08PNi'&<  'NiuP''`'&. &.Ni'&P@@<@T 08PNi'&<  'NiuP''`'&. &.Ni'&P@@<@TU Ni`'&.yANiNiNiQ$f NiNiNiRANiNiNieANiNiNifANiNiNigANiNiNiANiNiNiANiNiNiANiNiNiANiNiNimKZ%NiNiNiX`hpx$NiNiNi (08@HPX`S$=NiNiNihpxP${NiNiNicQ$NiNiNi (08@HdIANiNiNiCNiNiNiANiNiNiANiNiNim<NiNiNiPX`hpx\$NiNiNi$NiNiNi$>NiNiNi$NiNiNi$sNiNiNi$NiNiNiANiNiNim NiNiNi$NiNiNi $NiNiNiANiNiNiANiNiNiANiNiNiANiNiNi$QNiNiNi (08@HP$NiNiNi $NiNiNi$NiNiNi$NiNiNi$NiNiNi$NiNiNi$NiNiNiANiNiNiANiNiNiANiNiNiANiNiNiANiNiNiANiNiNi)Tc~\|{4 G7^0KrZ ۧ3OCxAcz$FbXwTؓzzהGA!!mP͘?VAʼC:˄=BH/f\MM!\CW&. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF@4V%4 (@@zz""z]z]n$n-n-T ,,n$n-n-NetBSDKwGPaXUYSRHffffffffffffUVS( o-9s 9r[^]UWVSZ(]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*t騄]9nUWVS(E@@9s{*s;9r[^_]UWVSW(E u S.M <(9ME @E -t/tuE;UEt E$Xl$tX o-9s 9rp"$MXED$E D$E @$Ƅ$Rn-9h9rX-4D$ D$ D$$1ɉL$W$荫B$SW(5u1ƃ5$tЃt^$k_[SWÉ(4uYƃ4t|$^<$^kt(?t<$AktЃ_[UWVSh"h"hJ.^ A&1t:P7YxOvhJ.j DCXZ3h%hJ.I^ hJ.j CjPUEU MsMU HE]قUVS1ۋC&tVP謜ZYu C&C܍e[^]USĩPh"hJ.]hJ.h"ܪD& CtsPhב"hJ.]jPUWVSE tuhޑ">URhc@5 T.¡$T. t Ph"j˫ud#~#]]ܻd#}~#Ud#~#WVSuQRPh"7YE td#~#RPh/"Y u5$T.h="X1e[^_]U5 T.`PXUjhc 5 T. t5$T.hV"j1USRj EPS" xU:t Shd"j蜪]UPEU Ph}" JtPh"&=EEEPhc5 T.} t5$T.h"j_1UWVSSuE H1ۃv>PWMZYtCݠC&uދݤC&Eh"W$ZY1tFEEPhc5 T. t5$T.h"jͩ1e[^_]USu ShΒ"j|]UVS1D&tSP蜙ZYtFSh"jFD&e[^]UWVS ]u} Sh}" } ~Sh";}1{EFE} t!v"'T1UWVS`] u~ uh"Uȹ1Rhc@5 T./E 5$T.h"j R.DPEU ЋU Шu>M9Mt65EE1EEEK>tt,uh"#81}}}}}E뺉t9Wuh"j5U9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4ŀD&5$T.hē"mR }t*}uuuuM9~VQuhؓ"jQ1ۉ]Ek]lS]EYu h"j+1}E1҉Uuĉu܋uu}}UUMMPh c5 T. u EX@1}Wue5$T.h"jEuPE4ŀD&h#"QCE rh+"X^ElU9U|S.<ES.]"rt9U}I}s}u,@)1ɉMMf>hS.h$PXZCtCPhq$P_Xj O^CtCPCPh@"P CtC"PSha"P Cts؋C4ŀD&h"wP C$Ph"^PZYuadXEw1e[^_]UEDU.]UEU.]Uh"j/Uh-"j UhD"jUhZ"jUE E EE])Uhjjjuho"oXT.\T.Uhjjjuh"go U.U.Uhjjjuh"WVXuWh"j=SbY_u Sh"jxxuSh("]hjjhD&EPDuu뺋hT.#H t uhB" PhT.WPZ_hT.t(#=t hT.t hr"2XhT.ƒtuh"<t?%t4!t$t hT. hT.h"j&xT.e[^_]UVSPT.uX$U.T.(U.,U.T.T.;T.T.rgjT.$U.T.T.(U.,U.X=50U.u4U.E $U.)EU}t 13A}uke[^]Ë(U.,U.ut T.T.UhE&h$jUUhE&h$jݝUUSË@4URs(PZYts$h$jҝS4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@u38uK ]USQ19s SVZSPEPPWƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h"jC4WPs(Xe[^_]UWVS]uVh@T.j@C4uu s(P(y8jVj?$e8؍e[^_]UWVST.}t T.T. T.T.EUEUEU}uHjT. t?11ҋ}9׋M} ytEU`U.dU.E`U.dU.ut(jRP5U.U.P Bu@u 5U.h"MuShT.Ɖ 19|8uu5U.h3"/T8t5U.h$j臛11`U.dU.utTU܉EE܋UT.T.5T.5T.RP2T.T.T.T.1ɉ `U. dU.5T.=T.9}u;9uu6E9T.u E9T.tT.T.|T.T.lT.T.9}u9utTU.t%=XU.uXU.5U.hE"-XZU.t5U.hi"jB)u}T.T.+EUEUT.T.5T. T.9uEr uM}u}tURT.)P5T.16 T.T.T. XT.\T.ut5T.5T.hT. ;T.C;T.7벍e[^_]UVSˋ |U.yQj hd#RPVuV8VSh^$A(e[^]UWVSljӃ=U.t%tPhЙ"h Vw?h PVʟ =U.wwVPhؙ"@w$w wwwwh"j@0wxwXZd=U.u[4-h"Ph"P5lU.Ph["VVhf">(=U.th"j h"j h"e>h"DXGWO_)Ӊ+G(W,ȉ=U.!=U.th"hF&hC=pU.hț"hF&hDh"zuDžF&t1jj@PEwpU.tM9މDžs,11RP,L1󋍤tM9މDžs,11RP+L1󋍜t;9މDžs11RPww2+1ƋG_RPPh֛";(=U.=U.t w>1V.V.tP5V.*E1҉V.YX1V.V.V.1UV.t*PSOV.ZtPõ5V.D1V.ZYu&UjhhY.h@J.i2 tjV.V.V.V.U.@=uUSUE V.U.V.MU.Ћ] Ӊ)~U.@[]Ã06$G&1ølbXND: 0 &    t øUWVSӃu]1W.2W.W.@ujjhW.hW.thɞ"h$<Y^W.W.W.W.`W.)W. W.1W.2W.W.@ujjhW.hW.thɞ"h$1<XZSjjhW.De[^_]UWVSƉ׀:0BtjDW.u DY.C1 mCE @W.98Y.؁}ULQM5DW.5ZYMUuX2u0?Ph$hJ.'hk"&18Y.H8Y.t $Y./t1 @W.DW. 8Y.u$Y. u DW. KF @t.t0?Ph$hJ."'h"1ttDW. !uhF_$FPY_Vu PQ#ƒ u$=p0:PVh<&hJ."h6"RuSRUǃ Uyl>!u7RZy4o0e:PVh<&hJ.n"hN"P,R+=ǃ=,Y.uWh"hJ.>" tE)؍X؍e[^_]UWVSW11 DJ.yh@J.j>^u@J.P@J.s=TY.9 XY.8Y.؁}U|WQ.ZYUu[o09Ph$hJ.!hk"&m+8Y.H8Y.$Y.tjJ j! =TY.XY. 8Y.u $Y.uΨu١XY.uDY.1ۉ߉ uW.XY.0XY.PY.uLJ.@t?@n08Phg"hJ. hr"*f%LJ.1PY.-fLJ.9t{t XY.XY.PY.މe[^_]UWVSWPY.C{ u)ÃEPY.<TRP Y^tELW.9HW.8Y.ށ}VR%-_ZuZNm07Ph$hJ.hk"&)8Y.H8Y.t1$Y.tjtjk 5LW.HW. 8Y.u $Y.uҨu١HW.5PY.ljD s} us*ExtXY.M| thr")[oELW.9~VHW.8Y.߁}WR#,ZY=LW.HW. 8Y.u$Y."%HW.25XY.NjM}t1s2PRd¡HW._YtD } )s!LW.9|X HW.8Y.؁}tVQt+ZYK5LW.HW. 8Y.u$Y.svHW.Me[^_]UWVSQ]utuh"DXZ} 9EueF95<-}hJ.hv%j^XP^w<\u7\>t.ˆUPh".ZYUtF-"" /B000CL 1e[^_]UEH!$Y.EPhht@jI x$Efv@-Efv<-U=W.uEW.E W.W.W.~9 1;X.~h%]&XUWVSX.}t~} t 9X.~[C ~KX.tIS P>ZYtF=DY.tj jvPjjjWu莇u19X.uh"%X؍e[^_]UWVSP]U u h%%XU19X.~BPSYX%KMX.uSwPux?]9tWsZu̸1e[^_]UE R.DBuh"%XPt[jX.t P&FXPPj/ƃ t9u =@Y.u5!5W. Z PY.뛃=@Y.u 5W.5W.WZYu5X.릡X.PP_XuPY.Hnt*ptlt PY.8 tK PY.̃=@Y.uu 5W.5W.Y[9X.;X.@X.=X.PRPY[1PY.Hnt*ptlt PY.8 t PY.̃=@Y.uW.W.9 RP>_ZBPY.Z=W.1Hnt@pt)lt1 PY.8 YWiSP+ h PY.뻃X.PP[^CPY. Znt1ptlt"PY.: PY.ăX.PP6ZYW.U=W.Uƅ=W.Uu h"W.;X.W.=W.9|9}h"pu PY.PY.Hnult PY.8 tσʃ=@Y.uPS?X.PP]^_PY. Znt-ptltPY.: t\PY.ȃX.PPY[PY. Znt>pt)lt/PY.: ^P5W.5W.1 PY.뷃1=W.\Pnt,ptltPY.8 tPY.σ1=W.u7uD-W.=W.H0V PY.wr 8 t ك=S<[t<\t.RfZÅu!h $ { uh"*[1C뵉) [.9=[.8Y.Ё}UtVW%ZYUu[KB0 Ph$hJ.hk"&8Y.H8Y.t$Y.tj\jg5 [.[. 8Y.u $Y.uΨu١[.5PY.ljPY.=DY.tj jRP9e[^_]USPY.< u h" XH< u=[.u$h3"XJ PY.R8tڀ u ӡ[.PKXu1[.t=W.u PX9j[.Yu(@0y Ph$hJ.hk"&eK1҉W.50Y.S5[.C(¡[. t+h'hY.PRp25[.1[.R]UWVSVPY.PPY.M1ۀx%u8HuzPY.=$[.h¡"[s9}ePY.PPY.$[.PY. \PPY.$[.2<  [.PY.M8 u$[.8Y.ف}|WRpZY= [.$[. 8Y.T$Y.tj0R Ph$hJ.\hk"&>8Y.H8Y.j$Y.U5 [.$[. 8Y.u$Y.[.$[.$[.e[^_]UVSVu] 1PY. u 1ۉ[.UPY. Uu 1q8u@PY.JπwE=1ɉj hPY.5PY.J[ v=8"uh"'1Zgu@PY.됸e[^]UWVS 5$[.][.=[.}+$[.;[._&M 9}y;M)9 ڋEE8Y.}RUuZYUu]<0bPh$hJ.lhk"&N8Y.H8Y.t %$Y.tj%tj[.[. 8Y.U$Y.uΨDϋ [.M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEW8Y.}RUuZYU[.[. 8Y.u$Y.t [.M9u}EMELE B19uu)d9|T8Y.ځ}tVuZY65[.[. 8Y.u$Y.ad[.Cw9|T8Y.ځ}tVuZY5[.[. 8Y.u$Y.[.؍e[^_]UWVS] SZ=DY.tj jsPӸCjPjuOXt 1E1 [.}t9U3 98Y.ށ}V5[.5Y_u[^90Ph$hJ.hk"&8Y.H8Y.i$Y.tjQjz5[.[. 8Y.u $Y.uΨuك=DY.tjj ] [.NjEpSP  9~U8Y.΁}V5[. _Z5[.[. 8Y.u$Y.=DY.tjj S舶 [.Nj󤋅  ?u9Ћ)ȉË ؍x[.9<t ttjPju}Uo8Y.=}tV5[.ZY5[.[. 8Y.u$Y.~2 u)u thG"HXDžS=DY.tjj S, [.Nj󤋅 [.f Qe[^_]UWVSX.W.HX.1ۉ]1W.+W.9UX.@X.P藯uu PuƃUX.PP[Z[.3E8Y.1SȰYu' 8Y.$Y.tjtsjX.t PFZPPjƃ t9]u 8Y.u $Y.uuEX.GX.E  Euh"XE tu RR x1e[^_]UWVSX.EX.E=L-t =H-uhb"FZo=([.t e[^_])e[^_]UPEEjEP54[.  Uz/h"Ph"hJ.ijUWVSf@8uVu1Q01҉hW3à {08#)tSWV e[^_]UWVS} 54[.fDž<Y01҉uJhPjS u/8/8thB$-ÍjjP, @u/8thϤ"j0f8utSVW yn/8#Qh%)AjWjyfDž=8[.t fDž9DžjRj fDž9fDž94[.jSVO @u.8tfu ftR.@ufDž=8[.uK"4[.@uσfDžftv@u KfDžMe[^_]UWVSQ}u VWe[ZÅuzjjXZu h "j//;s jEPW]Kƃ ?tE8thh"j.-8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19}9xu90u,]9Xu]9XtyB݋EEEE19}9xu90uU9P uU9PtGA,Ck,QMuHZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPGY_}ËBt1Uj,L$qUWSQ-`[.v=@[.ڞv]=H[.]5T[.5P[.hե"j5\[.5X[.h"j 5d[.5`[.h"jt5t[.5p[.h"j\ 5D[.5@[.h3"jA5L[.5H[.hI"j)E$h_"jEPP$hx"j =x[.tJ=u@[.1 ujeY[_]aÃ=x[.tUE PujB UWVS}u _Ph"j}3b[.B9tT[.e[^_]UWVS$ ]5[.t(Vj$V讛0Y^ugh" j0Pu N& yWp4$g0ZtWVP8 u WhΦ"O5M&jj0։( y0h" jju ։ƃ A Wh VN&ƒ jjWN&‰ V N&h _Xuh"j[^jh h R(N&y RY߉RZ=t*w=bt%1=bt" =tu h>"11 Њ Јt u hJ"jYu Vƅ/ t jZV8 jZVP fjjP% [.2tS SQPR(c%,9kP(Ɖ4W8t t10hb"j_ ^9s1BFu h"j/ 1e[^_]UWVS\]ƍ}ZE5 N&(,%%048EPSUe[^_]UWVSĀ]p$tV9V/9Y^㋃p tVf9V9XZ㍅xP1RPuut5-9ΉЋt}"Q75-VPh"1e[^_]UWVS] }AƉI1RPuurt C|WjVȃRP<tCuPhħ"j^71RPuuͻ‹N tvkk ыEe[^_]UWVSTERELIu EEE EE؉1 t1҉Ƌ] ڋUӉe ƉߋEE$EȋEt\EU 1 t1҉E܉UEU}9}}}sE܋UẺU1}}t 9u9uEUẺUF uuuE,P# E =[.E ‹EJu EDEO1 t1M ϋEe ʋ}t}\SQE,#h #5[.Ãt#EhSjPVHt h"^S0Y`[.d[.E0P[.T[.E<1҉UEt E\]̋u)։]uEEIu E E1 t1WVuu9E #E1҉ t1EUWVRP躹9E EEEEuűE,|"Eԃ Et8"EL0wEԋPatELhaRuuPh"3CPEԃP2‹EԋXX9t"ERQuuPh<"j)E؉EEEE̋UЃE܉U1ɉMMMċEE}$tWW}9t }O]K}9:t ] [}19]9Muu܋E,!EujP1Eă1EEËEt@d9s+tNjuE‹Euu}OEJUEMQRPuEPE]tXpXjuL5XZ9u9]EE@]k,Pu ËEY^k,tԋUEVFF E܋UFVEEtP4@0P,@(FVEƒEt@P@ltȉF Ek,Dԋup(ut H}P$]GVEXE`1 t1u}tE]9tE}?Et\]̋u)։]uE‹EyJu EE1 t1WVuu蛵Puuh"jEtP @@1ҍMQRPuEPE0ju231ۋE;pEE9shI9uEtpp Euu܋E,ujP-EċE1 t1u}C놨u  EE]k,PulXZu E}ȉ81EEE9k,]Kt[ 1ۉX]]u LL\HX M܋]HX]]tK0[4K([,HX]KH B9EutC E@ b]k,D$uu܋E,{ujP`,EċEk,Z(EiB$ t1EUFЋ]EEt  E}U}ԄtOO9M}1ۄt_9]u 9MGEt\ű})׋E?E9Iu EvEEÉ1 t1RPWVSPuuSh|"jE]ȉKEԋP9Ut,E:uRuuPh"jNE}8E}ȉ8}u}up[.t[.EE܋UẺUQEe[^_]UWVSuEPG1F VM]_9EEr )ӉM؉]܋Fƒu]uFt 11ENjE9sPu h"jpN͉1+MF@UtR UR)M]E9s )E]1]9؋]sU܋EЋEÍEeM1SQRP谵FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RWc}EEPhEN&ƒyERPh"j+xhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QYRPh/"1ɉM؉M܉<EPURvSOE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]P<E1Em}@[.@[.H[.H[.EЋUX[.\[.ẺEMEPhN&ǃ yNTQWPh@"0FPhN&ǃ yN"QWPhf"j>1eY[^_]aÍL$qUWVSQ9q[.[.,[.[.?1|[.[.1[.[.1h"VW ta#DtNJC7[.뷃b$DM&[.[.Cx[.C[.u57"[.e57i[.R57[.@[./57|[.[.57[.X7[.hJ.h"GYXpC.)lj80hJ.h"XZ=[.x8th"5[.t hQ"j5tjj)h "h+jj [_@u h"jj h "hj00h"@P@ uh"t|j/SZYÅu@#j@[.׉hjhjj`$8[.P[.1urh "jIjL[.؉8hDj803PtP3h("jW5[.HOG9=[.=[.tf95[.~W[.4!F_烽(ta1ۉ(,,9[. |[.d=[.tjv[.xrP[.0j[.dh1҉ldPh [.N&à t$8: ha"j1 1ۃ=[.*;,[.,@XRjPjj(($tLPhI"DXP 28rt)rz rz04z('JJ 04zh P&UP[.T[.f8ZY9tFS‰Yt"Ph^"j jPh"9 Phw"jz ‰Ju tH‰R840Ph"1 tH89s`u[1 t1+049Ɖы0|9Ɖ4}LV 9Ɖ4|9ء[.40[.<0X108014߭0ݝ0y11WVRPɫ߭ N&ܝ0W=[.pݝta\P%VI ݅y؉RPh"M\`+EU5[.9Ɖ# >jVZY@݅u؉Ph̫"j[.ܝp N&ܝ0 YLRjP011RPJ$01tZL9rKjQ#^X090Q_|OlaGl막9skQ k4 JHJZH XH J HPW4 |0u|0tGlDhjP88xuxuDPh"Y[, 1҉D<5[.[.8Hȉ9r09rÉ014840Ph"840Ph"j04 41119q09Ћ4N8JZ8<<u 8^9 +4i۷m۶R<8SPh_"DPh[.SW(~JFD\`HP\Ph[.W\DH[, X049Ѹ4}u01480Ph"1ۉ8Y98r;D\`j\Ph[.W\D𙋍09ΉЋ4}88SKut+4i۷m۶QRSPhɬ"kDPh[.SW$~FJ,TY8$D8t[.11҉VPh"B98~k,D$Aۉ<014߭0߭@[.@[.H[.H[.X[.\[.1XT011198t)k,ȋ0I9Hu0;0Putvt_|TRXR81RP؃RP10P @ 9|0,PQpQRPjW'k,Љ1;P}0PTQXQ8)Q t p룋Tșڋቅ}؋ቅ  =[.t 1P[.k,80$98p09~Љt$DPSh"pPhN&ÃQSPh'"j #tV:t&PhL"j,.gPh^"j,G$)08<11ۅt;k  袋9.}*WV h*"j,fk,V菳4Z1ɉ03PHD hP"j ,蒻_k,4 1󫋵 2zrz ,t<@PtȉB DH9v@l¹9} t8Phj"4<@8tGpBu訯E[.-Xe[^_]ÍL$qUQ [.[.5[.5-N&EM MuQQ$RPh"1MɍaUS]CtS P S tSPSCr s ZS [.X]USEPsH) [.[. [.H1҅u0[.Z[9t [.u[.u h%"jX4CXtYZ@]UWVSu EEE#-[.[. [.M11ɅtJA9~ʳ9M}#t[.h9"hM&hhH"}9x4u }9x(u9p$t버t[.e[^_]UWVS]uuu SO trNj@thj"hM&h1GGWX9w(~6Gth"hM&hhH"wVw G [^WY[.-;[.X=[.u =[.uBGWu[.GWtP[.WGtG4WPZWX[.j@j4Vj*G _4E UG$W(G,W0wE #-G8[.tz8GC GtWP { _ Ge[^_]USEM Puh"hM&h4hH"P ʉPHPPP s E]XPs2H [.[.[.1ɉH [.H[..1ۉXt [.H[. [.H[.P4JH8[.9t!tXYX tAP]UWVSUu }uWVRcËECUt[.R[.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQN& RPWVQN&e[^_]US]C%CSjSZ1]UE UMQ1]Uj蟄UU P \.PYtHJ \.@ \.UWVS] \.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdĨC趨${s袨 ]e[^_]鐨UWVS uE EEEE% \.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRPV_YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jlxËEEC1CC]C'^C :f1C C$hj1xEhj"xM쉁jhjxMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jREEpduSۛIE싀}@u jR]^_}E UG(W,}x0xdEtFVtRP~]YY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u\.EE % \.S0tK0J4 \. \.C4 l.C(tS(P, l.C, l.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hM&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hM&h)h"@륋B 뵋EEPJtEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"L}t/EEtP1uuRPh"]9]tSuuuh"uuk} WY[9t$PRuuhO"̨uq1҉U u_XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPje؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"֥C(S,C S$]9UrSPWVh"訥nWVh "蔥 Z}t5EtC(S,C S$9Uu9EtPuh0"T EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPfEuuWVf9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV.f9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi"ۢ.uH‰?9u*_YӉ9u9u :9r 9r}thz" {hJ.薙ZYtFpVtFHuRPuWEU}t h"XXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"象$l./t `d)RPh"z tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jHiE1ɉHEMAYA1ZA XZ1ۉY Y$XZ}th4jiËE쉃\XZu u =-ƉE} t h"X-EPjh WVuh4jhËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4jgEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"i~X@Et} t#h"J~Xu uuS9u u見X S蝋X]tS舋_13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhySXZ؍e[^_]UE Puj- UWVS]FHE1RPuu _t C|}WjuȃRPVetPu h"\ u~ 1RPuu ^tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuo^€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh׶" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuRt C|}WjuȃRPV~tPuh"u Ep 1RPuu7Qtփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSX$l.t C0S4C(jj\0uu Se[^_]UVSUE 9| 19[^]US^PPhF"hJ.QjhJ.h}"u-CtsPh T#hJ.jj\USSE] t$uhaq#s豨ZY¸tr1EEPhvd5Dp.v @u35@p.hU#jW]UWVSPu }t}~^h2#S>Y_DžtFhpQ#S+_Zt)hF_$SZYth"S [_t뫿}}uh\y$vڧZYuUEPhud5Dp.襕 @u65@p.hU#j膷e[^_]US}tQ,Shzd@5Dp.W @u5@p.h"j:bjTtDžd1ۉhlp`dPhwd5Dp.袎 @u5@p.hM"9tXl%NjX󥋽`8X K`t!Tj iYTujj'hp`hjvmT_Zt̋`1X\11t(X\H X+HXߋWV\X5@p.hӺ"S]hxd 5Dp.菍¡@p. BuP$Ph"%]Y[``pp pp5@p.h"\`px`@`9q j RP5Dp.ы@p.Au@uWVRh7"JWVRhL"\hT5Dp.R=th"hf %bXhJ.zZT` e[^_]UWVS] }t9hs4P v jh^"j sEP vjh"jݭ蹬10j Ps?Ɖ׃ 8t sh"胬8"u:9shл"ryh"g41ɉj Ps r 8t s h"=8"u!Ѓu h"juĉ}ȉM̉UЍ$Vhyd5Dp. @u35@p.hU#jجVh6"ZXZe[^_]UWVSlj֋ 1҉-tUPQM諜ZYtUBMQh"jOjhh@l.-s 5@p.ZDp.@u5@p.h$j=@p.@l.VWS5Dp.XQ e[^_]U05@p.hU#jUSS}tE Xhb#SZYthۼ"SZYuEEPhwd5Dp.谉 @uE ]UQ}tqEPhd@5Dp.z @uE O5@p.hP"YXZUS ..t .ȉ[]UWVSu.uӍ.u'B%zBB?R+B%zBB?zzJ}  ;u9tHk?9[^_]1.x@uUWVS։ˋ=. .11~B? ыE[^_]U.?.jh>RPF=vu.UWVSQ5.At t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$R.1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉M..ÉEE1RPWVpEE)Ɖ1UQh%SVXZ}Ut.H9u.H99stBRWh"V e[^_]U塨-=.tvPh""U5ĕ.5.5̕.5ȕ.5Е.h+"U 5.5.5.5.5.hT"U5.h{"U Ph"Uh" \ȕ.̕.5-5ĕ.5.QRP5Е.h"CU,h"[..5.5.QRP5.h2"U 5.5.h"T UWVSQƉ֥1ۉjEPVO >u#ËE8u誥8"u w܉1e[^_]USPܔ$d#Phd#Phd#Phd#PSh¾"hJ.W,jyJUWVS ÉM衔-uhU"5- hk"j.׉ljEU}jؙ#E#URPQMBuAtV--=PuRJ 3P5t.RI 9-uNE!5t.}e[^_]UWVSEUσ}u "}t"EU@uSh"荼XZff=Ut+=\.t fuuSh"7ff=u%Sth"7fLJ_f=Ut1=dp.u Sh"p7Y^dp.tSh7"H7XZj(VP@ x0XŃ~X .t\fLJᵃVe[^_]UWVS9.u.5.e1Xƃ.e[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEa"E$EtEu"11}=-E..U1҉U܉E1ɉMĹEEUԉӋERPSQ@PE؋UEUuuRP?RPuuЋE؋UEUuuRP?RPE؋UEUuuRP?RPuhi"P,"uuuuuuuh"P h@J.jdh.5 u h"jwh#h.SY[.]슀.< <$u { Ћ R.DQu<-"j EPh.E4Ɖ׋]h7?&SǭE؃}Ph"Sı tuh#S诱 t I =-Ήʋ .1WQRPc>Ɖuh"SO u` .ω%.ƉuuEt5.1Et 5.Et +5.Et +5.EÉ]h#SQYZ؉E8 t,h.&Zƀ.uh.h"N 59uE|E9Ɖ]}.uuuuWVh"xNuЋ}u}e[^_]g_USE Pu5h"8NDJ.HDJ. yh@J.nY@J.P@J.؃ t7@t( DJ.y h@J.mZ@J.P@J.h"j1Y]UWVS M -u h"j豟Ɖ׋-ؙljEU}ؙ#E#UƉjRPQ}Bu @u--uhuPBB mR5t.PpC 9-uUjWV5-f}Bu@tt.KE!ÍNju5-R5-A 9-ue[^_]UWVSRá.u ƀA Mz΍. S}8PR: . e[^_]UWVSEыEU u1#ˀ Ɖ+5.u}};=.}=.&"EUEUE9 ..}=.Euy.KlE9t 5.tމnʅu+.9UE}M1E܋E9E܋U}t+}t}u w{ƆoK"v"ȃ[^_]UWVS EӋEEh.@Ph.E 5.t h"jE9E|E9u|.] }) VRP85.31fǂU }u@.5.֋M)}CsKSCPKSs FS.Ee[^_]UWVSEU} u }7M] M]9 .ĕ..19UtWtN}1E9ϋE}79}E }&"=.}u1BuEP.]Ã}!؉˃u=.u =.t=.Y}t. }mhj1X.[^u hN"j謚fǀUE.EU ..EU ...t_}t E .Hu.=.hk"YS".=.;..EEU EUEUMxa] .tEV1;uE |9EE}=.}tEt뚃}.E 9.u;]t~.H.1+]9~ Fu%uF PPR15 . *.1RPEU .+E.XZEU ..EU ..>"" -""e[^_]UWVSË@SuHt+5.=ĕ.9u9t h"*Y^sǹ󥉍1󫍍@u({u "{t"Ph"XZߋe[^_]Ã=|.u x t!1UWVS|Éסԕ.tPKYYj/SLZ^ZuS5-h%hԕ.rK Sp ԕ.Yԕ.u hN"j5jP;XZy5ԕ.h$(^XxPSmZY@tϋuи 9E} 5ԕ.h"V 5ԕ.h"Ah ht.S: 9t5ԕ.h$読Y^4f=v.Ut5ԕ.h'")S;ZS;Xtj6:e[^_]UWVSát.u1ҸrV$t.f=.uf=\v.ut#t..t.\v.f.fޗ.U.1tޗ.[^_]UWVS á.fE򡴕....11t;f}t.E .16t.t9r $uf:t@9Ezti 9tܻՋ p.t.u$f}u=q.ׅu q.4=.t u)h9"/'Y t.uh9"h^%CBXZ=t.t]f=\v.u1v.Ѕԕ.=.tPhn"&_XPh"ZYt 1=t. =t.uL%t%1gt.tp1v.҅tSP5ԕ.h"a&=.t!1f=.u1 1v.q."5ԕ.hK"ZYu rV$ve[^_]UWVS ˃uu Dž" Dž"@uhh")ZYߍ1jh"S t 1/9Cu苅9Cus PjB ;Cuă=.t.{ t(s$s sh"-@e[^_]UVSPE-;-u*=\.u!URhmdP1.f}Ut24"J "Phd#Sh1":EPh{":~uhd#Sh": =.x@9uHh;&jjPR}QRh"hd#Sh"!:(R$NZ)uhd#Sh"9 6)uhd#Sh"9 ƒ< h=.[`p.Mhd#h"9 @ tShd#h3"9WVC$u`p.vj!lDXUhN"j "CQhd#Sh1"}8RhY"k8=.xx4"붍e[^_]UWVS=.ujjju u.B=.t+5. $ֿd#uVWh;"7 PVWhK"7VWhZ"7 EU RPVWhk"7PVWh"7$%PVWh"Z7PVWh"F7 ?PVWh"-7%PVWh"7 PVWh"6?PVWh"6 e[^_]UWVShEUȉM]t'BuUE$1ɉM$1uuuuE.E̋EȉEE d#1҉UUE.fE9.~5 .EE̋E,EUE$1}$&E$1ɉM$1uuuuE=.u(}t"uPh"5uuUEtuS&}t.Efu ukE }PEP諔 Ex.}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u.E1E EU EU}}E̋@ E1E}.ĕ.+EU EUE}5.=..E.1҉EUġ.19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡 ..)9E]| h"u}ĉu} 1E} lj}.1҉EUE9EE |K} u}t?1@.t&.19M} |.9M} |1EEUEU U.t4.1ۉΉ.9u} }9M} |1}E}u.9EE ĕ.|=.uh:"o9^1>E.E }uEEjhjjjщ¸H"E .EuE1ۉ]]]] }t# ..EU...