 B   H `V  0SP H0 p H00CPQX0p0x5Lp0X@P0 00 p?oV20SX 00 0 0p B0V 0c RpP]0 PP V0 Ꮦ P 0  B0?0C  h . 0(  ?p0 P s ᅖPX P`Fp0S 3P [[ (0 {1(0 SA-@P`p80 &0@8@-@`P MDp$@0p0 000@  ЍA-8R@QP`w v 200S8 0P1S010q G000Pv`$ pW@0PE QPP] 0 00P0 0 C `C0000-  Q  Q*RQ0 <00@8 0 B`0^P#00P0s0 㙒P ˠ0/B0L0`0  B0 `  p@-@Px Y|0@yp@-0P$L`T M 0S pW  07/@P ЍF @ Ѝ0804 H<0pL 0 00M 0ЍA-0P$L`TpM 0S $X 0 8/@P Ѝ @ Ѝp0 H0$x 00 0M0ЍA-0P$L`TpM 0S (X 0 8/@P Ѝ@ Ѝ y0 H0( 00 0M0ЍA-0P$L`TpM 0S 4X 0 8/@P Ѝ@ Ѝ >R/H04 00 0M0ЍO-MD`PpZ@@Z T6 0US``$ZC 0S@ [= 0 `;/0S) @$lV 0S H[ 0 ;/@PЍN@Ѝ0$lV?%.H>0Hh[y?/^40HJ>s/H+0$}>[/^!X 0 @-$$@M Ѝ@-0P$L`T M 0S 8pW  07/@P Ѝ@ Ѝ ?/H08p 0 00M 0ЍL@-@`pPxx0p尀 T  0 2=$  ⭩ᮦD 0O-ğ$M `H0  0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT   ^DQ #2!Q   "  R  R  \00t0!#300@ 00@00 @0`PU*$Ѝ@0 0M  0ʒP-0 S^^?0@0 0`0  ǒP 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0YP0U 0 Dr RQ0\  @`bl qA- Q@Pp`# ^P=0D?o! D2]R0S =p0$!0@<  14 40 0 V V 0 P0 A d A-P@p`P.T T |0! D32 0 A_T %D0$!0@<  1x x0 (0D,TSI6 O-00ȟ SMDȟPP x`pt  ?o2V0S Y W w@?0P0  70P0 [00 p1# 0 S@ PT- U T 0 1 #ΑP00? PPk@T`P @  TP 0@T0P00HC1S@1@! <`pPD 0 (0{0S V <0 G0CPap1  * 50_?  Rp1  ' 50>  Rp1 00p1 00p1 00p1 "00p1@\00p100Mp1 L IP@T`|P$> A@MI? 7 ㅏP( PzS? (  TPS~0 I0 AYdE? 8H T$ `p@T 0p 9/P%00wusq#3 0 D1 30 Sߍ@@Z0`S$O 0S,0  VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^\*  P2 0*A5)q @. 00 (0<⸐p  aP ~$0~s$@ 20 ,0bT 0 0S0"700 0P{00, 0R 00$00S$0000P04p0S 0SV W``w? D4pq00J81 `@`,P(H(0 [PY4*( [ $0@0S$0 EQ  -P U@I> 00P0p0^$ @<    \ 4H L@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ" ȹ@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 ЍTp@-@QM`P0 x0 `sЍp0@-@RMP0 e0( P]Ѝ0@-@M 0 00 LЍ-M $=Ѝ-M $(/Ѝ@-@ M00000l0} @ D 80P @0 0 30 Ѝr\ @-@ M (0}/ 0 0  @ D <0P @0 0 30 ЍBX H0@-@QMP0 0  }ό Ѝ0| 0@-@RMP0 0( }PЍ0 0p@-@QMP0`0 0$ }ό`Ѝp -M00  }όyЍh -M, }gЍ0 -8M  $}όUЍ 0-$M  0$Ѝ :00< @-p@-PP@ D!!!!@垌0P0 @p00  yA-`P@PB T% $0S:0@@T (00 E R ( p0S$?@04 $0S%*( p0S$ 004  @-PP@`Mr ,0PXPI00PX0: S Sc  SЍP P :tP 0px`P@0 ``\0@D`.S08H0< 0L R$0L R 8< \P@D V^0 0U :0]0S \040. SЍSp $p Ѝ0:0P D A-pP`P$ ,0=@P \0 00X0 0 0 (0P$00R `$@P0\X0@00\  @-`Q@M pp.  8<0RP@D0RP 0P0V Ѝlpp ۜpP0@t@ЍlPPЍO-`P4M(w ,00P0(0s S @COo, B0S 0 00P 0 .0 0PP0,0 00C /R 000,00$0 0 pHL00 0 ,P R 0$0 05000Wp00@@ P ,0  0.Sn P ,@P XG0 0, L000 0S5050S 0SK 0S 0E,0\00 00 $0 \ } R0@PS000B 02H00#0Q 000PPS0 0u P 0 0y0P0S , 0$000 0H,0 0\00 05~0S 0.S 00P 0/ 0 00$0T,P0Sr,0B 0 S; Y 0$ U0; (0YS7L0S,00 S." t P&  ,0%<,0@pW @,0%<,0p4Ѝ0 00P 000$ 0BUYe (0SY 4ЍO~0@ 0 [5P0500,0 00C /R| 0P00S  \R   B  0SL0S0y \R   B   R00L Ri0)0h LS05F0$0$0UC L0S,00S (0S05SƚP d+0$0SV O-`PPp M U0:@Px PV(p,P X PUP1QP UfP[R PPPP 0L0[ PP P[!  PP P\03 L, 0  PWU P0pP[WX EvP ,P0%K X PU @ ЍPQUP1X0000x0 `Kx0 we \ P*P ,P0%| ޘp,00,0 P ,0 0T X ` 0 p@-PP6 0S %$L R30@T@L0S~@T @xTP rp,0 k@p(姘0墙p@ 垘L0L0 @0`变LV `| A-PP @TP ,0,MQ Q% R ``@T +L0S 5S0T 0  BQR@( @D Q\! 5`V `V`05,0 $ t P ,0<,0@`V   <,0`V`P@,0   hP@ r5 0$ 5@T 0   0S00/,0 C /P00 \ @Q20 EX}@唈L0s ,0 `L0SS 5 ,0(ØPv(I,0幘P0 \p,  [/P W@ ` ` L0`00 0@kS 8P0 05 .PX,0 U@10jp(8 505I,0 $0S005@?@p(j0S bP -,0 00Cp( 505``0(@F@ 0%$0 0%$0ꔺ  U | Pp@-@P T UUp 0 p4"0 00 xꀵ ` A-PP`G L'pl@,0 $5 S: S@T @崇T V,0`<,0L0`S00/S , @ xE00 ⾖pp@ d00ǗP Ė 0 0 "긖l  1p@-P@PP 0P0S 0`0e0S_p@蝖(U(R(P(S0B0  pT A-10 0PS`@(M @Ppp 00 @0 P% 0 0CS%0  p0 0 0 4 5;1:(Ѝ 0@0<0"0 0(Ѝ0t< 0 00M 0Ѝ4p@-@PP P PpPp0*0  p@-@PP U p@ D0B0 nU(C<0 ep@ ز p@-@PP U p@ D0B0 OU(C<0 Fp@x \ < O-PMp 0GW"S00`0v@ P-TPg +T@`0@ ǿ 0  0  P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $UW p psW ꙙ 00 0M0Ѝ6갓3@-@0LM`Pp@0 1P LЍ`0 2LЍC-1 M0M`00<0pPRt@P U d1 0S DP(0 z ΕP( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nSP0S  YW@PPP(G(JPpnfsHuniop@-`T@ep@  P@P p0PjPp`@-@P @$F 0 (@Ȭ @-M @ᬕp 0: S  :p  JЍ00ЍO--3$@,M00 p@.+P"+R%1``kX00Sw00v e0$0P@P0 U 0 * @P 0 Hw P@ 03 p P@PET0S7 PUS0  Z*0P` R   U T 0F UA4PP @Xi 00D0@0 p$0@,Ѝ0 k00 0$00S$0`0 P P 0!ᐓ xpp  ` @ 10 0w01[  `/00 0 0 S 0S[  P ` 0S  [ P00 $ 㼁PP @ `  p@-P @T @T0 0pp@-@PP U   p@ 80:0  U;<0 } l L /O-pP M@`0& X, @T Pf W P5@1 P1 5* P  8/P  00[W@D:P PU Ѝ8080 D X @0 ; ꬧ r sO-PLMP@< [ TUC <000D $0'P [ <0S 0pD0U00p000E< 0 0 00 p ;/P ```Y`* 0 ᄀ h @( p RPpp,004PZp ;/P  R ,0WB^P5P1@1*pIp ;/P  R <0 @I 0 @V@ 0Y:V0@  Y: p I0;/P0  <0 0I 00 `& R p0 S <`0 P00 Up `@ppP 000 C Sx 00`  F \0#03\0SU (, 0p4P8`p p ;/ P0 p0RP `pP ;/ PZ V 0W$0 S 0 X 0 H BX 3  S0 0 SQ1: (,0p4P8`0S$*$Q R0B0C0 0Y00|P@pD 0 S, 0Pe 0 <s00 `<0<S! ;LЍ p@_4Xh0T $V0W0T $Op `p p@-PP@" T( Pp _P 0S Sg]P p@a]p0p@/80w0t $Tx0t $o o p@-@PP U p@ _80g0 $Uh0 $,o o 0@-PP@ M T !]P Ѝ0^P 0SX00 _<00 $T 0 $@dn Dn p@-PP@! T' 0 0S p\P ^P \P  \P p@\800 $T0 $m `m G-PP@H T  R! R `V" V  0LXqXp$, 0n R R2 0 00 0 `V000 0`V 0.L0 F0R#  0 0I0,$7 0\K/ `0 00 00 0000 0Ll %4l l  @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 0:0  k k C- MpPÍ`@PL TB A< VP8 HY` 0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T O p0S `% 0p 0 D0 L00 E  T (  RP R0RHHGTj i i i O-hIMdğ4M IM,J͍,@@P p`WP W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l ? J-  p y x#J T 0 ?s0澇 J- 0S VU0  SU S RMJ= 000:02'0 0d$000H0 40RP @,VU  W3 0S^0S  0S0s S0S RJ= 0 J= 00WWG O<  UP[ 20SF ig03?Q #< p0<0J8 0J= 000$ X\0Pq J- 0SJ=  0}tS SyJ͍ 0 *&$ 00SdLP P P J= 00W0  UPJ͍ ^P - FE\h h g O-,,ğ M@pQ `@#0 0CPS0 #3 0 0 30Ѝ#3 0 0 300 HD@pЍOWX`` 0? s0 ⢆pPT0S0SI ? /r "s0 DPT8VT00QWX00 R0SY 0Sf S4YP00SP"0 T `T@@O 00QWX00VT<!  0T D X: pYp  0PȠpY 0@D    !T00? ,!0  piT 1i #]Y:pܐP 0PȐp   P030#?pW 0@D DP^T[pEL   څxADd 8A Ac Lc b 0b a la a ` G-p 0 FM& P@`Mp P  RW  P Wr`ov` n0@Sp0 0 0 1 302Fߍ000 00?1 00  0bP Z /r RX 0S 6P 0 ꚣ0=`<A-@P`p 0 | 0P p@-MP`VP@@P@T 0S  R0S sP2@PЍpP*PЍpp@-@P .pPpP1p0@0 ] 0S/. AA0Cq.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP0 PeD@0S0S 0S  Ѝ00n0 X @-pQM @Q`P Q Ѝ0SSp P*pV0S# S!  0`S Ѝ Ѝ00S SD<0 ?P 00@8W W p@-@PP` U V 0pἡPp``D0P OUDD`0P FV((l0P =W V V O-ŸM2 H 1 #C 01p $0p8 `F P0 0 000000 8 P Y[0 0$104030.؍<Ѝ  0?sQ , s0,0 0(0PU,(Q Z Z Z'[ ``x0 e궠[00[00[002@V @0T  @-00AM M@P čP`p1 U P P0 H P,@  0 0 4 30#AލЍ0SP 0@ .Rd P @ "HHx0 /Z00T/PS  /R R @-t!t1 0$M0000S`@ S2  0 V& p,0< S:* @\ 0S PU S  S0S \Rp`Vp h0 0 0 30$Ѝ0@ 0 100 00 0.$-G-@P`p W"  jPP   @ @ !<<D0 W 0 $P P O-DM@ȟ4M M,&̍hQ,@`@$0 $0S 0S P0 <0&<00!S- &<00S &<00S @'t7 0, 0 304ݍ4ЍS@70 0 0?s0Sp:0_>`C @80 0YP00  03/P 0@&<00&,SS00 40R0ST X@`$`w R? p:00(,P Tp*0 C 0XPPf00  03/P] PsY@pYmY[` M40S?&<00S !T? ]Y ZYWY`5`z_0D0 X@P200  q P@) h`P% $0 D0R4  4 Sw[ 4Sr 000`0 T &<00Sc 0D'TS@pW0(pY,PD Zu H0H0P08p`h@ 0 jZ3 { 0{{ % %  0E {000000JP qP0qP R R 0   pR jZWy 80LE0S5 X00X00 30 0&<00S3@}P@V 0 8(5$%0 5s (0SP #0S \jX00@ $0R TA TThT @}P@V_(0S <0`PC80D\K Y<0 C,0PB 0P,0(00(070@PXOt00S000e@01z_0 0 W@P"00  03/P \Y 00`S @@80PRCPG.@&<00@$0@%/Al++*<,xG 8G G F F $$0,Y$0SDDC?,O0SddD0,E80PRCPG.@@%@0/lPU0@ D3WPp0000S 0R $ R[ $R 0`<O-@ğ SMDP0g`P gpP $0  08X0`00pS0  PO 000 UPK @@PX 0  DPii@|#t3 0 D1 30SߍY 00BW00 Q0 0 .Q0Q RS% d! St*+ 0 Phh @S Rd! Sf*.[ 0 P< D Pdo 0 DDQ0000 0000 Px\0=S V0S# S S Q 0 Pc0s70SQ0S V000000  Q000S0000 P=ʲV00 0 P3ʨV0.[0 0 0sx V00tx0/I0 PʋV000 DDQV00W@hyV00T! A O-`@VpPM 3 0 S_ `PL 0(H0L0P0T0X0\0`0(000 00000HSC S$ S0 0% 0#(,pLp0  0Phh0000 0000 d1S Ѝ 0,p#ᄀ=넀XV00VP P P 0,p#pP h08 H0  D 0 S㮟7 $10T0  0P  0 p P0{0(,0(0  {&0PgZ 0 Sd1SQdXN  00S? !8? > O-Ÿ @00@$0` pY i:92 I520Y0 0 S   S  R  R Q\  ^ \/oQ" S R0S  0PQ ,0 0S Q0S %0P 0 șP>  0 B   (KP(FY 0( P p0`8P<p`P,@4Y 0S@TJ 0S] 0S S 00S P)(0 0;! RDP RA R>0S0S ;0S'\ ,;3< P 0 0PU `V  :00\ Q  P U V  R R  p Y ` P 0S   0?S C" 0c6#PY > ^h \S㔐Q^ @ pTp0S 0`@ p$p T d:42 D52H 0SE0 S > S PR  PL 0@P0 0`P`&0(0 e?0 @?/YP|](0@ S0 `P@T $PP@P ddT$PY@T@ pTt W 000`P 0 `pVPUS Hc0P$0M PH0:L0 0``H`ePPP<$dd0S4 0S \d 0`@  ?3.QRSP㔐  P  P \?oR20S c R㔐J HP\CR PMVp `$p(,PP00 00SrP@T0 5$p0(,PpP S 00 0 P@T 0S00S`<`:  0 yP pY 0DtP- s 0P R 00S R00U  P3 0PW 00S#S㔐RG0S @@ =6.< 00q8P p<,@PcRSQ \`@ T P@P qcocTS㔐e ` `bc@ 0HP 0  0CP ` @P LcJcY@?/ ` `Sdb P.c` 00`P  0 ``dPPH [:P`P HHH HL0[`0L* c20;>(0$0e0PpU 0@Yᠰ @|Ht대`pPUp`K|`0B l`4 0  0(TP`ph !6sP qPK0K D Dp,0sP`KA,:H|,20[ Sh S0 \`( lpL(X3 3 D2 1  ,. ft- xt, |Ii R` 003 Q  R0R`U`7 qq$@0Pp0 00 a"0S0$0UbH@P P0U 0PJbP0U Bb0`$p(,P  Kb_.> fS hrP1x00x0 br`@H`0V00L0` bP]`O-PTMb Zi @` X1q0=>p0=~  PP` `0PE `0S S S T@QP `0S 0 0 0 0=P0 0 U  Y [ 00  [ YU,@TЍTDD?/>Z((D0/54( ,( & k & l G-XMp@P `P@ 00  0 P 40S0. XЍ UP Va 0 P Da8 8<3P 4PPiO 0 & % O-ŸM2M 0`Q<000 Z 0Sq p@ lr < p A.=~ *8PPh 0#S( u0P$  =m0P  @ PRP R R UPZP PtP4 @ R0 @PBtP $K(0K$ K$ 5P0(X PPU 00   P 0@PQwP0 x0 0< 0 30ݍЍTTD0/*i<<x0/"_L$ $ " |"  \"  0A-(M@ p`pPw .P @PP l$0S0(Ѝ! @-@ _P t0  @0O-Ÿ 0 M* `@p1Mp! P PX  PPQ P Q+p!1 0 2 30`ߍV0@SPX N0@SZp00 0P ~00 0 J P ZY0 Y  0!P 0 Y:[ 0 0 X  R  XR P 0 wh0PA-pP`P@ 0 I 0P 00 $h$ -0AL. R@O-0LMp  D@00`P840 <0T8 0 0'00# 0(<  .  " |b*. ,`Hǂ@# @!P(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 08 884  0$00 mꉫ#EgܺvT2 G-PPp`4 W* 0!ᣑ000? 0"@@i>V0: PB0iS@I"p ` *90V@@p`F G94\0P .00P '  p@- ! 1 0MPP0 00@( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t T,00t  @l   C-0"02 0 M0002"00 @00$ p P`0R   0XS 00 Q !. 