ĕ.EU11ҹuuRPQUM %FEU+EU ;E}EE}]u)։]u}tq=..E9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령.19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu hN"}u}tEEM9Ɖ}uM..1RPuuҋMu 9tۃ}u E9uWVjjRU:L$EUEPuhm"hv"=0h@J.jdh.u h"j5h.kpYvEHƀ.t'. t9EEHPh.h"/ uh.EPE EUĉEU EE}tjuuu uUEKjuuu uUE.tuk=.t Ph$jSPouN}tjuuu uUEjuuu uUEYt Ph$j}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE .. .;] u1;MtuuEU G_Z .UׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }PRC 2=.t h" YuEft=.|=.h"Z\E̊@EȋE̊XEȍE@‰.p1WVjjj" E1ɡ.p1WVjjj2"Ã(Uȃ?1ɋ5.1WVjjjA"}̊MO_U? ˆWGEȊ_EȍG‰.p1WVjjjR"xE(1ɡ.p1WVjjjb"QËUȃ?1ɋ5.1WVjjjn"-}̊MO_U? ˆW(}t/=..t Kx .u}ˍe[^_]UVSá.u h|"1X1ۃ=.u Sho#R+Y^jjڸ.CXZu҃=.u=.th"1X1L=.th"u Sh"*Y^ .RP1҉XZ=.tC.9.A=.~h"*5.j5.5.RP믅<f=.t3h"0^h"@*[q.t=hͰ#,*r.Y=uh""k Ph")XZ hv")XhX%y0X=.nPh#")Y[=..PPh?") j=l.t>u Sha")XZ9.} hz" 0X;_ .RP1҉u Sh"K)Y^jjڸ.XZe[^]ËUxPh"hJ.,j>UWVSĀ|xtH.wSh@"hJ.o,jS{4EZuhX"+xƉjRP| Y9u9thj"f@jSu| 9t"xthu"h"/@Xjz1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4@V&h"'.fEEE . .19E~[tP9}u1M;u&}_PaR.4@V&h"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaR.4@V&h "& }9sf}wfE@f.u4@V&h<"\&Y[|}tFaP4@V&hh":& ttt111E}.}....fš.E]9]E@ƒt<u.E}tхtu|EZE]9]uu9XEe[^_] J.yUhJ.j ?+XZáJ.PJ. UEU 19s f3P]UERPZYUSBHBy;B| X RQ*XZ]UWVSQ]u uh'"SQ(F fw4W&h"Ph."S*( FPjh8"S(FPjhD"S( Shh%&*uXZFXt ShQ"uY_FXt Sh\"uXZFXt Sha"tY_Sj v(hj"S'v,h|"S' v0h"S'v8h"Sy'v4h"Sk'$vUM X&t 9t@]UoPh"hJ.y#jUWVS EEu EE}]EEE1҉7pC.h"VuO t4ouBjWh@X&57u h"jqPnY붋pC.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh%d,@uLot"t"o0 :Z"t"PSh"jpjUVS]u VSyYZu Sh|"jp;/t"Sh" XZu E"e[^]e[^]UmPh"hJ.!j-UVSPhpQ#P![^t,PjPuVBV@t jPZYS%<Xe[^]UWVS EEu EE}]EEE1҉.2&1ɉ ..h"VuM NtJb$Y&1=..ě...뗡7.jWh@Z&579u h"joPYYț.JpC.4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP~IXZt1h;$9}P%^ZY uċ2jWSh7%;@uLlt"t"{l06^"t"PSh"jimt@t.Z=.HDž"=.tDž".t 83$P=ț.t ,%=ě.t "=.t $1ۉXPjh"hq&jlSh"h'"V u h "jlj/G PN/ZYt|#'.Sh"h?"Vb tj/C P/ZYt|-X1e[^_]UVS]u VSYZu Sh|"jk;/t"Sh"YXZu E"e[^]Be[^]UhPhW"hJ.j@}UWVS]E1҉ 11ɉtp1h"u uI athg$[&57ECpXDžp57CtX57=CxXDžt뀃K|wK|njuh[&57u h"jjPz_:pC.P;UtM |u4uWEp ЋttKxPWCZY@u Wh$jG,jptECpNtECttt E%Cxe[^_]UWVS SVpPtWu u1hWpSh"|,@uSVh"jGir@t@1RPh[&hSSh" (j3 USP]jEPSuU :9uySu h"jh]US]S[Zt@ h=5#SZY]US]S- Zt@ hA%SsZY]USP]jEPSU 9t :uy Sh"jWh]UVS]u VS@YZu Sh|"jXh;/t"Sh"XZu E"e[^]e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RPY^CSt RPY^CS e[^]UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]UWVSEUˋuE $EE tH$HD11E ~E}ufCRVڋE E lWVڋE E }t}t#RPw_Y`}tDɉ"%XZ"t9t h\"$X9}+uh"$^_ދ9|<t h"$Yh5.h"{Džx ;rh"%$XZu8u t h9"X 11  ˆK1<1P1HL@DK@#_tM⋅9t Phl"#Y^Ht2{{ @D0{{@D}"Zt⋅9t Ph"Z"_XzG1t{${Q!^t&XZ$t CpStCH\Ɖ)ULƒu 1Ҋ t1҉RPp@ȋ+tC@SDC,M)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t Ph".^_@ tFC8S8tGpBu Ex.-Xe[^_]ÍL$qUQ p.l.5h.5-N&EM MuQQ$RPh";MɍaUS]CtS P S tSPSCr s  ZS t.X]USEPsH) `.d. X.H1҅u0|.Z[9t .u.u h%"j1X4CXtYZ@]UWVSu EEE#-x.h. t.M11ɅtJA9~ʳ9M}#th.h9"hc&hhH")}9x4u }9x(u9p$t버th.e[^_]UWVS]uuu SO trNj@thj"hc&h1GGWX9w(~6Gth"hc&hhH" )wVw *G [^WYX.-;t.X=.u =.uBGWu.GWtP.WGtG4WPZWXt.j@j>Vj4G _4E UG$W(G,W0wE #-G8x.tz8GC GtWP { _ Ge[^_]USEM Puh"hc&h4hH"'P ʉPHPPP s E]XPs2H `.d.X.1ɉH .H..1ۉXt .H. .H.P4JH8x.9t!tXYX tAP]UWVSUu }uWVRcËECUtp.Rl.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQd& RPWVQd&e[^_]US]C%CSjSZ1]UE UMQ1]UjUU P.PYtHJ .@ .UWVS] .C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${s ]e[^_] UWVS uE EEEE%.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP`YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jvËEEC1CC}CC 0!1C C$hj;Ehj,M쉁jhjMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE Epd u S IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRP舢YY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u.EE %.S0tK0J4..C4.C(tS(P,.C,.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hc&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hc&h)h"@륋B 뵋EEPTEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"/}t/EEtP1uuRPh"]9]tSuuuh"uu } WY[9t$PRuuhO"u{ 1҉U ui XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRP e؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"nWVh "w Z}t5EtC(S,C S$9Uu9EtPuh0"7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRP蜫EuuWV艫9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV89Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi".uH‰?9u*_YӉ9u9u :9r 9r}thz"hJ.ZYtFpVtFHuRPuWEU}t h"bXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"İ./t `d)RPh"] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jRE1ɉHEMAA'A N1ۉY Y$XZ}th4jËE쉃\XZu u =-ƉE} t h"X-EPjh WVuh4j蟭ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4jͬEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"sX@Et} t#h"TXu uuS9u u X S X]tS _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWh4SXZ؍e[^_]UE Puj- UWVS]FHE1RPuu Ȥt C|}WjuȃRPVetPu h"\ u~ 1RPuu (tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuy€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh׶" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuޗt C|}WjuȃRPV~tPuh"u Ep 1RPuuAtփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXİ.t C0S4C(jj\0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RP€Y_}ÊtBRtUWRP藀Y_}ËBht1UWVSӋEU ΃tt RPVY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRP˖ e[^]UVSuE H$X(1y9)tNp1SQRPt e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDž Ep 19}5uWSh"莨 EzBD1H)CNjE_dE@ EDžpđ-pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G``E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hd&h("jHEÃd$S\DpTtt RP$|Y[B^UEMhSQEjXZSbdtuu{Y[EUEUDpTtM]19 }9Erp@dxÉ1 t1RPuuڈ1E URjW1RPVEEtH`Xd EH@E_Ή)׋EzEtIu EEu1 t1RPWV.1RPh"E‹EE@ EEEJEtp`xd @@ƉEӋE‹E"EE.E؋EE)߉ЊM1ҊM t1RPWVw]K!E؉wEtp`xd @@ƉEӋEB‹EE܋EcE)߉1ҊM t1RPWV1uk]ӃK 1;{E@ r EFE@4uPEBHEMQjPjjRqt Ph"k[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋E1MIdQ}u}u E M̉H}tZCr{<uX.C`.d.C@CC sh'"hd&hCh"2jS1[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋENUr,z0 t1EtpHxLp4İ.6AM̃HEEЋE1RPuuMtƉ׋EƃEۋMtEPjuރWVQtPuh" EEЃE̋]s E1RPuur€}trzuЉ}#Evkk BEEԋEMq,y0 t1}trzrC4SPZ}u }u1dE ]Ћu)։]ЉuԋE‹EJu EjEu1 t1WVuurEЉUԋ}ЋEFHEËE1EURjS1SQV]tPE1RPh"PEf‹Mq EJu P! 1k}t)؉}u"}uA1 rEF1ۋA r EFA4QPX؍e[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVoFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh@"hd&hhe"HMЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuha"hd&hh"GuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQnӋEE}tEEPjuȉERPu"tOPQh" EE@ EEH1ۋEtGW SQRPl*EEG1SQRPl}vkk ]Gju蕦hDuVuhDuVuy(hmFuVuehFuVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jLrƉ<WqFYZuWhx"1= .PE fF81FFC0PhZ"V/tPMX}!uhzd@u  @RhedAu  @uuhi"j4}1󫍅Pu6^_@4ȋ9!9t(Ћ}1ۉ1E1ɉ [Eƀ*Pkj PEP1e[^_]UVS4]jhPjS&YtO[]hhB"Pƃa+#lao1ɋu1҉ijh$P  cj2WVv2 9uE1ɋtWuhG"V PPh"V'uPKZ;v.Phh"VaPWh"V@Aƃaa9tRPPh"RVƃagZ#a^u 1ɉ]uh#"KVhVXW uVh"U ^"j2P 2 9~#1ɋKthP"Y#Zt1CZ9{~`1ɋtWh"oVhP|V uVWh""T j2P6G2 X#_tuhn"TZY1ɋTt h"a]PPPPh"V\\\\\]t h"]e&t8tp SPà Rh"%iXy޿؍e[^_]UWVS]CjPj~ _Z1uhd&h:"[^F9~?{jW2~ ZYu Vhd&hW":19~DBhpQ#u ?rY_uu hd&hw"| z"‰WWTZt uƄsh"hPzlsh"hPal #R$RW DžuƋSS9VhQR u RWh"CPPPPh\%Q&GtRWh;"Q ; ȋC AEV_4V ^19s~4蝀 FY莀 Z1e[^_]USRÍEPjhjjj jS艆U tShZ"Rj]US赻Phj"hJ.oSh"hJ.oSh"hJ.o$Sh"hJ.toSh"hJ.doSh@"hJ.To$Shc"hJ.AoSh"hJ.1oSh"hJ.!o$Sh"hJ.oSh"hJ.nSh#hJ.n$Sh#hJ.nShH#hJ.nSh_#hJ.n$Shv#hJ.nSh#hJ.nSh#hJ.n$Sh#hJ.unSh#hJ.enSh#hJ.Un$Sh#hJ.BnSh8#hJ.2nj`USRhPP u Sh$j臼]Uuu u衚 @uuhO#j臼UWVS(`؟ԟha#Rh*rPEܟП119П~7̟hW؟J ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟ު ̟u ПԟEܟF`벅u؟ht#j@e[^_]UWVSlj։1EEjhД%Q t(jh#S tjhaq#S u Ejh#S uEjhb#Sj t}~Eh#EPhrWh#EPhrW =.t=#}t#PVh# h }uE4Lh&Vh#g e[^_]UWVSÉ`dhPzlb1󫋅dhx|h#VhrS`h!#mg|xh:#Kg0tplhq#,g#u#RPh#gh#fDRPh#f0Ph #fXZ#4t#Ph3#f84Lh&hF#ufWUWVSӊ u@ ttg tbp\uPuhJ.h#虱XZPd[vPh$q#P臚 S+Yt@uPh#hJp pS!PZvPh#P Sj:$X=T.u 1=<.썅P茘^vPhx#P诙 h#h#h#h8#hX#ho#h#h#h#h #h1#hQ#h9#hs#h#h#h#h#h#hJ.9[PP[vPh #P  EP"Y=T.uH 4.f=P.u ?TS"Zu|P1p$&_)9s*,$*$^DžV[tF"k4$a YuhJ.h+#XZuP!_tMShA#hJ.Y Shړ%hPT|0h>#`d[릃=T.u1H 4.r|Xu=P.u*?tۍ_hX%S×ZYthS#S貗ZYt|ƄG|=~'hWPhW#hJ.XnhGPS dd!u [XhĐjVakx1ҿ1ɉlx9sUHh9ߋlhsߋhlX 9s1ۀx  1ۀx  롋ыP.t ~CL AQw Q1Dpk`9pk<t=P.tw7Shs#hJ.VCG t GG \hJ.wģYXt G^G `Njx9rhJ.j B;XZG\P 9sX XBtt9+믃9r s|(_hJ.j :Y[VHf gP聒ZvPh$P褓 uhJ.hy#Ph$P$_vPhp#P^vPh$P( dP̑[vPh|#P 0=P.thJ.h#XZ1ɉ P.hhJ.h#ߡ_XP.LPU^ v Ph#Px j[ PYvPh#P7 u|E3PڐZvPh#P uB=T.thJ.h#^_1T.{hJ.h#Y[T._Ph#hJ.SAhhp#P e[^_]U=@.iu=T.t jh ."&h#]ZujEUSh&#h`.4`.XZth+#h`.8UYXth3#h`."UXZth;#h`. UYXthD#h`.TXZa.]UWVSu }1ۃ=-ÍF 4.s==P.tM#}u-#hJ.P蕟XZuWVhR#hJ.LR؍e[^_]UWVSl]u }1=-EF 4.r=T.Sh\#hJ.QKuu=@.iu =P.=-u(WVhq#jd]SL}u WVSN VWV YXt%RU!PS8 MUufJ"uWVSu"Ã}uPK_XfKEe[^_]US1ۃ=-ËE H 4.s(un ZtfPfPxtP#X؋]UWVS=P.thJ.hw#XZjj6_Xt^=P.thJ.h#ĝY^ދ[F@H 0. s 4.sVm`V #XZu1;5(.,.WVYXt{F 0.ra=T.tS( Ph#hJ.O{uSg_S"XZ"S_]s s.C$. [uWe[^_]UWVS}E H4.4uW[1҉Ut7Mp p[Zuh#Ã=P.thJ.h#XZCtSPNfc_X[u릾1;5(.,.WV ZYuыXtCtNPP& xu SbjSXjPPiPfc[룍e[^_]UWVS=P.thJ.h5#XZ1;5(.,.sJWVKYXt3fSЃfC{u ЃfCft hN#SPXZ[Ƀ릍e[^_]UVS]S^uShd#hJ.XD 1Ouu Y[19Åt 9t@uu h#$O ~u}t h~#V!PXZ؍e[^]UWVƉjhRP(.t9xu9pte^_]UPh#qZY8u"h#h#5.h#hJ.Cj6UVS@fC5.=~D.)fļ.5.jhh.UHt -X1.1CPS.P-5.C𣤼. e[^]USjjj0o+CC]UWVSƉӉ9tR)ySh<#hJ.B j%RP6To^thF P6$5F e[^_]á.t#UPju uTHt -kUWVS =X.uu 9uEfftcB1=.tf҉jEPWSWt~Yf E1;] }߃=.tȉGffG=.t?t=.uGGG%)ƋOu9rG9=P.thJ.h`#)XZGt=P.thJ.ht# YXGW9s=P.t+PRh#hJ.@=P.thJ.j s%XZ?te[^_]USjh -O3Y[th SH Zu S4Y11҉P]UWVSX=P.thJ.h#-^_5.5.5.h#hh -:@.߃uFh%PyZYt1;=(.,.r%=T. E_߅ujSV& .@ @uV1VSju2.@ @tjh -h #进hJ.h[##hJ.hm#ph -h~#芛hJ.h#hJ.hm#߂DuuƠ@.ZY@ mVZX=D.E}tPuPuSC, uSW,EZY~/9jPuSjSh#h#hJ.4EPS4EPS*E=.tPuuuht%S#E PS+Y[ff~ uD Z5.'OXe[^_]UWVS}E U9ÅuWuu h#!?hhW 'ƃ y@Whp#hJ.3hJ.NC0K Ph )#hJ.3 1S ѡ..0*Nj[Yځ~RQW5& @u55е.5.5.h'#hJ.@3螀0K PhR#J=D.uURQV$ @uG5е.5.5.h'#hJ.2R0J Ph| #hJ.2$jd%%W&V&XZe[^_]UEU ]U:= -#tjjh -*h -蹳= -#tjjh -)h -蕳UWVSƉ׉˅ut;5(.,.rWVh\#= .RPWV.s{ S$=T.t [$t9{ u9suhv#S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh#P=XZUWVu} u1tC;5(.,.s..RPWVX.t;x u;pt@$e^_]UWVu} ut;5(.,.rWVh#; .RPWV.t H$9x u9pu 1pp P$WVh#; e^_]UWVSujj[_ÅtJNJ/t tF@PW3 oZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P_Zu1,VeY/txtEVh#:XZEe^_]UVSu~.F.9s%)P6Sjj&9tC/vKSh#:XZ؍e[^]UWVS}u h #j:[ulYƉ<.uE5.W7 Zu h#3:X). .9r ...uSM؍e[^_]UWVSu.uE5.6 Xu h0#9X.Lء.19r _$(uËC$. 1ECIDžuQ}u} ujjY_t VhR#@9XZVVj_C[ٸ1Xj/V ^Z@PPjC{G C_ Y^Et5uu YZYƅu hk#8_E UCS FC^5}u} t)uu ZYt h#8XًE U7؍e[^_]US]S jZ..]UWVS]f{t h#SG9XZ{u&{t h#S.9_X{ t h#S9Y^CS utcRPl_Zuh#S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h#S8ZY3.C$.Xe[^_]UWVS]E 8ƅu h#Sa8_X9stsF C^ j/u "ZYx3WƉWhC$19VPjfSЃ߅uЃ fCe[^_]UWVS`=P.thJ.h#xXZ=D.(hF_$u+^_u,x0dC Ph#hJ.n+uh/#g6fc 195(.,.rIMWVZY‹Mt,AEJSBPj2U=UR̓1E1}E9(.,.EuuJZYDžttj$GPEPuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP<눃EUU1 .9~(.1tBESjjEP<G΋E E̡(.,.EUMԉuС .$.E؉Uܡ..EU8.ESjj(EPQ<C @t,w0A Ph\#hJ.)uhh#4SJDXe[^_]UWVS=P.thJ.h#~vY[}uXjj5,.5(.q.jP95 ._Zu h#4^jjjhX%fHwjjuƃ y,4v0@ Ph#hJ.(uh#3xPVMY[y,u0q@ Ph#hJ.{(uh#t3EЍXjSx4 XZu h#Q3YSWV y.u0@ PhR#hJ.(uhA#3j(PPV xV@.Z9 Ph #h #hJ.C!hpQ#hx%! .u(n09 Phx%h #hJ.!j.Vh.OXZe[^]US..EU]SȝPh #hJ. . .UEu #tS葝ZPh #hJ.{  #=.t.hx.Ph8.54.h!#hJ.E h$.h_$hJ.1 $=...EUSPh #5.. .UEu #tSלYPh #5. #=.t.hx.Ph8.54.h!#5.h$.h!!#5.t$5.h-!#lXZ.@ @t hJ!#jm]UWVSu }=P.tVh!#hJ. EE]99ru4=T.mf!#;]ud#Ph!#hJ. F{5CPCPh"hR=P.t R3C4,-h!#hJ.[t}t?SHK))PDPPCPV!#uSHK))PDPPCPuq!#<SHK))PDPPCPVK!#A@{h"#P:\ZYth'"#P#\ZYt^CDtu%PuZY!#$PjV !#PjVB !#@uY{toCDtu%PuZY!#$PjV !#PjV !#@t=T.t/Rh"#hJ. =P.thJ.h;"#iYXg=P.thJ.j >XZe[^_]á8-x=H.t2UPXUWVS}u 1.L.=.t3}t hL"#&_=<.n1ۉ1.=.tjK@.a0+, Ph%#hJ.5jjؙRS58-@Bu@t…=P.thJ.h%#&a[_=.u <.@1҉<..PYct8. PVh%# +hh.5.Vp .h5.uP..@ .e[^_]UWVS8Ã=X.FC=TtP=ltIʁlt=Tt1#=.u$=P.thJ.h%#`_X.t=.WȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPZYChs,s(^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC0 PSh5-#hJ.=P.tSh-#hJ.z ]US]{t h-#SwXZfC߃fCStY=D.u-PqZy"=0 PSh5-#hJ.=P.tSh-#hJ. ]US]{t h-#SXZfC߃fCSY=D.u-PLZy"=0 PSh-#hJ.=P.tSh.#hJ.j ]UVS]u;.u Ct1ʍu1ɉMfEEE'E0VhQ`5 .8 @u h 4#j!&E<u 5.h4#<u5.h24#hJ.> ~<tP5.hE4#hJ._Pu󥀽_y-`9j&CShf4#GhJ. j RZ<hn4#Xe[^_]USUBBPJ R Ph}4# uE4#]USh4#XZ]USUBBPJ R Ph}4#x uE4#]Sh4#UXZ]UWVS } 11;]}#j4h4# uCPQ1󪍕JƅPƅTJjh'jJRjS5 .QjPj!gW,jPjAPjRjVR VRPW5.5 .5.5.h4#K oQƅRjh'hVjS5 .ffЃf=v1RLhWj HLRhWO LHtmQƅRjh'hVjS5 .ffЃf=v1RWhWh4#Wh$FLgQƅRjh'hVjS5 .fff=v1h4#X1G9 5Ct9C LHD04P# .Pjh.k;9}4u d#r2jPRU Utj@uVRPMV3hU#[GjEPjh .RU$ Uu}u7}u1}u+E9Eu#/tj@uVRPV3hU#j1GM1EEe[^_]UWVSVUu=l.ˋh. `.u'. T.h.hU#hY[=p.u %tDhJ.jSuu5Л-Ph%[ u Php#FXZ=`.~tj PXڋEe[^_]1vs9}E8Phw8#GYXt VhU#XZE e[^_]N@e[^_]UVS]EjjEPuVuu@ @u e}t ShU#j`. h.tjYY2=p.u Shp#>XZuuuuuhV##e[^]UWVS]uEEU E$E䡀. T.=t.J`. h.t}jjEPjuV_ @tdMt]QMS XtMMMjjEPWuV* @tM;Mt W _j.`Y}e[^_]^ }tuh.hPV# = t)tu*ShV# uShV#ShwV#ShV#XZe[^_]UVS]E jjEPuVuuj @u} t ShU#jEUEU `. h.tj sXP p.u EP1P5Л-ShB&G&IuRPh$3 uRPhW#e[^]UVS ]EjjEPuVuu @u}t ShU#j`. h.tjC=p.u5Л-Sh%苰 =p. h uu t PXuuh&W#O e[^]UWVS,EE̋}uu<=.t3EjjEPEPh.W#E܍Pk((U܉UȉMQM舻 XۋMЋUuwM1Bt(jjURPVWC @uEԋU1Ƀt();EtuhU#jyuދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhԛ-uh6W#jUR脭UUС`. h.t6j(EYU܃(t Gt9|]e[^_] =p.uuhp#pXZv$v vvvvv vv6h=W#G,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph.W#|<Dž|tWS XuCxjjxPVph @ult9xt ShU#jSl%EpuEjj_X=.t=19|Whԛ-Sh6W#jUR舫 EjjUG ŋ=`. =h.t jL=p.u4Shp#菬Y[%t hn#}Zt4Wh}W#jG9|j xXue[^_]Y e[^_]ÍL$qUVSQ$EjjEPuVqq @u}t ShU#j`. h.tjYd=p.u Shp#谫XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hW#ceY[^]aUWVS@]=X.t /Dž SoXuhTt&h$jH1h %R^Y^t{18jPSPƃ t 9u 8"uShW#8uv ShW#j h %jx 1PSPVuu @u1;t =l.1ǡh. `.tW EZ)P4<$PUEIVӽ tRh. `.tj ‹EX+aP$PًUES} e[^_]UWVStx|h.p.$.wYl.l)ȉp)ȉt lt|uH1ۋx9t担td#tX%RPh%PPCC뿃} t~|Pd#xvԛ-RPh%PP|Pd#xvX%RPh%PP Dž|-|-Ã=t.=p.th.hp#ǧXZh.h.hW#诧 EP|$w,t&PhW#芧_X}uC|@0|9hsPhW#ZY^P|p4hW#B |p@hW#,|0.XZpu hhd#h.hhW#0pt d#6hhd#h.hhX#h. %ƀt2hWh.hh X#h.| %s2hWh.XhhX#h.D % s2hWh. hhX#h.  % s2hWh.hh(X#h. % s2hWh.hh0X#h. % s2hWh.xhh:X#h.d % s2hWh.@hh#h., %s2hWh.hh>X#h. %s2hWh.hhHX#h. %s2hWh.hh%h. %t7Vha#j VhWh.NhVh.>(h.|h%PhOX#|@H t Ph`X#_X|p(hjX#j  } =x.=.u }y|xXDž1DžtxThj`SPPQtݻ @hu\t|@9uߋ|@(9uΉdQh藮 ^dtNjh󤋅|@XPwP躶 Y|XX=.uE t|@XhHw9=p.uh.hp#bXZ|@XPvhsX#PרX}|@t E iUE/Ã}tP@uj-s Ph.hX#j s u|xtjh.h.|x@u^jjPjxt0 @u<. T.=t.h.hX#|@@EHs$@s&|xt諐|@8dx. dul-t.s j|xtjh.h.S . T.=t.h.hX#膠tx \b|@4h _)jjPRhx@Pt诸 @ht*|h`t5|@4`$Rܳ ^K8 ]kЉX1ɉh`9htkh`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXhsR X1T.d1ۋ|;X4,F\s. T.t%xQuujPtAC`jjPSxt @jjjjPSxt @UjjDžjjVSxt訶 @uI8 u3藩 XjjVSxtk @u jٺ.|^_9S蒱 [DžjjPSxt @tgjjٺ.|8uר Yuh.hX#5؛-袠 KjjPSxt菵 @u jڸ.S̰ XZlƀ.pƀ.e[^_]UWVSƉLHT.j=P膱Y[ƅPt9sx?u @ƅPGh#V賝[Z.tԛ-՛-8 8V tG=^jhq$S T F<=t:ԛ-  ƃ=d.u hX# 41Dž81ۉh 1tpƅY1j,VqZYDžtG1ɉLPDžH1ۉ<1ۅJj=W3ZYÅu 1l@llh#WDZYDtj,SZYDt @Dh%WZYLt6X#Lu%PVh Y#2 =X.8j蒐R18jlPSv-u F0j PV" x;3ue[^]UVS@Ë5/=X-tjtSvZYuFl6j j5SHFS$PFSh%P/5/F Pha#j@]S踆Sgee[^]USQtP=/uS`Z]UVSÉu=/u VSZYe[^]UWVS׉΋]Uu E E!UuUg%td#[^_]USt<0„!1=/uSLZ]UWVSLEӋu>ha#VmRZY)ƒ?EljDUhTSPEUDEj URPEU:*u%jjWSRPEP{'tEuj>uf E9hTSV e[^_]9`-t3UVSRPjuV资`-e[^]#/t ú( /=.u, /UWVSƉӊ>uuV.HtB1/hg5<.VM=/1҉/hg5<.S.9=/~؍e[^_]UWVS,E9/L.];S5$E/Y^y#P.H.D.=/u/ /SƉZ=X=&wAKw2ifƞ7[nRfƞ7D=,w$==!fƞ7=Xfƞ7=KwJ=w$==` fƞ7 =%fƞ7 ===fƞ7wfƞ7lfƞ7afƞ7Vfƞ7Kfƞ7@fƞ7 5fƞ7 *fƞ7 fƞ7fƞ7 fƞ7EۣP.EݣH.EܣD.eẼEfE1E/ 5$E/ySj5$E/E/e[^_]USEPhht@jԲ 1ۅu E]u+ha#_ZtPv<.XÞ%V~<.ha#_YtPFZy<.<.1ɉ \-=<. <.t@.0ha#T_ZtP@.[p$~@.ha#$_YtPʤZy@.@.=@. @.P]UPUE`/1J$@w&(f`/ Ua#Ua#g{Ua#Ua#Ua#ۍUa#эUa#ǍUa#뽍Ua#u.f`/Ua#uf`/`/1UWVSVh b#^PL^_ZX-h%]Yu6$&1҉/Ph`/Y[Ht /b#t /H#X.b#T."b#.m &./4# .%b#/"…y11(.$.4.8.,.0.. .t1 7/E`.]ڸ%tĞ7ڸ#ud#/ڸ1#ud#/ڸ(b#g.ڸ+b#Vua#/ڸ7b#u L/e[^_]Ë<./}<./m=/tg=7/t =.uMU=`7/t=7/u<./(=7/u<./1҉/]1/á.t 1=/úD /<.@ /< /8 /US=7/t =.ul=7/u<<./u/8t/8t=/u.=7/u<./0=`7/t/=7/t9<.~j CX]6]Uuj54 / =7/u /8t <.Ã=7/uUjXË<.0 /, /qUWVSu }1+uG}-*u:Vt3st!dt1k1uUE 0e[^]UVS hd#jy~ hc#Ch /h /h /h / / / / / / / / / / / / / / / / /hc#C1[<=:tjhc#jq Fd#h /GXZ4uу@QuQhBd#R5 /j h /:a /UEtjtUt@t+t%=t]UVSu1ҀtXPeZ;E GtDuw6)u"^t u B9u1e[^]USMP;U sPЉӀuШtx[]UWVSu>WZPÃ$w&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=` /tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=` /u~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US] /1u7 /u'-zu=7/t-[]_[]US] /I1u7 /5u'0-%u=7/u-[] []UE=` /tE] /]USS]uh>d#h /Bzw2SYt'؃@PZu@ShBd#S5 /S-YtS5 /j h /\"E /ySEPEXZ /]US] /-uH-[][]UU 1}DuЃ=%" ]UWVSSEIuRP^X[RVZY1uEVLXt SY-h /jEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhh#9hh#9Shh#P&Nucjhh#VNǃ u.hh#P9Shh#PMu0Shh#VM Shh#PMEWo Ete[^_]UVShh#8P99ZYu3h#VНZY1t=hx%V軝Y[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPV3Y[{%=ehpQ#V^Vn GShV@ #jh i#V  1҉p1ShW? t t u@hi#W~YZh%i#WiYZh,i#WTYZt<"u5vptp~HpSPV O tu QMZYMuGCQe We _Xu s 輓ZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á4 /t);4-t!Ujh /P4 /@ UWVS]=` /u( /$ /uD /( /Àu$ /Шu[ШtSS$ /%uF /A /( /9~1Ph( /ZYu'1$ /P1$ /:Y=$ /1$ /=T /t 15T /s-f]4 /9L-  PS.Y[@$x&e21҉P /51P / 1P /\ /t \ /8 1P /\ /= /vx ugx V\ /= /w1P /X /+5\ /X{1=P /\ /8eu15P /Q1ۉP /e[^_]1ɉ P /e[^_]a1҉P /T1P /\ /= /v6x u0\ /= /x ߀x z\ /= /w1P /1P /\ /8 u\ /8 \ /sT /]1P / 4 /h-y\ / /h-Y[ t9ىM{ RUWh /Ǝ UMuʉY15X /zWh /1\ / /_X\ /8=P /t L /tP` 1ɉ L /[V<EPZE\ /t\ /tp / /<9s; u Ce-Ed-E11E쿀 /9stub}t6E9s-M܉UuuW趍 UMuE|1}t8EE18Et < u_ 1EG눅D /H /tP_ Xj\ /)@PvH /\ /)RSPDa\ /Me-8uCS;XuS%AL /_WAL /WT_ Y[\ /ML /txt/P /Ph8 /-1҉_Z @ /@ /\ /9D /si@ /u,15P /H /1ۉP /pu5@ /CYd\ /= /v d-8Huh7i#'Zu%1P /( /e[^_]e[^_]UVSQM1uu /EQЀ w[jjjj uuuVtjhEi#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1$ /9 /| /á4 /t @@@ Ã=.uUj11ҸÞXUWVS.t`- 0- @1/1bDž{PL@$j辿WP-V2DQ8QuZhF_$VLXZ$fSftxRPlqZYx,E%=ufSfthPBYXhXi#%Zud PZkX~P-1Ƀx tA -x t tlph i#h$SK|1ɉx =.u:pl)ыt)PxjjxPoh,i#SSeWVh@V[ W[ XZe[^_]ú9P.t9L.t 19H.‰USR/t>BE/R?[ XE=@u$/t t7tut g ]UVS=\-u=7/t =.u$t/..u ujjj5.RP*V PT/u =\-u>57/H /7/1҉H /u 4YX57/H /e[^]UU]飪UWVSt eYƉׅt‰//H /=E/u0t;5//}jjjG 1H /E/ld2t8e[^_]UWVSVEj)ơ/u/ǁt#tj11u|%/Su5/á/ƒ// t?x1 rjhei#FY[t j0j1ZtՅtVk1V(Xe[^_]USTá/$N   tw #5/jCP7tW6%I/f5/S5/5/ߟ1/?E4/؋]a//PSy<+u C< u.tPW Z;u 1.Se.X5/jPCP9=.S0X]q;!t/tP,W XS5/Y=.ui/uhwi#hd#ȀXZMhwi#P=.u>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉/YYu/ ыuUS]t CPX]UPGPEEUWVS@/<.@.e=/t1//1///=E/t[=.tj3_/t x@j荭//苝Yu*P:t!u5.BZujǴ_=7/t*p:t!ku5.AYuj蔴Z17/=H/un1H/=/tjhi#訣[1/:at hf#耣Xt?uhj:Ģ_X WrY.=E/weu:{1/1/&\P菕Zze=E/+ej//t.7iCЃ .jSP_Zdteh///^=/t1ɉ /_=//uy/u_uh/ƒ@+t t;!tA-Ҹu u ‰/@@/3=//  =trSZH?E|a</1EЍEPEPEP/ tD,EĉE-=/u Pw P_ E@Ƀ}}uEЅEPhj#x 15/Y=/S/YuS艒EЍEPhj#6C//Ht!5/hd#5/5/s 5/MZt5/Tj1ɸ/&C$Tx&*t@tS; u݃=\-u ̾J5h-j+Y =/t)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=/i j1ɺ%i0S{ aFcx $x&j1ɺ$n /19/}7/1;//|//=7/t5/5/LF^_j/19/}7/1;//|莍//j1;//|/1ɉ /=7/u+;//}5/5/EXZjj5/1;//|/1/ jjjj5\7/Vjj5\7/v1;//|/1/=7/;//}ze1;//|/1/|jj5/1;//|//F=7/u5/5/yD_Xjj=7/t5/5/TDY^1 /19/}.=7/u5/5/DXZjj5.6 /19/}.jj5.7tköUGA57/1;//|/1/7/5/5/E57/f//y 1/,d9ѹ|u$du=/t/d1//5/5/G_X//19|,fFhm//19| SGFRP0EB//y15/5/1157/RPFg8EȍEPh$=.uEtEP1Z9t䡐///7//7/j(Y{j8(7/(7//1;//|/1/ / ///1;//|/1/s/15/Ѓt+Ѓ$5/ t /1;//|/1/e/1.5/C1FP踳X/b"'//15/7//1=7/7//17/ha#맃=.qj 4-Fj# =.M5.6h#P!s u jhfj#5.6Ytjhj#XZj -f%@5.ѣjP/19/|/1ɉ /PZ jhk#45.V1_PrYt VV1jPb1//j1ɺ" =.u) -?#uf%j}=.jhPj# @j1ɺk#;_ ƒ 1?PSmp?Zj1ɺ k#>^ ƒ Sp`?lj1ɺ-k#5LY ƒp glSp"j1ɺ9k#%RZ/ t u.S}o_/j -f%% j1ɺAk#^/ /19}7/(7/ @.‰/ //EƉ9Љ}5/=/E)`//19}7/"7/ @.///T/1ɉ /`/XZ=7/t/_UE=` /t@]US]SjšZY19} B]UWVSu}t UE  u kZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:=` /HE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt QPZ;t*tUQMWSbQ MUuBBCe[^_]UWVSu9EPO[E11EtSC8e-t18d- MUURPX$ZYMt}tEEG맃}t1ۉ]utVcOYXjSԅE_Zǃ}tKd-PVe-PhXn#SW 3SP#Y[tuWEXZFFGuEe[^_]UWVSRh#P'Y[unVXtaWNƉ$NT$RUSh_n#Wh%URP  S-" hpQ#V5EV" E hpQ#VZYe[^_]UWVSuu1k>tV*N_u N|$Wg XZtu h%VhB&WSG }tjS Y^y S! ZPX؍e[^_]Uhh#juPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'.<%t.tRFP^MY^CGjCSȃXZutKH݀u=9us8Ft38Ft1 .<%t .tQPSSLÃCFe[^_]UWVS]S臡^u1jjjS<Bu@thVS ~ˍ19=` /t)RPZYu FSWk_XSjWƒ =7/u9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=.!8u#P^hkn#PEZYUtbn#RUsKƉ$iKYP[KkL$QMWd-Pe-PURhtn#MQVt $W XUVKZUtRhn#Pe{G Sh$PS{V t'iWY>u V^ Z SU X؍e[^_]UWVS}1ۃ=.u\WxJX$SWhn#SPVuPǃ VP?LZYu S Y1W V XZ؍e[^_]UVS]h#SL^Zt(ha#SKZYthtm#SKZYƉe[^]UVS]SYuVScYZu]e[^]'V!Ze[^]UWVS u=7/h.Zj!hj#TY_?|uC؉E-uEh#VK_ZEXHtjhn#s[^VuHƉ<$HT$RUAWuURP Wd VR YtsfGftjEPVs Ht-WZKtcu_E18E htm#~XBEPE8E 0h#~Y^WTZ;u S X1ۉ؍e[^_]UWVS}u =.j蟒hn#ZY~1E En#e[^_]qVWSGE4$xGE<$mGUMT$RU}EWVSURP$W V E@u t]e[^_]Qe[^_]U|EPuXY1xE%=@UVS|u=7/u1V[t&VF$P}VP3h-\|PVoZYy VhXG1ۃ=7/uu!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+= 7/u=H /u 7/u$Pk/RPWVWVځƉ׃WVʼnZYuu؉}ܡE/Eut u EU<uu uuqE؋U܉EU9uE}}E/!nEuuP)&ÃEU ~'=7/t(} t} uEU' t tؙ)]Ur'   EE/Em tuTi'}Ɖׅ}t(/EtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉUE/ t uΆƉ1ɉ 7/E7/Eu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI=7/t' t u}tƉECuЉ}E}t =7/tƅRPj # j}]!Su%uuwW=7/t&WVuuRPE؋U2=7/tH}tBy uE/t t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1=/jjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%= 7/uk/9EE}11S 7/uEU)juuRPQEURP[^y=7/tL,'83 t u, uE/< u@)E/ u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@E/Ey} u#"Å>H /-CMڂRPu à Hu =/~17/u}E=7/u~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ=7/t!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU=7/tWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5H-=L-4@w Hr5P-=T-e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S=7/Ee[^_] pWV9EZYt1E Eo#e[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuE<.)HP6WVƉXZutE21ɉ P/ T/E)SjjWV<.HPx<.H9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2=7/uts1T/WV]jjWV<.HP e[^_]UWVEU EURP)ƉYXBut1WVYZu$=7/t WV XZ57/WV hM9ȸ}|6Du-57/(~VRP[ 1ɉM E5o#e^_]"XEUEUEPhVo#XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjhto#W^_~}Ɖס<.HP[Y9u9u e^_]d0o\WV <.IuuQjjf *QRPY<.HPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃=7/t WVmXZ]u} e[^_]|USZtjho#VXZ%q|9} <.IQRPa ]UWVSSEE] wBu@ujho#V~ZYwƉ׃uu1E Eo#e[^_]VSuWVO9| 57/RP e[^_]Ê t u@UWVSƉ5x/5l/ho#hS=wWV)RPt/SXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPho#jR>p#"j PRM 9ud#ep#; p/<=t#; p/|:j; p/; p/9 p/ 9 p/҅5-,1 v#u t|\u@r;yj=SOZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=td#p#;8F1< t#uً1V‰8u$d#p# t tu䋅t3RP#&YZűPp#Pd(8u‰2ʀ‰w8t1lߋ1MWt/Ze[^_]Ë/;/~~/ l/ /‰/US/X/p//[]É19-t @uUP?kYt,.t4.t.t$.UWVS/UjS EjS }tUuuH YXtP5`/} ljE5d/5d/ 5`/ E`/Ed//XZ1e[^_]UWVSÉ։9/~`/d/< +t[^_]UWVS׉ˋ5l/Vl/Љ[^_]M=H7/tt*ttt t XÃ=7/u[USjm5/ ZYNb#t:t1ɺNC=/ts#t1ɺ*C]Uhs#/PUYZt /"hs#/P0YZt /s#jh9W`/jh(Wd//hP/hD/h /h,/ h8/1/ZU1}]á//Uh/1/1l/9h/~"`/l/d/1ɉ l/@1//////////// ///hP/ hD/h /~h,/~h8/~1҉/UWVS=7/uu uqƉ[X117/ @7/u=7/u u$ZYt  /@;P- T-9U] |%!ʃtM9 H-L-U |  /@=7/t /u aP7/9/h1Ҹ WVY[u1ۅtj ]SRPlDSkÃ1T7/)9~1Ҹ F19tD5ݺF1Ҹ //e[^_]á7/tP7/=7/u T7/DUSh/9l/~$d/<u`/PhP/}XZCԡh/l///]UWVS]u }Eu@0tj$zYEe[^_]q=` /tWZ=` /tw/Py_uS[ۃl/~K1S ~YuSW_ZVd/t-fZYul/d/DVe_tWl/uVd^ƒt 0.Vd/teZYt t8.t .t(.Ӊ؍e[^_]UWVSEUMЃt/} u}u=/tG}EPjEU RPu ueu=@7/tV /tM E졀//U#U ;E} „t!؃tEU ///]=/tT1ۉ/1/1k /9{~%8u u1ɺZYGFu1ۃ}tO`/ l/ E1~RjEP{ l/1҅~ d/TRPuuCÃ=7/u}u9EEEE55/+5/E;5@.'EPw_/9/uY=/u=/uEU //1=T/~+9=T/~P/81ɺ>GhP/yY19}E81ɋUG衠/9/|1}uEPhP/yXZh/9l/~Չ19h/~=`/   d/<<@B)5l///9/}1ɋh7/ Kݸe[^_]UWVSƉ׃=7/tCPN[/+/-;@.~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ19/~ /t /)C1[^_]UWVu} =7/uщu} 1^_]^_]nl////á/l///UU1wR5/ZYUS]1w%SZ1uS5/ZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;&9tu&ـuH &uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} /E=7/u#=/uS/Zt /1//_SPEZYtIWVM^_t R/xt /ShD/%vWVMZYu5/ 1/ShD/uhD/k/  /PvhD/Uu/@}/$`//9/}%hP/PuXT/T/=/9=/| l/l/؉ESjEPuU$ t9r)ډhD/t5/ 1=/[^7/t 7/uuu} Ul/~7;h/ `/|t d/D0te[^_]uuu} 1ɸJt1tq`/ЉERj]Suƃ `/E9s=)Уl/RjStNjd/l/?4WtV)/~뫣/z}l/`/=` /u/P8rYl/ d/ M9u3_u(t M./t EMMb_uM`/UL_uGMAt?S~tZt /E*l/`/PqSPuE u1ɉ / 7/t =7/uuu} U e[^_]g/+/4- /~9|0-)ș);/}s/)WV%U KYZK=` /tv =7/tT)PoZtu} UK=` /t+SsYtStZu} e[^_]u} MU؍e[^_]e[^_] UWVS]u }/t4 u t`5/5/1ZYt 1/ ud7/t 7/uR=// 5/=/1^//@/1ɉ /4뷃=` /t/ub//ÀuWV1҉"[^Шu%ШtS'n/5/=/Yf%ul /A//90Ph/Ln5/=/[Zth/nWV/ /1ɉ /<//vP/1҉//=` /u]ue[^_]Ã=/~U塰//1҉/]1UWVSQu} EE/tt t5/5/1XZ/tl=l7/tc@.;////l/h7/@.D;/~ Zl7/G=@7/u@.;/~1N= /t/@@.9}Թ ۃ=X.tt =T.u =7/u 11Ҹ *=T.t&}t 1Ҹ 1Ҹ11ҡl/e[^_]TUVS]h/ d/ށ9l/~tu ډ@[^]UEp/E /]USEM =/t)=7/tu ~JH1҉ ;/9~/p/h/)Ћd/`/[]/1/UWVSQSMQyq uu RPy^ZYu]ƒt1ۃ tt E/tI]8/H9U_Ut )]`/@]C뮋 `/t `/teY[^_]UWVSQMQyq 19| RP]ZYu㡤/X`/D_E t$E/u}tjU/Et d\L`/UL/T1;`/r H/E)K`/Uz11҅t `/ىt /eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQ-lPUt!SMQPEgEP@ E1jRjV)E뜉+E)Ѝe[^_]UVS/1/utFjjP$ t硠/@11ҡl//e[^]UWVS5@.@.jM9Y119=<.~"!уtRP /9}G։5@.19|)e[^_]UVSu Eu=Vz Y@ w>uV-SXZ1jjVsP u뾍e[^]UEo1҃t -]= 1/t& 1/tUSJZ P+JZ HX[]Ã=/y-U=7/u T/17/jhs#3ZYá/xW@d/UWV1ɉ /5/=/+9Ɖ}jht#=4/XZe^_]ø/ @=0/u10/1///0/$1/ 1/ 1/ 1/1҉01/41/(1/,1/81/1ɉ <1/UWVSEEE E}M 1/ 1/t"C 9{}E9Cu E9C֋s1/t 1/ /1҉/pxH }xUPC=6//ub 1/xHE0u 1/t,puX9} E}EE}ًEǀ}t E/‹ BA[^_]ÍL$qUWVSQ QEU=7/t E]!؃u 111}9Uй5 1/FV 1/t]9؉׋]}69Uu9Eu N^})//1=/~GW 1/tBN^ M]M])ӉM؉]܋M]+M]MЉ]ԋ]9]؋]܋MRPW[^$O_w E9ƉU}XM]jjWVƉ׃E/M]t u M]M]WVSQM]]9uEM]uu#WZYlN^~ v9uE}RM]jjWVƉ׃E/NM]u M]M]WVSQM]M]1/ȉڍeY[^_]aÍL$qUWVSQQEU}9} 1/,s{ 1/tE9ƉU}9}u9uu CS K 1/tEU+AQ+u}9}cq qMU[^Mt qyAQ ]9މM}jjRPE/uʼn!уts sqUZYus{CS 9u]}0jjRP\E/r!уeRPEUWV#EUeY[^_]aUWVSQMSN2ƉOEUXu$ux9<.~ CS!2Ɖ܋u}WVY[M9u M9ueY[^_]UWVSjj{T^_uxjho#1./ZY1111҉1ۅuuRPEUWV;EUjjRPpE/u uu1/e[^_]UVSEU =47/t5<7/9|)11[^]USZKJy ;J|< t Y RPZY]UWVSuE E>-uF"4Khf%'V'hh"~:t>u R^8_UV輱Xt̋URUÉ<$L$QM8*WPURh%MQS¿ W _usV7YS<S j]uuuMjTj;}t&uA&h t#7&*j %% ET/uGX1҉Ue[^_]SUWVS]EEEEuu QZYt jh1t#hF_$SQYXujhOt#*XZ8Ihf%%S%h,UEYYut@ . \6/d6/h6/El6/`6/tP Z1`6/@1/UWVSPEf=X6/uJ=h6/uA=d6/u8.\6/1d6/h6/7/l6/`6/tPY _15`6/{u#j;PsiCs/ 1ɉKs {SC;.u RWV UPGZUte[^_]UQMt.9Ptjht#.%XZP@ UVS]u .1k9d1/u$9p1/u9l1/uPa~#4t P'@5u1҉[^]UU19d1/uǀl1/ǀp1/=u]UWVSu`[1h1/t:P葰PVQ uEd1/h1/ 1҉h1/YS Xue[^_]Ã=X7/UWVSu h$u+`1/ C Suup6/ue[^_]j }WRPsu s蔾Xh#VZYtVWsPht#u跼UWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=<.E8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtPj Y1Cu>/CZe[^_]USE] =.t1E Et#tS..XNt1ۉ] Et#u=@-x1ɉM Et#^S-á.ZtP XS!P].S 5.]B=@-y1ɉM Et#]!.EEPh u#!XZ].-x$Ujh@BRP<.RP?7/USEtzE 8.MU u4@E Qh&R%- }t jhu#}Qh&R }t jh/u#k7/-a-y7/EEPhCu#>Pheu#j ]SS~P|0uD]EPhlu# XZ]á-x$Ujh@BRP@.RP"7/USEtzE 8.MU u4@E Qh?#R- }t jhu#}Qh?#R }t jhu#k7/-a-y7/EEPhu#>Pheu#j ]SS~P|0uD]EPhu#xXZ]US] }u!jS萏YZt]EPhv#BXZ]US] }u!jSXYZt]EPhv# XZ]UWVSUE t tP]+p6/^w=.t1ۉ] EAv#e[^_]P*PzPMRZYt]e[^_]ݠPƉ׃utS;57/WVe[^_]USEU tXtugR*-YYR)á-Z=-t tP XSPM-YX]] -EEPh_v#XZ]US] }uC=7/tS3*.Y,6/h%sSsXZE@]?s]UVSE] l7/Eh7/*l7/#tRRJYEEPhx#XZ]UEtHw1E Ex#].]U}u=`7/u]i1]S1]UEu=\7/ K\7/]UEu*=T7/~!EEPhx#T7/XZUEu*=P7/~!EEPh$y#P7/XZUEu#=D7/t=.tL8Bu @u]]UUE t#u?-^u2@t+-!-PHEEPhSy#N US E1ɉ <7/ 87/E 8,t)EPh$E P }t jhmy#3<7/E 8,uf@E EPh$E P }tjhy#XZ787/0587/5<7/h$j]Sʩ]܍EPhy#]UVSE] F1 RD+~vQQ r/Qd~ wG$x&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhy#1CSPi(7/Y(7/E sEEE sF@tK@sN@ sR@sW@sY @AuU9uE-EUEPhy#XZe[^]ø=7/u=87/ 1=<7/á7/ <.+<7/UWVS }8uMEPhy#Y[1kÉUP$@PƋUXZt@=p7/t\u Ct C$t!tˆUPWZYUtFVC؍e[^_]U@u0hz#j*h6/L0Rh z#j*h6/36/ÅtÅt%UE.z#tz#URPXZUu6EPhz#h6/6/UU1t 1BS]UU#t B tB]U}ou>¸t#u1]1=7/U7/EEPhy#ZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM7/tFPtu)QjP_XA7/ZjPEPH 157/1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr6/j+UjEEZY];+u$.tP _CP.YSJfh@ fXZEn=7/tz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPhJz#@EɅu&M}EuPhtz#}XZPhz#1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u7/9{jQEP C]tSjZYPS* XDe[^_]UWVS ]u }翅u jhz#Cu@t:EEPhz#lusEEPh{#JƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjh"{#5t)u9EPjEP }uSjhN{# Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjhr{#X Y^jCtF XZtC tT/te[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á7/=7/tUSh{#n~P~Y[u 7/@-;t CtS C t jjSXZ$ۋ]UM@-t9tBt 9t$1҉]UWVSEE1EE111E@->~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7`Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uhɍ#|YtPrZ~-øUS =8/u[h 8/ uZtL18/E܉EEEjEPj腔 E9$E/uE/ۃ`[8/$E/;EMMEEE=8/t=/t=x7/u-=T8/ttPjEP EufE=H /u);P=-9u E/&Pi^Xʃ=$7/t ƒftըu18/uu uWà 1ɉ 8/=H /tx*It 1҉8/8/@8/~+jX!8h8#ZE9$E/tt T8/؋]Ujh 8/csUQEPEUUWVSA0轸 uÉ4$|$WVuhU#WP踛؍e[^_]US]S茸 ZuShٍ#h 8/  8/]ÍL$qUWVSQYq AQEU}WRPq1薃ӉщE؉UM܋EuƉeWuuRP[u؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEP=XZUS-8/t,-8/Sh8/5-l 9t T/]UE-]Ã=h8/t 1h8/B$U=-<%!hWVSjubu Z Dh8/e[^_]U4tPw @rP:UXUWVSu} l8/cuWV3XZE e[^_];=t7/uldh(.WVh-T$.\S%g9@. T/e[^_]WUEU E d#Ed##]UVS]u Tuu ]e[^]-P1ZE #E #؍e[^]\USQtu u>31YZt[=@. T/j ZQujA X؋]UWVS]uE %=7/u>t>S/$PhPj jjjSPh$9t|V货 Xsuojjk 1=D/1҃=. PSW t"Wq _}u)jh+#[^tP4#6B ZY>1e[^_]US]tP #3 ZY1]U1}]UWVS|}ue( u )ZE E7/x9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWu< ƒ1Eun؍[|yu19E E H]9}/3{yMu$d#[<:N<%<.uFu!1E1ۡ<.H9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v % V ZY1CCC E/E/E/ E/e[^_]UhD/XUS]D/-t-=D/ujhA#XZ]1=E/E/E]UhD/'XUVSu] <t1ٸD/t;pX[^]UWVSEUE|E x@.p+l<.h57/ duu8EU =07/t4 <7/ș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1tE/ixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x=7/t )ؙ1)=~WVuuuu [Zt}뚃=07/tEPEP587/轮t D/t ] 7/t 7/u=7/t =7/tu=7/uSuNPEjEURNESEPuuuND/(Eu0E/ E/9EM|!ЃtE;E/EE/|lUsjjEPEPR`us3^$`t2EUEUu}9uEbUD/P[uC<ujj]SMQuu5D/5D/$ EMt%tEUSQuuMM}= 7/u(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ /M1ɉ /M)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E//T/}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xu u [^}t}EUW1ɉMuȊ u XZuD/tWsS Zjj1CCCj @u]e[^_]Ј D/CD/T/e[^_]U €u1=D/1]UWVS4u}E/ E/EUE/E/EԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUCE/Eȡ E/E@u}t0E9ƉU} !uE/E/]9؉ӋM},#u k/׋E܋Uuu  9}%k/]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}k/9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU D/>MjMQjujuWVY 7E/ E/EUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEKE/ E/!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEUE/ E/EԋUأE/E/]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU1E/= 7/u]]USj5L-@'YZt4jٸD/Zt = 7/u=E/uW1]U=D/u 7/D/D/D/]|UWVSU EEt :DM@RtE3D/ s,jh`#E"u jhA#Ht= 7/=7/= 7/1ɉ E/E]3Ɖ׃u}57/P"ÉXZe _= 7/=7/jh#_XE+j,^@=E/@1ۉE/.EPMD/Z@t 7/ 7/j1E/X= 7/t =7/U.}Ɖ7/u1Ʌt1<.H'uM@uu57/cX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; <.| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujjj˺ E/XZ=8/t UE]Uhwj荺 E/jj=8/tU}tOhwjTYX=.u>Pj7hj+jj"hgj 2jjjjjjjj jjXZUWVSE/1҉E/tkjj賹j(jj蔹jj苹^0jP&b$h>jojxT/ tD=@.5<.X<.9=@.u9t@.贳̴T/t=|7/tjXe[^_]UWVS E։ϋE/SRU$EuUR u.{tUM tuWVޢC SXZ1e[^_]UWVSSE։jju~$@PCuPOs {E C}u1C%u@$@PCuPN؍e[^_]US--t%CBs} s} S} 1E/E/ E/]UWVS5-YhpQ#PEmC} Z1ɉ E/`[ÍhVMN R!tSV\ uNJ< t< uvZ8tPt t=_8dPjP u1wHx^u Hȋt.8t&\uG@P9tWPΉ1Ҁx$‰uH11WQщ‹d--P- E/ZYX= E/t-E/E/1e[^_]UWVS ÉJtu i1ɉ E/u--@J.