0N `!P1 0 0 30 ЍQ  Aa 0s00C 80BS.R ^U* 00ꢏRP 0ES0 S S^*0W >y000@^0 8< 4^*0 8<0- MgP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D$  A- rM`PpP: U@ @X0^00pAtA X0OHX$1 000TAΌ LXP2  0 wpP# 0@"ZP 0 0 1 30rߍx0<0 U\=@0 P Z00 0P0꩎8BH` @ 0   M Ѝ -- M0 0 ЍЍ/--0 M0( 0 oЍ Ѝ/p@- MP@0x x` 0 l0  `@P@X@A0@CT  Ѝp` @-HH1 0M` !000jp @P  F jp i@ 0 0 0 30'ЍiPpW @@T PU 0SP@\TW00@<i 0p@-P0@ 0 p0Z(0PZ(P,PZt` 0`0PP 0P 00 0ppP 00 0pp, 0@-@ 0 0 0 0 0 0 00@- 0 MP @0Y 00P 0 M@?o20c Ѝ02 00 0p@-@P 0U0 0pp@-@PY0PPY(0PY(P,PpO-p0Pl `,Pd 0@00 S S0 S S x0PR 000PpUp 7 0P,@P! 0P0,0S S S@ 0AS A@PQ% 0 PS0Q0000]XP  WPP0@@PP8 x G-@ 0`pM,0(Sy: (T] TppU 00SQ 0 RK@D@T0PF   RB 0@D@D0P0S+ T0V  0 1  @D@TPH 00S#0A S0偠0p  ቋi0S000 _ xX0S% T0p@X0ppX(0pX(p,pC@ЍWP  (,@:(~  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ09p 0$  $ 0 1 Ѝ0O-PTMe pE,P@<@0 ppYPb,U`P^ 0 ppYPS,PPU0 @\ \G \Q \A pp 0U00S UP, p0 0c 0@ ` R  R2 R[ R 0 @U 0 `W 0JX0L 0 TЍ @\L@ 0U  0⼰  `0 ` ` 1 0 00LЍ 00!00 0 0@-S@ 3/@Up@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \0 \, \. P@^ ^ N@N P@\ \ \ \D@u4P@d\XTLHy7P x X @-@P @ GI0/0  p@-1!00 P@0 00D@1011.T 0@\0 S@ Z P pp0  00C1000L  00t@$ ʚ;8 A-PM,|p%Mh`QQ`pGQND@  N (0XЍ Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2S p 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`iT O-``!P@@R@@hǟ IMMčĝT0@ǟ< \(,7P0P80 0 (p 0b&6 0x PP < 0L00U0406080@06x@0T060D00,00 (P40Z00S <0`1  L0PU 0P 0U V P0BiV2x0S4,0?p5@P00P 0U9 W,0?p50=< 0[9 Wl0 0iV,0? )R 0DP8p  ( pP,0P8 *ܔ t0 pT Pp0꜔ pt0 pxt p 00S(RP O0P80X 00@4$3 0 4 30IލЍT0_P `t0Z0S 40Z00S <0`1  0 .T\ 0`h80S <#2 0 4 308IލЍOQP,00p (p?0r HPehUS2p`0E?h02`0B?X02p0`02l0d0XMhH0@C0DSH0GT0Ა SO?s t@. Y  h7h`0I  I.h T`0  1\  0H00 .H)Td0 Aꈡ0 䰊  Y 0 }@lp` 0 rtp pH  HgT0  tp`0\  0H00 .Hj)TʻYS 0gAh8hr P q ( L p    | h T D , , O-tM@@ `WPPt0 0PsPp 0  0g`14S, ἴᾤ0   t6< 0lV 1P80\6< 0B>M_PU  0R,40008 UXg`1S   ;`1SU0P a0  0P[0  0PGP  PP30  0P0  0P 0  0P0  0P0 0P`1S|Y~ 8 < P0ppW  0R  0ftpW 0pW  0R  0of`pWj 0pWe  0Rh ,0ofLpWIpWF 0 PS 00 of`1S   '0 ` 0 `@0 `0 `, 000 0O tЍ   YP H2_P0  t0I002p0 t0=001p0 t01001p0 t0%q1p0 t0R/Qh OftЍ tЍ80 k&0 j0 i|0 t0 gl 0fd0 e\0 VXD t $ < P l 8  | H (  @-@`00AMM0 400p00 <PP0S vD 80 0 4 30AލЍ.1ǂ̸`0,@-@ M pp Pg<`PBP 0S <0030 Ѝ00S.S 0S Ѝ p@-|0|AMPt 0 ` $ 0 @P $8 00 0 4 30Aލpy\p@-P@Q`  @Q bPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ80_0Pt0 `W00 Ѝ p@-@MP`0S 0 @S 0S@V00Ѝp80O@0t0 PV00Ѝpt p@-MP@u0@008@@T  0UЍp\`` Pt0UrO"*0@ P0Ѝp$  4p@-Q`M |00<@AP 0PU  0VЍp<0_P0 `t0tЍp @@ȩ P@- MP@0@0=<@@T  0U Ѝdpp Pt0MUN"* 4```@P0@ Ѝ | ̷0@-P M U{  U U= 2 E0R8   U@ &@Um U.A@O4U]  U:  Uc  U A@O&U+ UH UpA@'NU\A@O U HA@OU4A@)N (13N0@( P? Ѝ0@@O@@&N@@O@@O@@}O@@O@@yO@@O@@wO@@O@@ Mt@@Oh@@O\@@ M l @ (  t d T D 4 $   @-@H( }P?;  (0/b8 0@- MPt@,p0@0B>MO@T  0U Ѝ040O@0 Pt0\ Ѝ0 ` Mp@-@ML 0 Q0P0<00P@ 0 `0. +><T @D K000X L0 0 <0 30 @Ѝp@Ѝ/ `.0 TB0aT8 ܮO-PM@PP p`0 Q  ЍSs SRPP -\0  0+\0 0 30P0 00L1011 .\ 0 @T@ sq'R Q"  S#3 @ R Q" 0   S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0` T000@0S Q# 0R#300@0S Q#  00R0#03!3 T 0T @ R P"  S#3 @ R P" 0   S # 3 # 0T\}0 0K 0N0 000J00  08$O-@Q0 dM R 22/18R}20?\0QS0N0<02a!##tR2b1!A`2aL6RX2eDPQFW0E0@0(2h8's2b>?2crlqqHL01NਂhLΆbfXT P0H` aN3% /! +[P0 T XI Z L Y O (0L0$0\0L 0@00H0, 0<0 p0D `40n@[ JZ JY JdЍ00?N\0@R@(@g ό 0 0dЍdZ  PY  ͌<  igMbQl L t \ H @-@P 0D .R S0@*ST .P@Q QA.@P@@? -%x @-$MP`@P`[0pv> 00pp@ pp_p  /_Pc$Ѝ C-@P@P p` MOp 0D 0 SWh20k@`TP0dR U`N  R @ T( 0d  X! p X 0=+L0X 10"3! 01;L0==1;L020 201;L0L00 18!;L>L C+A0X 10"3 ! 01;A0==1;A020 1;A0;+A0X 1 001 ;A>A C0;vP   t H 8 < E| 4 %D L  D *  D == ====X ܿ h @ l   Խ 4 D P d $  X  0  `  VUUU=000+S =<00S@0@R_d 0 0 p`0 Zp0  0 d 0 Lp" 0PU0D[f* `pzOUD[\ 0d 0 0x 0  /p=<00S# Q=P<0PY@ [1!p5=<00S"0 S00 =<00S L2d 0RO00 0: `P0 p 0p00d D; 0' 0 p  0 d  0 p 3 0DR  P/0@P#DK1#\0Yp=!top=<00S~ S=P<0P8 0 B4PkS0P pb jDK/`Dk 0d  0 wpM t/`Dk 0d  0 ep; ^/` [/0 @W/d U? @` 0 Mp# Hl@P8 0@P BP d ! p 0YD3*`@({(p]0p DPY V 0 [pw `0d  @ 0 pi `F@P 0 Y !ZpV=<00S< t-$L0@d D; R? `p0 ep; 8040PC 0  `pP-0 Pp& 0  `pPHf ! qP] ]=P<0Pn=@  <<0=<00Sp X=d 000 ]?$a ! p `V\pD3 1RS@P ` , @@@@_- Hp 0]" WP *( 0>00@@$0 4/,0pG= 0p0VHD 0 S!@P0 p @P$0d 0>0w?  ! p ,@,@0O8p00@( D> `P0 pv -< t?B !?C0 SB0 opc=<00S ,P~,@{,PP0@D;?@02 U? `p0 ip? 8 0`p BP6H=<00SV 0 Cd_ PP=<00SJ 0   8  BP0D 0 S[. C 1#00 Su!o,pK0 Hk= P 00!4U@ *0(|. xp0p> 07/0-`PE HkDP8!p0 Hk= P 00W!U@ *0(- p0= 07/0-`PE HkDP]=P<0P-0 h= R=<00SH]=P<0P0] 0P CP] 0P CPpP$ 0 PU0D[:=<0p<  _@PT T l``Pp 0U00 Gp\ 00e0T0PE0 xpMP\d P? ! ip? Z `z_  TDK 0d 0 0! Sp(p  `PPVVe @Pp 0U00 G7p 00e0V0PE`E0 )p0 HK= P 00 1U*:0 (hP X 5/!p0 HK= P 00_ U* :0 !pY 0P CP*0pD` 0 p d `A? ` 0 p  0 p ` 0 Bp *Pp0 Dp =H{ ` 0PPuV *0(( |08 08/=p`F `H{ `p 00 `pV X0 EwpM t* P0 D kpA =H{ ` 0PP7V *0(' 0 0:/=p`F `H{ `p 00 `fp h0 :p 7*P0 D .p =H{ ` 0YPPV *0(& 0 0:/=p`F `H{`p 00 `)p xV0P Kp )@DK@0 p =H{ ` 0@PV *0(% 0 08/=p`FU `H{`pP 0 0Np 0 `p 0 OpqHe!` p  PDK 0 jP$!pw T0@PDK ]@`0 pg 8 0@` B'P^0DK 0S|})p @DKj_0d   0  kpA h)@DK0d   P 0 Wp- P)0d D; R?0 Fp 8 0P BPD  0pC P3P@PCN 4c``Pp 0U0 0 G p 00e0T0PE. 0 p )0D2d 0R? D! pT!`Np D2d 0b? +!  p!p `@ 0@Y0D:V!Np!p @xp  {@P_TtT Xa``Pp 0U0 0 Gpz 00e0T0PEYᲿ 0 piP`T`!`pY ` 0PC   L Ԯ P 4    8 D P  H * \  x  t ` ` H 4  ؟ !Mp# `ThDxmTbXr``!`8p ``=`<0P`m+J X0X! ##0 0 !+J X--!+J XX" !" !+J XX  # !+J X,-!+J XX! " !+J X 01;J!p PUD @- R  MAP  ,@0@(@@; Ĝ0? ЍО MM$000 1 2Ѝ/ A-PS`+p@ @W0 V :0?s00@PU &P(0@0T0T0@DT0S$0l0 (P@ G-0PU!/:@0`?T0(p0 ?0 0@T0T?00S X0T0 "$ P0@(00A-QMxp$0PS@` 0! $, (0v(`Vg0Sc(0S0! , $P, (0V-ʀ100[&PT, 0 ^,0O /  , U/ ,T(0P0T(0 S0P$00Q (0, Ѝ 0F7P&, (` , \ :0,0?0s0\, :$( ,00(0 SPU$P 0")00$(00A-QM|`$0PS@p 0! $, (0w(pWk0Sg(0S0! , $P, (0W0<00000)PV, 0\,0Q U/r ! , /r !,(0 Q0QQ(0 S0P$00Q (0, Ѝ 0GP', (p , Q!:0 ,0?s010Q, :!( ,00(0 SPU$P 0"00(00G-PP@`pe V[ Th HH0H 4H 8<T0YY200 Y,2 < "Ì!? P P@D0  PT T00  #2<0 W 0"!:T@  H 0 = H0H 00 =00P*0PP00 3h80 +L00 $TW P@ ` O-RPP@p Tv 0S7 t" `lRPHP [B T Wa@ Z 0 00@=ZB 0PM [ [T WE 0@0 0Z 0[9Y^ T W0 0@ 1 0Yp 7:P$T W 0@ 2 0Yp 7:P[0% [ S 0S 00@ 80 00 wT W 0S S0S @=S0,,0 iZȘ  x ZP 00/<|X00P @/4/,/ // ̖ @-`MP@lTp@X ( L0 < 0,M8 $|V@  A-lQ`PP@pO TE 00S>00XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQs 00000  0C Q700C20@?D0 ⺿$0>0 ⳿U ؔ A-Pp@GU`, T @ W0``W0 .pPEVp P7000 2000 S70Q00 V00gD0T q0x /\o/it\///^@-` @0 0DM0<000p2 0/0 RP500000C0< 00 0 <0 30DЍUiSp RO-d2drP0੒ 0 M #r @rgqC2(0,B刀B# C@$AR i!dP @`3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 Hzp# W0Y[0S    00000000SW 0 Wp@@ 0 DLp XW  0 M?p Y He0$ 4⏾ Ѝ @: %I$Q  A-`pP80S-@ xT 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@J( 0 p@-M P@ ȍp k`\ p Go4 (0 0 8 30ލpFhNLN0-@- M0@R0  IPP * Ѝ@Ѝ/ ) Ѝ@Ѝ/.hPRp@- `@PPPFP0 ?p@D4޿00pPRp@- `@P.P$P0 ?p@D꼿00pp@-@Q `PPP0 ?p@`Dꜿ00pp@-P@PDP p@ p@ p@-@P 0PS <0S P 00pp00pQP@- 0R R  ]00p@-PP Q@ @Q Q Q ARt032 E00pyP @pnP Qp@-@P P^P o U     0SPtЍ P EXH  0 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W  0pt pp 0@`> p PPD1?0 l0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333c 00 0M0Ѝ, | 0 Q?0S @-8\-- Mo ЍЍ/G-PP`P VV 00 !PER !U6@  PG0 ݲPU pWW@nPp X1 00ڧ  @@pG  pỲ00ʧ 诳 0@0 0ῧH0B0 ⟱V,C40 ▱ᪧ` ` A-@PjH`H0``@p w>T  S A` p@-@P|00CS0 S u P `0 Psp>`u@-@P Z 0`00@Y060 ;_ - M ? Ѝp@-PP@ T 0 0 00 p8080 T D0 `_ M@_ NA-pP@`& T- V4 0S 0S 0P Q0 00 R` FQ`00`6P0\ ۰T@@p0\ ҰV$$|0\ ɰ`^ <^ a^ bO-ß OM4`dPP `p@dh V Vt Z.` P 30 00 [ .Q Q\.Q _ :!ʢ!PX [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V ) P00 0 ` `0 0C SA: E0  `0  (+003/00H!81 0 41 30EOߍ:[ 000$0( @,֫0 0 0 `0P ,P00 ZZ00000 E<4 +PPK U.R}  :.P q Zt8[ HZ BO-`PM@  0X0 X0_( 0#P? % 000 00 P @ p 偝P 0 "00zP > R  R 0 @`V  pWI1:pG`W:\pG`S C0  ` Z`pGA R % 0 0 i00@ߍ R R0 S S  & P} ` Q PD ~P@ !T: p$ P@D X0P@- #[0i0 Z  '[` pG Ka   pG  Va ȪXV P 0$P 䠊` `p R R R RR T * ṜP  RPB(W$P@D PT p@`V0  P% T ::`P P !T014@1:q0 ⮮0 0$@ 0 @ 0 @0`pP`$, 0@ 0@ 0  PP P 0 `@Y DX V U ^@-pp10LMpP0D00@I LP0`S. @.0 gP) V) QPP0 0 0  QCP 0 $  0 0 0 D0 30LЍCPpPPP O@ z$T88C?F/ BX$ 0 p pIP 200S 0  0pW-   0 F 0 {k 0 tC?/ _] / 0 d( 00S S[ YTE D C G-M0`p@P0P0 V 0   0 p PЍ 0 PP 0/ ⸩A A-M`pPū@P , 0 (   P0@ɫЍ0, 0ЍA-@P MPp@`P UX&0S8 0S0S8 P(1(!0800<0  P00? p`P 00 ЍU U* ^/ 0 0 Ѝ0S S 0 00S000s S 04 P @,,?/ 50 @ ? O-<<ğ DM<h@P 0 ("PP `sppi0 `P ؖP 0,0 P0ß RR RR 0 R R $0 S S 4 Ⲗ@P  0p 00S S S@ 1U g*@ 噖@P 0S0 0 0R 0@B PE @ Y8:I S@@3 $宩 @ I@^ Y#:  埩 U@Iq E1P@GP `p   ᎩI  U>p<` V `pv 0  0`!L1 0 <0 30GDЍ(PPE pP *P@k P0 0 0 0t 0Jp `pP0 00 0 0 000&00pJRp`d 8? t> X> t p@-M`@P ),0,0   0kЍp@-M@ $$ 9 Ѝ`p@-MP`w @pP0P0 ɠ@0@ 0   @0PЍ0@-P MP@T 0t  P00 000J P 9 @ Ѝ0w@T8 00tC-a@P`PMT UZ !0 `   p 0S  >  0C ^0 .SDW 0  @Ѝ0 XR   9S '@ pG W0 QU 4 8<03?0T0m0 ?U8n<0 6 @S 4 : d: O-ß3 0,MPQ0$00@` RM Pg PU0@:T000 0j Tl 0#P P` `@0H FP [ `VV @ ZpW` @$pTH氐0S T0D@ S0 s\b 0 rJp<0p ǦT TQ ¨/00!1 0 $0 30i ,Ѝ!1 0 $0 30],ЍO@:TP \p P :Z:V0 0S 0$ S氐`PqIp0p }V T T0| rWU0| j<0| cH0S g@$pr @.T`@$pTPdwPTq` 9 8 7 7 @- 1 0,M@P0$00P`' U- 0p0H 00000002P* Z 0 0 $0 30,Ѝ 0 L0h0 U0i<0 &P 6 $ $6 6 O-HHş tMQl@p 0 R P P* ާ/ 0 $4 0 l0 300tЍTIP`<0T ǥTu T 0S0` ⻥x<0` ⴥ 0$40(,04801@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<0000j:000@T `0> Zg 0Sg* 0CR00`:᎒t"2 0 l0 30 tЍOP@PUF*0: T00S DX"H 0l 1[P3@T` 0Z00S RZ  @T0`zu YPr S 0 S P0@n Pa0SC: 0 Y Y Y@,!0Q 0  HP ᔠx8 @R0PHP`0T ȤW Tt T0` ⽤uC0< P@0 j0~ : L0@

0[' + P#p 0;/qp 00P @ P 00 0 00 VЍ諡p p*+P 0 Q+ L WY pp 0+P 00 0 SM  00 0;/qp 00PPßQ <PU;ẗ0 {p0 ;/qpP0 r 00 0PUßR <0PUß`X0p\ Ri0嚘0dX0P\NS  00Q[ <P800CPU0&Z   "  RNPL0i?  P;/qp@ 0P000P @ P 00 0 PZ 00 {`P)0S&: I y ?J0C0ᓙ;PPT 0S  0CPß01G0 fAPU0 Z 0CJ P&JPP @0P 0000 00YP0 90L2 0 D480 $0 , h+ + O-P,MPp@P` T 000S000Z00$0 0PP`W0 00@P $ 0R00SQR+X` P  \0P 0ߣ0  VP`P [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pd z ᧔P 0S   00S S0S S ^ S@@T000S00i0\#00& ^@ [ @@ S@ U80h0 0*g0DH' p@-@PP` U 00F G p 00pt060 UX7<0 0 0@p0TSݣ00& &  -M0 3/Ѝ/0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04P0 ⠡00 ♡% % 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04h0\ i00\ b% $ p@-@PP U 0S S S 0p@0/p0p@0/p40t ;00t 4d$ D$ p@-@PP U 0S S S 0p@0/p0p@0/p40  00 # # 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 ֠00 Ϡ" " 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 ❠00 ■! &! %0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 d00 ]! F E0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044>,+0Y0,$$ e 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044K?G/0a0G/D $ 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04iS?O/⻟00O/ⴟd D 0@-PP@ M T 00P00 Ѝ08080.☟T q[?.⏟  0@-PP@ M T 00P00 Ѝ08080^/sT [?^/j@   0@-@PP M, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/400a/-H ( 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044j?g/00g/d D A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0t A0/Co<0<0m/⭞(#[?m/⥞ ( *  A-PPp@`M2 W8 T& P R P P P @ЍPX 00@R X ЍA|&w?q/f00q/_W>q/V tP` Y0@SP$q{y  ^ _d p@-@PP U  ;p@8080,#U ?,  A-PPp@`, X2 W9 T P  R 0 R 0\A/V 0A/|| =/d0d0/۝XLL?/ҝW0?/ɝ    0A-@PMP` 0J U@ 0pS S  P R`V V V ЍW W 0SP00Ѝ W` 0SPVll>%.oT0/0%.h Pp %{4   p@-@PP U p@@ <0<0/DU$ >/;(# ?d 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/U ?/\ W< 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/ⱜU ?