&h#bDPD^Zu&S5WYuZ lj4$$L9QfVh#PI9tVxz XhpQ#WVWdz f;?S5YS&jjщ‰--P- E/ VhP9K th=E/t@J.tVRZXDP_t u Ƅ@t VB[ uR. u@J.DH@ZutfLH@tCu) ʍLHt@u C@tC fLHuDPttDP@yumDP@tG VDH@dBVCYZt1E/E/ E/P--tE/E/1e[^_]US-h#S蟦ZYuwh#S臦ZY¸t_h#SoZY¸tGh#SWZY¸t/h#S?ZY¸tjSjZZYxP>[X1]UZu E6 ‹ENt HujhĎ#jhю#XZÍL$qUWVSQ E/"p xutWV ƉY[jj講EUXZE/uFEPEPWVĕE؉U܃}u}tEU}u}ujh#QY[=7/tuuuu =7/tEUju{7P7ESjQjEPuuS7(Eu]v SWv XZEЅu u؋}eY[^_]aUWVSE/ E/]11~1t2-t AFKމt E/ E/[^_]UWVSE/ E/]11~1tr-t IFK݉t E/ E/[^_]á E/áE/ËE/tUrLZøUj<Zujh #WZYyjPWZYxU$E/]øUR~jEP5$E/U ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPVt Z1CC]UE1҉P]USUBt XZL[]UE]UWVS}wSKS Kr{3[^_][^_]UWVS]E EC9C|WƅujjWVRPCPt& HP5-PU^ZtbShVMA Nh7?&P#^Zu @׀8 uSzY9#h#P#ZYt @׀8 u SyX8t%8,t8 t@Ћ8tH5K/RxE/PY^tE/t SPyZ@xE/P C#uŗ#e[^]UL/jjǨXZUhUj质L/XZU!L/jhI/0 J.QJ.y ;J.| tJ.J J.UhJ.P`XZUWVSREƈEj}W5L/ $ f=-tk1L/5->jW5L/Pj)=L/t.VV"Phf#Y KtjhE/5L/# 럍e[^_]USQh}#_jj茧jj胧u S?Åt4EP 0Z9u5 h#_jjAjj8]jj*jj!-j/S{څtPjRS)hJ.h $舩h#jhJ.h $mh#j۪USQjhh$5L/M f=\-t#<-;tS軘$S5L/lM jhE tPE X+u}f= -t WVh#WVh# jhK/5L/}DhM/jj+e[^_]UWVSEhVh #^ 'jh"5L/Djj+jj"h M/jj(jhK/5L/'E4à yh2#HUX11ft#j'ƉXPr%Y9tGAj5L/jjj螜jj蕜V# Vh#MNjvDf=|-tj蹷)RPh#}jhK/5L/,ChM/jjjj- jj!XZe[^_]UWVSEzhVh # 4jh"5L/Bjjƛjj轛h M/jjS(jhK/5L/Co3à yh2#SX11st#j¶ƉXP $Y9tTNj5L/葳j5L/脳jujj,jj#$VVh#LjCf=|-tjG)RPh# jhK/5L/AhM/jjhjj軚 jj诚XZe[^_]US,]S5L/Wuh"u誎UСM/uUУM/Sj5L/hM/jj]US,]S5L/th"u<U؃%u ESj5L/ ]UShSh# S:E-[tE-jhEy$5L/t@ U-tU-5-t5-5-t5-f=\-tz-t$-f=-th"ht#qY%-t%-,-K/5-t5-jZE-t$E-f=L-th"ht#|X]Ujh{t 5L/zjdjhzt 5L/zUS]e1u:jPAXZ]0US]CCtu P$ZYt1]UVSEh#PZYtP賰^yht#[Phǐ#hP1H蓰ƅul-u5%@$@XCZ@$@1ɉ $Ph_n#SSj豘u*hQ#PXf@XZ@X1G@$hE/?à @XPwY9ut thJ.hϐ#:XZ댅yhB$赱xuPhސ#uPh#hJ.K CƃE/E/8 u =E/vH@E/e[^]USEjPhL/h# uxhL/hhPK>L/yhL/h #GZY?hSh?# t hL/UX5|-5L/S ]UVSjPhL/h6#q hI/hL/Y[uE>#e[^]MHu I/I/5I/hhPm=Ãy5I/h #FXZ+5I/hW#hVJEhc#SVe[^]UE"jPh`L/h# uXh`L/fhpQ#PLJ uh`L/he#3FXZ)j5-P f=-uL/EIUVSjPhL/hw#) hI/hL/Y[uE~#e[^]FLI/HuI/RhpQ#PIà uVhe#{EXZ@I/f=-tPh#Ph#hVCVh#S! e[^]UhJ.h#jG;UWVS}<1ۉK/K/K/%1u~11Ejh -hy#u uk=J/uhJ.hB#jj:t&`'FtrE96/ kU DЉE죸K/뉃a$&nEtPt=7W肄YvhÕ#Z?957jh#V蚅 jh#V肅 h2#V,^Zƅh#jԕ7h%SZYkh$SZYLh2#SمY[Åh#뫡7K/7K/Em=K/t h #s7j/RU=XYZUt K/5Rh%hK/[I EPjhjjjj57nK/U P57h&#RaK/tehZ#tMK/K/K/=J/1vldZRpC.E)t8HuR}t h#KE ht%RURYZUtK/"K/K/K/hFjhFjߏhFjӏhFjǏ 5K/h#j hJ/+@hJ/u hĖ#@u hӖ#jhJ.zVXZtKth% h$h2#& Xt 1N11҃=J/1-L-=-1ۉ|-=K/t ,-=K/t5K/9 Yu.t h#j=K/u"5K/ Zt5K/hݖ#j蘒e[^_]U J/jh@J/U4hpj}EXZu5EZt1 J/=K/u!ujNYX= J/h@J/%Zu+j dX=K/tPul6ZYL/j9YL/yuh$XZ J/V= J/IjPqXYL/tP6YL/URPThXZ=K/uM@EPj5L/  jh t 5L/lo jjHYX1}UWVS]=xJ/uh#蛧Yu h#jh1#~Zt8/t P ^x-|-8#Sht-EPW& ƃ 1҅=K/t7K/K/K/K/1ۉK/=K/u'K/%;/u%K/jSZYtK/t t u!hu#ShD#"^_ hT#"[j4->uUVQPC( U-Euԃ=K/u hK/hsV$Pc* @u K/%hK/hT7%uA* @u K/=K/xj:h#uY lj=K/K/uSh#!t$=K/uK/=K/u Sh#j"j:h%u K/=K/u3K/tK/tR5K/ZYK/K/j:h%&u t -j:h4&u} t -j:h\#u] t L-j:h$u= t1L-j:hs$u  t \-j:h#u t l-j:h8#u t |-j:h,p#u t1|-j:h:%u t -j:hy%u t1-j:h"uf t  -j:h%uF t -j:hϹ#u& tK/j:h$u  t L-=K/u K/h-=K/u K/`-K/t Ph#^_K/t PhD"|Y[K/t Ph4&fXZK/t Phڍ%P_XhK/h &u(' @u15K/hK/h#u' @u1ۉK/hK/hRM#u& @u K/ K/tJ/xJ/tJ/tj,S OZYt@K/tJ/؍e[^_]US]Ph#hJ.O=Sh#hJ.?=j/U=K/thK/htji j# DJ.y1Uh@J.^YZuj=L/t!á@J.P@J.=L/t!Ujj?L/hR#?jh`O/WUhM/jj貹 Uh`M/jj蜹 U E E1ɉ L/hͶjӆEXZjjņEYXuh$z8XZh`O/YtnE suj舆YXuj|XZ=L/uXE M9Hh@J.XZtU < tU EE9sE @E DJ.xˡ@J.P@J.UE Mtt @8u1]UWVSuM/N/FVtI)~@.#t8u\Q ^@P u f^?봈@M/[^_]UEP^vM/^?<tP@M/M/ M/M/M/]UVSEPh;#6XZ@-;t[Ct =L/uG-PPh@#6s Ct*PZVQPhD#6 렍e[^]UVS,u]S5L/j_VSG:VS:EԀ€Uԃ=K/t̃Ef=L-tMẼeewfEf=-t %‰USj5L/ƶe[^]UVSuU ]=L/tSRV* y@19t N/ @蟆8u hS#E%e[^]۞e[^]UVSP-EÉL/@-t68u-Fu#EPPh$35SV1%tك 8]tjEP5L/ Íe[^]UVS<-t;u%M/tPH [u4ãM/<-Yh2#Sw^ZuL/1L/h$SvZY…t[h#SvY^tVha%Sv^ZtNh%SvZYtSha#hJ.7hJ.R1Ҿ11Ҿ 1Ɋ-1 !N/Aue[^]Uf=\-tM/tP8RXj)UjhK/5L/(jhK/5L/)UWVSjW5L/) ފ< uf=\-u"0U)څ~CCjW5L/) ǡM/tPQ_9u1ۉ\-ƅy0h7%V7M/ZYu ƅnƅy\-jP5L/' e[^_]1f=L-L-UWVSjj̀jjÀhj跀hj諀L/fDžL/fDž 1ۉjjP( ~Ft=jhK/5L/n( ~$K/!S 9X<uY8C L{ t VWHrZYtAEPuWC YV:C Zu h=#V6Xc9s ts tC Ke[^_]UWVSƋO/C!wKO/XO/"8J.HJ.y;J.|J.PJ. hJ.j ,5Y[뵋>WoZÉO/F<w <tj<t<f~ u=CO/J.HJ.y;J.|J.PJ.!hJ.j!4Y[6h$.XZ|Wh#.O/F ^_tbP<O/v WhJ#t.>Wh#g.O/F Y[t'PPnO/$h$4. =O/"~1O/hR#4Ze[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@R#t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]h%So^_ug@-; CtcE.ƅUB@tUQMeY9MU~ #QRh%hJ.(Ãn#hJ.j w XZe[^_]U{tPPPhƛ#hJ.m(w$P/t@th P/XjUWVSSt Éֺ &"hƜ#h&hhӜ#.ou :u!USPfZYUu=$P/e[^_]VSh# j^UEuh#h&hhӜ#n@0h #1UEuh#h&hhӜ#n@0h7#1UEuh#ht&hhӜ#Un@0h^#_1UMuh#h&jTh΢#"n11f3A@=uUVSEu ]uh#h&j`uh#h&jah΢#mt0ffPh##fPh#"fe[^]Åt$1ɀ8u"UJRPRP 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4@&[dZYtdG (uh#h%h$hJ.i%4@&h!#hJ.K%C uhJ.j  _XFD&EsR@8t54V@Wa$WVVEP MU1e#sj@HEP8 susuh8# uhN# uh[# uhf# uhq# U$19D&t@ uRhɣ# 4@&hգ# XZ}tEPh}#w [^h0)uuh#Y,01e[^_]UWVS]uh#h0&h{uh2#h0&hh#j11{ u.hE#h0&hۋ=߶xtgtEWVhPs[u s h`#n=ts hm#HZY1uhȤ#-X䍕uu-WVhPsus h#t럸"=thPs h#xe[^_]UWVSSljUQ* ^t#u uSuW1Ãu V2 ZHWu uSVWN9uSuV} u V2 XV}2 co벉؍e[^_]UWVS@]uh#h &h8C@uh2#h &h9h#h{ uhE#h &h:߃uh#h &h;ŋuh#h &h<몋1 9Ɖ} PQh#9|(Ɓ tPQhQ#G 1jjh V = tS h fUtts h#_X1jjP9u 9t-uRh`#yPRh#u to@u h#qmu h#S󥍵Ѷx Զx9t PRh9#\)e[^_]Ë J.QJ.y ;J.|< tJ.J J.UhJ.P$ZYUYPPh#hJ. jDV/W|$wUWSˉ1҉V/M]m N&h}fU fUm]mURp pSQh-0h#hJ.; $e[_]g_UWVS]E }܍p(}p4EPSY^tSh#rXZe[^_]UWVSP]} CM% CSCt RPWG RPh-y 1t)Y18th-h#.r^XcCt2PWZYh-h#qY^}uzPh-YZu΁}ti=V/u\SlU\Y1҉UtRWZY@u\@Y8-tRh-MZY@u"{lth-h #oqY^uSh-l XZ }ye[^_]UWVSV/Xt.h-詌h-Ep ƃ \h-!jjEp&\ @Euph$p[^xP=(V/t,V/ 0V/t1=$V/ƃ}  =V/h-h#hJ. DJ.HDJ. yh@J.&Y@J.P@J.؃ t+@t( DJ.y h@J.&Z@J.P@J.Ѓ߃Yt\^jxt6Ph-HY[@u8h-h$o\ E *Ph-[Z@uȋE%=t[jhu GPhh-à uT 5 V/u"h-h$Bo\Y ih-跊GPhh-QÃtOGXW\`dt;`dE@hDžl-`dpt`d T`9иdT`Pjj\jjPjTjwXPg `1ɉ`dvRLP)TPS L9th-h$mXZDžX7)`d=V/th`d rPTjY^1`dhh`f/\ ƃ ~aVh`f/S 9th-h$lXZDžX;`d=V/th`dOtEp뭃=V/t#S\zRY^th-h$#lXZ\^Xu SY5V/t SWXZ=V/uh} tbG tY4V/9GuOxPS+ZYth-h$lY^$E9GuV/#G%PSYZuSZth-h$kY[=V/tWh- XZe[^_]UVS]hVsT u shJ#'Ƅ} t'h-چZth-hW#4k[^.h-V"ZYtVhb#١V/t jsPeZYe[^]US]} th-qZt h-hW#sh-ZYth-hn#jZYV/t1E ]]]US]} th-Zt h-hW#$s$s sh-eth-hy#3jZYV/t1E ]]v]U?PPPh#hJ.2jUPPPh #hJ.jUWVS|Ӊ΃=lf0u\0=pf0tR|Y_u%=@u"Q|h$WiXZOt#h|V^ =vQZVS莽Y_u%=@t=xf0u^VS_ZuQ%=@u?V&]^umP?XPSh%hS=΃=lf0=df0|8/uVP]ZYti|hö#UhSW^WYt=|Ph%hWtVWt|hܶ#g_XVSgpY^ lf0uS|@_ZuS|h#3 j/|Y^|tpj/SԒ_Zxt@xxVu@ZY|)x)؉t=9|u fDž.Nj|ƄPR^_x9Íu fDž.׉ދt󤋅tƄxPR蠺ZYu<|9u(;xu 9 u ;p=f0t=tf0hJ.mSh#hJ.bDJ.HDJ.yh@J.X@J.P@J.0t- t( DJ.y h@J.t_@J.P@J.΃߃YthJ.h#MI=|f0t%=@uS`S ^u@=lf0tS|_ZY#1=pf0 PSj|jtS=hf0u1#|`f0PSh*#޸e[^_]UE TET]=UE MQTU TE]=UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]Z=[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]<[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]S<[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_];[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_]L;[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]:[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]l:Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]:Z[^_]USU EAHtRSHtG t uF u:] M[]9t=f0uyDutJt] M[]%g01 []UWVS(Uf0 f0 f001d@DHLP4TX\x|hlEE8jj hd# SQj]S@u hͷ#js:Shݷ#!XZ=5g0FډWVRP#=f0t#RPQ e[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.PXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPf0tvv Rh#Ã=f0=f0tBjj hd#v\vXjUR;@Uu hͷ#j8RWh$à L g0AF`VdEUQRuui#=f0t#RPWQPÃf0 f0Et*=f0tU]Ã=f0u=f0tF%=@u FaÉ؍e[^_]W|$wUWVSEUEPdfEZuE#EC u=f0tECu}EUE؉U܋=g0} g0ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut({u{ tNV [[^]UWVS(]j&Ng0g0X=f0uEԃ}Eԃxu x EԋpP=f0tvv s h#B=f0F`VdẺUЃ=f0tBjj hd# RPj}W|@u hͷ#j56Wsh$ K g0AEUЉMMuuRP{#=f0t#RPWQEPv@Eԋxvs$EPh#j=f0u7s,h#O wsh#< =f0twshM#  F%= u9N % 1RPs4%1RPs0h#dVXN\=f0t3jj hd#QRj}W,@Ws(h$ "{(#=f0t#QRWPt=f0tF(V,=f0tF@VDF4V8\f0 f0Et#=f0tNVF=f0u=f0t@u[F%=uEA Eԋ@>e[^_]UWVS]C=f0tS D=f0t=f0tS(SDf0 f0lj?;-(C ;-~:P5g0 ^ZujJY]e[^_]1S -g0g01txux tF@-E-}E}E1҉U}9}~j}1EM9M},=f0tK(KS g0k‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=f0tS D=f0t=f0tS(SDf0 f0Ɖa -69~] [^_]șEș}E31tZ~u~ tIE9| 1=f0tK(KS c9U~U UBGv뢸 [^_]{UWVSP}f0tG X=f0t=f0tG(G\=f071Etn~u~ t]}~9,EEF,;-| 1ɉM =f0tO(OW Ev뎸 Z[^_]UVS RPuV u1\u󥍽hu󥍅\P@ t Sh]#?_Xuu@ t!\'8t Shk#?Y^||@_Zt Sh#{?Y^u@_Zt'8-tuSh#M? @a^tSh$/?ZYDZXt DhR#Ճ=0g0t%SDh1" ڋDSƉe[^_]g_UWVSÉ։ύEPW<Zyhҹ#X -y h#j|'t)tSuSu;XZuuY[etjux;jSp;_n#ju\;jST;ι#uDu<jSVVZ%y h#ie[^_]UWVS ~1ɉ=(-u,h~P50- ~fDžDžVhm50-v y%h#0jR 7fDžDžVhm50-- y $hG#h~W50-à  $hq#h~W50- t$h#`fDžDžVhm50- '(-tith#jgXZ fDžVhm50-C y"#Shʺ#0j؍e[^_]HyUPj XZËJ UWVSL]0-tP_0-15`g05h05h05\g05h05Ԍ0- yB9Tg04-u1ɉ 0-Tg0<-0hjS0- y"Sh#0j0-Pg01Ʌuwu0-Tg0D-?hhS)0- yy"Sh#0j询 \g00-t`Pg0tVJu0-Tg0D-0hjS0- y"Sh,#0j9=0-1uUhg050-_ZyNTg0!ShL#0j50-0-1ۉ\g0yP:^@ujg0@u75Tg0h^#j蝠50-0-1ɉ \g0 u)EPhm8@50-_ƒ tA:`t-jjj50-LBu@u ¸:t1h0 -uD=g0=g0 ~-a1҉\g0u 00T-(-17u0~~u 0ug0S}wt 0Huzg0g0EUu30t)MؙRSuuҋMu u0z0~~11ۅtFMEUWVuu蛻ҋMuu t 50u}붅u0(0T-e[^_]Ã=h0u =(-U~h~P50-. (-1$-=h0uNUjjj50- yh#0jȞ RP50- x11U=h0uh#j蔝XZ$`g0t5D150h#joUWVS] }1WSub ~ )ƅte[^_]UWVS] }1WSu ~ )ƅte[^_]UVSUM (-0-=h0u;QRPà ~Gh090tn0tb`g0VQRPà ~ h09(-5,-tVh#0jOVh@#jD ؍e[^]UVS] 5(-Su50-ƃ 9u$-h0~1(-h0tH~Wjjj50-)RP50-M 1(-1t8u 1(-1 8t8EuL8 uha#j(1ɉ (-[^18t8t8u%{xv$-h0=$-u Ch#_u5,-h@#j誚 y,-LSh#0j肛,1Ht u h#jh#jZXZe[^]Ã=g0:=(--UWV-whK#j_Xh0t h0h0 yPt 15h0(fEEEPhm50- xr(-yh05g0ujjj50-x3jWVRPK)WV50-d1ɉ h0=(- hz#h#jXZ1e^_]ÃUWVSPE1҉P1;EE (-h0jjj50-Ɖ׋ h0xoEU ug0] g09É}EjRP50-y%h޽#0jO(- )}Wt1e[^_]ÍL$qUWVQ1y(-rh0u9Dh#90jjj50-y(dh=#0j蛘(- )y11҃=,-~hj#ojRP50-h#` (-롣019MQRPWV豱U}uth#j(-XZUfEEEPhm50- y)urVh#0j託(-(-1eY^_]aUWVSJ.=-tJ.P/+5Hg0=Lg0Xu u1=1=-OhK#WV5050覴RPVhվ#hWB5050h#hV 0WVh#hV}}t^=$h0tU5050h#hVVh$h0h#hV(VM$Vj =-ubh$Ԍ01WVRP賳RPVhվ#hVOV5Ԍ0h/#hP20hK#0000WVRPARPVhվ#hR5050h#htW05050h#hVRWV5Ԍ0,-HP10h@#hPc8}uV5D1hU#S*%V$Vj薸 }*e[^_]Ã=0-y1Ԍ0h0h0UP1 |1t@=h0u7=l1t 01R5D1hq#501501=\g0tLhg050-ZYu6g0%=u%=g0u=g0u5Tg0G1\g0X=-w=1t -~ jPVYX50- -Z~jURP 1 |1t.=h0u%501hv4#1l1501 0-h0 h0u 1Ԍ01h0h0=1t,-1 |1t̃=l1t011l1=1ti5D1h#ZYuS00utjhRPnjh5050TRPh#501j5011Ԍ0ZYUVS Sh41j胶 yh#0j/ jSjW yhͿ#0j 5g0=$-B 5@g06=1u5D1h#R[XTg0hD-SZYjh<-SZYUh0C,-uPSh#hA#PShf#h#ۏ-wh#h1l1[^|tFu=0t5=~~ h~Ph;#thPhi#jYw@5Tg0XZx%0 0001001 y 0 0T-~0~UWVSX1t h#jp0=0T-u0yS0+0EU EUT-EEuuuugu})׋E9ƉM}u}WV!ZY+u} 0T- M19}k0U0;0s#50PY_00+ 0RP_Zxk 010T-щ 0}=000EU)001ɉ 0 0o-h#j\uXZ؍e[^_]Ã=P-US=-uh#j%uXZyx1ۉ0015T-5 0ZY~% 00‰0001+P-~C9}Ph/#jt Iu뙋]ÃUWVuM 0)ȣ0^_]UWVS$]CDž$$ x$|$x $=1u15xPu u^_y狳VhL#0jtPu@ZYud%EhU#0jvtۉ15T-5 0u cƒ  09|Ru -WQQRuk9uUy%^Vh}#0js79|$u9x$t h#j\rZPu ZYyVh#0jsNjE49}u;0th#뗋9}3t)1;x$|$}Ru ye[^_]Ã=0t1US5T-5 0ZY~' 00‰000=u.=1u01$x100X1]ÍL$qUWVSQ Q1ɉMMu u150=0)9}Ή50)څutċ0]؉}܍MQWSRP(Ɖ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u}001970+0щ9|`tt%u؉}9}M؉]܋E0+u}럸eY[^_]aUWVS] ~E0+0 U )څ~'#9~؋50}50)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu Y[uEl*DžlhhU#0jo֋ltE1҉Pd19} 0+ 0 } yjș9Ή}hlpPtPQ50u ƒ2E0x} yE} Gpu5X0=T1 td@9u 0Й).1];x$|$}Rhu  19x=T1t, u&Ed9$thh#jm 1e[^_]UWVSV 0019|1`; 00}h,#jAmZY1ۉ00T- 0‰0;E~ 1}}])1u5T-5 0ZY9T-uG00E 0~$50lj=0T-90~?E00 0E)։׉=01Jt[tTA100x,T- 0‰0;E"])X1EEe[^_]Ë09 0s.UWS0)105T-EXe[_]UWVSu] ~;0+05T-Zx 9~‹=0=0)1e[^_]UWVS1;EE }P0+05T-Zx5É9EE }]u 1=0=0)]u 1e[^_]UWVS]x$|$ $=1Pu )_Zyz9VhL#0jok[0+0~b9}P50u K )019|5T-|^yt7ho#0}94tVh#ji 1YuxPu #ZYy3ShL#0jij;Eut Sh^#֋U Ze[^_]UVS]E xz$usPDZyVh#0ji$tAPYy$Vh#0ji$聬 1$ 1Ze[^]UVS|]s|PV VXYxS=1t1F $M9$$u0;|u(,$U90$u;EuVh#j2h 뻸e[^]US|]EPSUZYy1=1uOE%=@uEhX%SZYu\SYy} tnSh#0jh/S@Zy501ٵ<Sh#0jrh̋]UVS]EUdh1ɉlE Upt1x}=-t =-|PST^ZuZ=-u#EUdhEl=-u$u! PVXZ=d1u ($jd1 - -t[j $P3V%A=-u =-t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSuu hl#E18}t}t:11E16SVu{ 9Ou h#i11E1ҍCtPR XY P͖ Yuh|#jP[XZ>CPVЉUP EU 0j\̍<+E e[^_]UVSu] }u1NjjjVy Sh#jh$1V yiSh#0j[e[^]UVS]u x@P赁X=1t*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu  ~ pt1@9uNjt9|$up9x$th#jY xPu ZYy'ShL#OT$9X$u;t h#jjju Wy$Sh#0j Zp1$1e[^_]UST1tPv1ۉT181XD1um1 DJ.yh@J.mYu9@J.P@J.9-uu%1S H1 t뭅u oډӡH1<<1u<1 B<1tϋxyRZV붉H1j5P1hH1T1 ,1]U=1uP1=1tP1=x1t P1@=D1u'h  H1Yuh #jWXZ1Bt1t9UVSut>uh8#j 輒 XuhS#j?WY[FVEZH~ 8/u3E ؉C1C=D1uD1@1X@11e[^]á<1t@=1t 41=1u4=1t+UE$u81tjP5T1λ US=1t8D11t6{u+uhz#jVVXZ3h$hJ.蔉 [Ƌ]UWVS]=41u =T1<1541 @u=1u95T1ѵ81Yu @uЋHHQf $|&@PURURpp p0]9xjjuuuu81p ph#jfUph#h#p jDV Qph#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=1L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPy y$81pVh#0jTƄ  ǃ$h 81pCPWh 81rP55D1h#e t1<1@=e[^_]W|$wUWVS<ÉUMMQEPfnu}j( 9ƉЍM}Qh+#Qh5#j@Sue[^_]g_UWVS\]u=1CEuPh$Vڅ ue[^_]à}W($ۈET$X$(j8$z!Ej<$O#Uud#ud#PjRj4$WhA#VX$ w'@$  R%PhS#|$x$h^#V uEPh4%V$Pw She#u Sh3"V辄 Vj iZYV褟Xe[^_]UWVST]}T$X$uV($葇SWVhm#Pe[^_]UWVS]u fVfuP#Zt%t0SRjP}WRVW>Cۉu ]e[^_]&e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=1!u%U1hv#jLXZ1ø1UWVSSu] E}MM1҉7=\1u)S\1:-uX1 pC.=X1uA \1Q\1u \1X1UWPZYtAU:uC7tMM}E] ue[^_]鍢E] ue[^_]W3h#(x:u9pC.9}7@pC.W3h#hJ.?e[^_]1UE E EE]钽W|$wUWVSjEPS?Ɖ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uh#P>_DžuBh#jPJY[8zx1҉P= 1uf 11tc߀?t\j,W[ZÅtj=W͎ZYuh#Ej M YUuh#jIV蒍 1B1e[^_]UWVSQÍEPS-r^_uC 1%Ƌ]| tC]SԄ Zu11 KDe[^_]UhJ.h5#jo-9t BtU-UhJ.h#hJ.hi#rhJ.h@#chJ.h:#T jnUWVSPuh%S"{ZYh%S3_ZÊEhV(YXu/Vh#0jeI }t/1e[^_]UWVSlj/E 0 _ZD1t@E D1h#P[C[^bD1#\111҉U11ɉM11Ejh`-hJ#u uKzX$&7!057h#f 0렸1P-덡78-uxu1Tg0EjTg0[1QPg04#B13x1$1-=-u:#`@}1`11=1u `1d1-c1T57;_11p1a -HPg0%9`171$1Ex9~/pPuU EZYuh#jEjkEMȋ71P}Pg06$1\11|157,DPg0s#gTg0-XTg0-ITg0-:Tg0-+Tg0-Tg0- -7Pg0$11=x-1ɉ 1575CZ411pC.E 4-umu}t 01J.01J.Hw49Uu }uj5 CL-11t HuP11E`hx#jC$h#Pµ[_h#S諵ZYF1`1}tE8MMYEh#W[ZYE@J.t&hpQ#WvEZYuWh#jC1E1EEYE}tES裆 [h#uڴZYu`1u| XEjh#u u@`1t EtSF [EP6u/ XZ1ɉMEHjSu E&EE]}t EtS҅ [h#WZYt u[=1lW5E.j51Ss ^E6~t1C}11ExM}h#SpZYLFLjP[_}u'h#P+[_u^ h#S ZYE@J.ur1҉UE5DžUuzuh#SֲZYt u؎_=1tSh#{E@u}jPZYy!hpQ#S)tEY_vS6tj.h#W\YZt2jh#W艱 ujjW_Z*jS1ɉ P-}CTg0t 81h.#ATg0Zt 8Tg0"D1"11jh`-h#u uz$&1-ă뿃7057h#11x7Tg0f1 TPg04#E1@31΀1 7@7tjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh#j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 5D1h#5[_Vh9#5hi#5h#5h W5hS#WZYuh#Wܥ[= u h#:5Y덊uh##5ZX<.uuh#5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDhQ#j2|tHL@t<uDht#hJ.e WDh#hJ.et@th WD0 1e[^_]UWVS]t K΄u h#R<\u FFu8uSh#j1 Dž~j8m Xuh#j1[^GjQPә t5hVPSVh#ji1 W)u YpV֊t\uF8tFWt Sh#yR8%ZV1u,Wt h#j0GBGtVuhJ#jk Xuh_#j0[^C31CVZC 1ɉKECE C= 1u 11X11e[^]US 11t6Cu+uh#j/XZ3h$hJ.b [Ƌ]UWVSu 1t$tS=1u S1u=1uSu $uoFP>#Yuh#j /C_Zt/1s\Ct/1ɉK;WZC Hǀ?/uC C$l 19tP@uh#j.Y[CSWr 1$Z-e[^_]UVSu1ۉ$ 1u,=1u1=1wC |/t[t0CuPFP3p KVPYuɡ1u #$tV^Zt 1$e[^]UWVS]=x-tes{.u{.u Ct:#b1e[^_]UWVSQ]t:t4=1u3Ujh=f 1_ZUuha#j'[^#t.\u{#uCSDF YuSh#j& ʋXj jCS3à E =11<7t 9t&@uja Zt p h#b1e[^_]UWVSut>u h#j/V[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh#j% RE@j7a Xuh#j%Y[.t;u GM1GtAt+@uVhf#%O}tgE8t_W@uuh#j$Wh bGƒWt+G 9OG}Vuh#j$Wh 1G=1u=11x=11 h#e[^_]UWVSM=1tPÉֹ=1:t9pt@9u9U}tj_ ZUuh#j$[^1p1ɉH xe[^_]Ã=1u1Ujh Mc 1YZt1h#j#XZ1UWVS}1$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj^ YtGGP,Zt0 $$$CSEC ECECEC1~Sf YhB#j"XZdUh 3 Pz $Uu-$CHCwC38f S2f [^̍e[^_]UWVSM14$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3e X]e[^_]se e[^_]UWVSS=1t51ۋ4t#1ɉ v0E=e EP4e XZuC u͍e[^_]Ã=1UWVjhG` 1_Zuh`#j!Y^C#=(15,1-5,1Z@u螡Vh#0j! VpX1e^_]1Ã=1u1Ujh` 1YZt1h#j XZ1Ã=1u1Ujh=_ 1YZt1h#jP XZ1UE$$ $]UWVS(}u=10 $$$EUE 1҉ẺUЋ,$0$1!!ډEԉU؋E9uE9t1!!ډEU 1EE11ɋEUƅt6@ ]9Xu]9t@P @ $$$NEU#E#UЉE܉UEu1Uu1  O $$$ƅE] tYE]1؋U]1 uEjKZ X1ۉY $$$AQ F AN tX1-t"1111uϡ11M̋]!!9ur9unt`11utLUjY Zt=UMHUPX N HF $$$EԋU؉,$0$Wh!#jh\#j1e[^_]Ã=1u1Ujh=!] 1YZt1h#jXZ1Ã=1tDUVS110tjjs sss3[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ 1=1Et#؋M9Hu9p u M9Hu9xt@$uj($X X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R-` XE #Ee[^_]Ie[^_]UWVSEEE EM}1tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3{_ Su_ XZ1e[^_]1UWVS]}E=`1t,;/t'PS:^ZuSh#jT |j$V Yu#Sh#j2 tXue[^_]^ S4ZtGFG4W8F VG(W,FVGlFF 1F51e[^_]US1tvC1=d1u{ t s3賴XZ- -tjjssss 3=|-t s3YX3 ^ S^ 1XZ놋]UWVSE @~}DE@Eu119}1Ҋ LBuEC}t#]1ۉ]Mэu9s F^BE1uZY[^_]UWVS u=1FhGSPG <9tjww 5-uy;Wu;G t hD#*SR5-{ 9؍tșh\#0j SRA yT$X$G9__W1jT Xjjj5-xG WxNS5-J{ 9u)T$X$GW1W8ht# h#0j$ W[ Xh#jZYe[^_]UWVSQ1uh#jXZohu u Eޅt6uÉY_tcvj S ^t;u ƉYt#u GZt _E81QV+[ XW$[ _h#jN[^0^SuNZYtSZ uE F_Zuh#e[^_]UWVSu} 1t=h7V t&3VZYuusV蛥 [֍e[^_]UWVS1ۉ]U]u tu} 1҉EU]t} t} u^ <^4^F (Ku0CEUEU}t9s}u9rKC0E}1 ۉZY[^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=R.ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u VhD#h S_CSyEVhL#h S?CSy=VhW#h SCSzyVhe#h SBSZe[^_]USSˋ t%RQP=E3)X 1U1ɉ EeveRu P  ]URPhp#j Ujh豨ø1҃=1t1UMU111<u @=u3} u( A=1t1AH]UVS]} ~;uqjh#P軄 u%=-u -h#j@ZY1-jjPƺ 9؍e[^]UVSZÅ3h#VZY[uhD#SZYt)SVh#jhD#h#h #j -vSVh7#j1o1e[^]UWVS]u hV_Z@ub- 1{ǃ4$K<vCVh11 | Rh11 Y jjFdP(%($jjFlP8$jjFtP<$$jj F|PdEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1҉$$$$ 2t8,1ǃ$ǃ4$($Qv`ǃ$($ Kt $x$|$ށ1$$$$w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%1҉$$$$1|/uDe[^_]UWVS u$Hwv$&=1t_h]#j h#h#h#Ń d~ Ph#뮋XcV~Rh#땹1jdRP1$$$ u#EƄ/ojj 11#Y[1u9E2jd PEP苝ojj 11wE1Ex$|$ƅz ӍynHʃ0Pu uo9uhH#9rH@0%1҉$$=1u =1t 11 T$X$W($1jj_Z_8$1jjZYg<$1jjY_{jj _Zud2M1jjhZYuDhSV[_y>jh虡ZYx鋖$  Ѓh##'e[^_]11UWVS}} ?jh#V} Åulhe#V~Y^¡1 1 u1hm#jE XZjjP虻ƺ- 9tPVh#j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPWnz/@E K<vM E)Vh11Mȉ Rh11  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)PyjjFtP<$ Ɔ(8$P P]ZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2hpQ#V4_Xu$豁0-L PVhn#j[@J.1EPSh)ZYt/G}vEVWh#jEUt@J.u1 SNXe[^_]á1t UU RuPͫ51NUVS]u F51tRPSM tD3j SDZYu1e[^]US]}t X1|1 1t=l1thJ.j 1l1ZY5D1hp#hJ.2Su hJ.hJ.j  ]USjh #%Y[xEhF_$PI1YZt&hpQ#SI1YZt1351WMZS`&X=1th #h#j ]UVS] u}t X1|1 1t=l1thJ.j 1ɉ l1XZ5D1hp#hJ.1VuhJ.~SI Phq$hJ.1hJ.j XZe[^]U}Ph#hJ.1j0$ 1U}Ph#hJ.{1j $UWVSƋ=81tPh#hJ.O1 =01u ЉˋQtjP9YZto~8tɍEPs4XZ=41tVh#^Xjsjs%} ud#VWPREPh?#hJ.0hJ.KDJ.HDJ.[yh@J.LY@J.P@J.؃t- t( DJ.y h@J.LZ@J.P@J.΃1Ylje[^_]UWVSAօu"VP#_ZtDžF%=t1jh" @txPTY[x^9|u,;u(^9u;F u%=t|W"Z<jjj[  ׉NX^\19ȉ}{ 9}Dž 1P  9+{!Zcjjj [G? NX^\19ȉ}{ 9}Dž 1P; 9+{ Zjjj3ZnfNX^\19ȉ}{ 9}Dž 1Pd 9+{ Zjjj\YNX^\19ȉ 9}Dž 1W 9PPWJ +^_jjjhX~\vX19}p1҉ u݉19} 1QP 9u#)B[@ @1h$莐ZYuXe[^_]UE @E E@E]IiUVSutYS} u C tC01@01R: s: S: 01H01 u,1te[^]UVSu01@01`1؃8t VPjZY1u 01u,1t e[^]e[^]UVS`11؋tJ9tFjPZY1uԉe[^]UWVS01@01ƍPxY11ɋ`1tx?tBA'u9t h# 01u,1th jVSW219}Vph#p-HQP yP-H Z J GSjXe[^_]UMtA'1`1]UWVSu^Nj7t#vugY[Åu jWXZ ׻؍e[^_]USh7%JZtaujY1"41tP{ Ã1X؋]UWVSP}U UWRW"ơ01@01$TW舩C1҉S URwC01H01u,1t e[^_]Le[^_]UVSuV[t#sVeZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY118u&S;u0h#5-qXZ1P1uj=CP8Y_uyjS5_ZDžuSh#5- Sh#&w%-xWP yPl -H YlJ ]@PS3XZKe[^_]UWVS5 1R.DCtVjEPVUZ11] &8KȉMA&uV)PRh#&tK11C&u)BUPg1NjU1Xu,Ƹ^ À~|tH;= ÊVθ(,)%%#$Ƹ Ƹ^ 1e[^_]U51Phe#UWVSQ5"11"1PIÉ5"1^=F-t #uKt;u[5&Xp1҉jEPSvWƉ?p 8uE8t+*p8t#`& tBUUue[^_]W|$wUWVS ÉUM7Hw$4&# uu #!uME5 #tރ uWVuu  WVuun  MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=1%1  UU6EU=1&t #2E11MQ  mWUEaYutu]ƉӉڍe[^_]g_UWVS(Ɖӡ11EЉUtUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh"j]SjSuA e[^_]US7=1)u c[]W|$wUWVS4É։MЋ?E1EăH311V]ЉE뭃$" "tCك<E4EȉU̸#=1# wEУ1tV!EȉŰEЃ'wF^1ƒ}'u1EURPh"j}W0jW6 EУ1 11V]U]11VWEnY1 M1ۉ]11VWE7҉EȉUX}t # n1t VEȉUU1Ɖ׃ƒ'u1EȉURPh"juV&jV51 #닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sá11EUUV01Kw\l&8l&}GVQ1YYuRPUMY_Kw#l&9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ 1AZwSjƉYX=1uRE11MQ  SUEZ  !1e[^_]UWVS}USFƉX=1uQBE11MQ  SUE щX 1e[^_]ÍL$qUWVSQ q}W軝51XjLP*,ZYt5xIu,xNu&1҉Uj P ,ZYUtB@)։51@뽉1 1k1=1t -#EЉUWԝEЋUԍeY[^_]aUWVSRE} d#_--11HO;t(1sx&軞P ωʋ71tx BM菞P M҅xJ sH+ -Q舛X5"1SƉRPh$ e[^_]Ë1Ѕt /tt@11 @1US]u1Z;/uPhX%ZY@tEPS~ZY@tҋM9u;Eu3E3U ]UWVS}V蚚VP. tS[ 1Y]e[^_] SeZ8"u뺅ue00 PhI# e[^_]UVSu= 1uE=-t.1҉-h`#}PYZtSΙ 1Xue[^]3e[^]UVSu3t = 11tP( Y01@01 111 1jR01H01Zu,1tG = 1t,j51h]#j5 1h`#jh`#m[^1VS@$1VPI--1 >/t[5 1>t'1H1FxFC蟛XVԀ~/u#1KhS#VEUZYu$-9r :ƅuh1K;/u>thX%V UZYt 1x/4)X/ XV>t1H1FxފFC9-u 1x/C ܚX/=1uȚ101@011tP & X 115-舗 1j51h]#@j5 1h`#.01H01u ,1u@e[^]UWVS} u01@01uxYy 01u,1ttj;á01H01Zu,1ttt hd# Y0t$=-u =V-t5 1h$gXZ1ue[^_]UWVS-hƅdh#葮Yt =l11=P1u 1P1=1tVW=1tVW_X=1tVW8=1twww*1ɉ P1zjwXZ1=P1P1fjw_X=P1tQP1E=1tgWfY(jSW Rh#:h-V EވE1UR脇ZEPՇX1t=-tP1t }tPtje[^_]UWVS} E E܍uV׆5"1ju\1jY=-tKt>=-u5tUVUt E PuRXZ=l1u V袆X\VZu1P1tje[^_]UWVSWE} _--11HO;t(1sx&ևP ωʋ71tx BM誇P M҅xJ 莇H+ -Q裄^`1PS|ZY1P1P1e[^_]UVS]h11jshXZ=-l1tKup1Hp1t1l1up1Hp1W1ۉl1MwE5P1=P1; ut-t)E Ps5P1l1ZY[x h15P1e[^]UWVSu=P1=-u1EPiE؉E܋^Yt$hPS.M =l1b[E؋E1҉h1]؅6F"1=-P #1PP[h#Qv I-xWPyP-H =_ J=s--xWPYyP-H X J 5-W_jsv E Pvk=P1=-uJl1t:up1Hp1-1ɉ l1Hu p1Hp11҉l1 h1=P1EPpXe[^_]UWVS]uV趂E؉E܋S "1jPs{K[tt=l1uk{t_G"1EpWPZYt@1=l1uA=-u81; u{C"1u s ]P1ZYt‹띋[1P1V譂Xe[^_]UWVS]} 3EsdX=-{5"1 #1P褠Ph#Stj RU5-UR h#Xu h#X-HyP-H X J 5-(Y01@01u"jS*fEPSRUztUt,uveuu 01u,1tjsKWs$UuR\e1҉P1 RpP1X 01u,1tjtJ=-tA{t;5"1 #1P1Ph#-Ee[^_]e[^_]USD81EE1EEppX=-tlExtc5"1 #1P赞ZYEP($#[EXtj S5- [h%#[5-tXjEPZYtlE8141j7XEuKt&:EP$,#X5-XԋEtP1j58101@01Eģ81j EppXZ1ɉM 01t5u EpY[01@01E81jX 01t,1t뻡,1txEt"EP$6#X5-LZ]UWVS}] 1CCC =-EP~01@01E^@u h>#VjWbjWPwu31ɉ 01,1tuju(jWu}E؉s 01H01Zu,1tpEP ~Xe[^_]UWVSE ,1@H#1X"1("1$1`H1EP}X1L1E@"1ptEXt7u!C"1hpPSE 1 sB_tҋ[ŋt1ۉEp ^x|EXtC"1sYu|1҉4pjxPS E [븅t4B4닅4P.{_0pt0J0H 䋅010T=-t"=d1u4~0@T40)Љ0=-u 4}fEED 5"1 #1PAZYP[x1ۅt--HyPd_-H J ~j=W Y[Åt?v{Z-HyPX-H = J={=WAX6 ept@t--HyPX-H J vX6 뼋Ep -tRVPK t vHyPhX-H J 5-_uxsjh`&V4 u Xԁ}D ``041 Huw)4)400toX4t-X`0QRUR0of}Zf}tJXZ:-{z-uzu apu CSu>E `tfE=1u Ext,AEftfwE= t=D tgˋE@ft501@01juo][^#=-tf}iExt x V#1H1ɉ #1H1DXÃt t7B 01tS $hO#,1t}jEP_Zt.41uH1j1uP1PS@81@E81h!x[^8<5H1RuP],@81H#1=H1H1ujjSM 8"48t448t*48 uxPWKZY@t 3WPiX뀃 h u tCƒv~ 1PSP6hU#jUWVS]} Cfsftf$ftgSH#1$jV$PN P|hJyӅtsh#`XZ Xth#_t h#YVh$"XZt h#XVh$Y^tq01@01sP$P`01H01 u,1th#3,P'h# PVh#{ t--HyP-H *Z J*-HyP-H X J e[^_]UVSu&t"8u%uCVP"ZYt؍e[^]UVSu&t8uVP"ZYuCݍe[^]US,-1ҋ1tHft fux@ |u[]UWVS}01@011t,Pfu9x fu9=,-| P X҉΍^1t 01u,1t e[^_]%e[^_]UWVSuH#1XE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVh"#qZYUtU~:uBC렡,-U҅y E,- !WE,-Xe[^_]UWVS01@011t!f{usS XZٍ݉w1t 01u,1t e[^_]e[^_]UWVSutA%<11tCVPs ZYtdߋ} tX01@01VP$=cÉ1fCC VCP01H01 u,1tB=1؍e[^_]US&tjP)f@SPXZߋ]U01@011 P` 01H01Zu,1tUWVS] j/u0^_t[EtFxPuEZYy -8t-8t-ffCf1CrƋMH#19tMEth!#QY_tM ju_Zt@HftftfuEu6Eu E u=,-yƀx u1E\tE Dž\u =,-yuGYDž5DžXt,-f~tFXDžTDž`juEP` Wa1Zu?/ugX9`Y@Ph"#KnZYtuYDžt51h*#!nYZuzX9`hxPW^YZy.,8B+84+T"E%==1tlEWLȉ`+-$Q`WU_ju+ƃt fx`tWuh/#dQWBcXZ01@01d\ujuY_f~udfF`FDžT BtEt$jTPuh<&5-"f`z01@01d\uju=XZf~udfF~ 01u,1tF FfF CfF fCFCe[^_]UWVS(EE1E11E111EhD#vEZtPE܃bw$h&1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEE1: E؈E11tIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5-s^-@hN#[EjWVZYtY@ft8*fuu<1P18ufHu("fu}}t̓=,-x tH#1fMfMPu̍EPW EfEփ}t f@ E܃}xf}tjWY_t jPlXZ(OE܍e[^_]UVSu 01@01jucË@ZYft&fHu sXfCFC fFC FC 01u,1t e[^]e[^]US ]01@01fEEE-fEu EEPSL01H01 u,1t ]]UjuZYtfxup)kX1UWVS(1E11h#s_t'ptvtV EѾʋE ct ]tPh#nt h#^1ۉ]ԋ 19d#cuz#QPh#/uSY`&uwjSbXZh#j w tmh#ſXwh$0_XuY1P1x 8u SPYZthh#h#XX1딡18t-HyP -H YwJ h}ujSXZtGfEGE<H#1f}f}U؉UPjEPSEfEEE؃1f}f}t f}f}j/SZYu^H#1}tEM؉MjSEPEPYMIy߅ud#t#Ph$#蘾[_uljS9ZYuuYhջ$u_Luu#0w Ph\\#W %u%h+#uhA# uhV#譽Sh$ZYu hs#舽XEE~Eԍe[^_]UWVSEPY@1+-P X -^_}GE܊_tqtg}tb} C<v8u1:t* t/t<EP4Y[=V-t"E u 1xA gZH}낃=1uOZ1-8u(hh#YYu3P Z1t p P EPXXuEE %E1F^t\}tÊ"& <vC< w 1@1yYH @1 1@1yYH @1AE@uF9utm&t_U9UčvsՉ‹EĈ@ȉƃEM9MMP YPEP/ EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQIZZYx>EE1EE׉E1҉UURMQZYZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=1Uqxvtu@r t@;}u51[xP51WZYy9tt1t9s'@ZxvttE]S@ϡ1;EtP9Uu8/t]C X%%PX E91t@/Džp>t F1ptJxw@tu@o,1tSMYpF/SZt؀x .u o.ux jWtJ tptWuL51@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu$1sk^<*P@1@1+-uuuuSuu%@1+-ʉ@1)@1uX uuuSuYeuXE)؋"1 Rh#u܊N#uNQSHPRh##u E܃EEPSE)HPRh#ëW@1+-Pu }tzM]u EMEtZ|wt<1<1׃uY]Qt@뿃uHus독tEe[^_]UWVS]E %E1ɉME tE-#1u #1E@1+-E;~uE t u S=XZE 1Es}B~< O$,&:=J{s{u{y{@u{=uz1D1E} t 1@1y;P@1e s 1@1y^;P@1"1 1@1y8;P@1 t=D1t"@1+-M9~xuH@1 uE uE 11 1@1y:P@1҃}u C< w 1@1y:P@1S 1x@1H @1Us:H @1U߈ ts"1E#E PVu R<1p<1<1VvXU 1x@1H @1U9H @1U߈E {~=u}1Eu V[X u"1 1x@1H @1Uu9H @1U߈EE RuZYE @1+-jPHP pމe[^_]UWVSEu ]=&-t1҉D1P <1-@1-11ɉ ,1 (1P"1Sp1_Zu#u8@11@1H1@1ys8P@1@1+-P}5$1 1XtXZEu EL}tzKyS]P _ P KyS;P|^@P|4M}tVhh$S荅 iEM0EKySP Y P EEESqEZPe[^_]UVSMt0t"119};ivuC⋉11tJiD} u&ƒu=t uă[^]UWVS utF>%~W,[tW,XY#*Ft~uH<-tB<%t<+u:-#-i1 #11E1MxdtS~J~?Hu(UFPQMcYZMUt UQW"+YZUu뗅uV+ZtjV+11XJxRt~i90tM΅x291~*i1t"# #)#1ۃ} uVP萎؍e[^_]UVShd#K5X=1tYh7#r-HP&-H YwSs1Z8P1xj10Y^u hG#BP+1i5rO@Phi#) 9DiPhh$FXZՋJ ;1e[^]UWVSQ111Uhq#-4ZUt%jtptg Ժ;ƍ7H~hu# 1tyt h#UjPYXUt 1t+1i5rO@Ph#t"Ph,#XZ1tnHi0i0h#Հ-HQPFY_y/P#X 9~ -x99z 9~ z8 ܉e[^_]Ã=1u!UjuZYu11á1u!1 1Jxu 1øUE=-t@=1t7uR+1i5rO@Ph#5-UWVS=1t.511NxtSX1111J01B01uh<ViP)Ë11i߉_19~i9uFP蠧 ^11iƄDŽIu1 01u$,1tЉt 01@01=N-1ɉfǃ14؃} ~iE PZ 01u,1t:؍e[^_]UWVSu]=1u1ɉ 1811SSrwXZu11}=-tpt u 9W8Wj^X}u-W5-莓ZY@u0t hPhB#SjpSjp*}u$Sj^wSjVwtAt8t$=-tSjpSjpSjpuI1=^uj݈jhx% thx%hw#?}uke[^_]US]U M=-ut u1uEM E[]UWVS}tE1ɉEPu EPE t!01@011E1f81tt;E܋EEEEi}9r(}i1M9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉tcu tQ=1t1=-P;u uEt tEu- 01u2,1t)h"}upuEe[^_]UWVSjjjà ~ jjj=-tQCtN5-ZkS^9t7aSP5-ҏZY@u70賩 hjPhB##11951|btPu=1u>SKX5E t t&tt M ڋEsF떍e[^_]US1h#h+Zt$ltptZu⻀ۻԻ͡1u t8t Ph$im^j`mYV=-u =V-u@t/jP‰١-1P1@YZuS5-DXZ1]UWVS411ɉMh#*EZt+}nt}put h#裃=1E1Eă}u18Eąt2jjW{ uWh#jWMY^t Wh#@1Eȅt}E151 1Nx.}t 9u1҉1ủu؋1MjVE^ZMu u؉}tKE؀u?MjPZYEԅtjM1Wǀ =-uXE؊uẼu؈R1M ƒ}EЃE…tEEËEȉEԡ11U1Mx3t#t uE܉kuñȄ]܅u@1E܍EPjj @u q耉E]܅i\9]t}tLjSPY^Eԋu5}t/1҅tHi4h#juV艈uS#Z}u}Mt7}t1jVW~ #}SXEԍe[^_]UVSu4á01@01ujVjQ 耾t-S5-觊ZY@u0荤 hPhB#u%+1i5rO;-t ,jVY[=‰tut čt ujZuVX 01u,1t~؍e[^]UVS=1th7#jPXZu hG#Ph$rsY^9~iPhh$IsFXZ١-HyPq-H Y J u5-^Z@u0 hPhB#u~01@01SSË01J01XYu,1t}؍e[^]Uhd#$X1US] hd#$X]1 1uPUS119|:t%uh#q1X A1Ë]UWVS fE 1E1E11}uEE@<}%<a~<w=$T&)`-&F<=Pހ<'<\"FEF1FEv t!3#< t*#E0 wEA#< u=#փ8t "B;&u11}~ uxFEp"ntj@-t ɉ1:QS@-<}t!~u9SCE\U'$G#"M# $D#1E]CMt]BBuPt}t E"M@EE1E1 [^_]UWVS]} =13v$x&|$jsZYu hO$Xh%[_jshd#jsshi#f[ hn#T^hn#I[Y1벋st7jv3XZ>t hq#X6jsjs u7{t1h#Xhc$jsh`-&1~[(hu#js u hO$_hx#js { t&u hO$f^hy#[js T u hO$@[h#hI%#h#$XjsZYu hO$ Xh#js u hO$XhZ{%h#s h#jswh#js h#Cph#zs t=jvih\m#\jv U; uh#h#9_vh#s!h#sX#1[#%1a#1^#1a# U#S9tRh#j}WlWVC [w*yh#:Ph#j]SlSvjPiZYh#h|$NXe[^_]UVS]u t3u h%XjSZYt{t h%X[ɍe[^]UVSEX1=-u=-u251ju XZ=1 D3...1e[^]UWVS}]51t/1}t3=-tޅttVSYX}u-t?Hi@@} t u P XZ؍e[^_]UWVSP]u }etu,EjWVSE#M0ɚ Ph#>vPWVSe[^_]UWVS]t P1 =P1dPXX#1u \#1 p#1`[1\\9P1~jh&`PΙà u\P1dP_NP^؀;18t@x/t9@xPS;ZYy1EЉEԋ\1\u941E[ 1u#e1:tt@u=1h#S范^_19-T!T-51߉Sh-xWPYyP@g-H X J EЋUԋ\11\ke[^_]UWVS}WY}E11tb=-u5}t/j5-4jh-Xf-1PaHZ=-u;1u{=-uru=-t`=-tWh#qgXF+t'=-u1҃=1‰1jPyY^1WZ*u@WTXe[^_]UVSU:01@01jRrY^x jPXZ 01u,1t\rx=f-t01=-t -1ۀ=-t-11jjVj =f-tt-t-e[^]he[^]US]01@01jSqZYxjP01H01ZYt Shw#q,1t~qjX]Uu}~E p P:ca1UuT Zu h-#qUu uK ZYu h-#rqUVSuV辺@$VPL_؍e[^]UVSEX9-}]ށ}01@01FPb-P-5--01H01Zu,1tip01@015--)- 01u,1t4pe[^]UEuj h:#jn_-)--UE--P-P1P 1P1]US]01@01-9t-P XC-C-C 1 01u,1t ]bo]UU01@01B1R~01H01Zu,1toUWVSW -\ k01@01=-5-1thG9ua-CPW¡--J -+-1-1^^t5;8u1H+pp X@MSNjM󤣐--X 01u,1t e[^_]Ine[^_]UE01B01-)- 01u,1t]n]US--1-[]US-+1-)أ1-[]UU-)---+U У1]UWVS,ME 11˅t MP+ZMwDGƋ܃}tE0v hE#mFPKE0u _E1t0wLG VȶYMVuY[MM̋3XZ̋EЍe[^_]UWVSD`111EE hb#E_t/}pt}rt}duܡ1EЋ1E뿡1E؃8u hh#ljTE^tt S`c[Ejh<"nEZYuE7?&EP5--1X1EEԉEĿEÉEjMQjk HMt EU߉Ӏ\uA}\}u:jQjok HuE߉< uO}tj/P_[X9UtltRUuZYt%URh7?&߉ZYR}] 1xF $p+-E1!=1u 1}NE-9r,>Wu]ZYtWh7?&LZYuuƃ}tjuh<"ki j5-E0Vi EE؋jh&P݅tT}q 1)Otދ1E؃xu*EJ1xF6p'ljUh<"E0ĵZYUu.J1xV P+-RE^,u1j5-E0gh E5--11ۉ]*EP EЍe[^_]UWVS1hh$E[t01@01jOPG01H01ZYu,1ti11rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPh#]Vh# ]Y[ ȃ0 wF1҉U1ҍpЉvSh#&T1 EGuԃ}t{Sh#Dh01@01STXtҁRW]SW% 01u,1tgu0j PSh#gҁRY5-SZZ-@th#[XEEe[^_]UWVS$f11h+#QEYt(}St}at}Hu׃Ҿˋ]E&E؃8t@9tE Sh;#1Mԅuxt h"fuh:U#uE^Z|u1ۉ]܉]k] EډӉM܉]FFHЃ w!̋U9и EsuhO#ft uhb#EX 1RShj=Yu9UrMˋEÉu&11EPC P\sCP3hq#gZtWEUE܉U}uM}uGh:U#2ZY t Phh%ZXZu ;u EUE܉U1C 1RPuuTXRPh#Y 띃URE@ P\ZY@Uu:0趉 Ph#G}t]u]u ]uuRE@ P[[^y0m Ph#dE؀x u_jDd1*tEUEUuu h# YY$}O 1SQRPiWRPh$X 5-WZ-@th#[XXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSM 9t#t9uƉׁvSh4#Sh#ce[^_]UE0 w @8u1]UVS]1tS躬Z1tpVh%SF ¸tVVhb#S, ¸t<uh"St Y^¸t0 vSZe[^]Åt2US-t1:-u-Au-[]È-U-PPR-PXZ=`1tM=6-uDPPc`1XY&u?#jPhL#9a UWVS}] FhP#U_%1ۃ<-u,-R-#RPhh#8Vn#Cuġ-HyPT-H ^ J 1ۋ-t#t#<-t"RPho#U Cuhy#:U[1-:-t2-#t RPh#-RPh#uU Cu-HyPS-H YJ vu&hy%W^Zu-@uK1-tPWZYuډe[^_]FuW#Ph#Y`e[^_]USMU 1-9u ]R@uQ#Ph#`UVS]Ct&st P } XCEe[^]| e[^]UWVSP]1ƍ@uPXtUP0UBX1h1r151=11҉1Ye[^_]UWVS }t151EE519N 1BE-uB<-uzu+t 511ۉ؃EEE@tcu}t11ӃouUE8t E!Pu"Ft51U!RPuSjGY[+#Ph#W^ru"}th#`Ph#Rjf^SPXZDu)--u~uMe[^_]e[^_]UVS] C}أ1V-1-@uV-jMX18u=1un-=-u*=n-u:j ^tjYt - =-u=n-u-=-u --1=-ut :-u-1 -u - - -@uـ=n-uC=1t 1u<@1X1P11jPV1X1XZ=1t6뻋u h#\H 11Pt1111111ۉB9tt 51 1e[^]~U}ujjjjVE01@01jL1Z8tPX 01u ,1u1U[UU0 wj jR' Hu111UWVS}uEt ]uQ t9-u Ayu+UB1ۉ1ۿE?5Y]-uyt͉:UtKu5?:u$EEEjEPh#Yà EPh#cQy:u벉뮍Py:xuWڅuU?<:u!EEEjEPh#Yà tEPh#h-Njh#Z^1H9ujRh#LYà 1Ujhd#h#/Yà U+E@1?1ɉE11ҋMPh#j URgNhURh(#X ÊEEEjURu X( t1E1҉PjXe[^_]UME  h/#pYP u1=1u11ɉ 11h1h1RppUVSM1tuA1u1:-uztC1B<-uztBu 1˅tǍr8tuPhR#9Yy:u܀y:u.zu 1J 12u Phe#{X51151e[^]UWVSj*1^Qzth{#:8-0E 111j1Yt8zt h#W8-u @P51P)Xu n19\x9}h#벍EPYá01@011 1)<}_߉ƋM9sω9s x19r )ЍpkME)9s 151 01u,1tVSo[PY19} h#01B01)أ11ljNx=1tE7s ZEy1ۍ1)‰ Lu11 01u,1tU1e[^_]Ë-z8U 1x@ @-J8-z8]ÃxuUSt Ps XK]HÃ8uU1҉P8u]UVSƋXCF~h 1A1Z1f@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P-JHR P UPUSUJtXxv-u~u C $t h#-B0+B8PCXe[^_]UWVS4-EX=uE8t h(&35--1} t u Eu P9!E@EŠt 9u u4--PP GӁt uu ljE)WPk 1H}t 1R\uG1x\F p\Sà u! 1x F dp 4-> 1xF Dp u"4-@4-==O A94--PP 1xV P-)Rx-X4-M)ȍe[^_]UWVS@} -B ]urV@Y wVh#Vh# 4&h#j"S?FS Z؅tWh#}xM4&h#jP FSUWVS]S5-M EZY9-ulP虚_H=`19s<wDu 9rMW5\1j ZYt%\1=`1M܋=\15\1 # #S e[^_]ød#-ztLUS`1tt#u*d##4#1 #154-P`1ZY]UE`1jZEODU謳\uH袳 u"4--@8xtjjXEjjh"D _UVS-Xt 1ۉXX8x tjb-1҉P Y1p84-P0 1x1P10ƃ)c t,~tŁF $& 4--PP @\ |td;Z=t g u,?&u-@1-@d|u-@Ǯ-@)&t;u,-@ -@ q-@-@r-@_a=t0 u74-@4--B0ztjj`Y-1҉Pjhb&Vtà ؍e[^]UWVSSá-@tuy =-,uyGEt7`&t,O8uQP荘ZYu`&^_8Et2jwV2Y_t XSP4$PS- Rt -1҉P؍e[^_]UVS-p$ t jj-ubX(x,u{ upVDZuh7#P: uBPVg-BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um-B]US]V9tjS]UWVS3t u%j _8XpZʡ-@؍e[^_]UWVSS-@}%11EuCPw C u j X1҉PYt8uj 1~^Xj 1҉VPXFYƉ}t'}ugEwRu D}twu}um-@-@}t_&t<}t jjG-@#61ۀ& r؍e[^_]UWVShEӉM-@E1E81E誰E+-]jEP(ZYtxcTd*"t~L tgF=.H#"$$& Džd't+pЃPЃv;4--Yt藧PЃw tPd@d_ƍ@;w`u h#<\u<\uh#ރ?PDžd Džd11\PЃ \w t0)Pw t0Pw t0脣 Ad9ud(=w h#0=1 á1HCw6 1?ʀJ R 1CC@wj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1Ywj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1;wj 1?ʀJ w 1CC 1 ?ɀQ vP 1P@ 1 ?{ 1?ʀJ w 1CC 1?ʀJ vH 1H@ 1 ?ȀP vQ 1QA 1?ȀH vJ 1JB 1?ʀB< vA 1AA 1Xh#}€ u 1 e a]tW t)蔣'~ \u聣=uh#%4--xtjjX븲Š"& <w 1C 1fxt @ 1C=u 1s\谟k u%4--@8xtjj^GJtujaY>uVZ0VXs;5d1};5h1~5h1}>uIy>u |u &u y1tm&ups1ɉK-djdB(-@(X4-Pj¡-@(Y-u @ 1҉P  躚s-X$-@ 荚-`H,hP S-p9-@ Y (\u: 151VXO"D8 .lhjډU1H\^{t &1\+-X 1d\@{1#Tþ}Tty&uh R.DYu[tJ}Tu@Td1e1jjhd1 T1Tۘھ &tJ 1xd@d\Xd\ &uJЃ wK 1xd@d\Hd\ƒt:@Ѓ v0t' 1\d\P 1xdX=d6X=d%:t #u&¾Rdh &wUYZ&d1H1tx:C X:xCdXdt\dd9‹\uADdd1 u#}t 1x#C $X#踖1Gfxufxt΀Aw@ ȋ-X2dVNj@f@f@dr@b&1҉Pa'uAW|b&u11\Nj@@"&f@1\$ו1HNj@@&@f@e[^_]UWVSS-1ۅtXC1-0x tj-1҉P YF8Pv vS‹FP U8tSj-p蘚7jhB&P-HUJ@ B Κ]e[^_]UHu+]UWhPT81ld-`(1\}1󫡨-X1pjEPNZYE81(1E-Tjh螙 :jhB&P -B t$Pt=^- hppDžt1ɉxR|T}E-jjtP‹ -pnX-`-dڙZl81\(141u jltDžpd#u^j2DžpF#X-`-dlXl81\(1pu hpp}UWVS -@1ۉ]}¡- u@$xm@4$&jj}CjjlCQu;jF Ej@UBjj,UB뻡-xu j F Y1҉V @jaj 3^ -zu jCjUjCjD-@C u-x,u p [u h^#Zj诿 -PS @0C>-Yx ubx,u\h%p|^ZuIu¡- up0-pY1҉US@PvjjfHu? 