/⨜8 { p@-@PP U p@cD00/├U((?/⋜p@P  p@-@PP U p@D0D0/tU,,?/kp@yD $ p@-@PP U p@"D00/SU((?/Jp@  p@-@PP U p@KD0D0/3U,,?/*p@8@   @-M@P0.S00Ѝ$@-M@Up  B0?R0S Ѝ 00 00CЍH 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 /l H0 00/L 4p/0/ 40/0/O- M0 R Pԣ0г Pl \ Xg@.000\` @\e  X[@PAR0SI <  cSB!  S   XG`(S P@p@P  pGW`W0P@W `0FS@0 R R S*   Q @CT00SD$0@ P֚T S М(00@ ЍAS0S010! 0 X@P \P!S" Cr <"-  X 0@Q 0;S@S \S ! C]R X@!#!! Cr  @ D"!!1Cs0#Š1 0 D0DX0@ESP0Sp pg' 0`A0i pg'!"h 0`30[X000S*. 0 c    Q` O-@pğp$M W0P Hd``XV @ppW \W* .W 0E0CH XF0 R S.R? pWP 0E0C 5 X3S0 X ń- PEU*0S0P(pW [W$ >P @Qq 3P @Qp (P @pW؛(00$Ѝ] PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00    0]R' @R " XWQQ   Y I b"r RyA  PRA .R pW@Ne@w@t00Q    Y t " ^  @WX  P0R XW(@Qp59:fX0  0…1^S X ńY PEUV0SPUWX꼾 x 0 0G-LA Q@I*`0S$ R@ @RpP00- 0Y70  Ԡ 000 P00`S`00@NT00X0Spp$0]/PݘAS 0SPQP!00P0YΚ(0@0(  ( RO-P3P#RP3 M0U 0p`\ @U @RF R R2 (00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ a?.Pt  Y*@T*0Pj 0A\ R!ɑ" 40S04 0 - M ЍO-pSP$M Y p 0 pS 0S0^@w @^` \rS0  H Y B `@p p@TW @0S @S] pZM TP @`T00 S Sn*p 0A>Sc B P_^p0Q ^ QC ߙ(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00峙(00@$ЍATw0S"@@A@pZ ᢘ@0Ġ?  0^q0A>Sp0pS000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/PMF00@G0?Q0Sllv?}/P4 Vw*p/Y P LP ((m?.P!B J j8 p@- M P0 `00Dp @ !p < 40 0 1 30ލp@A A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ@`  Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?Ro00Ch(00/C/A-@P`TP% UVT ōP @TP 0?Sp ;006(00QSp@-`@P 噍P@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1AP(0000?00Q @-A?SSRB 0@S Aϗ00ʗ(00/-- Me ЍЍ/@-M@ zp TЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@TP-TR +T} Y ?p]`00D" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+:50S \0J0 ЍY@0Te UGp Pa 0A0C0B QSlUPP&]`?pa00D0 0R0   ЍY @~0T+ U# Pp0a00D~0T00XS"@ 00DAAs PQ0Pp>cj p>cP0?0 ̔BPp>c00DZ00XS UPpb 0N00XS UpbPPp>c 0?U0@PP0@ p>cP433 00 0M0Ѝ( A-$$ rMPPp`, V2 @X0^00pAtA0O `p00TAΌ 00`L PP:'0x @h0 0 1 30rߍL0F0 QV0G<0 Hr> < T 4 0   M Ѝꬦ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/@ O-@SM \ YX` 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8 Y P 6   ٔ U 0C  pSPP0 0@pQ 0S  Ѝ踕T 0 @0000@0 ⫓꩕ 0 0 A-@`Pp㨉0 0@㨉$0$ 0 M Ѝe Pp@-0 000St@@@pdddPP@Pm@P z0000 0갣 pNlp@-P@Q p@G-@`P&tpt0plp 2 T  l50 ⤅   G Т  8 A-pP@`  F T{000@P p@-@P5Ppp@O-BލЍAP (@@P  4/P Q Q 0 00 00P $0 0  @D P 0S 3/ H000P < Ԟ  D xKK0@-@PP$M U! 0 P% 0 0   0P $Ѝ0XX<0H X⨑U<<|0H X⟑@\H ~$ O-@PU  RM `100Xqp0S@ @@@ P ఀ $)A0PS,00a000S 000  000 000 000 OI@00044<0 X3 | t A-pP8  0S@P$ 0 @S 0`PP0S PU @P ^@U0X00 =y 0P@@ P ((<0B/X\@ O-(ğlMR  0 S X 3`000Sa# 0S00 #3  04 4 0P YP|3|s|0@p 0V^ p p @QS  QN `P0 Sh @p $ 3/0  0PY@r@RPH00SS" 00C0T@lЍxB0@@@d20\ 000SN  R0200(   @(,0 @p 0TTP 0S 0 @00D00@00qP 0 S PW @@n(0XS,  , @0d R1 1S@X 1 0(   @(,0N6&>I/X0S XQ?I/X@lЍE?I/X܏@^(  (,0%( p8FhhEDH lDCN>?#c!!"N .  "bQl.5:bQX. 1d.#c!!2N 0  ]0@ S 0!Yw0`0S00p S `l0 @ pE``0 S00C  B2=0Q/,0A!b0dP  @HYF0`0S00? S 0  B2<0Q/,0A!b0dP  @'Y%0`0S00 S0 p@`; 0Q,00dP  @Y0`0S00 S0 p@`H; 0Q,00dP  @Y0`0S00 S[0Q#/ b !S : 0,00dP @Y0`0S00 S;p: 0Q,00dP  @Y0`0S00 Y" 0 p @e``p0 |@`u9 0Q,00 dP  @gYe0`0S00^ S()Q1?0c01Q 009 00dP @0@GYE0`0S00> S8 Q00dP  @0@.Y,0`0S00% Sd8 Q00 dP  T0@Y0`0S00 SU3PU/P7 Q00dP  @0@Y0`0S00 Sx7 0Q,00dP  @Y0`0S00 S_0 <008@0 0@D00dPH00L0080 0X0&  Y0 `0S00 S8 0@90@ S0 Ř Y0`0S00 S!Y@0&  `0S00 S00(&@1?2c 1 R11Aãd0Sâ/c1S0c05dP0 0\YZ0`0S00S S 08  @8  p&80 S0R`05;4 0dP  0@0Y.0`0S00' S0 p@`0dPS00D4 0 0@ Y0`0S00 SY@0#  `0S00 S0 p@` 0@S 8 @ $qp  pqp 0@Sn R-Q Ry0c"Q312"0"b0A Yh0 ^ YP ` R  dP Y0`0S00 Y0 p|@W`r0@S 1Yj I` R  a S`]UPs 0@SUU P 0P  Y   R ` R  @P=0`p p@y`20@ S 1h Y)0`0S00" Y$  \ lP)\(\ ףm  | 4 * P | , D 8 8 ` h @ n t d $IQ 4 0@S 1 Y0`0S00 Yj 8  0@ P  0$ (P, VR\ gR 0` p`! 810 0A! ~0L,, ?A1c$ (P0T?"dN2c 1 11N @0?2cQ  111@/ d0 S  á/c1S0c01dP0 0pYn0`0S00g S082Q0,00dP YYW0`0S00P S ` `o 0P i4 d76C-MP@`,p<0@000 08 @pT `ppFЍ"00Ѝ@-$$@M Ѝ} O- M`p@Pm뀠P 0 X0X 0 0p0 @d Ѝً@ Ѝ} O- M`p@P>|P 0 T000p 0~@6 Ѝ請@ Ѝ| @-0N~ \0N~@ T \ڒT00\艋00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q BW@122e3cPBz :E.€Q_uk9"mnףp= ףP Sc$IųQ\(\ Q(\)\Ⱦ  c 00 (: 600+$0+>! 0(a`  o`!!!0C0Xÿ0+" ?00 #2>`T[ c 0Ђ (: 600+$0+>! 0!Â!!!0C0(AX Oÿ@1+" ?00 #2>[?W'`FPGp1#1 :#0! a,V"! / 25:$" 0"4#2><"Q0 3 #L201d0U\`25? B4sppp0/S[0 is c 0f"(: 600+$0+.2(a1110BX2 o;#0(``T[`o@t c 0>0#$: 600*$0*.P3$1110B@Tl3 I:#$B0Nt3`0 `cR`@ V0#T Ba!kYC(1 ? c 000$$(: 600)$0!)>P$ 0Â!!!0C0p$Xxß)" ?00 #2>r/E B 2?A1c1c0R@ 0B 05P!@ 502c(%2c2A@" "b1C S/  0@ p0\X%X:#包  00u!ό#1 W?0}:5$  *4Ϡ! 5*111A T 1#0 0! C2 ! 02">"@T0@000|&  0@00U``PE0S0@P P$ 0Ѝ& t)1?c 0 0H0 '):60 0($0,'(>!!!0CD'0YL("1 #2>L<0`0@<' 0 @<0`0@ꊇT 0 O-`@PM 0S*  U 0%? [P>psŸ !" 0<0  0 S 0 P00_T00<0 S" 01P0 U 0< UPŀp1 !"3p ~0U 0  R!yh&0P l6m&NSp@0GSH0P0 0Z0b 0S0ƒ!100 0[;hhPx@2[ O\1X00 1@T$ <T=0 S0S >S@ <S*S0S -S0 C Rp@0G100H 0 b9@h&lFpFtF0N  0h@1 0 0*T@T -T00D S0@0JSn0S,S  ;S  RiH .BL S` ,S;S\d00PU 0,SRx@PL 0SI  H L bh& lp&g.tl68$(,P0` ؠP`şDw6p%cR0#03 1d002c2c# b?0ppcW"Z  ^  R P`N |4|$cR*p$lpLP 0(,P0`p 04(p0,$p 00P#cR0#03 1d002c2c3?0  cRP c sP  RP0t#3>#!BcR*x3t3(p01c00,^00P00D#4p 8 00N  0h✃@0@ ╃ @t 004p80!/Z0S |Ϡl a^ZQ `S@ʟ@ < VP@@% z .X )  W.y 5:IP % ^, Ό3# qdO0 QS@dyWEVPP$ `@E`E`ȟ(ȟ K,(aoZ.h 11:h@h$ ^, Ό3# d S 0 @W `PLH@ 1S\` VPE_ 0(!:60 0 $0Ϡ! ' >0!!!0Cइ 0Q ?##. 0Ϡ 0,όក(~C1  ቂᢍ  Dǟ 0 Q0 pǟ0 ' ^, Όp3p#p q\ ` V PE    U&0 0cP:S8;Q$0(080` Pp@`PL40#XT YW W0#Qp? 00?0S 8@<W 80<8p< 0 5/P `0Z\ QX Q~T QzP QvL Qr p0`S P Q$% Q!S, Rl0S pWg 0 SdJ1F Pe,Px` BrIX 0S@`TJ#M @A 0S7 0N080+ 0+P0P0姾`@EOo [*[:[$4[4*[\4$*[B@#[1 "*[$![[$ ! *[[ *[ [$Č*[[ *[$[*[ *[$ [*[W Z2\T}QR [ *[$ [$ RI SG` VD  ` ,^6TF 0 FC:  0PS.`Z00æ0@T )9 F0 0 30\Fۍߍ0/S 90BQ 0R/S  5P DI@@H00`X0@TR ZSZPQ J `@p 3N$ (,004U= 0\ 4 Q"<$1Vp+ ⁡ZF` R@!X0,`$ (004@T@M`^v  \`0\ \0$0\4 \$!?8:[ Sa0J08*S R\ R\P 8ZC7PO L| 0Wp@0P 0@E+.C E0a S`Nph@@W yP0W0 @0PY a0共`LVPyP  yP0/SR0/SO]P&0/Sr F`Fh QPQP Q Q@Q@QDQ PR9 像AN h(0$ Z}$ (0Nh   Q)`z@ P$ hp(0,P0 0^  4Q"<$ 1 VZ $ Q\  Zp@`$0^ ^04 ^$0^$!? $L\ Z Ao pd i0S PW"@0W_0 00S -@=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``0SZ0@?`cX0SPⅡQPZP }SPPA@QM0`0 RW@ 0# C !p|@pP(0,PF̉S n"1 R 0oS0" !0S  0H0B 0410S01 R  0S !0S RNh0@|00 000PW @0E a0`ᅱpl@1 \像B<02hC% p+N @ 0K hhNA-pQ@X 0Sd! N,00 01h6l6h`P`P 0:S  DP `VpFPU N hg0PPT`VNLg@_ `S T 0:S*S+0Cs013ZS@Sa0CSR`P t p@-4P4@P@ DPp p@4 0 00P/? p,0, 000S  O/? p P/ Dd @-\F ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2S!!`!T!(! p   A-`0P0Q0PP MS@P1 V7 T=p`0 80xq|q8OT@D @@`@p8P1TA`NPP%0@ 0 0 1 30ލd0P0 (0 r|! 0u @-@P h 0#C@h0;0 ru RZ@-p@-@QPI 00!R ! 00! \ uP 0B RQ`' Q0AP R 0 U00SpfP DfP `>fP0 PW40 ?r 00B(0<0 5r3t 00t t A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!pP  w0S< 0[1!pqP  w0S p w0SB 0[1!pS w0S, 0[1!pD[O[Mw0S 0[1!p3 P>   w0S pT 0[1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% [1 0!p0 *R# 0B Q@ 00B SP i  w0S  qp q  w0S `p  ;  w0SV 0[1!pw0S Cp  0[1!pwX0S 0[1!pw0S 0[1!p}wM0S 0[1!ppw0S  pw/0S 0[1!pWw0S 0[1!pJ pu pn pgs R  0p 0Z  [@ 1, pJ pC  w0S p6  0[1!p  w0S 0[1!p I w0S p J w0S 0[1!p npD gpp T { [p$ Tp MpI Fp)_ w0S 0[1!p] w0S 0[1!p , wt0S p 0[1!pnE w0S p$R_0@' p7 w10S py  0[1!p?w0Sj 0[1!p2w0S pXw[0S pL@ w>0S p?  0[1!p  w 0S p*  0[1!p p P  pC {p tpD mp P  0B Q^@ 0B 0B P$R8 w" R 0Kp0 [1@ P [ P V P Q P L P G P B P = P 8q0 S p  0[1@!r P $R@00 P  P  P } Pz x Pu s Pp n Pk i Pf d Pa _ P\ Z PW U PR P PM K PH F PC A P> < P9 7 P4 2 P/ -dq q  P( & P# !w0S p  0[1!p P  P  P  P  P O-@ϟM M0Pƍ0TH P@ H0S 0T00!R !000h00 Q 0SN   RT p H 0  0 L ,/찍 4 K/@(嘰d 00080l0`0$00@T$ `%T @T0PFU$0pJ!(0PQPw00$pT 0 @P `~0-1,0`4 0EZS00 P`P   R00s H0S P`p>+h1RRhOh>TQ.`CFmˠ0MPQPDH T,TdD@|8HLI`P$`a`P`$`0@ 0@004p00EPqp00E S$U, ,pS2 U zUP ^0P00(00{0$080S 80匠0@0S$00$00ZZ ,< 0 6 30T$܍ЍUX 0D \l@U`X QP @n~@\X<D-$0\, Q00S@00儰0AXP\ 0,0\K0|@DT!L\0`P0Q ,pAW#S@0$000(000@T0Sv \^raU` P X0$ D -1 00 S0 00 SP0100 P000p0 `P 0BL00?V0X{ r -!S 80S 0P80 0p0S-0~00s<0 PpGW0x*0 Pp0 S@0$0Xڼz堠pt@ @ᘐpHX   R ^ X P  HX( 0t@t0\0~Q-Q3BS(-0d0V~I 0 @\0U X0  <0D0S  XP @@U S(0^L0(0CP0)0A00QP  h00Q@TG L 8P~@\0`0S  VXP @@h0l0>00(S0  @X0P 00Q(0S0  /X0P 00@~0Sy 0~Q00t X0P*( - t QS t X0P(  t T800NS `U~#?0(`0 @P0\@X@<@D0S<0SP 0PS@@Z(p_`P(pP@FJZ   0RP0 S W0P00JZ0  0\0 < 0   SP00 P0Ϡ 0S-0q~0 0@S࠳   @o R 00P1s 0P0WX\  Ď@X  D@ 0sI L0 0-1S; 00,0QK0(S0&(0D 00 ER0 nn2!  00Bl00?R0S_ 0l S~P@@P8`/\@X@<@ mT 0P ( <0SPL0PS 0@`L0 0^(0RT0P009 c HT0P 00{ XR 0P ^ 0Sp~`[ @倀;> ^% 00~  0S Ϡ^-Pp  R  00PSH 0 0pp0\^[ 0Sp~`@SP001P$0 c^<  00 S~  %p S0P 00k  SD0P 00 00 0H00 `, 0 , = = 3= @ 8: x6 <6 5 2 (0  `. , D+ h+ <) ( >@H  %L`Q0#"002(c`38# SD0P 00 S  P000 P000p 0 lS0P 00 |0-10l0XDpdP0pPE<S 1,0P`>p x0D RPPS 00C? 0@E S(0N0<0@8`\0X0/XP000 P0t@d}4R堀P(PpH@DT$   0RP0 S  S0P00 0S  R0P 00   0\@0g@mD? P4a T0Dp@E  $0@00P0PP0@9P 0p0P P0 00~RP0 00倀P000 0P P0P00P0sTP0 00~RP0 S0  R0P 00(0u0D \_00CL0B P0 R~ P0 ,,0A/\s_SW 0 0p1i^V 0R! ~0WpF^ 00~` 0S@ RN 0P1^N 0R! ~0/_^ 00~` 0S @l>00(OQ@d@P00ppP00P0 R ~P03P0 R ~P0)P0 R~pP0@bP0PP0pZP0 \^CP0PpP0P0 R~pP0@?  )S(@00D \^ B0?V0L 2@ SP00P0$00 00H 01p 0SP0 , P0P0 R~P0@ ;P0 R~pP0@P0 R~ ϠP0xP0 R~P0@'P00ppP00m @P0 R~pP0@P0PpP0{P0 R~ ϠP0Iy8 &P0PϠP0 @l< P0P( @ < f 0@000S0 P0pi0\0X0P`00E SOpqp00A S$Q0#S/ 1 0P`O O SP00P0$00 0_ 0 0$ 0H 0zp@S0P0`1 ` 000 P0$0H 0cp* 0SP0  P0 0pp6@-@`P MDpS@0p0 000@S Ѝ A-@P`pS0 x0@SO--@/ pj0H30P  (  O{(j3):0!**R7 0P000$0110@00S@(@P p0 0[0S0SS I00S Y Y R H0P0 4[4 0090 0pG04a^ pn0G040S  @(@9U Z$01P00P0 0009 0 00400A-@P`XUTp 0S*LP @Xp@@Xp$S XT@pX@:L #*460/Q /*460/P@-@00 R@P@Rp@-P`0@0R@*0Pp@ R 0 R Vp@ 0@!O-0@ MSX@DPa`101 0RYq`":0 6  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-`@0UM0@,P.0L10V{{{ {U0.      WW P @-K @- @-p@-`P@ TP P0F R @P  V00pP P 0?0 UPl p@-@P UQ`PP  Vp0:0 U@ -M Ѝp@-@ P` !LNR !@Ap- M ЍP/D -0")2b3c1@2`M1 ЍC0@-@PPM {  0{ Pp`Ѝ0 0;0 2U    p@-0@Q r P p0 S P1 pj PP   ! V @0O-`MpD.@0D0QP0+5X! @0S Sj @ 0 1 bP  P T@@  0  WT`r ЍW Qz@0 Q AX0P @0   P 0`00QB@`VRTQ`p0 0"!` b  V0 XT@P@0Q=W 0000! @TQ- 0P0@20f  000TV" 0 @000 @O 0Se0T0 2aPPlv"! 