8j@-1҉P P-J0HCBHYvB-@ttjjjtCV-@^Xj蓾 -B0+B8C j -p0EC 5- ~ uh%vzZYt h%CEF-xj ƋE0FEY-xu-x  jj p0‰EEU表-@^Zu UBE밡-xt jj@0Fj:F -@Yt-Pv jj u -@FEM1҉@{j jC1҉SY^tNjjX=V-tt3j"-@X&}t-@uWf^_VjjJ¡- u@$x@1ɉutt;tj aXZÉs؍e[^_]UWVSP} uE E1E1}-X- u+p0ƉxXtӡ-p^[뼋H up$E0FEE럋]K9u}} uwj- 4-H4^SZYuht#Ssj/vJ t h# -4-+A8FF-1x4M@u} u jj\1E1҉j 1ɉHEFE F -@0F[e[^_]UWVSS-@1tu=V-tt h#LGܡ-@nAuWj 腺1BUjnËUBpXYUjU$C^Ut1ɉ ֡-@tj")pZƉe[^_]UU-1ɉHHPtjjX-1҉P t/Ht3-@jy-Ytrrh#*-1U11ҋE]DUU Et 9Pt]UMt1tPt9JuB]US]jθSCU PUPUP X]UWVSEPD[y h>#9*u;5-~5-ExWxsZ=w PWVI `jjjr uNug*jjjj jjjj$jj SEpujQu*Ee[^_]1=p1UWVS}u ~}th@VW辘à VWИZY}t9u9t:W)X19t-y)0M PVWh#S)SVWh#)9-}-؍e[^_]UWVS]{tN7Gu p1} t} t&Wxjw PR+GxP)YWE Z1Ce[^_]USt101@01uSwt1SlE 01H01 u,1t ]']UVSt1t/}u jS$ZYstFxPx(X6͍e[^]UWVSu] -9}5-9~-9t7S7(jjSV+9t衁8V(WL PSh#'؍e[^_]US - A - ~.CPjjm' x9-}-P'X͹ؙ } l1]UVSul1 ~;d1|p5l1j V&à x9-}-9t'X3跀8u0=l1  蝀8tjjV& ؍e[^]Uj ʹZth1h1UPU PUS]h1h1t9Xu  PGC X‹]]&UUh1t 9Pt]UWVSĀu} ^01@01 $@&vMQtVQ%YXty$1j0&PVhn#&jW%PjW%vvhh=-trvjV$XZu hh nxPWVZY@u W%~$E%=W_%~YVvhh vhh VL$ǃ "N xtQqZuQtYttj :   <t?j}WSQy"6~0H PSv h##$S$Z 01,1#VXT9=-}=-~~EuxV-9t1jPSW0y}0"H PSh##rjjW# `1j}j0~$PVh(#X#19u1e[^_]UWVSƉׅu#P[u VtYt ukj jV(#XZut|0sG PVh=#"jV"XYut|0FG PVh]#щ؃p Ѝe[^_]UWVSƉ1LÃ}tVho#5- Ed#$EtE"&-td#NtRuh%PFЃ!t)t7Rhz#Pe t u1~ t1h %5-<YX 둅t}tSh|#P h0tV fYwN9d1~>}u}1ɺ<ƒu,EEptVl_9h1}Vh#0sssru>v1UPjS" @Uuu0q@ PSh2#> !9t'VjS @uu01@ PShR#}!ju܋MZhq#rXe[^_]UVS]u M1P1<&t#KyS PMX P<&<uFtPh#S+ S4<&VZYt vVuQShS#MSh#EF y)KyS] P-Y P-Ph#S Sv XZۍe[^]UVS]6t01u!u  1u01tX=1uOTuZ 1tO 18tCt>!11@1=-tu01uO ,1s0[^]US]SYt ]]鋵h\%S: YZtSZu]US]#t%SzZuSh#j h1 1]UVS]} tKyS P ^(P ?u3Sh=-3=-u,=1u#=n-t=-u1uYEPjS#p @}t tD1:=-tt!Sv=-<uu9ujPSmZY@t^u1u jSZY1E܉EEEK>v p DjEPj e[^_]UWVS] }uh&sa^_t}sh7$VqaZYuh# j5- xh#VDa^_Eur 1tF01@01 1P2 1ɉ 1[t jVXZ 01u,1tF@u111Eq}sh3$V`Y_th&"V`_Zt CE1#~puM} CEh&E0b`ZYƅFMEu}}(th1ۍF~u 1u6u h#XV?Ph% C ~ h-u~u1}tE1 111ECh#RXECu\ 1t 1Ph$Y[E PaÃEX?vEphp#5-6 h# 1Zu h#  1P XSCPh# zCuui01@01t VX 1t 1Pg/ Y4 1t jSJXZ 01,1EO111Ee[^_]UWVSuu 11ǻ 1tB8t;01@01W- 1P01H01ZYu,1t!1uu e[^_]e[^_]UVS]u 1u VSQYX1<vjSehXZuƃ1e[^]áP 1=1u t8u1UWVS11ɉ 1!1u@@u 1e[^_]1҉!1=1u‹ 1t1}W15P1S!jP+S- d1t }wWk15P1Xe?!1uHuUS]91t$jj1jj(jj1]US\1ɉM=1u'=1t1t EEP111P11tjEP[Zu Eģ81jEPZYt01@01jEPY[uO8Eģ81=1uы 1tǀ;tH1 1jSXZ몍Eģ81bjcwX] Cvv1ɉMMMMEPj?{XZjS fYX1EEEEK>v h DjEPj  SPdXZ51'gU1E1YUWVSh`&P ZYj'V^,_Zu <)ș19e[^_]á01@01-t,UP + 1--Z 01u ,1t 01u,1tW UWVS]~;1Wu u  ~ )Dž~E u F ~) ~g8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu"1CfKS u>01@01s>C CC01H01^uV,1tMV Ffu9s01@016CPRC S)S01H01ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9-u]e[^]e[^]U5-uXZU5-u~XZUPuu EPE u h# uPJu( UEPu u UE Pu5- UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'V)_Ztt~tnh#VqZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h`&V0ZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9-u]e[^_]se[^_]U5-uXZUh-Ih-?XZU8ruPh#Ph#UWVSSEPE X85--1j=RUo&ZYj=Sc&ZYU))9~߉Ӊ 1I 1<=t$t xFU蘙p UCɅxUzU] Ue[^_]KUE1@u,"1+"1Rpp h#jh#1N#1UWVSu} ]t t9u t1141&Ft9t&!@t)[^_]UWVSS11ɋ "1tZuA=u܍P訕EY1 "1t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#S@mZYSOZ9u;Sh$j'Sa$Y^ƅu+Sh%XZ/<'uh#sXuS)Ph"#o e[^]UWVS]} sSt"CtS҉XuEs1Et Wh9v$Y_}t5uh9v$XZ$-Jy R[ -z9 _F>=u y:Cu}thrz#FPZY-HyP-H X J e[^_]UWVS=#1u#1 h;#1Y11 "1tJG} tE t8tEt.#19P5#1#1%#1XZ#11tfzuhx jjh &1zuHh jj h&BR.uhx jjh0&h}#P@ZY¸(&t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&P&_7;";f xuWS贻[^1WSZYuNf$`&)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!]]9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$&SV>Y[SV>_ZYSV>[^SV>ZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PV躸^_xPS裸ZY04]E9uc9u_E98PVa^_uWxPSNZYuD04MU9u9uE98f9]PV ^_t1oxPSZYu鋅|9u;xu͋3E 3U $J"~t08u9ut1u ud# 9uMLG8Mt#y޸<5#uPh# ECSW YZ@u';"}s#RPh4% E}t jW XZMuUVS@#1111W5<(9t j=S YZt hSXZb Ph#j@]SjSh7#j h-h<"(j hN$h(#*ƒ &u?#j PhL#mj,h<#h#\j hN$h6#K$e[^]U=41t 111R- 1141<1 1=t1t jY-----tP 1-ZUj1ɉ P1~>R-11-Zxt@~j01@01jXZ11uƀ1@@u 01u,1tj UEt]UVS]u tVs XZe[^]UVS]u &$&Vs [u CEe[^]s 3VDF4$VsJVs Vs[Vs Gs[3VDF[ ]VsVs C[XZD[*uFEEh#VGY[EEE8.u(px*u Eh#V _ZEEu uh,$EffEƋE@xWBtG,%A[A< $,&CCA<2hIEܡ$1tP^u($Mǣ$1YE܋E܊@<<~8Hw0$&b~<'tz<\tv<"trflnhrdt`v\ru R.DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС $1tPZ1 $1$1tPzX1$1$$11ɺb E5$$1FP£$1XLx׉2Es}t"tRSuuh $1\0RutRSuh $1=Ruh $1* @ $1 $1 Ek5 $1h$`$11t$11҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPub_XMƉUйjEV}t uWVuP(hWVStWVSWVN$1th؉EM܀"t'uEЉUmЊM<[51҉EP$10}С$1P$1UY^MmЃ=$1t^}ѹLE}mt(t <$SuPX <$u t <$SP( <$]EЃ}t%tPP$Suu LPP$rt PP$SeWW$u%}Nu 1BuhI$C[^E@EEf}f8$15--fBYt*fBhT#jK$1}9tǃ8뼡$1h_$XPeY[^_]aUE E EE]%UWVS}0uh j jh`&MQÅu$Mh j jh &QÃHxu Vhl$EhJ.h$Ea6Whe $hJ.vWhm $hJ.F (twu1h -&S#Y_ujh6$&V &t"VP_Zu&fH1&uhP11҉zY[th$vVh $ fH1hj$SV_Z1ɉ>ÉhR"V _Zu h]"VZYu6hb"VY_u Vh $, e8I1h $S_ZDžum>jP11҉(Y[th $赡XZ uhp$蠜Y[ &;twWZt ucPVWu uT- &ËI1WYƀ>th#V_ZƉ>1&tR.DPt7hP11҉,ZYt$h$蹛[_ Dž"!y v5Vh^$耛h$v1ɉƇH1H1$ &pI1|I1|I1H1WH116C-fCpI1|I1|I1H1te@H1t>16C‹|I1H1hH1Ze[^_]UWVSP1۾ &< &tCtg1}jSEP(V th$螙Y1@E h jSP1E43FZ9uuXe[^_]UEU M= -tMU E]V]USÃ=H1=H1u1҉Dt%PhH1XZ*0 u=H1t =H1t*0 ux=H1u=H1u7jhH1hedAS/ tHhH1hrdAS u/h$jhH1hedAP y h$j]USQH1WEVdI1WEVfhI1hH1:fhI1X=H1=H1u2hH1hfdS y8t8t$rE=H1u2EPhmdS? y h&$Z$-h= oX=H1t1&hH1hgdS y7$W]UWVEu H1t H1e^_]UhH1hmd5$- UEU 19s f3P]UERPZYUS]EPu h@J.hS&ƒt$t< tj S8FZYt1]US@-tsPhi$h  `E Ep$]EU"=xJ1u"Ph$P: Hu9Y[빋FPvTh$SF Hu0Ph"&S/1 HtSh $XZŋFTe[^_]UWVS( h($d^h;$VY[@-tۋtAR$RV# uGu VuЃ 뙃 빀^`Q ʃ`98A]9|@fNj}Y[u uVh,$YI][<1M9Y<}Ph;$蝣Y[1jPxa t5h$1uhJ.=tJ1~E1]9^~ t)t;FtF5h$1WuhJ.+FGVhS$XZe[^_]USBHBy;B| X RQ裨XZ]UWVSQ]u uh'"S/F fw4`&h"Ph."S FPjh8"SFPjhD"S Shh%&XZFXt ShQ"Y_FXt Sh\"XZFXt Sha"Y_Sj xv(hj"S脥v,h|"Sv v0h"Sev8h"SWv4h"SI$vu8t/j} tu Sh$E Shq&5_X뿃} tu /Ph$ 벍/Phq&[^띋$t $P蟪YP蒪Z}t E1_jPS薚 y h#X7ƒu*t=tRƱ$u hU#z e[^_]UE(P1E P1]á(P1á$P1UE PuhJ.hJ.j H~jUWVS]8ށu= P1t5(P1hp#莕YX=K1t"= P1u5(P1h)$j1K1XZuu I ZYyWʰPhq$? t7= P1t.j IX= P1tP5(P1h7$j1e[^_]UE Puj' UE Puj UE Puh UE Pujj̊UWVSt1ۉ$P1Ph%Q^_y hg$YKhVu茊 }t Ƅ1ۍPWxQYZyWhv$NXZ]%=`uz 9u;u$P1Whh L1d à uWh$뜍xPSP^_yS끋%= Sh$e= u0t,WhV詘 à t ߻Wh$+WY#0hVcy à uh L1h$BXZ멉؍e[^_]UEPZtPRPh$ u uh$hhK1yK1U塄K1tjXj QUSj0h&j訇 K1jjq]US^jjjjjz>]UWVSÉ֋x CPww wwփt=@P1~j 蟬X@P1e[^_]UWVS1=4P18P14P11,P10P1,P11 Džu/h$h$`v[^Dž SUYuÅu@3hVw ǃ uVh$XZPXEtVh$ Eu {u{wu"Wh+$hJ.n DžQCC jhPjVK Ãt'$Phzd@S @uS [WYD R.9rDYt)PH,P1t4KRWQ u <tPȉj# W~ C1ɉK C C1{;0P1C0P1f}3EE܋Eؙ}E)9EE у}uUuG=R1=R1 }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AExR11}fG18f@@XZtA 15R1xR1C,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=xR19E9UʋMou{5xR1C,)֋C,C,)s$S(;h<$SNjCSMEAE@ufFZ[tA 1R1Ee[^_]UWVSu^8C@Pvu uu uhPu uR1 )P@1ɉ5TS1NP t1҉ 91CtCS OtNCSWV^ +QCSLCS >WV] +CS yP @1t|u!<|uxuxx u xv8|^u |txTS1=R1XT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp xR1TS1H0|Ãx} xR1x5xR1f-sTS1B0C9sjh-V_5xR1 C =R1t@Y @[ JPdh t19}#8@#BLlp>Ãxjh-pO_Phr$j=R1t h$AwYh$OZtWC jjTS1@0 RPJ P^_DTS1@0Ɖ =R1tL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|21R1 ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jjTS1@4 RPjjWVv f-xR1Hɉf- f-f-f-f-E-=R1tE-]E]C WV XZ=R1t CpSt C(T1ҋ TS1I4 xtWV`([^11tjupE\ xR1f-UJ TS1@4B9s$Ujh-QM[M xR1 UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_#f@tی#Ph$$\=R1t+=R1tC CC C u#h$qYh$ڰZu1R11nu t3f@^_`P1dP1jj ¡,-ƅDž Dž1 R1X[tBBp tBBtPR^_t`P1dP1h$Ӄ[=R1t/5(-jjjj`P1dP1uh$蘯Yu5,-RPjjt0S1=R1toh$Bpb5`P1=dP1ut(jjX@[ZHfAWV$1`P1dP1XZ=R1tj jh_`P1dP1ut!jjRP!`P1dP1uu h$RPof%[^f=@h $sh0 $臮ZY5`P1=dP15(-jjjj`P1dP1utRP5,-jjEhjj5dP15`P1YƅDž WV}@@PP WVaf@5dP15`P15dP15`P16^_8th; $x1ɉ R1[R1R1tCjj RPQ u{C9s#Qjj RP|N N0ӍS19r)#u 5dP15`P1iu"h\ $蠀hHLY4DEUE9ƉU}4Ѓ1R1뾍U1E 1pR1tR1hR1lR1ETS1];X,W}}1Euu TS1U׉e^_\Ttq֋}!qSI SQhS1To5S1TS1}󤡤R1=R1ttt5TS1u5S1脜 =R1tE@x TS1E1E=`R1t7TS1p,kEd1E;SVuPh*$hJ.3&1=`R1=R1=R1ExU t1U u E#uh*$;[^ExU uۋ}G\M]ȃ}tgu EUHu}u}11ۉΉ!!u6u2EU}9}u܋}9}uԋEUEU}uE|S1ËE}uu 1ɉK<}%?}u}9t uuu,EZuuh+$:j_1}MECEUEUtxu}9r WV[X M89xu9tuËEUtx5T1=T1 T1T1TS11҉EUtxEUtxt1x1 E9EEEEe9׾r 1)ӉΉߋ|S1E]3u us3S1|1҉TYm9}u9utc%?u9tWVh*$;9jSub0YXu Suh7+$9uEsE)Éٍ1EPE 1R1e[^_]UWVSEP@EUE@ E}juu艻 tT1t`}9xuPu9puHEuuh/$Ep p T1qyEpxu}qy T19@S1u @S1u덋=T198tEUMK؍e[^_]UWVSTU1EE DS1T1111ETS1H,9M=`R1t5kEd1M6SMQuPhd+$hJ.~!1ۉ`R11ɉMTS1U;9soWVtXZt`u} R1tCCpR1tEtCCttEWVkZY8tEPSZYuE_Ee[^_]UEU @,+B,]Ƀ=R1tf‰Ã=R1tÃ=R1tUWRPY_}UWVS Ep8=R1t 1Q=R1tt1;R1R1slj}1RPj@F[_DžEx48x0.FhX%P^ZY"}O_ u9ttFPh',$s4Y_+$Pn`ZFfSPV  wh+$>`_tr<Fo)efFYPVWGfSPVE@0P4p pihfH DžU;B0B4wr r@Y[=R1ƅhhS#Px R1 R1ufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFhS#P[ZYucA1A =R1 ~hN,$Ep pFhL.$^H1R1EHX P@uuȉhf,$SQRPVFD9+$>tFPhs,$y1_X+$P][tguE@0P4=R1t h,$CYP1҉P FfPh+$#]_u@@ uE@0P4=R1t h,$[H1ɉH F>ufWVs C+fFPVSPfWV6uDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uh,$ ~ .u)h,$Ep p֝1>hL.$[EH0P4 19R1R1s h,$=R1tuHu<~t6h,$1RPEp p蔜=R1uHt%~u븉FhL.$&[[H1f1RPcXY,t#B<v^uM;A0A4o hf-$1RPEp pЛh,$ZW1ɉ R1?M;A0A4t!=R1=R1+$+$R1RPEp pPh,$ZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0Ph,$Ph-$-=R1t h%-$Xh,$XYU;B0B4}R AAQ=R1tTVC9tHh0-$1RPEp p™CFhL.$~XHt 1҉R1 DžfKPRh?-$>+u Dž 1 e[^_]UWVS\jj`_ZP$&h[-$+h2 $W[^u 1ɉ R1}hjjjj8h-$+h0 $W_Zt5jjhjjjjآu hr-$X*1ۉR1h($SW^urjhejh-$+h0 $,WZYuhL.$W_>jj%[^@%@3fs Ph-$)=R1tjjY_fXZh j5$S154S11ƅDž 54S1$S19T=`R1tD+4S1=$S1k#)WSPh-$hJ. 1`R1C$w0h-$ss xR1A 1C$hL.$ xR1QC SRPRPhW^ xR1C$1҃=R1tQRPWhA$h.$a)QRPWhA$h.$b)=R1t h $9_ xR1C$D1C$=R1t/ss CNjC$1~YY=R1u$GW 萷h $TZHt1R1GWڍ@1=R1@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=R1u4S1_54S11ɉ R19s؋{$@1=R1@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =R1th6.$SQRPOhS#vvvv 蜓fOWhP.$SQRPhL.$Pu 1R1,v vOYf@fOFVFV RPhS#vv 訒4S1$S149s$;ww Y1҉WWY_8u؋=4S19s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=R1tUWVSX$S14S1D4S19=`R1tA=$S1))Kkd"VWSPhj.$hJ.x 1ۉ`R1ss WZY{u { <{u{t t&5R1tC=R1t8=R1t/u*CS 9RPWf@1C SCSut+RPWW¡dR1Y_:u9|Css菰FXZ95dR1|)js s賜Y=h.$E"h$YN /ss^1ƅs{Dž  R1^_tBBptBBtVRPZYu h.$x!_Pss觛tQDž ssvVPtUf@Y[5dP15`P1UfHXZ4e[^_]UWVS EP@EULS1ETS1RVuu EEƉׁ\TtCЋU!CQC RPhS1R5S1TS1}󤡤R1=R1ttt5TS1u5S1 ExU t U tuh.$ [^1}E@ EE}juu跢 pEUЃ1EUR10M;DS1Ӆt3}9{u}9{trzs{DS1RY!}tdExU uEp`ơTS1RPuu E؉U܉Ѓ1EU܉M؃3pR1tR1Ex@t+jjTS1@4 ؙRPEpHpDp p` TS1Ez89x t2}t,E@$ EL@ EEUMW}tu}toTS1E{89x u^E@EL@jRPEpp K` tPuSzch 5TS15[^5TS1BLЉ@D =R1uhL.$ [Huqh8$Y=R1th 5TS15hSP5|S15R1ƃ hS1lS1pS1|S1=LBALt[=R1hY;$`hL.$tY_jjjjjSW;=|S1fGWW:fGS1CJtejPhx;$ =R1uh0$ Zu9h*$X=R1tC=|S1fGW9fGS1_fCff=v]h;$Y=R1uh;$Zu8h;$sX=R1tfC=|S1fGW{9fGS1_fCffuih;$AY=R1uhL.$5ZuDh8$ _=R1tjjjjjS:=|S1fGW9fGS1f{f9}zD3<:u$ {@uRs s: Rh$XZ=R1th=$۸Yh >$Zu 1]UWVE5LS1TS1x=R1t5TS1p5LS1e+ e^_]`R1ÍL$qUWVSQQ9R1 R1s RPh/>$/5S1 TS11ۍ}WSQRPj U Ƹ8-;sAeY[^_]aUWVS\]u EUEUEUEUEM1ȋUM1 uE u uE %)uu*_Z=[1u <vuE #]e[^_][1U1EEƃE9Eu E9EEUEUEUEUEUEUEUE ]uuOURP\S|)lj$SW莞wG/ 9rbEUEU}t@EUEUE ES#RPNURP\H1҉[1#}u1ɉ [11[1}u}tF?N)Eu ]e[^_]UWVS]\T?2} 4E uh`Ѻ} Zu hR>$h`SPz =R1t hy>$}_=R1Lu=R1uE PP%Y^E \=R1uPPK%XZ1f Fff F@9u=R1tE PP%_XE \Ǎ=R1tE PP$Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\P谚 UWVS}u=R11R1R1y R1h T1P^_=R1=S1=R1t h>$j[h>$eY=R1u׋TS1 S1=R1ux șRQ^ (T1,T1h S5$1=\S1=XS1=R1TS1=R1t h?$^h?$[u 1ɉ R1=R1TS1ƀ1҉PTXh P5u6G뭉Eu贏Ee[^_]UWVS}]O,uhNC$h&h` ؙt,hqD$h&ha hB$U Msu)u؍e[^_]UWVS}]O,uhNC$h|&hq ؙt7hqD$h|&hs hB$UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}[1t5R1WVShD$RzSWVu5R101e[^_]UWVS] u}[1t5R1WVShD$ zSWVu5R11e[^_]US= S1t hD$|?j5[1{[Zt!hE$Gh($[ZYujo5[1xX1ۡ[19XL~$[1t@Pp0h=E$hy Cҋ]á[1t%Ux,tP*Y5[11[1ZË[11t z,tUu uuuRUWVu} WVZY=R1t@X@d=R1t1s&TS1f`u131 ȍe^_]UWVSR1tH [1 [1TS1!`t'RhjE$ۑh($ "j]natuhlpx1RhE$脑h($蘽 thE$TS1 ǀdƀah P5~jjhK$SjujjjjjS iytWVhK$S~WVh@K$SjujjjWVSE ,EEEEEPHME@ uWVh6K$S`~0E1ɉM܉EuuuuRERhRK$S EԋMQуt;t6juj1RPEURPS uiMPBtruiu`thL$}u}uhM$SY^,(ST @u,(h)M$S EjjEP11ɉ6 @SjjjS1;t-jSRYZtW@ P$@ utS9sKjRP jWVS@u/tPO ZSlX1 $ ؍e[^_]USQ]tdҀBuCu'EPhd@ @u%h>M$SXZuSh]M$S E]N ]US]jSZYZuhM$jS? YZuhM$SXZ11;VF|~$u~,u;VV | F_8tZu[tuxY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ||t2@|jmURj$O8QpUR|PtijWR uYjuWUu@uuZYjuPUu@v0shN$u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0hN$S? 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uhN$SZY<$E܉E1EuuWV> utuWVhN$SLEPuuuu; Ɖ׋EUutuuuh%O$뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^h %57'W _X1td1SщU&MYZMt/UBuShYO$u h %jV XZ뫋&&  Vۉe[^_]US1&&uhuO$P`u܋]UWVS ]} Whd#S 1&&EԉU#E#Uut7d#;tn#WPS讯W&S衯EԋU!E!U`u}u}t;uuhO$juVNd#;tn#WPSJWVSB؍e[^_]UWVS]u tEU E UuuhO$SY[ SZu E@P9sPVhO$SۍFEPS Y_EtVhO$SV 뭋EU҉EU#G0#W4 E UG0W4SZ@tuSZYEU#A0#Q4 E UA0Q4S_@NVhO$S Ee[^_]UVSP]u >u>j EP57*U ߃ Ku;=?v57hO$S A BEziuUŠu 57hZ"뱍e[^]USQ] ;uX}1҉j EP57) U:u1҅u.P8u F57hZ"u Ћ]UEUitstau+u P uPeZYUD@RhP$P2 UE t*u 57?ZYt57h0P$u@ US] ;u#57Y1҅uhKP$uXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h]P$PdY[E1eRP $RPP[Z/@8Zu%S57>ZYQhoP$P ֋]UWVSu }jj hd#WVj]SB yEWVuhP$OK}t Shq$;KZYj SJXe[^_]UWVSQ]M tu E"E𿵶"QhP$S'M $jZXZM uWhP$S 9jVQjjuuSU 1ɅuWhP$SV^‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_ZthP$6jSY^ujjjjSTEU}u&}u hQ$SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt h0Q$PP @9E}}EUuu hNQ$'EUjjjS@ $uXY_u hhQ$jPjuujjS8 uV\hQ$SU p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PSg<_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS <ZY@UB߃}uujSr@jp juuuuS u hQ$b @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9pC.tE @&1҉Ue[^]Q,(hR$&$hR$F$1RP,(5 RPhR$ hS$MjS\ uhS$LXrX CRPh.S$6Fs,s(hLS$s4s0h`S$$C8Ph#hxV7VhsS$EsPhS$E 1e[^]UU E$E8E U]UWVSQEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^hGT$PWE UEԉU؋E9EE]}5Eu"WVuu uuuuhVT$Pz(1 AU1]1 u`U3U ]3] uPt3}ut(EuMWVuu hT$PMEAE A E$A$tMu}t==T$}w } &=T$w&QRhT$u<1ۉYMuWVE Uà  E C E$C$E;EMu7E;E u/ACKtX EYEUQ#E9Eu0E9Eu(ACKtXYE܋U)AQ qMԋE U+EURPEU?E t]s{ px EUMԉQE܋U)AQ A}G{YK_Gtx)E}䉸hT$u"XZ؍e[^_]ÍL$qUWVSQ8EAQE؉U܋A QEUqy19WVuu- ut-E؋UWVRP?/ ΉE؉UMWVuu]- ut-EUWVRP. ΉEUMEEă}Eăx}PEЉU1M9ˉËMY}u}tE9E؋E܋]DE؋U^9E؋U܉EU}XWVuu, EU}u}t6EЋUEȉUWVRPi, Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}u}tE9EȋE̋]9uȋE}uH}uB19}FEPWVuu) ыU}ut#ΉEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@^1EċEčeY[^_]aÍL$qUWVSQȋ]yIX P@E؉U܋w yhT$uhU$urXZ~th7U$GW EUN^ }u}u O_ uuSQM؉]* M؋])9]u 9M@E9؋U}SQuuhXU$uO_ ȉ+EUEUVFV +EUFV FGFtxM]M]SQM]uu) ҋM]ut&M]uuSQM]) M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U# M]uhT$ugt tN-}uA1h 1h RXYS}uMQhpX$S jHJ8QRUP0(Ur 1B$E1r(z,ꀃEE}S_@tPS^@tFUȁ¾1uuuRuSz@uhX$SZY1EEe[^_]UWVSSÉЋt""""Ujq Pq qu uSU uWhX$S &PSZY@uWhX$VWhX$S|1e[^_]UWVSÉu uRP@ }}t}ME"E쵶" UMEE䵶"E"@ Ur $Ep PFVEPF V$EPFHVL1Fv VFE0S@uuhY$S uuh.Y$Sb1e[^_]UWVS]} tE &1ue[^_],SEUjS thNY$SjSrjSd jSVjSH u uheY$SY[z uhY$݅t)I }9y$uu9q t臀PhY$S 븅t*t u5Xu}+rz WV tjj _Z@ultjSY^+uu tjjr_Z@u)jjjjSuu hH$jjjS4ƃu hI$1fdžUjuu썆PjVjjjjjSC0PSY^@uh!I$ShY$S0XZ1e[^_]UWVS4u ] 1E#h2Z$uV_ tPSu @u95pC.th&jZYjh Suee[^_]UWV`'}^_]UWVSH]u }1ɉM܉MMMMMMEhxZ$WVE_ Eԃ @t=}buEPS^XZ׃}qtuԍEPEPEPSv@uE95pC.th&jE1;EE}1SuMu_t xuPt9pu 9uU@uuuuuSsẺUЃ}u }E܋UEĉUȋE؉ES|ZEHEPSEjh`'PuuhO$S\ g$1RPuu EUSXt E;AtIhZ$S_Xqy 1U9ЋU}`9u\9uuW}u}t,1U9ЋU}=MuuWVX ҋMu#u}t 1uhZ$SY[uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,S'Z@tJup(x,S:@t$uűMq1uhZ$S>Eԍe[^_]UWVSH]u }(,EUEh0[$WVx\ t(qtsu&jsEPjjS@uzE95pC.th&jG_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuh4[$S Z$1RP,(7 Ɖ׃uԉ}؋M9ȉЋU}WVuuhK[$SjSEY^tPE܉U}u}t h[$Eċ@ EjS_Zu hM$pjSY^u h[$Rx G EG$EjSg jSY tu h[$SXZE9Eu"E9Eu}u h[$S_X1E̋p GPGTEE܉EME9s3Mjh`'V MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuh[$EԋU+EU9E| h*\$.