0#000 @ 0 l`@Pr 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   TV X@@pp0 `f360@p1W@:b : PPO- -4M@0 @ O0l0x0 0&P t0p-P 000P0 0 00@ S040w ` 0@t`00@ SVV!Ђ0 @ 0SЍ 0S0 EP 0l0 00S $`,(@S\ ?o280$0Q0$0吊g{V VGڐ*5 f01k5UV(0 S (0SG( %0fSt(0| FY!0 S (%Y 1  @ pyPxL |0p0LY|0 ; |0pP0|0 A R< Q0 tCY x YpOyk0p000400 S|  <00S00<00 00 $003 (0,@S A,8$PQ۟䫟˟滟P?@0 0HPL0X@H@C 0P0  L ! Sx07 P x   !Sp@|4 0PDp0 W,0@0$ 0 @p`C0D,p@`@Q0C @D@`@T00S0S@D`FpG,0SDQO(0SVW 0P0 7 `P 0S0S @  @ PpPppW0 80  R P" ZN<00 S0l0 $@x T0 @DTQ [ Z0MNpT0 0p$ 0#[00S|0D0I hd @PZ dQrtWx  ! x PxI 0Sh p UbD0p |0Z0 0C?o20S )K{8Ik{_Zɋd 0S     &?@V瞯<? ?N00XS ptp0P P0 0<x Qt000Sl00l0R  x lЍ ,$t0t00+S -S( 0C ^0St t00S 1C\@Z $ R4iS* %IS' NS-dt` > P% 0l00 00t00(S6 000x P PB \ ,$ EQ0 0,0x tl0)2S$"8{PP*"* /B B*  *0CS'ʐ: # 0:II0H   {0 0tV0r0St00S n1CQ 0ESI 0 At@pH  i  h3Y01{ @ )2S#{*"* /B B*  *0CS'ʐ:# 0:II0H 7 {0 < PJ Z000t0PO p-000(00t00@ `t00C ^}^t,t00C ^^0 ,S0,0 V`∀V!Ђ PP`TV! 0Ct00C [dt00N0C [L\Xڼ@(Q@a@nS  x Px p0 0p0js% 6@08  ,  B1kl00{0 G GiPv|0 00*$&%&*&! IH I `xP  PZ/ 0IPT0 tPxG  B\ 0S< p $0 0R0p 0 0P01  P-  pa 0P0s"@ 0P0jxS Px <0| 0C B<0|  x>0P 0꧋{ ZNj Z{相80吪SI8! 80S0T00T0␪相T000cT0Pxa @P B\Z<00 Sp  Bp 0{j{I{7{l0T$P0X@l0 0S |0 0XVTHRP |0R! 00SA S; SP xB0x00 l0000 "aQ!*6P00  0c230 0x S 40S-l0Q000l0x @0l0bQ"00q @Bx Pxi |0p0C|0EYA??N0 00 l0x0 :Q"000 000S0 EP Rv :!0'l0 0IpT00(0>0080q_ pZW000 0tx0Pl 0x S 0t0,0a$`8(0@0}x<0| 0 <0|  U $PX@ppEW0 xs$ Px |00C|0&Z{相80吪SI8 80pS 0T0 {Nj0l0 0@,0AS$`( `400c8050 080H 0l000 P8 $@T s@DP.$PX@x <0pP0C|0|Pxctp`P t00Ct0Pt0 0t00000x l0~ !\ \ \ \Q'tp`0C0,0㈀ 0ES0$0,r0x000 0P 0l U00XS Q0X j00Q )Q  0Ѝ{;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:iX O-M<0p HJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0SpP [ FU 0  UE\ PN Q UP   U 0CC10B1P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0L"00IZP0D^0[ @S0 QL 0S@00S P3 4^E *@C #`P `D21 2 Q\` U00 00S@0T@DUQV`Db  218 PE 9 @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E GP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq KP@"00ЍSn Sh S4 `Pb@00@0 00V@ !kJT 0 PeS5 0 0@0saF PeP\  0 S S HK@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@J0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S 0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P @  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPV 0 BP @` pT  0 BPp0U`98@-- M` p@KU0  B00C2S*ސ* Q6cZKE A Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ H0"S1 1  !2R / 3RS/0 00 c Ra `` 0 ` RA 880 ` R/ potoA-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q @ЍA-(a(1`pP0MS3 U10AT !0S 000պ ㆻ@T  0S0 00Ѝ  @00D1S@000孺0S 000夺(t pnD! 0p@-@P0p R pPQ`00App@莽D `ᅺ80 0QApp@yr pmDxm0  +0#10/sQ#8sQ#4  00/sQ #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P$pP   ! Gl`hP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  $G  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1a @P4 P1 p@T `P@T10SfP@$ 000S 0702@T 0C  pP@h0iV0S <0 ,0R0i n hipqiDgG-`0b@TP塢ڃ0TP$ Zp  QF p0   a!  \2)R0L`0C\0030 `.pG \ `$-0P!1^$23\ *G-0@`@DTP  !1QF*32\ H*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@ H 00P0S 3 # Q0 A B  02NS cP 0!0P` A-P@Q`pE: 0` P0T @ *\ l10E T56 501 P56 +C0T `6<#511<?@--` M@P@P : #z:S W 0  C.G B 50c 0 Ѝ v0P c2# RW C>C0C01` Ѝ0S0/0 R /@-Xap`@PMA @1P4PP2 pP,0S  Q3 Hp 0: S,AP 0uPP0@ 0$  0,  0( 0 0Ѝ2F00Ѝ\PL0E0 #D!F00FO00|g 04p@-@P :00CS00 P:pP0=0 C@-@P 00CS00 @0I04 CLp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SE 0 p`0>0 C,`p@-@P8 0S< 9 P00P! !' 0S 3/PP೼000P @ P 00 00`嵹00aap9\0`` 0p姹7P,080 ECCE 0P0@-@P 00!R !#P 0C 0;0 %C@@-@P 0 0 S @60;0 C$p@-Q@PPR 100S4 0 US 5000S: 0#$0 3/0P:s004p00P @ P 200< R 800p@@0P᜶Hᗶ6P00s07`0J08 B  0@000 pD 0 @00a p-Ѝ/@-^@S S S  `0@  D0@ c|D 0  0@ 6@00 00 0000/<P@- 0At @XD41S O- P`c`EM  A 4/p17/9? !0(l (|  p;o7@p:/ `;o$ 7:/(p,$`;o0(, 7:/4p80`;o<48 7:/<`@D L;HL@̀FGpE`JK t (`DI | HpŐp$ ǰĐp@`Xư`0`pA/`pd APpMOĀmX@Q 0piPSQ 0piPHQ 0piP> Q 0piP4Q 0piP*Q 0piP Q 0pxiP@Q 0pmiP YEߍCO|C,Eߍ/4aQ@-P @41S  P  P0[CA-4!@ pPP/1S 0L1囷 @P!唷PPPUQPMoP PQp zW Cp_oRCpCpp@-@P 0@a@A-@`"P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V B0@BB@SSO-P M1 Sw$aVp$(q SSp A`TO X`A (0Pʀ R `(q^ 0P@  Ѝ Co$B/0S (xp \ Q @pT`xP0TC G(VJ ( 1$! AT$$(0 [ `(0 A^% S :0  @PB@@,A \$O(!r5 V(* T$1$$H0 ?([$:((~ Q  0 $? $ @(!$AY 0 $?0(S 0 6oPb ,0^0{$XpO-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 mPPu2  $`mP$`  0 `P% 0@SP㲀0C  P\ \1 \"  eP  0 hP@0`00,Ѝ 0 hP0 0 †Ằ[ PಐU I  eP(A0DS V(Qp  0pmP 0 @-@ ! \ @$@,@00,1S@-@0@ @00,1R@-@1  @0@,@ ,!O-`ᰙ0S ]M= pPwᷳ@P Uq  @| @P 0 Up3 < pɟ00 8p4  D!?@ ?8 PXP }V P0pS40X W!3^ TH ^^@4:P3] uD H 0$ fP 02 KA<,0(5 = Q PV\^ P  0p pt 0} V( 0S% A/ 1q++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^Բ  9/@P OPq.>P]ߍ|Ÿ 0( P p1DN90  !NVq QU0 aPP$4Q$娰Pc @Aq!弡Q0 0 ` 0! `]ߍ> >Qt|> R2 < p 800p4  D=@ =\>{ Z Q>N>@PqJ>PnE>PB>Pd0a:>p5>p]4P Ta`hO-(P`P10p5fS@(Pp5 Rؑ4P- () ,0[ D D S 1"1 Ofꂡ P ر .$ J< =ؑ@-@ 13/, (Q0@-@Q -00 2= 0 O-fMS` $ [pW  0 0 ,4 30CލЍx.0P70 P#Q7P@7?00. l` - |O- M  @pPPb 0S9 2 @0) '봠Z( Q0= R  ' '`PJ A`@DT@#*t@@D @P 0 0RZ @0`10CS@9*t0V 0 Ѝ0b0 $K50 R 0崠 @Q'T Ѝ  H'0崠 0R &P 00,0b0 $5 )'O-PpQ`,M '00 VV 06J  (07`F0V` 0FS600@,Ѝ(0VP ,0`1vY 0`1 0`1 Iⴐ0 1& M&@P a`FV`:b $ 0  4a 0`F `Vv6:v` 0b`  41ᰑ0I⩐`1Yy: 0 b 41,0`1S  1` & &@P 10CS0s0:|5b0 $h4 @崒 @P 0 00`(0r00@(0帑 = ` 2  @]  W&Y 0p@M 0S> "0!0 @& %@P< Vi V1 Ve (0aV@ )&TA  %@P# 10CS`*0Fs @崒 0S 0S 0M@T  @崒(0QaVU @b,  1% h%@P 0VSa V0F %@ % % @ ⴒ[ @Iy洒 U(01ḑ0CS㣠y'*z0YV) ` %V )%@P 긑0(0 @崒 /`FvVv @: 0 b3 @1b0 $3 @崒, 1% $@P 1ᴐV0CSy`!*v0Ya V0F1ᴐቐ  10@! h% $@Pc ` ` A0b0 $B30Cs 0 4 0Fs/0!10@崐 <% $@P8 10CS`:D0b0 $3,0b0 $3Ll4Ԃp@-@`PP W0 00(0`00Q(0pO-@ ƟP LMQDp` $00 2[V  400%5 0 D0 30\LЍ0w R*R* p 0$00 <000S0 P8080 0Vk 1S6 ,$P䑄/  00 0!0{Ⱐ0 BR张:1S 0ZS000 P 0 00000S !$  P 0崐V` S0! 1 BR,*0 F P 20 2r(k i0w Qx #`P_ 0 p ?$R0CS㣰*{0Y* C00C \1! 0Cs0 ! 11 0 I0D(0  0RK 1S RQ  RYF  # 20 2A0Q0i*10CZh PbJ0V㰐`0 2 i Sf # p 0,00 4000S0(p0000(01 S0"1!{/010CSP*u00C S {?尐!0b0 $1c0y漐`尐0300D0b0 $x1,0b0 $q1! ! }||O-(0pM I @aP0`f0PP P FP1uP0y1JZqa@0 R 0 1Q@@10CS㣰N* 0Ks0S0Cs00 VqS10C1(0  0R/ Ѝ@ Q! R b0 `(0p) 0  PQ  p 0 0 p1 S0C1ȁ3b0 $0T> Y3 0I 1pP(00(0U QPEUP*0EY*0 p1Ps YQEQPEUP|*uP0EY Vp崑 (00(0D10CS0I*S ```@0 `p崑^P Q "PP @ PAPV(00 (0"0!0!0 !PPo 1P0CS㣠7*0J 1P(00  j"0b0 $O00 1pP(00(00b0 $<0u00C StQPEUP:P0b0 $-0{80b0 $&0 5"sz`xxwwp@-@PQQp !P 0 0"Q !P 0 0 "ppO-P,a V0Fh  1r!@P! `Vp0ഀ0 0 po 10CS0s0*S0SS PP 1b0 $/  H 1zp0FV㴠q1p 0 R 0 1Spp10CS㣰4*0Ks0S  Cr 0 S00s060W10C1 ! R bP  0! 0 XP! y!0b0 $^/vtO-Pp@Q$M d!00 2uT T F100$Ѝ(  @f T0 0$00 } `PN  R Lt@Y* bP 0PeA 2@D @dT㴐: 0 bt@ /Y:Aᴐ@DT@* 0t@ @DOoS0CB0  0p= 0S0C@0  'P 10CS0N*s0SQP@ [ pP 10CS0*s0SC 1 X1@0CS0*s0S!P  m  hTp*t@TsP^ 20 2$Ѝ4b0 $.T  4b0 $. T`  0 0 P1  RA @44`0 0R7 `V t q, W@ t@@DXE e q Wl 0G 1P AᴀW@DT@: b$;.d3b0 $4. D ? pP]+P{ 2b0 $.02b0 $.G@W1 @t@ @01p 1 0@1@p01  P@ Iy0   oP v@T 7T1/00`   P~ ,` 0R @T 뼁VpB 뼁0V" p0H 1.P] XR  B1r W 崠0pG1 #!0IpGsw0崠1 加1 0  P5 10CS㣐:\0b0 $o-  ~ PsqLqpoodol@-@PM 0 0 P Ѝ050 F-lO-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ hP /00H"<2 0 4 30Jލ Ѝ >@0X0 0UXS 00; Is0, T:)[' P0K/S  0庳0P00: S .000S0I S.?00 1X0 ,QP@PV# 4- >p!.0SY  \0 RK Y P.00W up ztP .@oo G kjjR Q0P:Q0Q:x-@-@-@@῟ $ @[ ( p@-@P#)P$ H p@+ࠟꨵ 0@-@T M 000 @P 0S  Ѝ8i( 0O-TM Pp`0H0 @D8  $(4PD 0,0`< @@pLp PP  좟쒟肟 `p  @$ "dXb`%0#  `!,l(a `& `zcna'b(*abf` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah猈b,)` &`dL(bdl+`|.plXp`<%cjgpl& ```ga*aldH(d` &b()`b`j+g .pl\c:%pWpl̠ 000 0⭢p. R+. X ( - h   0 0  < 40 0 0 30Ѝ\ c @-pQpP`MDʞf0S7 嵞@P PAUЍ Ѝf0S"  p #'p 0 00  0p@  Dp xTp@@ePU ᨝ @ Pi&b$ *@ ح 0O-llŸdM \000 00A0PEZ!0 B"3+S+s`@? W: Re:0GZ0#Z(WG @`p @ `@`@P W0@P[ Z]!|1 0 \0 30VdЍ\\0 <)@  *W; @ A S@ 0 ` *@ [ 0`@h0 <) T:0GZ0Z tt0 <)0GZ0ZW[`0@ _4_^ O-$Ÿ$2 M0p@`000 刀 ;* P!0  S P Z  @ 㔑?P N^艐     @PF E*Z3 Z0  D 0F P  wP 00e @@P0 f0`00d X (0 0 0 30Ѝ4 ^]4]\  0@- 04M 0P0,00M @T d 0T T H0 0 ,0 304Ѝ0$ $  D A-$!$1 0HM Q0D00@P ` @qT( 0T  ` aV p 0V  ] h X0 0 D0 30 HЍ$ |$ wԛ <  C- 0 04MP`0,00%`@ pW:T p 0T %T H0 0 ,0 304Ѝ$ :ꗛo  0@- 0 ,M0 0$00 @ P-T ` 0T P D0 0 $0 30,Ѝ0$  iA  T @- 0 0,MPQ0$00` a p@ T 0T p d0 0 $0 30,ЍHV?Z/<'$ 0 T WA-@P` Aq08q0P00P 0p0S   L| P00  000 0S$1  @p  P 0  P 0 0 0XO-رK[@pm*{0 80 Pa{`FP 0` 0 VF*vP P  C{沱ᶱ PaP`F ` V>*vP P00 000 0 O]Vv`4*V 0 rPP:Vv` *V 0 0sPP:1bL0d p#'|bL0d p'1\bL0d p'@bL0d p '$0$0 $'VVlVLV,VO-4M 01X0CSPᰐ0*10C 1R00r0 0*0S! @p`40 $ ,P(0Y P P0ES00 01P0P0PYi00CV 0@p P`Uv`d*0Pu@S0SZ 000pVwp:@@T,P*t@1@A(0  0R 1 S0"s0&1!V 0 0C01ő YX0X 0Ӂ 0C00 䒟V*R 0P0@Pr V @Bt@Q 01Y00!00Sd*00CV` YPU:( $0$>&01 P0P P P r01P0 P0P h\P   r` @pW0v`@Vt@@TB*t0  Y !0s00 s014Ѝ   r   rpGwp@@T,PL:0 $%D00 $%hbL0d p%L0 $%`@p''W|UUxSQdQDQ$QC-Mp`@P%  PP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍO-M@ p8kPPN 01 0 0 0رR 0ⲱ 0 1ᰰ0CS`G*v0[: ر y`PF 01 00 00Q00岱000 P 0 0P<0 007!p3&Vp@PЍ{pЍ 0p!0@P,bL0d p% `NO-\M`0儀pS>D0@ P(0$  t@T X&*1#0Cs0 11 " r S 0 0 0@SD@ a,^p  $8 008,000F 1APR `V 0`0 v`0CcS00 p㰑1 0CS*0S 00p"@ `V@ 00 0 00CS00 1!R p0p  0  00 0VS00 IY㩐*y扐1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 0#S1 0Cs01 1   00000 u 0@00DpS, 0S 2  0  / +a0S @ R3@p00 ,F 0 S@Dp      \Ѝ3@S00 01040封HX㨀*004 1xpC0wp0qqᰁpHX㨀*0x03@S00 01040封H⨀Xx*X 0 0 sP:400 H x0 岁ᴁqpGpWwp*W 0 0 sP:0 0]  IY㩐`*y0V* C``F  001`01pL  | x@ r ne`V@Dp  0 00Q00 0 P} 0 0 0L각HX㨀b*x戀1040F각HX㨀O*x戀1040`bL0d p# 2  0+ A]@ \ 0 0,bL0d p"/bL0d p"=bL0d p"SbL0d p" pbL0d p" 0!jbL0d p"hbL0d p"Lq0 $"DpQ)TLLF FFEEEdEDE$EO-@`şM ,p00 q p )PG A@D@Tt@7*T/ p @Ѥ@spT PuP P 뤰P@D0t@ "  !P0 @ 0W 0GsP 0k P b$Z"0  0Ѝ 2P  pUQZP10CS@*t0UQ 0 0PЍ P  ᴡh @P 50㼡 W0  {00CR #뼡@ W 0J 1P 0ZK[0嫰:2b0 $! 2 p P tP 10CS@c*0D@ 1 PPE 0㼡 W0 D@ZTj 뼡0 W P0J 1DP `1b0 $!1@DPEt@ up@! @10p  $P 10CS@: E(1b0 $!D  A0b0 $x!0p@Dt0' 1 01p01y P0 1 @Dt@ @U0PE10Z!0s00 !EBA$A@R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P L  0 0@ (! 0"L?O-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ>= 0G-1?p@P` @g(XS G! 0@0 0$0@`F0($0`Gp& ?V:@F?@( 0@  @T 0 , 0< 0$00T$0?`@p?V @?V@F?@ 0$ <@@ T 0$ ?@@@?`V ( 0$ a0 0$ A-@PP! $ap:?`V7 ) `0(0 0`0$0d0W 03?R0Ah v  08R(@R )@ bi (`8 a )8 b[ (`R @-I/ @-@-@P P Ό 0 0@ (8 0"|9R @-"/ @-p@-@P X00m]\`  0 P 0$$p8O-$6LM0^_~?800@( ,0  0 ( 48pH`D  ,$ Ѓ D$A-"2 R0hM@PP0d00< 0 C 00  X"L2 0 d0 30hЍ 0`0S# p0PO ! WP00\0pS pp6PP0001|0`  0St$p@l ȖPA L10F L<10/R  0 p6{ {5{ 00{ 0SP ` 000p p00` ppl0`  xP꽴  | 8 |hp@-@0MP}00Ta~V( ~0T1S O~0T1S~0`~ 00UTX!\!R Ѝp@}\!~00Ѝp@}00UX\! X\!0 000S/~ pp@-0 00PUp@0|}00TQ~~U0` TQUP p}pX1P0X1m~0T0`X1~ ph0h 000S/@-@0U}0X10CSX1 @L}T1O}0@E}} p0 000S/gx} p0 000S/p@-P@0,}U0 \AQ\ X10CSX1 p@}`5~0T1Ou}0p@}P} p-X X0 04M 0,008 00 0 ,0 304Ѝг| || p@-@QP  p@咐090  t,@O-M8@0 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W  0pt pp 0@`> p PPD1?0 $60p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 433333300 0M0ЍTq 0@-PPM @0  $P 8 ,0 0 0 30Ѝ0"8 q p H0 S8 0 / 00 @-tp 0 S 0,/00(@-H0 S8 0 / 004@-o l0 S 0,/00<@-H0 S8 0  / 00H@-o,o 0 S 0, /00P@-[xH0 S8 0 / 00\@-Fn $0 S 0,/00d@-2H0 S8 0 / 00p@-m 0 S 0,/00x@- 0H0 S8 0 / 00@-@m 0 S 0,/00@-H0 S8 0 / 00@-l 80 S 0,/00@-H0 S8 0  / 00@-k 0 S 0, /00@-DH0 S8 0 / 00@-yTk 0 S 0, /00@-eH0 S8 0 @/ 00@-Pj L0 S 0,@/00@-<H0 S8 0 / 00@-' j 0 S 0,/00@-XH0 S8 0  / 00@-hi 0 S 0, /00B@-D0 S4 0 / 00E@-h d0 S 0,/00G@-D0 S4 0 / 00J@-(h 0 S 0,/00@-| @/ /H-M 0ЍA-`@pP@8#pW0PpP@-M/"O R ?#0!PO$P P!Ѝ  0S RP/0?c0 3??oP/p@- MP 0 0000`@`0@PP  7P< (0 0 0 30 Ѝp*\f (f e A-QPp@` S V '"RSQ P_ 0Cj ?o/o0CS 00cÎ10VS& /o?o BR Z 0b0Î01pϠT\ ^ R0V0 BV  T$ 0d0?oc008/ooAq!  R! b0r8·V pV000e0?o0c80@b>08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000 / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@R`P R U  V  R 0 p00 (QRp@-`P@ 0S0 0 0R0  0pP0l (XR S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00FF00@ B4 ,0 0 0 30Ѝ] W V - BMMRč d X @ P   Pn{1   hV p80@- @-||Ÿxr M Mp$ȍP|`@M TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p0\ @p ] 0 xQBnP`.d0a/fxH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00LT0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@,@,0 00/4N -$0$0 0M 0!ЍN -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/M p@-@p@-0@ ,ppPkb0PpRlR//////P //1O-0pPW`,M 02 00000"00  ( 05/,Ѝ@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+ 00 0 0 00hT0 0S0H00 0K롋@SS0dU00`0d?* 000D@D 0P 0 `prpo@pl  0  `, P ,@ 0q *XH 00H S V ! 00H S /L|H P@T R ^0P  0CR P0bP 0`BC p-x $0p RPRP` p@ 0 0P00Q0= Z"* 00[ʅ Q00CS0C0 [ʄ0S* 0G @   0lX pp| 0000 Rp&\{0S P`@0 0P00Q0 Z0504py< 0 0Rz @0000d0SP0LS0B 0? T0SPA`B 0Sd 0000  +00hpe0S 00_{\<} 0 ) ' R ǣp @#2>!d00_< 0 a 0R00 0000S P   pDP`  @00CS0C0S(0S- Z 04 0D Tu00CS0C  [ʄ0S*0S[ [0S000SS0S j  0000 x00CS0C8` P @ 0 Z0J0#2 0 0 30Ѝ    000D0@A0 3  0     [000{ 00 Sx*< P B C 0 @~ 0    0 @ s0  0 !@ s0pp-DA@ 0000 h 0 @s0}|0D T)(0D T!-@+  * $ 0 0/ p$ T0 0 Hp\-J ($0@ pPA-|@P@ `l0pP@PU J0S 8/`PEuX@pW0:0 x= t 0SS S  0R @-{o/ 0R0@o/O-((@CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 0p `0pP qx0 h 0pfL+  n 0n/ꌣ`< (< < dG-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  P# `VP@ Q@0 R!R  "R0 R R QO- BM 紀ḏxMXčH1 0!p P` X' 0  p\P@P U]~]0 ZP:PH <0 0 4 30BލЍ9 9 O-LLAM P MU@čO2 0Y-:0px0(S`4 0t@?s0T!T/ 0 0PU 4]1]  0 P @T t   0[\PP D0 0 4 30Aލ Ѝ0x0(Sꔢ8 7 O-M Mtϟ0 p X0V [ !R & R# ` 0  0 ?p@X@0  0p t|  0 H   R: R20P တuo@ pR EP p ᰐ)P R!Rs 0P PZ@ 0Sz 00 0[ p@`u_``0S 0@Sʰ00 9 S 0S%< d 8, [g0 @0040Xv?D0\4 0` S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@ ( P w@u0 P oP @0 40@ 040D00D0 0S \0S H0S!80S P<00p  R  H RY *0ㄋ00ppt`0|@ 0 @5/P |4+$; 0 6 30Sݍ Ѝ00S0 Q 4@PD0Px !}D0P0 y  0 : X0p jD0q4000SB0T0C@0`S\0c  `@V  0p`G0?`&0 0$P 9`0>P090Z?L0/ 00 ,   F  &|PP. U<(0 0R0K `1  0 l90 X0L80 Z   800803$ 00 0 SL@0b0!0t刀?A9c!{P l0S h@f0 P n0`ȟ-  ,80P80I Q"  (<  0 0P _R`1  0 70PX0 800 00}   1 01 080<`0 @({P& I 0 P[ `1 p 0 60X0 ^80]0 M 00 TX6PL0&08@ 0 XԂ@1Q 00U0pI} M 0W 0@`vQ@  ˆ20W000QP M  0 0vp1000P w 0 H5@X0 M0HP80 {P 0D }@{0 P m|0ğR/0  (0d0080m00lğK/0d @M0W 0ʤL0 +S .0CSDCPA0 @^;@5@30Pa.P AQPRi `1SC 0    R 0H080n |P8R6`!!! Q2   30 @| X0X  G0H R; 9 qW *`pR|@P 0p t@7/P 0 80k`V~ q0 <2@X0 ~=0`!02 @XUⲁP S0 \01S@ 3`0`00S S````P1, '`0 b{P00 `!zP101@PD+YhP p0< (00 y<00PK00 P 㸠D,07 7 h2 ķC(@|,`|$ԫP8 ا TP Br R D yP00d0-P+0@&@ d06SV `v XXpT0H0x D0 P TP Br R D yP0d0@0P tlp0L 0S\(0 0RS 0`1 x 0 10XP 0HX0   eKl0 0d @ⷀ PD 0 (2 X@`0r#Z0   2H0Sn=00fl00  d≀j0|p 0 Gr 0R0 D P T Br R D  R,#xPʊuX Aa0@ 0zP`P 1011S1 T000 30 X030 3@X@" 0cZ0   <0d01d000 \4 X0 "00`u0d0@0P k0 08 (0d0`0d0 ` `0 xH 0+S .0CS&@0P ck0X [k%00 d05 @XP0 @ :k&00$X dr/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@yP$Ѝ0 yP͡0ıġ0"c110$Ѝ00@-$MP@xP$Ѝ0 xP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/MbO-@$$ß CMM,čßS1 PXd ,p0$P0000 0  (~ 0p r P<QP0p\400[ PJ0D0= !8 S000 $0<] \40 ;  P0 0000 ; PPP P00 "V t\10,430NCލЍS# V 0?s0S0Q1 Q+ Q% U     `  0?s0 00|/?r s0}UUU[ pl$@ @ $ԣC-XXPAM M č@`p04$ R6 X}!0 @` | P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @H |D }hUD  8O-AM⨑ M  čRwpPLpA@PF }PPB t @+0>P7 0S4 `  0S+ 00@ pB2P00@S 0S0S 00@ @K @ e @ެ ڬ@ ,0 0 4 30AލЍ耚  t8 O-ß CMM`,čPp@X\<@T0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P 0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00 0 00P00S !  @D DR0$0 0s<  :T80 tP0 1 00S|z0000   Rl@00S}0000 u 0s0S0S TvSꌙ l O-p0Ÿ\M P@`dT V p"!3 0!100UϿ@ 0U 0 P 0FSX0 0 0 F SP0swpSS0SUPPj   B RX00 0 BRP SSS PHSUTѺ4<10b 0  ({0 `F 0S0 s ySwvS wS0soS0S   <PHUT0XU `$0@ P\Ѝ<P0\ЍPHUT D(pC-@0 Mp`P(-@D T@?),S0Xp%S뵐0 % S  @S U 0@D?0s0?0T00S  Ѝ\x LL$0 PR Ѝ, @(G-@P` p崒Ḃ- F0S@`=0WV!9 R@R @,%0G?o`D2V0S ?V0*vG`DR0?U0S X HH$0 P,,0 P`ԗA=O-0 MP䑐 0S2 @s胟p$` S S0  P$  <P- XPC  tP-0V l 0  SR 0  SRS ЍPd1 00d1 ,yP0 Hy P P060 P0 dy P  P090  |y000yt0:0 zP tP090090x dP010{  [P020r  BR0P0Yi @?P1?# eb0 2Z E:0P0YQ @?P1?# Mb0 (3B "P< @ KP0102  MP010)$ @-@HMsxs% 0{ P  |- 0 x{ 0sxHЍ @-AMT  |s0000 00sЍ@@0@- 0 A0tMT0l00  ^s 0P0#0  "b@ 80 0 l0 30tЍ0@@꣖@  A-@Pr 1!01n0SPpuOp qp0PSp@-Q@U x3s|p b01P b01000pqc9sVxqP //hP /W/@G-P@`>V$0QV@0\!R p Âp QVp "@p O-@H;_M M0<+04; 0P050vP0ZU 0 _01'`, 05p d!  d!. 0`1q1110`PP  Tʟ ~0ʏ Wό d10 d1u YP( `P ``0DPS_H ] p\ S S00 PpP0S SR#3:0 0CQS0 0CQS00000  9cxP ~?080}o 0p+039P 1#S;S 0(S$ 0(Sq 0(S@ 0(S 0(S x8 R00sS1 S SL(0 n/,08 R1 S S0S00 S S SS@@ `0 K`_A_0P@00Q"0A'A+S? 7R1 S S00 R00S 0P0 S S00 , e@@ R R| 5 p@ @@@@@  @  uOg?8  , 0GPb4P R^P 04P 0R@zP@J0d!S 0 0 2d1pe Qp|1 |xqp @ όx0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0(UPRP /[0%004 0 5 30 _ލ Ѝ4 Rq W W Zʨ$( k?$00,` `ᄴ k V V` VV00;V0SJ`V @4 @0p ;V  00@`V  GPP   P 8 Q$h!7P ``V;V #0 00@`V;V   P 8 Zl`(,`z3 R1 S S0So00 S S SS@@d `P ^ _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ000002%}_)P.P `5_0!x3!|3paDP` DQ }ouQ\z`, qP 8 Qh!h!2/R1!RiP;h1QbQ]` P@+pL 2 M P|Ed P X domasearnamesortoption(iner list`<ch8 p@-!1 P@hlHM QP T 000HЍpp Qx#r coV p 0 xT00oPT $000HЍpԃ@-@ RP0` PU ` 0P\\PpP pP sP pP O-0PSMp0  dd40Hu0P0 `u\0P0 0@0$ (    )?P rPX" RN K 0!#X㼠`Fd 0PP P qP R X@ PU& 0  0  `F@YP) (,$@  Q PX `F #Z Yr 0 L^00`Sߍ @,(0P PEQ*(20 $^  L  `0  S : 0C S : P CI⼰ R0 P XPJ( c X   TPPJ, 0p  0 H Q T P pFZp  X   0 ]t 0 {0 0 ]tܣ 0 m괄 L@-@0@ 0@P @6$$00HXt$  @-$0$ 0@P00 00/ @-@P @500H1tx @-@P00p@-@PP  P  0 p|L0X $~p@-@PPM1  0`   00HsPP0 P =PR  0 ЍpJЍp  0 Ѝp L0h $~ }@-dA`P@ MI T!T1 PQ0 Pp 0 RpGS( `Tp; ЍA@D@fpP 0`pP 0S@ R RpP@0 DL -_ Ѝp0 L `"_ ЍH00 g00 @}|}P}$}}0A-0PU" 0U"0PUP!q@@ ``F[P  ([P 0!E`1(,`P$02~Pd'',0O-F帖@ MR 00408 6P0( ,0xfxvx`{np`S8 X&Q !GT@ d,!@ ,&0C S00  60@ ,  A0dP@A <8 @P, 8@0 P,0P{ PQE@80Sf0S h 8 0Sm87S H% 8 0S4E@40S S508 RT 8 0000040S4ğ0 @, 4TA4*02P10S P1p1 S^ h40, \40$0Sp @4@$0 T ,< 1P,6VqP0880^ 30,P PЍpAR $0Q*# 0T@!6# 84,P< @@P,4&1pRv4"0# @*Ȝ1\ \0X $0T:p @, 2@0 1P6,P_8*20,  20@ ,  l20@ ,  X20@ , D20@ , 0204 , 20<  , 0 0,0 ,  10 , ̡ ,0, 10, 0Q0001刡0 0 0 0p10uSp , 8PЍ>p M9p  u p\TmpP/ 0. S 00KL `&], `{{{{({{0py,y`xwd8w|d@@upuO-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 ЍPd}H}T}D}4@-(0 $0 pm` (|A-@@`V 0 CQPqGYP pG ~PXP 0`0 p{@-@00 R \\  $0!0D0 0@ ($ T @-@PL  0S  T0S@YY@YdP/0-` 00 0Q,000 P0($0 p@-@PJ0`D P 0(S  1T  0"004`p`p@-`0P3W@P P.WP 00p C*y A- 0@S  P p00  ( $ 8PP(p`P0x8+O- ,0弻S 4Ms 0 +夫   / +~` P @h+0\{p^/  H[@P^_@@ T@ } @Q0 :Q , @T  :R^@Z :0 Z:P00<0 0Pt` `@ 00H4S   !d$R; PSt0 0,0Q090( RC 900 RB ) 0S  Q )0 0($kIk@(p` 0X90 4 R B8ɟ  B QR90  P`0N( ( ( X 0 80P ` I Z4Ѝ8 0``P P @d8p0 00  D( 00D0DS: 8B0`800H@004  P`D0 0 0H0C 0 1 ,Pp$p$p(,(\x*ppQp(pW pA$pW P G@Y@`A$ppW0@  ^(0 1,P0 @P(@ @(`P, P  VP P  BR \`A Ng0@(`P,  P1#0S0 0 PPp`@(( (p( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000%4000C?00s( $0\V$00( P A ,P$ppT (0$0 1000@`p $P1(P$@ mP@` p$0 V$000\JW 30$1,k, 0, 02B0@ (mP t R-pP( 01 (0lPP$ 0 1(P$@<0 (P$@$10$*QPSKKG 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `|@ @0`0VL xxwwvvlxH t\ \P0qhtHxmmpm@m mllxl@-@P  0Q ^  00$0000 0@ ($ <p@-l@@`VpPPp0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0pS@P  0P"P` pp``@ YbiA-p`@PSPP T  F000P    E _AliXi@-@@0/؃ 00(/000/004/00/00/x 00(/t000/`008/L008/8A-``PU 0AP p_pO0AP6U404 0 ,(0  RDT U/-@@ <0 Mb00a.hW Ѝ`g8 @-@P 0`00@050 `m@-@Q 00 2  0 G-psPp@M 0Np T 0S0{00 0  0 0$ -0{PP 0` 2$ "Z &= " 29 O 0 0 0qp} X X >00;0@ cj <R 2"-00*@Z 2: 2 (eP0 0] 2< 210 010010 010 0100100100P 0 R00   0T 0 2 13/p ЍTg0-00PP 0`2 2x00@Z@P0S}X 2: 2p DPx 2 @0 2D001800 48,jC-@`pQP M 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH aP (0 $( p 2 P7 ЍP ЍM00P("- $X000X "R0#03(0 $X "X002S13/p . ЍR Fi@-@`pQP M 00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00PO-1PSM3:00 X'*q`I`[ 奘p@ p W g0 PtZ 2< 2ЍЍЍ RP O-MXr=*`00A̱PkpP W [K DQ@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 p Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0 9 PpXB Ѝ 2< 2 ЍQP ЍG-pZ RbM* U0U @ RD0  P XЍ@ 2< 2ЍЍG-P഑p 0@E `` I`\1Q1v`01 @Q=zQAq @0 R 0 1Q@10CS㣐/*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pT00 (t<00 (m$bP0h tea``p@- @VP P 0@P bp \@p@-P`@Q P00T T 500p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-P`@Q4M 00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  *`0P 4Ѝp$  0qp 0 塖P 2: 24Ѝ?p`(0 0,9/P 0 q DD>I/h,,I/D0` IqI}Iu 0A-s %!