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u hW\$SZY^ U܋MHE܋U+EUЉQ}u hs\$SXZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uh\$S @ r $󤋃p PF V$1~PF0V4j\V\FSv H PAQPA Q$PƉ׃q0y4AHQLS4@Eu}UԋEh\$S[^MffuSZY@h\$Íe[^_]UWVS]1uuuuu11h\$uu 9W btENtoat%itClh-&UY1EPS&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9pC.uEU t th&jHZYWVRPuSwe[^_]UWVSDE։ϋ$]$ẺUMЃ}u}tE uav"]t=]$WVPuu #;E] er#E H]$tA]$WVRP%1E%EtEE@u}wERj hd#uuPu A z*E }\8Ev"EtE=]$ű}EO]$EBE@EtjhWV  %1ҋMIM˄t u tfRPuj MQ"ƒEE 9shEčDU)ÍMQSEʋUXY}u ED }tjhWV Ɖ Euu EʈE}t"EˈE}t t ű}؍e[^_]UWVSXE׉M]u E]u t4jj hd#EƉRPj]S y&E j@URPUME[ƒ u묉ډUuuuhW]$"U:t Rhq$"ZYj !Xe[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.Pa(XZfx8tNUVStjmuVj$8Ph`]$jn:jVEP;$t SjQ:XZEe[^]1UWVS΋UM x$&Ev]$u 1ۃt h}]$!XhH$!Xuh 󫋆Rh]$P!X&8Vh#htV=Vh]$!Ãh]$E]$e[^_] E]$~u1ۃ>t h}]$ Xh]$ ؉F VX1ɉ9u 9Auh]$` h]$K _t6f~8t/sDžuQzjmWj$8VҸ6tt tVh#Vh]$hWWh]$ÍtY^99W3Ch I$Zumudhl]$tE E]$e[^_]\X=߸l]$u PPh.%.à d#ى؍e[^_]UWVSljӉrh^$s3h ^$s sh^$ tsh#^$XZ{thh1^$K Cs31| C "C 8Ph#hSsSh^$QFPh#htWFWh^$$Vh$hS$(Vh#hWWh^$WSC` t Sh^$YXVh]$hSWS`t Sh;^$XZF0V4ut!RPhPPhJ^${ÅtPh_$`Sl1 e[^_]UWVSxƉ|PE_|t 9St[RhZ^$V趸 T{ sډ5Rhr^$$1Vs3щ¸^$A$1Vs sщ¸R$(Wh$hV Wh#htSz SV^ZYuhh6$&V_{ SVh^$4GPh#hS7 Sh^$$jmSj$G8PŴSh_$h_$G0W4uu h^$c"XRPhPPG"1e[^_]UWVSxpPYps'2N xR vh%x h^$8h:L$x h^$h^$!x \ tDžlH]$pt DžlA]$p@hhh lv6x lv vx ls Fp `Ph^$7N Fv61 f~ Wh$hS Wh#htR tRS6\uhh6$&Sx Phd#th^$~tu-h \1h#hS Shd#th^$j*Shd#th^$RGPh#hSU Shd#th^$%hd#th^$ ƅhj hd#FN x$$RPjSJ (x Sh9v$XZdd#t`-&FN x$$ʹd#dtc$SRPQh^$d`t;FV hQpщ‹x t Ph_$[X ^jmSj$G8PưShd#th _$ hd#th_$G0W4 uuh^$KYhRPhPP,Ghj7#ËN Fv61Xd `FV hQpQщ‹xǃ ted؉WpWZƒs0\1\L 9sHt)))к WRhd#Ph,_$ Ftw]F 8P%V 1󫋂Sh#hSxShd#th^$K ve[^_]UWVSX1ɉMMM 0\111h7_$uu ~F ǃ x`HttWtA}ˠ뼍Ol$'뤃럍EPu EPuE_Z@u7skc [`SKh0\1uZY4hp'jɿY_! F=0\1ha#}ZufJ.ft)$URjh jjj jP*/ }uEPhht@WE u E0\1u<ttu$0\1P"0\1x0\1 0\1@s tE 9pC.thp'jپZYju8^_uEu hH_$Y؃tڋEn;EE}3uMuZt xuPt9pu 9uU@܋EEtى‹EniE ǃ>v> ÀtGu_1tq EVj@MQuщ‹E t PSY9sNjFV j@MQuщ‹Ex tPlSZ9EsEv뎉}E?v? E?vE?%EuFs}sEh%Wh^$h:L$uh^$h^$uY}vv vv6hr_$MN Fv6" yv뼋VOQMQSщ‹Ej tPWh^$ FV MAQMQSщ‹E8 tPuh^$  FtLPh~_$XZ N Fv6^ vXZ7 hl7#TY1e[^_]UWVSD] }1`'}E_$uh_$uu zA tfitJTt,Lte[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh`$W^ 4 uEyƒte$h d$ m Y^uhd$륋$1QRP{ uh_e$SC 1 hd$  XZthd$V ZYtjhP{ u$he$SVM B  4PhlF$V5 F41$1$8Phd$V? TP8Y^!1RW($ $( ,10$(+he$ _ZOhd$P諨 ZY4PW _u"jh`'RӼ umV Y8Ph -&W= dR8ZYdt8he$S 1ۉ,DPh%Wo3 LPhb %WR3 g,9DH0|;LPhe$S莙1V $@P~ , uhe$SXZ:jjj.Bu @u hf$1$ 9sP,Q} ;$u9FjRPQ-Bu @u h(f$-hf$r$, ;$uF9$shH$ } _X h &R` Y^P踴 ƹ,hd$R0 P Zu X+tPhC`$W 2 t,0Ph#W2 ,0Phd$W2 ,0Ph!d$Ws2 ,0Ph.d$WO2 a,0Ph -&W+2 =,0Ph=d$W2 ,0PhFd$W1 ,0PhQd$W1 ,0Ph^d$W1 ,0Phld$W1 ,u/(~ǁ#,$ ,0Ph{d$WD1 ,0Phd$W 1 K ,fǀUjjjk*Bu@uh:f$SI$, ;$u ^u&H$,ȍt _Y4t 1󫍽@Wh -&V8 tuhd$SՔR@ZYu(Whd$VQ8 tˍEP@_ZYt@he$S腔 fEPh%V0 tEPhb %V0 mEPh#V/ SWh2$V7 tj$EP@1 sV1ZYu+C xu"t s srEYXj 1ZuXe[^_]UWV։P Zt hZh$j@ jVXMQE 0Xe^_]UWVSuE @80ƅ77Ph5#V t 7um?HVH ,Z3V _t hh$0x jWhЎ(  Ttg81ƅ9Ȏ(@󥍅8Phh$jPS7y0Phh$jPuVy VShh$j? SV[t hIx$j? T˅tdS zuW$(,s/ZY(u1$zu%B Nj] t>sVE*ZYu+C xu"t s s>YXj ZutXe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u hl'h]g$u+^uhl'hLh$jq9 sP3;Fs Ws/FhV%u諐 t.P Eh$u莐 E tZu EYLEPh)#u) }Chs@Pu @qhi$u XZt Vw Yhi$u XZt QY XMEPh)#u E Mu {hE EEEM؍CU`EPu u @Muhl'hi$fEftft5fu6t2C t Whi$j7 }tC(Uhj$C0ut3h$j$j7 t C0sHtS4KL9sщ}t:s@shu us@s`ur @u;4681t/sl`}t$CU[s@s`u< @uEsd6CptSuZY@u s\h:j$s8sXu @u s\h$te[^_]UWVSPu Zu1du 8 _tLV胼 Yt4W蝑 EWu g tPMQS藎 uSK [1VY ZtS X؍e[^_]UPEPh$uK# ƒ 1tEUWVSu\Phi$V) t\Mfnj4Zu\VXtd$1jRV>VhiS@tt}f1RPhi$u 8" 1e[^_]US]uu S? @t ]]1]UWVSu u謌 [^u 3Pњ Y9Es3?Vۚ Ƌ}M)1Ze[^_]UWVSu uE [^u 3Pj Y;Eru3?Vt Ƌ}M)1Ze[^_]UEPh-#uQ ƒ Eu3UWVS8uEPhAj$V uhڍ%h'hhJj$,hj$Vv _ZtPҙ ƹ}[E]ShiV4}ĉjS Phj$u ׋ ƃ S荴 Yt:EUu؅y1ӉM]! EjEP虗 XZuVhj$u x V1 He[^_]UWVS1Rhiu54 @t|j7RPhj$hSހ>tVhj$V t j7RPhj$hSP;tShj$aS \ e[^_]UWVS]hj$S؉ Y^tVP Zthj$h'jVhJj$*V ƍUܹRhiS<3@u hk$j2 e[^_]UWh%1󫍅hPhiR2 t|}UWVS\PhAk$u uhڍ%hD'h0hHk$*dShiu2 tT\`ty1׉\`! ftShiu>2 @؍e[^_]UVSuV|ZtÍEPh"$V uhڍ%h'hhHk$@)uS#1^Xu hk$j0 CPS蹔 ZYu h'hk$Phi$u 蓈 uh'hk$jn0 S31e[^]UVSSu] EPSV @uh\'hi$j10 hk$V脇 ZYuh!&h\'hhHk$v(i$Eu$PRS He[^]UVSSu] EPSV @uh'hi$j/ Eu hi$jy/ hi$V ZYuh!&h'hhHk$'Phi$S{ He[^]UWVS}hs$W视 [^u-PȔ pY@vhk$VZu hk$j/ VPhs$W@u hl$j. xtdPhiW/ thl$뮉`SuX`e[^_]UWVS}hWq$W ZYu/-rP pVYXuh,l$DVShWq$WK@u hAl$j. 1҉Uu]EPhiW#/ @u hZl$j. SX1e[^_]USÉЉʅu d#t#QuRPShgl$]UWVSu1j+Vhxi P @uhsl$ UЉUPXۋUu hl$j^- U]Vhxi WQ  @uhl$ڋE9E~E19u~tj YWh$FXZj SjUVSPuVZt"ÍEPu V @u Shl$j, @PUWVS$ƉUЉhmp$P [ZtPJ ƹY1@]Shvi Vs-j Si Phmp$uS à V HZe[^_]UWVS(uEPhl$V uhڍ%hP'hfhHk$b$MԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EP貏 XZtVhmp$u 薃 VO He[^_]UVSuV[thV%V誂 ZYuh!&hl'hhHk$#P ^fx PSr+ZYu hk$j+ PX1e[^]US]EPhl$S u )&juS-,ƒ 1Buh4'h$AXZ]Uhl$1US]dPh%SA uhڍ%h'hhHk$"d|lPhiS8+ @u h!m$/AX1]US]dPhv%S uhڍ%h'hhHk$D"d|lPhiS* @u h/m$@X1]U1EEpPhiu* t hl$jg) 1Uhk$u豀 ZYuh!&h'hhHk$!Phi$u 3 HɃ0 v+BwBÍBwBU']UWU1ERhiu) @u hZl$j( 1}W|$wUWSÉЄtGjj hd#QPj]S S zd#t#PSh:m$ h1#¸n#@Xe[_]g_UWVSl%n| uh$'hRm$j( jLh-_Zd#tFm$jmh-ZY¸Lm$ud#WPShmm$hJ.=h-t VW?Xjmh-fZY¸Lm$ud#SSSSSPShn$hJ.$V. jBUEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-YYZt /%=CЃ v؃߃Av %h-ZZ>u$ -1]UE1҃t\1]UUp-t H9t@]UWVS41ۉ]܉]E䀖Db1EԅƉ@b1EPj=yZY@u ho$EU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=@b1}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EP[@u hIx$j % }‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEP Y[=Db1tSZusujAEPjwZY@UEM9u]9uE9E-9ŰMh(4#j# UWVSÉHP]ZtP_D 1D1V!LY@u hx'h]g$&RPHSƃ uhx'ho$j# R1RPho$hWrWVh5p$ jVW軾WhiL9@u WhBp$6:t PhSp$XZjVWqWh~iL@tt Ph^p$Y_j pHZ@uhx'hfp$uu =`-j:RPhtp$hW?tWhp$ Wc| j:htp$hW?tWh q$W| tHSW?YXjVWRDž@WhiLuhq$WXZjS9#jVTWDžd1hlWhiLa @t|hXu h-q$l@1dWhiL @@u hGq$@lh_q$@R =\1t%ͱ"w'Rhmq$gY_HS XZ=\1u0=\1u'DjHSDP jV`V̻V\1-{k?PLB@uv$=\1to$Pj h%}q$ Kb1BXuthiw$n#Xuthͱ"n#Xuthq$n#XutRPhq$ h%q$JKb1_uthiw$n#^uthͱ"n#Yuthq$n#Zj 5X-XSV65p-tjHSVv e[^_]UWVS]S^t EPu S @u Whl$j< u r Sks Yyr Etuh'hq$j EPaEZt hIx$j u1EVtRUW ZYU}tRUu ZYURh$S tFE=Mb1tFtj=Lb1tFu[=Ib1tFtL=Jb1uE=\1u+!Hu)}tj XhJ.vZY U6"=\1tj XS蹝 u豝 u\jUWVS,ÉUPb^uhPh$@ht$St ZYucU̹ Rh8i(S @u48t ht$jm jht$u uh'ht$jF Eܣ`b1`b1u Vht$j e[^_]UVS։PVVSPhu$j UWVS]U h(u$S?s ^_uh%h'h2h2u$1‹`b1ށ؃E u %ERU0 NjURM WPtDPEV踩ZYUu K$9ERE ËE É`b1X1e[^_]UVSP]U Chsu$Sjr ZYu WP菀 S诀 VPGÃt7EPS5`b1ƣXb1S1Fu$U`b1e[^]UVSP]U hv$Sq ZYuh%h'hh2u$P S VP詋Ãt7EPS5`b1Bƣ\b1S1Fu$U`b1e[^]UWVSS]U h=7%S9q ^_uh%ht'hh2u$+Ƌ`b1%EVB Vb WPƃt1Pu3ZYu~u$EM É`b11e[^_]UU EkEPhu$u uhڍ%hd'hh2u$}`b1%у uсE ȣ`b11UhJ.hu$JXZUWVS]h=7%Sp ^_u3hv$So ZYu"hsu$So ^_uh(u$So ZYtP`b1 \b1Xb1!‰`b1d$1󫉕tVh7iS; @u hu$j e[^_]US] u虤Ph$E tPYt Phu$XZEPHYtPSh%u %܋Et Phu$XXZ]UWVSuV%[u hPh$/VYu1P{4Z@u hT'h]g$p 81jS8P蠲8Ph8i(4@`%1󫍅`PhiV @uhT'hu$j tWph v$lX 'Ht#8tuP9u QXVhv$1XuShv$_XjPY^u h "j> \8Ph8i(4& @uht$HNPh1v$h%HH9Tt$hb$h%Tj)j P4Z,H%(h v$4 '_1ҋ0t`'xtO(9u 09t4#HɋL d#tn#QPh% ,딅u h6$&^j YjmZti 119X~M%9u>uWPh=v$k hSv$^h\v$4j kF뫃 u]e[^_]7e[^_]UWVSӉϋuuh 0h Zt2tVWP?l u3 1ɉ [u1Vݔ ZVԔ  Xe[^_]UVSu]}t j~ NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPuBpWMw Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPƉ׉‰ 9иr E8ta8"uoR;sC| C 9s} 1"WVp1 Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtP X1e[_]UWVSÉUMU1}E;E t[ztMUj8?^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(P:XC$ue[^_]UWVS1ۉ@}u 'E@u E@ u*PE 0rh ZYu6PE 0Yh ^_u獅LPh-#E 0 u 10 L0t 1󫃽0 00_0nu蔂[[Hh %HPǖH,ZYu Dž,[5&EXtj/VyR[_ÅtC`1DžT0XDž\@PTP,V͍ǃu@xuPqdbTt/0u#xPVtZYHufDžtt,Ttt T]1Dž,tN(j DPS^+,D (t8t1ҁ,v "1҉(VX(0tDž,1ۍK 1UvAE9s:2UFPhw8#)ȉMPM UuRW u9utD7...}e[^_]1e[^_]UVS ]uVhiS @u hGy$j EPhWy$S uhڍ%h'hhay$E߉EVhiS uEhy$XE1e[^]UWVS$]uӹ!1j EPhc%Suh'hy$j EVhiS} @u hy$j 1e[^_]UVS ]EPhy$S uhڍ%h'hhay$&uVhiS @uhGy$E؉EVhiS @u hy$jw 1e[^]UWVSxhSh~$uQ@uh'hy$j DžDžDžDžDžShy$_Zu?Dž1ɉDžDžDžDžjShz$) u ؉8 R.DytRx:uL҃0jWVh %Pt;9u8tMh z$j jRVjP\ƒu;t 1҉Ŕ@|Phi8uƒ 1Bu h*z$j e[^_]UVS0]juVh~$Sg@u h'h:z$V, Zu VhMz$j Uf@fEލEPhiS% @u haz$j 1e[^]UhJ.hqz$rXZUWVS] }1EPh8i(S @t&E1r r r1ʹ|󫍕[!RhiS @[< v Ph {$j hJ{$ݠ[P\P <fDžLVhiS @t%fNthQ{$=\1t h[{$xXfDžLVhiS @t%fNthd{$=\1t hn{$8XfDžL VhiSu @t0Nf=) Phy{$_X=\1t h{$YfDžLIVhiS* @t0Nf=) Ph{$蹟XZ=\1t h{$袟X|1󫍅|Phi8S @t}u(j 莞$PhiS@Gh{$BEEEEĉEEEԉEEEEE|Phi8SO@uhU?$Xr}uMu u uuBEH~HER.DJtx:t~&jPhy$ uWh{$膞^_1Dy hy$kY Pt`XZGj,dXh{$6Y4t8h{$XZ ht#Xj '_PhiSF @PhiS* @jh'P[ u ftePh{$蛝[^Vf"fP& Ph{$f ft Ph{$KZYj cXe[^_]U81EE1҉UUUUUUUUEPhi8uO @u h*z$j1 1UWU1Rhiu @u haz$j 1}UVS]EPh~$Sv uhڍ%h('hNhay$&uVhiS @u h{$j 1e[^]UWVSSÉ׉Ph$.S)Í6 9})j<*X)ЉU~&Phw8#GZYUJuj>e[^_]j-XUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh{$XE1e[^_]UPEPh{$u uhڍ%h'hhay$ME\UPEPhe{$uw uhڍ%h 'hhay$MEUVSjjj"_ y h|$ \1ɺuBhPS y h|$ZuufiuSБ Xe[^]UPEPh{$u uhڍ%h4'hAhay$MIE=@u h+|$j> 1UPEPhY%u uhڍ%hP'h4hay$tM E@u hG|$j 1UWVSƍt1fDžfDžRhiV y h'}$jZ h'v 1l)ƍJ(R!R _9l}l' Džl hB}$hɬ%hG}$hK}$h|$hkz$h}$llhP}$蟘(pp(dp@!Pd!pP Yb1t b1Eb1tI@tc@tC@tP@ tS@@tB@yA@pXx@`1ҋpv9}pL9}B\pfP@u uw%k pfx p@tp d#!= = w-g 1u=w_f?v-k 11u?1p%:=$v1"- 1p1p P< hb1SW`\VPPllhy}$莖p@"Xp@!dǃ0X*w'Owt4tov2tW0 Z=\1OGPySPh}$h}$ԕ=\1i|$ub|$WZdPh$處XZa#d9s ΃d#yEy$VRPh6W#`C %Ȁ=\1XGPGPGPh}$h}$*G1d_19d&j>^=\1GPh}$RKStRTRPh}$轔RPh}$謔 F뗀=\1GPh}$臔Y[Gd<G=PuZh}$h$VXZ=\1WGPh}$8GPh}$%_ f`Wֹq|$d5t-\PQh%ܓK "\`f\TddT|$tHv|$Pt|$Pty$Pt#PQh%SK "봊`\d<"\TL=PuEGu:h ~$h$^X=\1GPGPh~$В t#=\1db~$h ~$h$蒒Y[=\1GPh*~$tXZ1t D ҃L dd`d#dt|$VRP`Q4@'h8~$Cu_hg~$h$^X=\1GPh}$בGPh}$đwW ÉTӹq|$\t-dPQh%臑N "dϋ\fd`T T`|$tHv|$t|$ty$t#PQh%K "d\kT`Ph~$蹐ZY=\1)w '$ '|$}$tx|$un}$g|$`|$Y|$R|$K|$D|$=|$6|$/|$(|$!|$}$ }$ |$}$OG)Xsj pp)hXh'"e[^_]UpPhiu ulhl~$Xl$Eu h~$jv EwE11 -USE UUXt=EEEE1҃UjURP 뺋]UE Puj蓪自 US]SWPh$jF SNb1Pb1~ UuUE Puj4(j UE Puj Ã=b1tMUEE EjjEPEPjEP账ƒEBuh$XÃUSP蜆 jhh'萄 jSh uSh7$6jPkZ@uShI$jE]UWVSd@u~Q1}=b1tC&;Et7EE jEPjjjV@uuShs$O 1ۉ]]]]]E}W]SjVSjsÃjh$ ZYu$$1uuuujEPj* E"1}jh$h#m EPh5% h5%h$j ju6h?$r[jjj} jWj3jVj)\1ɉ -jEPjH u8tghn$Z(9uV,Ph$jWjjVj Pb EҀu+=t$h$DjSy = -m = -tjWjtjVjj -RÄ = LEEEEEPq Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh -ZthST#uNb1Zu h "j jjSPjh -u‹Eb1]USPh_$hJ.ۍhJ.h$ShQ$hJ.輍 jHUE E ]cUWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9t''  9$t' '11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t'/ $ 9L$t' '11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]' $09tu' E'11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t' $9L$t' '11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t'9T$'uwy|$y|$L$ ˋL$ ˉ$4$19t'9L$t]$$9T$tq$ '11 [^_]Uhe jjh@-u|1҅tPUWVS jEPڲ Eu_X1E9}2uSPZYt!SPZY tG1EEe[^_]UVSQË0tRVhу$EPvVERsZe[^]UWVSQ1:nuzouPgsX1҉Uh %P, ZYt98nuxouSPZYu}SPZYuE1V耘Ee[^_]UPPPh׃$hJ.jrzUWVSÉ} u,PQ 1- ZY u QhG$1t VrXt*hk"WUOZY1u"su4h%,P^_uE"~u M }jP褰 ZYt1ih;$KjhU$W uU jZP,Po t% 9|\ 뭋QRS/ uc1 c1u17h\$Wj Vhl$YEtaq#Et#Et"Et6%\'u0P,PY ZY@tjj@Oq^_,t#jhU$SD uh$VfY[0Z"tSh$Sh$hV0 ,Dž@h %,PYXZ9 PWpNjXZڄtVB L<-u.1j=VϕY^t$S@$S4Q ,t1|=c1t}t=c1u}uD]h$Y19~4h%GXZj Y=c1tc$P Z@u hOt#"Xet t6hQ#X t 術XP蔓=c1tj}t0$v jv j( @u h$_-,W3h%h,R}P,Rn 8tV,Rh$; ;u8uWVWh$ja t 賒[P覒Y}u, Ex](u jj  WS$t ~)t}u2hJ.,PXZj P$Xt ~j,P @uh#)X,Ѓu ƀt&qttP<PVhU#bbH}c1 c10SVU Y_@uVhф$XZ e[^_]UWVSj Ph܄$|;11to`'tZd't =c1t>h'Fn#ub$QPh%| !ǃ 끍Gd#t#Fn#ub$WRPh$,|tGn#ub$Ph$|"q t 0h$ h#{XZF=c1KtSpn#ub$QRPh${=c1hn#h${sds`sTsPh$$p{slshs\sXh@$Z{0=c1~chSjjhk"ju.t%j S$^_tSh_$z h`-&vYX1uh /#X1Y,u@B uPЅ_uh "fS[^ljxj,SZYt X1e[^_]UbPhv$hJ.V}joUWVS]!11҉tE1ɉ7pC.111plh$u uʩ 0r=dhWlSh0"x ,@uSVh"j n@t(RPh'hStS/}jlUSP]jEPSU :9uySu h"jo ]US]SeZt@ h=5#SZY]US]SjZt@ hA%SsZY]USP]jEPSnU 9t :uy Sh"j ]UVS]u VS YZu Sh|"j ;/t"Sh"]ZXZu E"e[^]FZe[^]UPh"hJ.xjkUWVS EEu EE}]EEE1҉7pC.h"Vuv t4ouBjWh '57;Yu h"j PXY붋pC.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh% ,@uL3t"t"0虏Z"t"PSh"j jjUVS]u VS YZu Sh|"j ;/t"Sh"XXZu E"e[^]kXe[^]U#Ph$hJ.wjiUWVS]E1҉#11ɉd111lhhw$u u蟣 HuLf$M,9tQG.C|g$"'UC| C|C|C|57CpXDžlL57CtXDžh.57CxX57Xjuh`#'57xVu h"jS P$VX57 YDždC|pC.P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPW.YZ@u Wh$j ltECphtECtNtE%CxdupVzV[@$XZK|ǃe[^_]UWVS SVdPhWu u&hWdSh%! ,@uSVh"j f@tKRPh"'hSnSh$ p0jFfUSP]jEPSU :9uySu h"j ]US]Sn_Zt@ h=5#SZY]US]S@dZt@ hA%SsZY]USP]jEPSU 9t :uy Sh"jj ]UVS]u VSS YZu Sh|"jk ;/t"Sh"SXZu E"e[^]Se[^]Uhň$j Uuh$h$h$hF$hv$Ph$hJ.Pr jdUVSQÉj EPS U:uVShƉ$j e[^]UWVSuEE@t"c1 1VFe[^_]P2_u h /#jl VP ZYujAd]e[^_]UWVSQ]E10u1-h$$u u9 2F$$'=d1td1뷃=d1ud1c뛁K뒺a7C8K t d1hK\cPD7jC@K@2K&g7@P s4K I7C(KK@KEPuh&'57Pƃu h"j Et d1tctKtK@tK t=d1d1 s=d1td1c@tKt1҉,-sc sKsC  sC sh)5#VNd1Y_Eth%VNC$KXZEth$VNC KY_Eth$V{NC$KXZEth$V^NC @RPh%'hS!gt^j j WhVPuWVhL$hP(8Phk$;M j^Sh{$ h1e[^_]UVS]u VS  YZu Sh|"j% ;/t"Sh"LXZu E"e[^]Le[^]UUM B<t<ufJPh\$j褹 UVSRuEFxP^ FXjjpq,à yFFvpjEPjjS ppSu^ (ujuu S@,e[^]US]CEEiEPjEPL] ƒ Jujuu sz ]UVSu 蛷1҉uuuVu~C9`d1u7VJu/^˅t)v V0O0ShL)'hy$@fe[^]UEH؋U PEf]UU otzȉEEȉEE1EjxPjEPjjhuA w/趶02Ph@)'hU#e蚶HxUWVS]u uu uQ fMA1CCS1CC`d1@`d1ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh9 ECu h"j PBX'7jh$R\I \uTxPR\蛘 xZY\t8t PRhŌ$vr Rh$jh$R\՟ \xPR\# xZY\t8tPRh$$j rRhR$j N&s5N&P$ptX$pPR赹 ZY@u57h$jɯ ptC S57OXDžh pC.E E)ȃth2\u: u\r^xPuJ@u uh$bhu}{duus`u EllCe[^_]UVS$SPPVu u{j VShI" ,@u Sh$j蘮 @hɍ$4\h֍$\h$\ &QYu1RPh$[ 0h$[XZK^u1RPh$[ 0h%$[Y[h3$[XZ1e[^]USP]jEPSU :9uySu h"j[ ]US]SJZt@ h=5#SZY]US]SOZt@ hA%SsZY]USP]jEPSZU 9t :uy Sh"jЬ ]UVS]u VS YZu Sh|"jѬ ;/t"Sh"I?XZu E"e[^]2?e[^]UWVS]fU ffCffBCffBfCffBs sF0Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB sss/Y^} GWss]/Y^GWs$s J/Y^G W$CDȉGDs,s(//Y^G(W,C@ȉG@s4s0/YYG0W4CHȉGHs$+' t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh"jv 1ɋuЋ} t1M98"t$M tM9uM9t Suh4"맋E9ƉU}7=i1tuuWVSuhU"4uuWVSuhU"?9u؋E}<=i1tuuWVSuh"i4uuWVSuh"j虡 e[^_]g_UVS=i1tPhA$hJ.R hu$Ph$hJ.RhJ.h"XZ=i1t@,'ttsh$hJ.R j E=i1u UPDUWV=L-uHH׉=ti1t&ɉ HffJ=L-u f@ffB^_]UWVSƉ˃=i1t/=i1t 1}oQi1xi1Pu< Rסi1ΉRPSu5i1I 9t 0liPWVhۗ$Mj"De[^_]ÅtUWRP#Y_}Ã=i1UWVSƉˡi1=i1tQuxi1P; M׉ΉRPSu5i1H 9t G0hPWVh$6Mj$_Ce[^_]Ã=i12W|$wUWVS#Å=i1ui1BB4i1i1 i1 ;i1i1ؙ=i1;|*9i1_1)։ؙ5i1pؙQ Y`-'JtRz!9t !9t ҋ1҉ؙ=i1Q ;Xe[^_]g_W|$wUWVS4EU؉M܋ i1A Id t15i1/X=ti1ti15i1PPW i1xU th($QXi1H xU t@\U؋M܉M؃=ti1ti15i1PP i1A Id t15i1i1i1JH,1_9M؋}ruuh?$J i1\Eȋ1ҍMQRPuu]1 Ɖ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuu3 K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05i1#5i1Fx1҉$Puu%2 ti1i1\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu?%ClÅt]SuOXZ1EtttpY_DpTtF u1EY_Fu @ߋu%CPi1H05i1EЋUXe[^_]g_UWVSQEӾ=di1t1}=L-tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='Shi$hJ.J ]W|$wUWVSC s(H1`i1t ǃ^F=i1s0Kd t1RP߭ڍ N&VV$hV$y) i1 ؙy8PۅI4N&WW$q,h$4) i1A0= @ i1i1=i1u\Tu k‰i1jjjhjRj£i1 i1ui19uh˛$5i1F$B1ҋ9r)=i1O`艅FW897~U uv`G`ai1$~%i1Bl5i1F=i1=L-Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5i1F$뵋i1$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹i1Bi1;i1u^=ti1ti1s4PPF i1@i1i1Z4Jd15i1i1i1i1H41[i1Z0 } i1؋5i1=ti1t5i1i1P5i1 i1X05i1ދvxx i1\t4Tu%Fl%CPO붡i1i1𙋝ڋËƉ߁TtAЋ!AƃAId t1Ji1Y\Tt=i1Ys8i1){0ƉK`Cx1񉅰69s)9si1諵%Cl뀡i1i19rߋ i1A01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==i1j.rX܋ i1ߋƉ߁\TtAЋ!AƃA׋Id t1d#t%WVRh$9|]=i1Di1P,t,=i1t hS#cX1j dX1x~j @X=i1tj;_u=i1th$v5i104=L-0FF4+=_w h$j{j i1X󥋅`1=ti1tR5i1K[^i1=i1t ǃ\8 5i1x\󪡤i1RP SY=ti1ti1i1r4PPG i1X4HdLH t15i1i1Z;i1sE=ti1ti1r4PP i1@i1i1Z4Jd15i1aX5i15i1ti1@4P5i1^eY[^_]aÃUWVSu]tVj _uVh"jh `1ɉPhd@u G tGRhedAu F @u!8g8tuh"XZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(hJU%g ƹ ߋSh"VJ CPhN"VL C Ph "VL CPh"VL CPh2"VL CC,$C,PhE"VmL C0PhZ"V^L tP5 X}!uhzd@u EE @RhedAu 'E @uuhi"jg 4}1󫍅Pu^_@4ȋ9P9t(Ћ}1ۉ1E1ɉ [Eƀ*P$j PEPs 1e[^_]UVS4]jhPjSkuIjPjVSV u؋E ʉʋMQ؍e[^]UVS]u VSe YZu Sh|"j}e ;/t"Sh"XZu E"e[^]e[^]ÅtUWRP&Y_}UWVSuuuu É֋EU)jj`RP Nju 1ۃ`9}1EPl@hFVk`EUȃM ~MAhQlCȍe[^_]UWVSP]UpEM1^F}tF^ECS}tffCCCCC 1 :}u: 1҉C(S,C8C1ɉ C Xt1 1( Xt1CXo1=Dt1$`t19$9rPhx1'hС$vTn1D 1;\t1sin1tЉtF$9rhx1'h$`n1‹ ȋ( Xt1GB돋$9(1҉G䋅$9s11ɉ u2\-hJ. hJ. u2Lv2=XZe[^_]W|$wUWSøthw3h$XZ5v2h$5v2hפ$x3t Ph$_Xv2t?v29} h$u[()N&MMEuQQ$h!$M j dv2Z0|x3x3EEhv2sH~-`v2]PP$0J @N&RR$Spv2QQ$SEWW$S h-PP$Sh4$<|x3v2v2"]v24v2EzuN&ٞzuN&=v2\$=v2$hl$e[_]g_1Ujj8XZ1=v2PU=`-u =v2ujhu7v2ZY9v2~v2|x3ueUSáu2u2xFأu2u24v2N&wN&r\-y1]X]W|$wUWVS=w2v2ffBw2@v2=Pv29=Dv2u ;Lv2w2]f>w21Ej]Sjj5hx3| yh$[jh(x3jjhw2Bf>w2v24fpjhHx3jVP5lx3 Ã9t:y h$PYSVhw3h$hJ.Z1`-v2% v2 x3v2@v24v2Lv2(v2=,v2u(=(v2uv2Lv2Lv2Lv2(v2=v.}fE fEm]mE(v2,v2N&5xv2=|v2v2]u}fE fEm]mE0v2 (v2,v2EΉ߃ɚ;~ʚ;Eހ}0v2 (v2,v2Lv2(v2BN&؉(v2,v2(v2,v2 0v2ى 0v2ɚ;~(v2,v2ʚ; 0v2v2rW xv2|v2 (v2,v2 (v2,v2v20v20v2=ɚ;~ (v2,v2-ʚ;0v2|x3t 1|x3te[^_]g_UWVS<ÉUM|x3tUUEčs}uyMăA}9}fE؍t E;v2uJ1@v2Dv2u5}t4|x3u+?EPuh$ Ѝe[^_]W|$wUWVSEU܉M7C]|x3MQURuh/$t hM$rXWhS$f|x3Y_t,sE @N&RR$Ph[$-=}x3y"uCJ.e[^_]g_e[^_]g_US<5&=3ud#m2SPh$hJ.`jUWVSƉP¡3_tEtPh{$E 39U|} Vh$j4 su4 1C@C1t )уȋKAPEFCCp1}~CpMуt[}D;19Ue[^_]USӃ 31҅w =w"=wj=w:=w R=wA=v=w.=w "tft uȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPslu PVh$ S"h PVh$BhPSjPVh˰$SgPCPVhڰ$ihJ.Xe[^]Ãt"¸$7t$tURZø$USљRPQhS[hJ.S0] J.yUhJ.j XZáJ.PJ. UWVSDuhJ.>e[^_]ÉÉh$5'a_E1ҿ!Es,s }uCEtHH1ɉ B u1ۋtЅ}t2}uK]1ʉj.h3EPjl:]1ʉubs VPh$j.h3Vh3h%XZT5؃3VPh%oC 0=ă36UWVS$@<tPh&$2Y[ C 8'tRhp#PhQ$ ^_PhW$XZCH<$3'hd#C Ph`$C6' Sssht$C! `6'<t6'<t8'CTS C ACPh$`CZYPfwk$ 4'h$h$6X1Zh$h$hʱ$h"_3hϱ$^!hױ$Y Ph$XZ뢍A9shޱ$X 6EEEEEEEԍsEԈEӊEՈEҊEֈEEUMfsfhw.ffQRPEPEPEPh$NjfuVuVuVuVuVuVuVuVQRPEPEPEPh$$݋EE1u1hV$' [rE9XC҅U>}tSyM9)sxEt  Cy;8-t8-PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth#h#he$aJ.HJ.$yhJ.j /XZJ.PJ. }e[^_]'e[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һn$~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(USFPhu$hJ.8Sh$hJ.(ShӸ$hJ.$Sh$hJ.Sh $hJ.Sh $hJ.$ShM$hJ.Sh[$hJ.Sh$hJ.$j>UVSƃ=D3udPSS^Zy Sh$P-밋l%=`ƋT3t:h,D$RPZY ho$PRZYu\t_X/tXRPhu$_RPh$hJ.\`tRPhǺ$  RPh$hJ.Dž`t0P _tPh$苧ZYDž`9t SX`tjtj誸jUWVS TPjhPjT11ۉ`d`Ph|dV_ @ h;lu\1ɉXSi9dsW`XZuh"\P Y_t X\X;lrt\h"h%hWEPt@3tWPh!$tWPhǺ$ lS Zh`PhedAV: 1ۅ9usCaPTh"h%&hWPEPt@3.t-WPh!$tWPhǺ$S CiV Xe[^_]UWVSV1}jj}Wjh :' uTEEPjjWPh :' t S[!h%SM ZYtQh%je[^_]UWVS]u CV9t)=Sǃ4$Z9t9su ]e[^_]e[^_]ÍL$qUWVSQdYA`A EA|AEjjj! hk$ Y1tpiPEZuh "Vuj ! E y h$j t}th.0huutCtQt_}uEPEP _XE#t[OEEd#R$:E]$"$@Ed$"EV$ƙ"EVh[E܃|ƒ} ˆ{EX}1ɉMЉME r!S"Z9EsECEUԁڻ}ujEЋU M؉SQRP|  T9ѹ |+ɚ;9ы}ǻ |9ы}ǻ |9]}]h$h$h"Sh"SVuh$uh$ , E EE1EЉEԉEȉẺEM}`tEd9xE@EE@EEEEEEE{u Eu}u}̋u}u}zu} }EݝpEݝhEؙRPWV( Puuuhļ$u؉Ep݅pܵh N&PP$EM)ș WVRPӪ PSEU WVRP踪 PShϼ$jj hd#WVj}W @u hͷ#jj hd#EU RPjEP @tjj hd#EM)ș RPjuV趲 @tWuuuh$ Ep݅pܵh N&WW$VSEPSh$4fE}MЋ] }tajj hd#SQj]S' @jj hd#EȋU RPjuV @VSh $h MЉ]ԋu؉uEȋU WVRP3 PWVMЋ]SQ Ph$|"Mȋ] }jj hd#SQj]SZ @Ajj hd#EЋU RPjuV- @jj hd#EȋU+EU RPj}W @WVSh6$gM]u؉uEȋU+EU WVRP, PuEЋU WVRP PuWVM]SQ Phc$\}REȋU EUă}m]m]jj hd#RPjEP @jj hd#EЋU RPjuV @jj hd#EȋU+EU RPj}W輯 @Eu N&QQ$WSVSEPuh$uh$vu؉Eu N&RR$EȋU+EU WVRPЦ PSEЋU WVRP赦 PSWVuu裦 Puh$uh$萷,uXeY[^_]aUPhڽ$hJ.j脭UWVSljU΃=3u'jh3 3ZYuh;$t [3Xi 3}u-WUP>ZYUujtdWUPZYUu=tRhh3Ɯƒ 3uPh$j K c1e[^_]UVSƻ@-tPVZYt"Vh-$5X4边W4MC St8tPRh@$x RhK$pxZYuj 3h`O4 CDO4@O4 e[^]UjWX=dX4t%X4fPftjh =tX4uF_$=pX4t!$tVWjVjjhRSySX W4e[^_]U帥"}ut#]U}u h,$h5$h@$5X4Υ1W4UWVSE]uu1҅‰uTpuCE xh"WPZYu u0Hht#W3ZYu1t/t#F u븥"PVhP$5X40e[^_]UhX$hW4u uIW4U}uW4=`X4tX4E Eb$] ]Uh$h X4u uW4UVSE] u1=X4X4u{"yt gsh"V$ZYtBht#VZYu 1X44V迻^sh$5X4 맣X4X4노t#Ph$5X4 =X4t5X4h$5X4ϣ 5X4h$ X4Y[t1҉X4W4e[^]Uh$h`X4u uW4Uh$hX4u uW4Uh$hX4u uW4=X4t1X4Uh"$hW4u uMW4UVSE] u 1=W4bu.sh"V臷ZYuBht#VoZYt1sNE4^hsh3 W43 뷣W4W4t$t:u5X4h3$z 1W4ZY4E4:u)#t#t"SRQhj$5X4 W4W4e[^]Uh$hW4u uW4Uh$hW4u uW4UVSE] u 萏uHsh"VHYZtBht#V7YZt6VZy+sh$5X4J 1=W4W4L3t "t#L3PQh$5X41=W4W4e[^]UEt~W4Huh$E PEP޽ tЋE ph"$x_YZu9=W4uJ=`X4t5X4h$ XZE ph!$:_ZYu8N4E41E4USUE W4u 3Pt ]pMYt`P Z@u Sh)$; X4=I4thI4h:$P赟1ɉ W4 PhS$ XZ]]]UEulW4=Huhl$E PEP荼 tӋE phx$'^ZYu 8N4USSEuW4Huh$E PEP. tP3h#:jE[Xjh3jp XYE tE ;u1ɉ P3jju ٬à uu=P3tڋetShx$U][Zu 8N4=P3u=dX4tW4W41ҋE tP3W4tujOXZ1ɉ P3]UEuW4}Ht}6h$E PEP uh$E PEP t}E ph$x\ZYu!E ph$a\ZYu 8N4UWVS}M 1ME1 tg$%tWMh$VZYA$Mu$~AEtu!t~1}h#dYu 葊n}ph$Zt8uՐ"QM-É<$٬CP諾|CSMQ@P =dX4t5W4W41ҋE ¡P3t@P35W4ujTZY1ۉP3EM9t EPnXe[^_]UWVS}u ̇.jj2|ƉXZS臍 CYujj֔h# à u5%j/Sw* _ZڅtPhRW =W4t65X4Ss X4HQPY^y Pj vY^ J }~j5W4h_n#WS0f  jWS"f Sh$W4je~Pl Z9uWjZYFu h$eX1ۉW4e[^_]UWVSPEEuqW4Hh9$E PEP菵 EwɋE phB$"W_X}hJ$P ^u ]E XShU$VS1 uY}h]$ Yu ]E X Shg$VSt1 tA5X4ho$ XZ<u}u"E X Shg$[VS.1 W4e[^_]UW4}t'=E4t =E4u#r=E4uX4E E~$/ hE4h$5X41W4 UW4}t鸄=I4u#X4=I4uE ES$ hI4h$5X4聖1W4 UEt~WW4{Huh$E PEPx tӋE ph $UYZu9=W4u<=`X4t5X4h$0 XZE ph$TZYu 8N4UEt~躃W4{Huh$E PEP۲ tӋE ph;$uTYZu9=W4u<=`X4t5X4h$ XZE ph:$7TZYu 8N4UWVSu huS 9}1hE4S] F 9~hh%SC GSh$SY[Hu j5NZ8N4e[^_]UEu薂W4/HuhB$E PEP跱 tu uhd#- UEuJW4/HuhW$E PEPk tu uhq$ UEuW4[Ht}6hK$E PEP uhl$E PEP t}E pphw$R USEu腁W48`X4`X4Hu h$ORYE ph$EUYYBu@t)EPmPPE ph$5X4]M;MUW4UEU u$tW4]Hu E$]DBE E$]DUS] hF_$jSu1tssh$5X4˅]UWVSVEus.Huha$E PEP̢ t݋E p٭[u W4zh$yYt8uՐ"RU É4$|<$舧WURP Wh%S~ WVSv (S迌 1W4SvVp e[^_]UWVSEurW4Huhl$E PEP th$6yYt8uՐ"SIǍ@$ͦ|GWS@P =X4pX4tX4EU`X41`X4X4pX4tX4jjh$M qVh$b=X4EUpX4tX4`X4(VnZe[^_]UWVS]} t q7h$V苘ZYt.h%VzZYth $ViY[t뷻wZttH3tD35D35H3h$5X4P1W4e[^_]UWVSPU} uRUwZUuUE @$X4Ee[^_]Ë@t Ph1ɉKXW蜥CZ=`X4ttP3hV$5X4e[^_]USEU W4t tt<]p-t8Cud#PRj hm$5X4_jrr 1W4]UVSu W4}t e[^]pvvXuvh@$5X4,Ct P_1҉SY3hv$5X4ρ1W4 e[^]US}uoW4B=M4uX4E E$] `X4`X4h$Q@`X4X]USEU Hv;oW4V=M4uX4E E$]K `X4`X4Hu h$?Yrh$?XZ`X4]USMU AvnW4_=M4uX4E E$] `X4`X4BuPh $`?XZrPh($N? `X4]UWVS @Eu} t/nW4AHh$$E PEPM tЋ5@3} 19~j k3Pw t*Cu%whc$5X4W4 h@h4P' 1ؿk3X 9XrR.DP@tC4<$t<\CFC R.K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mPE4)PE 4V5 E 43߿iu6CDžؿ9}~)E4)PE 4V E 4/ƃF;p\30mXu 5X4h$u!5X4h$L W4^X~ t=W4u 5X4h$΃=`X4t:5X4h4 X4HQPYYy Pj YX J j 6R \3P5X3V =W4t3~t-X4HQPy;P| J PjXZh@Ph4 oX3E\3E 9XCؿt G9}ce[^_]USËt PG1XCt P51ɉKXCt P"1CZ]USd̫3jwX=dX4t>tPhz$jd]Sw~!X4fJftPSRm jh@3%N USdj+wX=dX4t>Ph$jd]Sw~!X4fJftPSRbm jh@3M UWVSÉ֋:j:W?YZuWh$S臤 :WXP諗YZtj%W YZtWh$SQWF u FfP HuFf=tPhe$S h $SXZe[^_]UWVSQljURڷ[Ë7 <wsBSuRUQ u8Uӊu <wrs C <v1e[^_]UWVSË@t P1s_stV=Y1Ct P݊1CZe[^_]UWVSljӋu\X4u<MP6uEPMQSW脨ju>y8E8 u@EPh$)[XZ H< ws 1e[^_]Å8UWVSH%Pty=R.UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu h$jM jh$W uW1ɉK fCPjh $W uWC fCjh$W u WC _t36 vCvCF C FfC (Wuh$LY Ei$:j/RUk^ZEUu R菚8)ЉUHQMƋMQURP4 { uEuVCYj@VZYt_{ u1҉[urVj]RU蜈YZEtH:UttWuVh)$)PERVaMVu WuVhI$fEPx:t1j:V0YZtP>t3tJj EPRUyO U:tM9u HvWuRhn$W?fC*C ttE4tE4td#R՘CZ{u%{ t%P赘CX1e[^_]USZKJy ;J| t Y RPxXZ]UWVS\fDž1jh $P _1Dž1jP$AZY@t(t 8tt 8uSh$U7(8j;P ZYƅh$PFY_t>h$V5_Zt4h$V$ZYuh$U_SVh$Sזj@P蓅 t%1ۉth$VbpYZ4t3hSS hh%S hVS $hh$R 1ۉ=E4 tSW41ɉ W4t hh$ hh$R/ Pj?W4GE4uj/Vx [ZtP1ɉt PjPjXZW4-cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh@3O? ZY3u P$Y[@ S ^<$Zffu/t+;:he$SǁZY%ho$*t?u+$u =E4uh$MWeY,,E4t <,j/P~ _Zt@,PZ P YE4 t 8uh$c1=pX4=tX4xX4|X4DžtDžx=E4t0 tRP%ZYupX4tX4OXX4$,hpQ#P^_44u ,c4P處t$P藐Y[u/txxX4|X45pX4=tX4ut84P51҉$WVPŗy,Ph$_Xj=`X4u=D3D3,Ph$5X4j pX4tX4 X4uu5X4j UO[^RPh($Q^jhSh@3 M4@3$<<8|h]$r^Z8PuH$k_h%HP>XZ?tj:Wm ZYuWY9sFj DPAP(B ytD9u9tyPW)P^ …YtEy_ uu1 %=tX4u =pX4tc Ӌ`X4t+Pha$h]$5X4 chi$Vϋ h{$V詋 h$V莋_Xh$V聋XZ1N4;xs4hN#Vc G=tX4u =pX4tP5X4ha$蒯 Y[5tX45pX4h$V"5tX45pX4h$5X4'b=4N4u&4h$( Zt6Ph$Vъ = 4G$t4$PR諊_Xh,$h5$h$V蒊1u4a$tn#t7=`X4tWh $5X4Xa Ch?$ t2=`X4tWh$5X4a CVh9$ u<4h $P̉Y[4P,^@u6hS$1$[2=`X4t5X4h*$߭ XZj[X<415-΂`h$ -X,j q^_u41DžDžDžDž@`j lRP lt R.DB@tU`e[DžDžDžDžDžDž1DžDžDžDžDžDž1ɉ1 DžDžDžDž11a\ddh$~tej `Pd>? xX4|X4`8\P -Zpfx$ ƅK#d8*u@zj pVP> gp8-X@dj VPp> 19Ћp8/ Pdx*u,j pPR> pd8=tX4=pX4h$$tXH ׉dRp^_oDžh8HVRHYtx>$stdF*$TtRۿ$Dth$=X$$udh$@:$tdN$ƅuT$u}tPPlXV~_Zt:H-,r)=tX4=pX4hf$t;u h$x3Px3~ h$`X41u>u$Pڋ(Y^'Sh$5X4Z ƅu  Sh$5X4Z ҃th$;XZ h$;X DžDžjXu tSjYj_uRh4$DžDžDžDžDžDž 9E4u h#Pr_Zu Dž8J.\ 8|uQjj TZY hF_$@PE [^88u @Ph$lDž08<pX4tX4u!t9Nj}5uPuGxX4 |X4!΃9=`X4B5X4hS$ץ ^_+u t=xX4=|X49u 9t Pha$}9 h7% hF_$PXY[88u PhG$"Dž0Ph'j-S[^hvjS_Z$3t9D3tK 3tP(hYD3tЁ~=}$3PyZ 31X4X4X4@tPj~R^_DžjR[4P5$35 3U u h$P1ɉjP5 3ƃ 39u h$8"ty- " 3R)Ph$F  u @;u‰Њ B t th $P_Zt h$=0N4u 0N4șu$31jP]Y[؉|tL𙋍|9Ή| ||=X4F|19=$3|19||Nj4PWj5 3耀ǃu4PjZ1X4X4|)ډ|8 3@DžftS)F utڃ#u)uË9 Ph#}=X4X49X4X4|#6X4RoXb)f=0N4tYjPF[_++y @B19|@B)RY맋c[1u9V4P5$35 3蚀 uj@N$$h $5 3_Zt h$F4|ft=X4u4P4}^tch8$覸Q=X4uڋ X4X419}NjX49|X4 뤋X4#[#jN8$smY0=Pxu tjSXZtx1ɉ08R18 $P _Z@u*tPN9$re$hE$5X4Q 1;X4X4|xX4 |X4y )jFXpX4tX4X4X49؉|1=X4=X41@u @u"PjLY[㋅Pj wLXZ@tPj^L^_@tPjELY[4t4P{@t PD Z0t8t08RX ;E4t t Pa1 X,t,P`1,XtP`1_$t$P{`1ɉ$[(t.(P\`1(Zpe[^_]UWVSÉjh$P jh$S tsh$SeZYDžt$jh $S tS)Whj$jɝ uh<$C_u?F t u8t,jh $Su uVj11҉/ZYe[^_]É؍e[^_]*US1EEjh X4l ZYt-=W4uEE@Ejj Y[hhjI[Xhj IXZEE;EEj:M 4_ZYtw1ۉx3= =W4uD N4h[$_=W4=W4t 53/5X4h$uڀ=3u5X4h$ [^1;V$hV$S`|ZYu1lW4-w 5X4h$븍RpRRRPh$h`3 t5X4h$n:u:u:uҿ33󥋅pff3j3Ph353Zy/3=W4P0 X31W4m=3h3j53]ZYy h$'_3=X4<<3<3P3P3P3P3P3Ph$Ã=W4i)=X41ۉX4303=X4t f33tPw/ Xjj3P3 y"h`$-_X4=X4u#jXRjhP @uh$$3Ph353S yh8$^L3tjXPjh53 Džh31󫍅hPR539 @ hW$됃=N4D=N42=N4+= N4<u\t3<u1j j WhStPtP 5`X4=W4u `X4WS\h$É5`X4~5t=W4tN4_h3h$5X49 =W4u Zu<if3RPj3P3P 3P 3P 3P 3P 3P3P3P3P3P3P3P3P3P3Pjjh$ÃX1t X4<uADžXjXPjj53: 53J, 314W4$ w=t5X4h$olpRPRRRPh$h`3| V$h[$SvZYW4$ j3<lpRPdPRRRP`P\Ph$h`3 , R\x`kd^31f3 Ћ Ћ ȣ3lp ff393C<vlpRPdPPPPPPPPPPPPPPPPS`P\Ph$h`3茼 \t5X4h$.\` d31f33@ulp ff3jh3h3 x5X4hU$[$m=5X4hu$r5X4h$be[^_]UWVSD}3=W4tWPrjjPm( ƃ cPj53N( @H3EfEjEP M]ġ\X4ZZ<ډEUjEP߳M+M̋EZ[+Ey@Biy1QjEPU u蛁8t葁8#th$Pu h1$IE03EEPEP53' à u!I8t?8#thT$荙[P53' 3VjS2' @t0}uEjEPjjSO W53rJZY53Q' 3X1e[^_]UWVSu1ɉ 3hlj{.EW4[_tp3 3W 335W4W4W4M4thPBUPT UBCM4 33 󥍺0303ȫ3<<ȫ3ī3@@ī3DO4DDDO4@O4HH@O4T3LLT3W4PPW4W4TTW4W4XXW4W4\\W4jhW4`UP j`PhW4 jhW4U썂qP $jqPhW4݌ W4U쉂W4hhS4P讌 hPhS4蘌 $hhO4UˆR| hÈShO4f uj,3 t13EEe[^_]e[^_]UWVSQ}j/W [^ƸX%t9u%jP虓 XZt/y Whq$ohWh3͋ 3ƀ3. d1/F09tBEjh35 XZۊUx"0t$uOu5X4h$} Y[13F<.u1F@Fɍe[^_]UWVSuī3u/h$X=d3t W41Ee[^_]<fDžƅfPftjjWPt h$Xhh$5ī3$/5ī3J ȫ3gÃ(t h$賔X=d3t W4j<Xt(t#fVfthWPt! jYu=W4(ujZjXe[^_]US E1ۉ]h$umZYt E$R$=W4t\$EDO4u!=M4t=M4u9@O4u%h$Yt!5X4h${ TjS{XZjpX=W4u)5X4h$$z [XjMXW49@O4uh`3h<$iZYtjS){[Xjh3 ZY%hj(Y[EpX4tX4uuuuh4% Hu.RPhD$ tԋEPj;(XZjXdjC $~XE@EpX4tX4uyuuEu Ph4% Huv`3j 1$51$E$j'XZjY1ۉ`3uu hN$5X4P,RPhD$% sjh3 Y[hjO'XZ1ɉ `3h$uj[Z¡W4tt =T3tSjtjrXEt1=W4PVX=T3t(MEu Ph4%| Hu\j[뼋Eu(Eu Ph4%O Hu/=T3tjY1=W4PZ=T3tCjX=T3tqjUg 1ҡȫ3e~jl1$bX=W4u06u=d3tW4 hd$脐Xj7XjVYjN[=d3t W4EPj%XZ]UWVS1X`X4ptXX4`"1\X4X4xX4|X4X4H=`X4t}u=W4tTuu u{ E 8-u}tuhX$5X4) u h$5X4) ʡDO49@O4u:1ɉdDžhDžlDžLF_$jh3 [^u#jPwXZ뺃=T3jXh'jz$XZhBjl$Y[hh#u g^_uDžT@J.1X4E 8|u]jj *$Y[lE XhpQ#S[ ^_TTuSh$sXZk1=X4DždhpQ#u ([^TTu u hG$DždPTfzt T@xRP}MZYxE%=tu h$5X4( EЋUԣxX4|X4jh3 ^_q5pX4=tX4uhR$urfZYthW$u_fZY@O4twCTfxu TjWVPKT@jWVPTyu h$Y[X5tX45pX4hD$ 6DžL$}tEuuh4% H 8N4LZ\\uOuh$^_뽡3t9H3tK3tP6YH3tЁ~=}3PHZ3j!_l@ujj m!Y^l=X4t=X4t =|X4y X41ۡ@O48\fxt \PTfyt T@S5(N453 3 uu h`#DXZr8 X4X4P ta\`RPPF @\@ @X4X4TXRP4FPY^@u|u\`RPj vF @uc[pt95X4X4|ȋX4#5X4?_ptX4pt륅u!J\@ @uX4X4pt9 X4X4|X4 T@ @t0X4#UqXu h`#蝉XZ\@ @t"-q`Ih$sXGj%XdtdTR^1T\PI>1ɉ\ $[zhPjXZDžh=T3u W4c3xP X3\t\P=^1\jf[W41;X4X4}jYh@u l@u"hPjXZ㋅lPj ^_3xPo [3du \u)TtꋅdTRY؋\P=XHX41҉pX4tX4X4X4e[^_]UWVS1ۉ,4(0X4PTXX4$15X45X4LxX4|X4X4 W4h$uK`_ZDDu =W4uVu=`X4t}t}u&E 8-u}tuhX$5X4.! 뺋E Ph$5X4! ɋDtE uPu} 1ɉ8Dž<Dž@1=W4uDHjh3J _Zt=T3tzj^h'jXZhBjY[<}tWE jP~ Y[E j/PI _Zm8tNm8 tDE Phq$[^W4 E h#P^^_E 8|utU %9t X%tE jP Y^t/x=W4t m8 uW@m8 u"E hP _ZyE Ph$P=W4t 뽃=W4tE PYE .D@O4uJutY jjlXZDO49u&ju/^_xX4|X4W4ujPlY[=ujh3n $_ZSDu}u/mpX4tX4utRPhD$t vˋE8t8Puh4%P HThpQ#=^00uuh$Y[ȃ}E h#P\_ZuDž(J.15X45W4E 8|uXjj !_Z@E hF_$@PT Y[((u E @Ph$A15X45W4Dž8=E uPY[((uE PhG$%XZDž8P(fzt (@xRPoB^_@tE%=t1ۉX4W43t9D3tK3tPc-YD3tЁ~=}3P?Z3j'X=X4t=X4t =|X4yX4$1$@O4DtBpX4tX4ut/(f{t (IjRPQH50N43 3(fxt (P0ft 0@$VS u0i8 uX4X4h$I^ڃD =tX4u =pX4(jjjP?11y4E Ph$Y[,RPY<[Zt׃ t;5pX4tX4(|jjjP?yv뚃 $X4X404RP;XZ th(,RPj (< @tv(@ @uju04RP;^_tA gL@L Hu (,RPS; @um$uwPT95X4X4X4#5X44YPTX4ډPT롃X4X4#PT95X4X4|X4 H0@ @tNX4#*f4f8 uX4X4 h$~Y݋(@ @tMf,E Ph#~XZjJX8t8(R^1(0Pn31ɉ0 $[LuX4X4y3dLPh$5X4V 5X4h$ve XZ뾋D(uu=W4uj# _苅8=Pju)[^X\Bu@j`S2^_X\lp1tE SPv ZY@XP$+‹E $Ph:$5X4n`jh3 ZYt$W41;X4X4}4jE Y*hjh^_=T30PH[벋<@u @@u"h]$WNZYEue[^_]P2ø#=W4t}$Ph$5X4 -t$=W4t~ tPH2PS2 S%%YE ]e[^_] QMZƒMuQWh$5X49KSu QWh$ދ}u#Uj PMQj MMEPjUR rPj hm$5X4릍e[^_]á4 `3!t$uC`4tJu6`4W4%`4P4-8!u-UVS t t @`4tJt `41&`4W4 tGtBB@"u\uXu@!@B؀"@tՈBut B1`34u/`4tHt `41`41W4[^]US44`331ɉ `4\31ۉX1X3P5\3/XZtX3@ڋ]UVS =dX4t2X4SPEZ 0^Z8tPh9v$5X4  5X4'jh@h4h@J.D)y}uB5X4h$t.=dX4t X4Hy Pj Y[ J z=X3?\30ZÃu 5X4h$+u 5X4h$x t =W4u5X4h$LY [^1ɉ W4j 3uVg \30P5X3S =W4t3{t-X4HQPy;P| J Pj XZ{ Yqhhjhj e[^]UEt]1]US]u h$jY SZu Sh7$jY @]U=-u b -X4fPftPZ Z9-ÍL$qUWVSQ0`X4 X4 XjP+ `4`4Z^+`4y @B,N&ڽ߭ݕ X4X4XX419}l؞vK߭ٽf f٭߽٭؉Ή߅ud#t 11#RPSQhh$hPٽf f݅٭۝٭Q~DQ#ud#RPh{$)PP<Ãt PhU8#)PPÃ<RPh$)PP؉19}t  @~4h<'%y)DžkddʉӉف1 Q%1 RPh$)PP8X4X419݅xX4|X45pX4=tX49Z)߭߭ٽf f٭۝٭׉h$)PPà t!VhU8#)PP~Ã<RPh$)PPQË+`4`4`49}9}&h$)PVà hZ)Å~:ùdhd#)Sh;'Ph$)P=P9ǃ119ʉst  @~4h<'SQh $)P=P+`4`4+ `4y @B,N&ڽ߭ X4X419ظw ȉ߭LN&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4h<'%Ƹd PSQh$)PP*áxX4|X419‹X4X4)ލ 19‹݅99}h8$VQaà +pX4tX4߭߭ٽf f٭۝٭?~~h+$rtPhU8#VQÃh%VQà <ЙRPhE$)PPoÃuhS 5W4tjh$h3 S uSt M4 M41DO4j hۿ$h`O4P t\h`O4h$5X4h Bt 1M41M4t*j h$h3<2 u5X4h$VA ^_M4M4M4M4M4N4Ы3'h$躲Y1uī3t-fPftjP 5ī3 1ī3 1ɉ W41W4j芾PZt ShG$jO@ +?0e[^]UWVS ]uW4=P3t =W4u$u 1ۉe4e4Pu+e4tÍCe4C1ɉ e4e4h5N4WL /thh%WdM hha$WQM W[ryWho$VXZ1qP =`X4Xأ`X4X4X41X4X4} t1=W4PXF_$t!jjRPPh$57%֡W4-cvt3} t1=W4P豼X=`X4X4X4hpQ#SFe4S$qe4 uuh$ ^$Phha4i u5e4W 1ۉe4j ha4ZYua4e[^_]UVSQQMq`X4=W4u `X4=M4ut95X4h$C< Ph$YZuBj h3o^Zuj UR@P M te5R.DN@tVu=W4u=M4u1ɉ M4t=W4u5X4h3; X4 XZz`X4eY[^]UWVSQ4MY=`X4}=W4}=W4u `X4=M4u}5X4h$.; fPh$Ԭ^_j h3VZYtj.h3A^_th3n*Y3uKjh$V+ u7Vh$5X4|f320h3hV$5X4^3 }1V*ZtVhi$5X4- EPh$VKg tEEP_uu W4u\]`X4gu=W4u=M4u1ɉ M4t+=W4u"5X4h39 X4 XZE`X4EW4eY[^_]Uuh$j2ha4u h$j: a4UWVSP}u jjh#jWh$VCf ƒu&Wh$V.f ƒ uWh $Vf ƒ USjcEe[^_]UhhI4s ZYuI4UVSE45`X4W4=W4u `X4h`#YZuQj h3ZYt?8t:x"u41Ɋt t"u P"u @E4A@ƁE4E45`X4W4e[^]UWVSu huS^F S8B hX%P)u]WS0 YZuSh $]PXZ19/uVJ'É$VW~( uڊ/ e[^_]UWVS}GE119ut4&Z9sFSU衈X49r1uÍD1EkE1Eu9uE1E9]tzMt5X4RU6 YXU;wrX4 t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=W4u Ed#$=E4uM=W4MtEE4E}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL#=W4t M4u#}mډ)Ӌu N ty.uup9swBL#=W4tE4)؋u ^ tA9sHBLE H9cS%"M I9OS%49sSڋMA[^_]ÃUWS$]؍U1EEEEPSh[5&uZ ƒ1uuد Xe[_]UWVSu] }VuSF u1N tu$t$fN lSZHˀ; uLUJ9uD DJ.y h@J.lY@J.H @J. t@u҅t$ff t1҉e[^_]UVSQuh4w[áX4?vPh$/ j}uh$PCƃ4 1҉UUR@)R4Ph@J.yh$uh $5X4:jX319\3 U e[^]UWVSD]} Sj j VhRuW| t&hh#R8= j h#V+= E4tzW9Vt vuvvSh @uT.8jjjhSvv| thh#S< .8Sh$FY[4jjS ƃ u(PPh\y$h1$FPjS] @uPPh^$fDž=\X4~"jP_\X4XZuWS; @-8$}u-8A^PPh5$E >jP_+‹Y_+y@Biy1fDžRjP uY!-8u=\X4~{-8#tLVjS ƒ 1BPPh"nu,< tQDžPPhhSp @ul,Z, e[^_]UVS]u SXu ]e[^]C` UWVS]} KyCSXu?C u8@t4+8ufc +8#tt+ P0e[^_]UWVSu }EÃu3F u,@t(+8uff y+8#tt k+[