@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!ApPQ?U/'HW0O- @ştMTP @`儝0P(0f 0 | P0 ^ (t@0 000 00P0 R= @ H $ p 0\ D@x +  H ᲀ@ pRڴ R  D@D H P|  BHL  10@ r00(00@P @r P p4 X $ 0 00CS0s00 R(< @ @r 08pS0Q Ⴠ:8 0@00 00P R 40rS 4"08<04 RrP\P0p0,Q0 00 R@P P 000pwpP;0s00 ᳠Z100S B CX TP\[0S$0Q0 00 R 0P 0P 0 $0 000 PP,h40S 460 0`00 00  0P(d0S 0$ `@0T$0 hPY 4v0 Br 0X @.: 0H00( Pഀ0000 000tЍ( 084<0Y40StJl04800<0NLU]/Y? ",.= CB O-X\p0`S0P @L$P I HP' Y  0z S40 û 0(10S0 1$10$10 0S0ڛP 0 P0S 0ʛP  00S 1$10$1R00O-MYP@000X00 ``FV(:S 1 !r `p pGwp l 0 F pF000H00 B 00p0@000 ``FV=*Yv`E V `!0p pGwp D0I`v`0s0抠G0Zp01`*0ಠ0`0p00PP{ Y```0S0`0Fyp0 ,0dp0 ,Y0v`0``FVk*Xv`V p0 0 00000``FVM*Xv`? Vp1p!w 0S Br p0 0`H`Fv` պ0pwp0s0扐F0Y`01p *0ಐ0X0`0p0 00PP @00S;0`0FPЍЍ 0 ,^0p0 ,Vp0 ,NheT0 ,F0Dkp`40b0 ,8A@@@?>>>G-p`P@ S  R0 ᇚU@ T6 P X0SH0SQ 0R0Ӳ00ô00 00As0R0 BY001*r 00 000UU800C80t 剐BY001*\ vHHp0 , 0R0ಐ0CS<O- R P0@ Br( R(,W _0P P I# @P 0R  Br( Z`pV Z@  ;P@@p@-P@ 0^\ ^ P0Qƙ Pp\ p pG-@` 0PS 0S  0 Qᥙ@PS"  00S p\: 0 BS P= 0 \቙P   00(!S$! 10$1P0 uP @0弐p 0Tp 0 S 510 B\r ἐTP  $1 0$1(!00 O-\0`0CS0P@Lp M P G EP& 0 0  eP 0z S0  Ѝ0 0S0 P 0 0P000@- M@ P p10 Ѝ0O-@pM 0 0p`Hp` ኔ P PK0SRD0Z 00 @ @ 0 pWK0@r s pGW0F*0@p 0@000S p0Cps0W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 |P0 ,t0 ,0 pHHp0 ,00p0 ,05f55}h5G-Ÿw?`0 0MR,@pl2SL:0JSI Pz P崐2Sk1! BRE:0CS㣠j*z0Y* C00C 101@0p扐0pԷ  20 20!(1 0 ,0 30A0Ѝ rP0 ZP崐 Z y0 p[P202 <p 000 p$  ` 0 {p Y$0b0 $=gy$ Г 3A-@pPQ`M ?00 2   Q Y:1Q|]0" B1"0001 0 VA0 0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " vЍ00Ѝ0PU Q:(0 $P0PU`PBP  \ DP 21 zD2@-0 -M Sl lP 0PS @P000S 3/M SDpUď 8 80 $0Q/ $0S/@ D H0<<0 0R/$ 0S/@ Pd0A-@T 0S$sp`/XP0P@QD 0 <[WP 0A/P،ho&O-@$MpmET|$Kpp4pD0q$4SO 0! 0  0SpC(ljBP b0@S3S10 3A93 3$$ 3$ $ 3  3$$ 3$ x3($ h3$,$`M D3$D @Z$Ѝ $40$0($0,$0$0 S3000`V" P  2RCZPP2&C70 p00ShP\R0 p0 00CS0z +p`  RF(4S VZ  4S8 0V0$R0S  ?Z6@) 0@ }7000`006@FU0`00 ᩉ 4S ! DZ6@ 4S $rp ` V V ,4S ^rp Irp4S VMrp -rp `000 ^rp V?@0`rjNxh&\w&)-o&Oho&n&tv& L&O-@PMp`PlHsD @@00,3,# Hp: RPGP P r f0@3 hP>  2H@ P PxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  GPPXPPqT! #m`P "  6PP* dPP0SQ t#YPdqPSp`@ 8%,1 B R  0S ᑺV X l 0S X  R 7/P  R N6$ D $ D \YU%-xh&/d~O-yMPkC0`Hx00 00 (Ip8`K[( 0RI Sp 0 0 X㏇vPePRPGP!tf0@S (H0@ S aP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SsQ0}QK4xQ q '⣸ P M6pP/W  0 10S /RpI0S &0S0@0@P0P/S R 0: S00! [sRo0: S 00000#/W00S %0S0(00S00JpW   ݶ0P0K d50 0"0P @/P05$%0CS0 $ `aC   `pPP0S 夆0Sq 00   B R\ L` V `,Q% /0 !P@`<0 !P` J/R  S/R/  # C  R:  ` 4 3 0S S/R$ 0hSR& ]Q0sX/ HL!R\0X\!R\ 0^X00: S ø C C `*Q0: S P1: S  : S!  Sp  Sh p Sa S L0S !%rPN,0SL ! $mVG0(尥 0Z Z80 S800 Q xPPP1: S 00Z0S 80`!0CS!80 TT0 @oPR X0O 0S !r0S !q其S[ (0S0S 0 0 Pp!|凅ڒ{&ےxh&ƒ%a%0vђғՓޔP{&n6?sO-@Pki\/AH&jGp@<6sP0%/(0@fsPP8P0T P5P%HPNP8P H00 0(%43/00P08004 Os4q 0P012sPP (+sP 0 P0 &u@0D 0 luP0; S @ ,0D(0#!H0P85/,TP0P$~Otq2PP P0KTs崓0 CS 01#SrP0 0( ,S* Bu"!0 0 s8PU H003/p0S@fH0803/p$^PP  h`0ld 0 GS * X  A0 $03/0  0-Q3  R D2s0  0 -1/ 2P0 0 0 0 `0d 0 `0d P0$ ,!r 0,ذܠ0Z[   P  00h0 l 0 h0l   000 RLs0 0013/s Sq S>qXP\`0O ( (0, PU`00 XP\`> ;Q#$xh&DЋ'%'p'Ќ'p'T X 'ȚTxO-MMgq? ]Gw 'Ep 0 Q 0  xH0(0h7G@-Pn 0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S X=PU R8nR oR0P<0,㡹`P  t<P8$`P,㍹PPP{ 1T2QRN , 05 PzPpla4 1SzH0S?80S<@0S9 P0SP zP4PD0S 0$, +@p P44X(D`尠XV 0PU 0040D0S sލЍS ,0SX sP 娠=`0@0S0H0S 0  FuP P 3R㓵( F P3m W` H0Z nP t3  dI;P \T 0D40`FP pMPP uPPT0S00: SuPPP4 01!P4L  0R p 0P0 T0S|aH R 0 T0SP RptuP4T0S 03AYX 8SU # WpVJ    !   !  $ ! ( , ! 0 4   8<  @ D  H L  3]P   rP40SP8`כ'-&;ٞho&exh& i@-04e|P000U00SOr0C?ou21@ Cp0 1000C00S9 000-S40 2R)0pP EP SP ml hROsP xPqDJ84 4" 4" 4" 3!00000C0q|㦻P&b@P |S!⹇TXcQLzPN<32S L#L02R@Uv 3 0S 000S 0P 0ryP`PH000!S 0 M0S XRd000S BPgDEQ@#A1S bVqQ"P$P2S 1"Q:Ua`0:EulQ100S S 4!0`00~01(}@P Po )|Pj @zPg 2S 0"r r r2S`A]"кPG2Sl p0"PĺP, H0"`(pQ0 0kQ갣'xh&ho&-SbD''Lx'Υo&n&@-@MP`/?P@P@PH"3 0@B@r0 2Bp= 2Q=0 q E - PW RZ R\ R3 0!BSQX KPS0: SO$00  Bpd10 ER!IpDwPePLP PP0 FP f0@ S0 0000 0 0 0 0  Q |ɋM J@P0: SpGP ᳋@TW' xh&٧eO-`M@cY;IqpP!Ap 10a1S 000`F0PmP pP kQPdP xb`cP9[A LAp@U,80Z 0IJPi0 0;JPa 00-0 * R U0Z /0 0 U:5Ip @T;MZJP U:IpVqxh&-WuwO-JM M@c :`R!Ap1 @DTQ0 aS T  PLiP fP hP vP00`0` 0QDIpP0: S ! PP ~P 0Y/S / J>00$CP@T {0p/SX/Pk0 S:Lp` p=ē'Axh&hFA-`P@MpbD4 0I nIP  H dIP  H ZIP  H PIP  |HPhbd3P0\3P P$P@3( 03P+( -P3( 'P7( !P;( P?P ( PP(  P 9P8$@Ѝ(P (PP"N(0S (P(0S (P(0S (P(0S (Pq0S dGP|!0S0S {p Tպ`PLa @1R`ჽPU 0E /R 5P(PU  00,0/00+90 0CS0 P0$0v00S tj}닠0s00/ꅞ@(ho&P@(L|%'F'p@-@PPa9`LP PP `t G?ph00SVP(}P $< 0@pd$0 y dUQ 'RU2 SU> QU040,   ttPcPSP PPL=d @" nP tP0 aPP pU] [1lUT  ==  $h$ ?pX dЍ $4$ ?p3!t 88 ?p2/( 8e 8Y  HߥT@D,PP`p nt`TE`8 ?pP%P#<"X0B!v  0!W&X 0  1 P Q !%t0P0#tTK 0@SdD\D.+&p08b08 pO0PU 8 F & P P xP0ZS <n.`V  $ ttD0P`\\Q-Fxh&FJG~D(FD{DPF|D(_FlF}DFFGEG!Gho&yaratcidO--0`pOaM␯吏22242222322$ X/5pjL?"42`FS 20000b2_S R2SVV10 dbV% ``L0t/p L+pP  ``L0g/ppd2S P`>PX0: S0d2232d2o``Sn}0 =fgPpng0S f Y zPRP3P/Pʞ=S@'P x=1@P A@PT=P 00j0000] ,2,00SP r<P0d2M042J02G02D02A02>@\ @UCTaߍ02.202*02(\H\ }(\(rdA{\edA\z((|(Y]>\\]8}(]n&L)]9;P ⋟팃``00"l~:,00!`0,"t:? 0,! 0 `0("-h:(q9Es;P s0$    0 A2S3 bV02@t8@2SV;P# ?| 0 0 0?\5:@HA;P D2!` V!0Tp2<<23Sa ;2AS``b2S C8$)0 ;PO >>b>I 0g2  `V' 0`EV ``    RV 0 S@0  @0s r @Tm :?T 4?"20"0=P`=PL `]]]4%^I^^u^z((^^Z_]^__-0O- EM MP 00P00`PPP@ 0 $0pԄ0040pV4$F ލ ЍyPcP PP! TP' d\4 STv?wP" 9P  |mU.;P ap@.D F8"88PB}7$RXE00 CZpWD ` jL[P/ ᱴP1Z =Z2h@Pg?o[20S@ g `@T  j$[`P4j/}mP  8p. /7P>04P(`CQښ. . a0C2,S!R. !$RU>"0DmH(pnxh&8oho&n`(-X(iooP%nnP(nn0pQph(zd@("p-pedAbpppqG-p@`㠁Q!0/p$V】 0S 0S h4``10pWA ƲP 80S  廲pW$ZЍyPmPPP fP G n0@ S0  0 0000000000`6TV 0dUPP-\GPXGP 6X-(uuxh&cuuO-H4MD$` 7P! 6P!60pD00PPP#.p4W00S 0S 0S Pp3 a X( 0S004P h/0S T)L&WPY430S ЍzPOPBP FPL k"P0@*S 002 ᣭP2 坭P200㘒"0 0b j <00P2` ჭP00 @|P00 0 c jPx /s000o00l00i!0 mj1 P :1k100000P000L00I`!000D000@1p=0000070003P10SLNZPU 0P0&`IF2zjZ f5rjZ(p(=Txh& (Ɗ-ƎɎώ%(sO-@Mp@@O넱,جP0WpG10,ʼvPlP+HP1 TPH e6p0` 0& D cD0`Z |  Sqp` q0S (%| G-`M1P_P)2P1 !p* P2X2@PH2@PR0 0 K0@O@z 2 Hp HQ 1P  @  p1a 00 @ p0 p@ `080<0@0D00P0 0 080$@P  80 HL@P@T@X@\@HP. H*000 0400,0@@,0( 00P#p.PPUPT0PP 0/`Ѝ)))_()))*&<%%X%$$$(O-`pPH6MDF(` 0 0&(p$6U K V0S`@@0VoP 0SЍuPfPFP RPZ 5g@P P0P 0 hf0#S P` $$0`0S  $$0`0ShKP zf0#S (yP $$0(0S x $$0(0S|00y0P ᯧP6q 6q 6 s6` @s0KSq0k0Pi0 C@Q 0cR pR bRJ fJK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX J@%00S_ /P|0 0C?oR20SV X_00 0$,0$00S 0U00S 0 0S0P000010Sz1 0S 0P0 0  Q00s  h1000T,0 0/80P0S& SR 0@0@0 #  R S /P(0s  u/pX00S =/ 0/L+-+xh&,(&*V+i++++++,+9,tv&&,L,O-@`'M M⨆V$@@@ &;'p㌦/6p0PKlU00S 0C0 1U0 U!qRPPy YDP㬀H= .p`*&0S   eAP* a@P5P 00@50S $@Y ddXu@000@0000p P P P4 P/  P*pP P( d}p q8RPXq/d00 000#0 00$00 0PP^`P'ݍ Ѝ( P(@TPY =y1 PmP(!hfP( ]^`PP p8ᥥ0PP 0(`p` qQP 00 00$0 00PP^P ^P^P ^P PduP PpP DkP!@jP0cPZ P( ]Pp` P( +P /Pm``ţV":r0 0-p` d!d.P-0SH00 000$0 00 0P0@(p .pn-l-Ꭳ0Pa0SJ(S'- 29S!S1X/0S (%[`P@\pc/.8(I1L-xh&14--$1%.-V101`11H(zd@(edA p@-P@xGp@-P@pGEp@-P@hG@-Ep@-P@^G&p@-P@VGspp@-P@LG"p0O-nM M800㌎`4P9P 0h~0 P T僤PL 0D~S$0Gp000,>,$00 000  %p@9=> 0S=D$R$r R  $mBt $Jԧ<$.}p|0A: x0@ <$0t(0JE-p T" <4 4*8< M30`PEB@D4T@@ 0 0<@"P < $P   <  p<$$r $|L P 8<$0 00 X 0 =}0(00 L0, ;0@m xb; ;$d0 00 0  h;V0!00 p0  0; H0(00 80*T :$:0!00 0  :(,0!00 0  :,0(00 0  rP:0l:@<:0S "P00x: 000 ` H!00 8 0 M:0!00 0  ?:0!00 0  1L940c 00 T0  #,: 0!00 0 ` 888̨@0S C.0, NPaNP0@4  P@ 0 =a`8Ȩ@ PD40 PD40D4y  H 0P$0n P800 1 1 ($8C]7@P00U7 000  HL7 G: PǗP/ —P Fa0S 0T4000-00* PEU UY~ V 0. PpS 4S<4Y1 H4L$0 V,pYm?HL4P80S $EnF?ῠFHdLV0.= 0 $?ᰠ`5VLHd04SH$L4R0 &*pP # V+p  4S@  tN`P  =`  UPP;%TPPp%p`V+p (:: SD%H/ $R(U*@P%$49XpP%  e  P0H 0(0pWZc>$R $0@0Up!$Tk = (,0̡P,0 r0 4СP ˡP$$@03m`Tk 40S0X44S.=0@+R$)SR- (8 # *~妡Pb0T40S囡P `#00ST4Sd31⊡P L3 50s (8`"" R H$L4\* p```0 L4H$Ϡ2#!0`p<2 C  _ 0- ;~pn\Mj 0P0 8!  㼤dL$H?("f4S 0>0?V B`0$$4RT SQ  V  07)p0x `VS  S!0$Q\ +S0$0 Q$ Qg*cX(TrT>TQxh&VWW-wTzTho&}TTTTTTUU&U:U^Utv&lU}UUUUU8%UUUU,VPV^V(oVVVvX-W@WVW`(]WoWWWWe(WWXX:X]hZ(p 4S &PP$p$T`P#X  L(@tP@4(0(00`V Z<0 00p"#7$p = 0YP0 r0 4]P XP$#0\3}p$p4S80S4l 1S !1B0"H 0S 8c4P "0b1p1   $$!0#\pX2   \$ m{p P lb $ t$4嗂s'4S 0< -?X   $tR $4'S  4%NX0; 4 $$ X  0%p0k\X2X0:S Q4S  0  _ &0S Z &b*!X0⫱X+(6f-jxh&jj(klf%ij jj>jFjQj_joj|jjjkk+k:k(Tk@knkkkEl`ltlllO-GM MP`h ܠ0t@$$p40PEPEUq @@5P 3D04030033(3 p0,0p0T3000D30804<3<#  3@ 3D 2H2"20L02"d2l"Dl2L"{$T2 p0V0 (2Wi2 p0X01!W 1`Op0x0p0d1 ?&p㸐%c  CqpW0 S S D / 0Z [0SA0SPT0 FA/xP 0$ 0 0@ x+xI@PZ FGލ Ѝtvxh&-uuuuuuuvv$v0v>vOv^vmv~vvvvO-` -@Mp L`K@%\UPZ %P$ph $$pX `@>< 4$pI( 0{@{0{SH{{S $P{{Z$P<;Sګ$P Q^ $<^ A׻G8 ({:< (;S[ht `30X2pGS1<+0X2#030S" C@4P 09 0,3 P P P  Q R2 3Z 0;8;08; 00t2H2P8"2 P R  0z{ l+S Z<2 P P $2 R / < X 0< 0: 0 Y@0 010@;F 0@0 00 008;0|1 Pe P @ \1 R / $ 1P& 00z 00w 09t1 PyP ` 0PR x0 P9 P 0 R @R hK?{Gz?eA`RMb@AYn )ƈ-Sxh&ɇ">Wi)~)-|p)X)}tv&ω)T) +|))φp)8Y)z)Š%@) 0; 000  0 0 000 0P 0 P R  Xp<00 ,<ad PP 0: 0 d>!.t8@|1Z 1@2TȌp Tpp̌ ňpp7Pt  Y 0@ @ 1 0@T`Pb 0C S_0400000,00(00$00 0000000000 0000000 0f0p R= @@:)ĂW> (s8;p 00 L0#p8; 00 L0~#pD8; 00 ,L0p#p8; 00 dL0b#p 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;p+,,@⎝p L05#PX;"0#10@00 0`K`QHD  `   ` 0#PqK0S `` K0#Pd 0  00 45"P@Wd X+0 TT(``\5d%\"P`|5|%|"㽝!2`(10kkkk,a0a4aU 0P````㤝<<;SU">@˟ .\z{ A k:L:۟S"@ \Vz{ A k9I:`"2Rgd@' { d30S 0 N' L N@^IN2 X0弅)!pV00 媏@+P@0W0 00Dh'@X2 ppW T p (2C"PL0"0:CS0L:"`pjL1堋{8 {'NjCAZAG:@8țINT{({*X PU7 [0S3 <i0xT0T000p+t pP F0S |0!t;<000[ W0 0 |@* q'd2"SS% 0 " $@-C6?8~A@@))o& ))ߊ)"ho&+)%< `G1 PS& 2R`嶐@pYTT0R?L0 d0 0 d20 !  s  `00hl0?ph{{7{{{|3{{ {  M@ )*3h2 00h232@0d@Wp |)<0 0H 0@02 0BS= (SE; ? 0;&p@0S<}h2!0@0Css0S0 0 0@ s04r & 0 @ 2币  0h 0S h ;    0;& 0W |S)6<0 0H 0@0&p0V 01 JxP<0[9W e0 0RZW |!)<0 0H 0@0 0 0D lHB&p0WpH9&@6&p )%Pˋ{)o&T)69t>Zw$ 0CS0 0 nP \0Q.0 p& x|%t0䋟p@0|xtplhd`\0 2Pb <0 )PY 3Q0 %%0  P; \Y %0 P* %0 Pd 0 P Q Q ,(x$v 0 P x0 P 0 P 0 P 0 P 0 Pd 0 P @0 P 5% 09 e50Sj CS^ S W |'<0 0H 0@0p%Hڌ9Ofv̍|CeĎݎ-Q[kˏӏ,)SIZ0KWI7L$DDD0J0ZD0 0I) 0K J0KX  QJY0KWD01ʸ+Y wP WD0 $D0J C <帛QWT$pDDD0I0YD0  0J#1 KJ$ }Ww$|O-M`P@0-S@PP- @3 pȣ#p*30SP a`F0P[: PQ9 JKP9 nH S8P@ 3 C d0@S  Lp@20SK@HGG 0{ 0  X mdSY'iK`P9P`8b2 R 2 K0 S & !U+ 0 7!0!00zW p4 ,pT0SW` pB0Sv8P p00@@ 0xR Vh`fT*txh&k}KՐ5>O-PAM MF@`6P&0P0V00-S' @ P ᦒ 0P0R@0p0I\[00) `F0S0`@DDA@Du%p ,0S@bLpP53 Q  f P -00 e `@[-00  D0B5S0  00S PRPKR0 0꼄?4P DR0000x4 |4 0S d*R L4 00 8W#P   300S Pm0$0h0(0e0,0bt0C?o#2p R0S0$0P㬗t㩗P㤗Xmy0H~! @DT43a00@`FrS= RS iS1 tS xSm$ 㨢в+ <(0p 0@00@00S  0\Y#0S sAh {:8< Q (0 B b/S CD{V (0S p 0`+ZE0S (0S |Z1 00Xw S @K& (0S (A 0` o Pp+ 0 pPUUZIT`*DUmf- +“%ߓ 2xh&pho&?%ڔo&Ĕ8+XO-PLM'P0N0n(.p>,# PER a0:  @@0SCPvPcPSP TP LP =!d0@S0 0D003030800H00 30$30(30,30<00",00@)0,0~p  qW3S(!)P @ P< P /P LЍO3S 00 p, 0 4  8 < @  0RWS[Z0DSPQp! 100gS @{D EY0`,  aR @L0Z S P0-Sf!0 @ 3R:  "0 0: ` P0 0|:0 0h:43043{0830<3@30@3ppzzyyx||{U ,0E U ,0U ,0U ,0U ,0 % 0 0U ,0 L00L0U ,"U S S0X0X(0CS0 0 PD#8 D#<#  P Q0P0083 )00b0,X0$X 0X@0X0 X0X0,0  ,0 =}P圐PdH0S7 0U09@PH0SX'BI0- ,0SSX p43 S<0P7/aUF cU2 gU0BP)03S_0Sa 00gS# H0S |&Z` 0  d_0Sa PYpWpUpWX 0S00"J ,P 0N 4L 8J <H @F DD ULЍ0000H3P0P xH30娐PޓD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R  B   0z< Q $0Q P0 00 R  B   0z< Q $0Q P0 40 R  B   0z< Q $0Q P0 80 R  B   0z< Q $0Qp P0 @0 R  B   0z< Q $0Q^ P0  <0 R  B   0iz< Q $0QL P<0PESZ $3S0S bD0S] @hp907S  00&c;sr<  R z d t v n  h  b UlPœ0S 0S 0S  Q 0   ypqPU ]8 30(#0<  ! +xh&oyX0N%P++NX+`+h+p+x+H++`@++fs̿G-PXMpG1fPHh   ,MDP b0@SS0 t80 6d(1pX80U 0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R  4&R <&R 06lShQaGDPA07=CP $P W0S  fP 0000嗌P6T&0 WDP]P061 (VU$wpXK0+Sp@(86 000D 뻲<00 0/15T& P 0p00 :XMP00G00X=p: h5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#09qp(4 0P 0PQT3KߋJZp=V [x`2o`F#P0 0SU030#:U 5%$P屫+P pF= XP&T6K/r0 43PvTS0 0 S6# G@Jx SPEzX!EK/r0P;x 0 0<6Sr46Sr 06rS 0GpT2R01 j xf6S 4aP W0`W  0-P :x,6S m/X`P b"`Q0Q n"f3wD+<6S46S^E`^E`@6D&SH1 0 00R8!P H& R$!$Q $&R! 8&R0&@PR  Q   @ ? @ 9@r8$+@-xh&>*+ZT%+H%+\~tv&BYEn&p*+|A-P`pI䁟HM! p10PEU GHP h0@ S S HHIIp1h1X1 T1 pa 8P (1`   aLPP J L`$@@Ԁ`(` `C UP P0S PxW MP XmJ0 0000 xh&-%*+ yt Ct #.0G-pHM`0X.BR"X p 2B1 pGS 1S 0$  !RS@# P+PTYP<$&JxP`PAP MP p!a0@S0 00 04044041P100101@30@3101101101101ДY 000 0&HЍP  PP  I0S  )G0 `P^JPW a W p)pGW R $Sw ,0< sW p+++-xh&;z%-H++o&C-Mp`ᖏPPEUy% p5U@U`F V/@T xҊP h͊P .aP tP,5 R -0%  PV 0S A@D .Po`VD c _tP@PA@3P zP0S<0S000S00S00S00S00S 000# pPU 3 `V= V30SU7 0S4000000S@0000000 0 3 0Sr<0Sm00Sh2%P0$0:]0S 0SW`V UUQpP ` P dPB UB U UR<2PEUNPP UH Q PA H U2 @U U60000  x/- U+BPJ 0000 0 e/P  $- a-$0S / - pqp!*If@T  0r"600"$0$P @ᄉP tPd/+xh&-ho&50'KexwtC-@PpMa M! p10S QฑPE R ލ ЍRP fP74p91{5P` GWOJ\P1 JP/0: S2  S)J !1P0 JN@n` 04S00`d΍0S lphJ 0PJ 0@PJ0@0+xh&!+.O-4MGMM ~=0Pr+0 <[?@P P ;T(Xx[@`0P\+TX8T 'H;P  0S,;0+, Kh8S <PU hXJP@ 9OoB:pp>*:(8pp6P `ZT`hbPdhod:xJ 0pP0 `*p`W0 J S,* 0 W0C 00܌10 l>  \z8P`T0>0 XP党0P- S)/0 _gP\9Tr _P 49h(iVP 9T(X(_Z⾇P 8h(^40FDS00  8(o 8X(T( |8,8 8P 00S| h8l ,F(8, ,, ,o 8,k 7H(g7l 8nsn^ 7L(Zg+uw PS:?@ 0 x7P(H7hgbnpZP78=l7 87<(8 (7T( X(2@7 r7P 00S% 7$  6t(6 ]6P 00S 6 6p l`E "w68`n`F080 P 0S46E `V 8=p ^+ 5, 5L(5m0P0 p5`(d( \5eajH5P ? |5?Qt(^GލЍP5T H+10D4<<兂0P 0S m 6=Pu@PD8SQmd4 mpLD Rnv hvS^S>  r^ U` i^LU a^DV Y^ <  S^6W L^ /rq/E^= ' >^Y Z 6^kitaha`aTaHa 0S0SA  SN@288S2W@Px |b<S P 0S m mD2 kN @+v P:B?lS |081<Sa\+Tu P*ba㕊0:{P 0jP M@P&Ia Fa'_&@P xh&e W-% `+ho&- % {     Td+ , $ A-P`(&EhOP03wp2S l PCU;{C~PO p 9P/P00@˜7' s\vP3038$p,40pEWQU 4 000`ᏃP C,uPE0S3 4# 3PPMJGxPp~C`p\ TP姀PH304F<j|4S ,S{P  aCo P 4SsR{Pn l PpR},p`bG1/΅<01 1> 110101$1z   #2R CzCmp`a P^ Q1s0S o:q`|qzp  lQ00S {p P *`3P?o20S R=?o20 P P l{1s0S 0 S S 0RRzp  \z=`S 0 0000 ll{1s0S v`m|d0,~ !   xh&tv& (, <  o&  &2 &!!$,P,x p lv&@-@`ᝈPP p1 lqd!pX10SAH81P@ 1*$qӃP  ΃P 0 nPbP 9P0P |  c0@ S0 VP mn 00@0 P0  @0  00 l0S(,k$)xh&((ho&(@&A-`4C0P@00$ 0_{P0 0!vP00}|빢0뽗تcP0r00"SB:P U 0+0C0SHPEP H\p8>PPE <P 0S+P10 $P1 0Q 嚭U 0SP䉭MPEh10S \10LnDQW0S(1(P#ePwՃ;Pqp 000000SP DťPP`0S :PPp00S߬8,6)A)[,1)F)I)P)W)Z)c)r)L,[,)Z,)&))[,(a,)[,[,O-`pPLBC%D@`4"@p(2 0 qQ pPPpGefuP`P GP IP EP 0 )*a0@S 0000 p U I p T p V & p>`V [ \|X@PPPm 0L> J-Ixh&PbA0O-@xM0p5p%@l5P@d5b \5p@P5b/剃@E@eX00%`5(%(E5$%$50`0{P`%偯 P P @omPD DP4 fPğ5 CP6 dpP8 rPt$xp=eJ`(` P00: S0S00',sPP( pxP 00SW p3 L3 CkK3`3p;qWtpP i MJxSdd0@ KjPPD ~P    㽃㺃Ux0@00#P@ UP@`Q p,V ((P,@4O4`(PV,@0,@dB( (P40B4`V(P,@(:(P,@4`V(P# 0 0S0 0 0 0 0 ?p  W-@P Z 0I001"1B~PtZ 0Q wmtI 0 Ѝp,8, x,H,@,p,| ,,t,H,, ho& -; ,L,5 , |-, V TZ xV (, X D,,P,O-poM9!0 @U 8@0 @$/p`S4 W[Y~ pP 0  (P(0: S) 0T0[0Sf Y X⿜P$@PD  P %z !z%PYmPag@Pq Y4pVaVb`FV` zV" F!0 l 0` 00 0<3 1 $ 0y300u@s pT 0!0 02QX 000Ḑss` pP0; 0P*  Pt%f`Ph!!( A% WY !0_<"0;P K<    P"   P]0S  xT0S \0 0/X0 Pp0 0  Q   S  R#4sp V`P"0S T  㫁 lU @pI-t 8u xh&Cu Fu Qu Su ru u u -!u -u o&ht@u u u u u u @v v 0O-PMp00@}P }PO*( <⌛ߍ(@*.ኀ>p?PX1h?/0201 2211$R("T122IpᆜBp;p^w&[0n0d10 .0>pZ90n0C 0 0R080 h婨0 l10 B1!1pqϹ0 gPPZg0Z n 0R =+F.00 M 0 80 0YSVPMP 6P@ ?P7 4P㈽=N@P fP j@PX=P D=0X1h,=)hVP0V30 [0000z00u ǚPo㤼l㜼i 0p=P 0P 定0$Q_H 姚0 Ri0 ٶPP  0p׽ 博84'000`1Zp┧1S:P 2;  s ᾙ:0P 0@ @ Tp  pAd( P0Q819:d!*`1 j pHSP` 7   L:L@p+ L%`11`V zPpY  Y0)+0  03 d1 lp@p ?X 0S` d ۦPQ )0S@ Zo F00808"/0  ⇘  2st8"/0 y2sc!"# op= 0x垦 {P`% F 00 88@p 138},&P@  7@啢p0S T~0HX0SX|0S 0 Q  8 0 *z np0S &ABAS`p0S &BABEP q <:p|Bmt50 K S 0pD; cp7 P ,60$A>0 0T1 6T@pt- A @ o$0 T1 5T@pD- A @Gp0icp P 000I\ 呣D嬥0@00 P  w0 `40 ph0 $4    406pIA  +p⣥ H4@婡p- A @◥!R`14`11ƧP-pz!CP0!  R!瀥00!R00SRd1hv`1Z @0#0B Q01Y; -u`1 U1pW4180; X >< 490l嵤(8(ϳ1PU 0S 02P[P 0S  ՚ 0S Hڥp R080SX R   (001/0 S   0S`VbaG4峤0@0@`TBhU oQ0   ~ ԃ + X& @  @ xh&  x x -   < O @t |   d ` ք  4  ,s  ˅  E  #  t  tĆ 0 <n o&  Q/0p@-x@0Ppp@ P T0z<p@ 0 0$010| D t' /O-1bM!0Mb  [ !1 b0  0 30_bݍЍ  0  "\ ,|`  $;(0(0 +Pp0G  80G( G#pn x8_S  000 00 0 PЀ @G 0  kxP x8##[`@* `xP0 l8 40G PU P0l8  40GP9%%C C $A$0ƒ S$*0@- R P@ 0\ R^ H00"@ 800 0^ 00"@0/"""@-M D 1  Ѝt8h  0S/ -PM00 0I p 0 S 0 0 Ѝ:TT: /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/l */*/ |*/y*/v*/s*/Kp*/+/jk*/Oh*/he*/ib*/v_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: ,70t<68@9I<P?XBP^E`H`N8cQeUeY j]j`qfsismwr({w@{}@{Ċ@h ƏˏяL׏l*D0D:\G(SX@_@dlu,{,*3580?\A0O0OTTTVŐVʐ8Zΐ\Ӑaڐ8ddjp  %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s'd*(.39L@@?CF@@LRY] `ft@@l8ut@@z%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdin<ċ _$OЅXfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1sETw#Fm%c9wNcinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.BD69`hn<|AJ.O? [SV"ekqty2'%s: %s%u-%lld%llu%d%s: directory causes a cycle %s: %s: fts_readusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS/%s%s/%s ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s!4&4,4411Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"eVeee/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+LLL<LLusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found !!PXHl'Zha!Uarithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression8A3>DN#+T QIarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %s  '9CO\rO\r|EZ#' '_9^9F9<9>N?aterror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   6:>%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...%s is a shell keyword is an alias (multiline)... for: is%s is : %s is a shell function is a shell builtin is a special shell builtin : not found vtjPED[[[[>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error intv{fds{cmlr pnv b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:.[ (8mYSgirktEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpected6BJNRW\`dhmrv%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \ !&(*/4Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) @&,28>EO@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error %d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATION,P(0O(1pO(1O(8P(0P(0O(0O(0LzO(0PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad number       ! !=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unsetPlVl_af`k^phwhdy~Xcommandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp$Ю,2\;58>CpGpKQYO\O^}f@kl%n|%v<|GLԦdl|lxiH0$#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260313194102Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failed" *  0 4 8 = C H M S W  \ d  j q  v  {     option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOP#l%##<#"#$@$$%#%%,&X&% #<#8%L%%illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedtty#3#3233# @@#*:BKRY`gm t@z tC$xC}C$C@@   @!( /4;CHNTZ`g m@litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %s--'-@+@--@5-@<-@D-@M-@R-@W-@^-@f-@g, @k-@q-@z-@-@ --------,----------@-@....!.(...,4.:.B.G.N.U._.e.k.o.v.~...7,<,.%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:or******++=+J+h++++++%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=$//////////'///"//+/U/9/////%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:..........$...// ///"/'/+///9/?/C/K/O/U/Y/d/s///t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO++++, ,,,,',.,7,<,A,H,Q,Y,a,g,k,r,|,,,,,,,,,,,,,,,,,- --/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd %s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:8a9e9j9r9w9|99999899898#999999Disk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>a8h8m8w888888888888888888889 9999#9'929A9M9]9Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdD[D[[V[D[[M[[[[D# %s: N===> >>>>">(>/>=6>:>=@>===C>I>L>R>type: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u <====$=+=:=A=G=N=V=[=c=h=m=q=z=================%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. CDD%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:'@*TMP-1  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootableBP__``:`M`t`` ` a ?a [a }aaaaaaa*bObcbxbbbb b!b#b$b&b1b2b3b4b5c6b8&c9,c93c:Lc;fc<c=c@cAcBcC'dDNdEddFydGydHydJdLdMdNdOdPdQdR eS%eT.eU6eVNeWhe\reaecedeeeffgfhfifp"fqbsbtbu8fvbw>fxRfnfffffff g,gLghgggggg hh6hRhjhhhhhhhhh i,i4iAiKiRiuiiiiibbbbiiijjj1j>jPjjjzjjjjjjjkk3kHkek}kkkkk l l@l[lvlllbb mm#m8mRmrmbmmbmm nn+nNn~n%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype(rn-r3r7rn>rErJrTr^rgrnr}rrrrrrrrrrrrrrrrrrrrrssss*s:svfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY3:CCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:õ.%@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:4%No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec],H9%AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions];%@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x), %,?JxUnrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functionPb%Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:c%@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored'9M[bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGF+++!+=++U++Ogpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: ķLxhT Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*'27<@DNTX`djnyPartition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sXt%@Afp:sNo MBR in disk to convert*Qx    8 Zj,@Uk !#$&12345689 9:);C<a=y@ABCD+EAFVGVHVJlLMNOPQRST UV+WE\Oajctdefghipqstuvwx/K\ )Ee}/Gdt D%H[j}#=Mh8Pn.I %EX!QMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s@|y%@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremovedt(|%@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]c|%@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]X%@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] $% a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l.!(*,Iy %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)en_GB.UTF-8 (active)UnusedExtended MBR%d - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s Could not find index %dDetails for index %d: StartSizeunknownType: %s (%s) Attributes: None()start %*ssize index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]=\%gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed Ԝ%@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l 2l% a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eCSFU0eCHah!IdontNeedEFI (s*K>;*.|nQn- q+9E|nQn- q+T^|nQn- q+kt|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(YbBRuoqr 3Dh&"\ M}-5F@Mjy֬Wh-чHy}-чHZIчHIчHIчH2IчHL6 %?a S'@ )Ѹ *1@ )Ѹ:?1x )ѸKVST.qBHo6֯ifq%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL%@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-$%o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin(%@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeee[%+-/EXXXXXXXXifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s  linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroy_zi%fyialiasdeletetrailers-linkstrdescription-descr-description%%%k%%V%  %P%%7%%%%  %  %broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6z         @      0 @  ! arpdebugunnumberedlink0link1link2  @getifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %dG,  `@media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaopt `%) `%   % (%. D% %no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %d44x4\P 4l4tunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnela%Z%bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanifp%j@T%jDVLAN tag(ELGnpTVnnnnnnnnnXnnnnnnnnnnnnnnnZ\^`bdfhjlNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA >> >>)> 2>>>@D>I>P>W>]>@f>l>t>x>@>>getmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: mount_kernfs [-o options] /kern mount_point :@D@O@R@U@Z@c@g@l@q@x@ ~@@ @@@@getmntoptso:kernfskernfs on %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsrealpath '%s' failed"%s" is a relative path.using "%s" instead. & 2usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath uCCCCCCCCCCC CC CCC@CCC@getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead. '*? -($25GJM + Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupJJJJJK K KKKK $K+K 3K8KDKJKQK@YK\KaKkKpKsK yK@KKKKKKK H@HHHKHHH I@getmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpsrealpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s $rhw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'nPuPPPPPPPPPPP PP PPP@PPgetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}A*LZo%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).ZZZ[W[[[\\J\g\\\\\ ],]S]{]]]]'^N^n^^^usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead./+-$ '5GIUamz%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @vBwCwF wI9wLCwNPwO|wSwawbwcwewfwh xi,xk8xmFxnWxofxruxsxux -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jd݂@@@h pp pp ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880bj #'@PSVgmp] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uB*O$command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c )+S QJNunallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s &NMM*MMM/MMMCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood 5Mv(T N%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +8/& Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/ *<IO^(l$ 4 /AM`<lMy/Eckccc88-4(Edov{regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): JOSZ_fCTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %8s %s PriorityCapacityAvailUsed%-*s %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%cx421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)        ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiB@[Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEY'9,i +9,i pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4\VValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS./1%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s5}}}}}}=}}Zf}}}}}K}g}}}}}}}}}}}}}}}}J}}Tam}}r}/}W}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     #3( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. ! ! ! ! ,&! /! R,/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula:& . 6& . %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5, . . ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalid6 54 6 7 7 7 7 ,7 37 97 @7 H7 M7 U7 Z7 _7 c7 l7 w7 |7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF D2 2 2 6 82 /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug!,E E E E E E E E E E F F F F F #F 'F 0F ;F @F EF IF MF WF ]F aF iF mF sF wF F F F F   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s X% L parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errorQ Q Q $Q .Q 7Q >Q MQ TQ ZQ aQ iQ nQ vQ {Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q R /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijzp (} } 8{ w Dt  Tu w s s t h{ H y w o $v o xo D 0u u xt x Pt disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSP @~b p %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhai9258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_newh feopopndnd]8_8e@dq Y\X_XXt `uswv(ix[YUZ ZZYout of memoryIh 1h $i $i ,i ,i 0i Sh 5i @i h h Fi Ki h Ri h !h -a \i ei li ui i i ,gpt %s %s -b %llu %s*h 1h 6h 9h gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eC쬝l l SFU0eC쬭l l Hah!IdontNeedEFIl l (s*K>;l l |nQn- q+l l |nQn- q+l m |nQn- q+m m |nQn- q++m 6m |nQn- q+Dm Hm =rGy=iG}Lm Wm ;Mt?bm mm mWC 3KOOxm m yD<#*=(m m YbBRuoqrm m 3Dh&m m \ M}-m m @Mjy֬m n -чHn #n -чH8n t Ht Pt Zt jt zt t t %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_newP s s `0 @@0,LpXt @ ̾dh %s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s Vv w w w w w w %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %d failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %dSTOPPED%s: removing interfaceSTOP|  %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREdhcpcd_signal_cb%s: writestoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpairfork%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULLeloop_event_add/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SECeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_start%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init eeeeeeeeeeeeeQW\{22*e\222eeeeeeee.4jn22v282=Iy2/Ee3rw|2eee?ete"7Lasplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument> bI cP dV eZ fa gm hG iv j~ k l m nؐ o p q r s  tÌ uƚ ˚  vњ wؚ xݚ z y A B C D E F" G, H I6 J@ KG LP MX N^ Og Pt Q| S T U V W X Z 1Ǜ 4Л 6ٛ 7 | ~ }   ) ; G L S X _ g l r x ~         Μ ؜     # ) 1 6 F ϑ O [ e q    option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL$Y$YVV(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_freert_headclear0&ctx->froutes != rtsrt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deleted`W`Wrt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deletedVdVsa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULL~ ¤ Ǥ Ϥ - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s\ a f m p v protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequestdhcpcd%s-%s10.2.3%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%u%d%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK) ű ʱ α ձ ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s    %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshot%s: releasing lease of %s( 1 7 ? G x K  S BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04xdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKRELEASEFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- &&&&: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc&&VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory . I I J& J, @J2 `J8 J> JD JJ JP KV Kalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~l |v&p y         @  E"C"A"ASCIIcs_path` X  bc_base_max  bc_dim_max  bc_scale_max  bc_string_max  coll_weights_max  expr_nest_max   line_max   re_dup_max   posix2_version    posix2_c_bind   posix2_c_dev   posix2_char_term  posix2_fort_dev  posix2_fort_run  posix2_localedef  posix2_sw_dev  posix2_upe  stream_max  tzname_max  atexit_max /usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[ U U \V W W HX X Y 4Z Z |[ \[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d pi  S7gb8"u lt$$ januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDҵ;15MS7) q:e%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n20QKGC?:64*(++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQvQvQQQ,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K6Dzg Tr_I" 6A.o\vI16Dzg Tr_I" 6A.o\vI1" acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0/5J+-t}`o;n Punknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger/852array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist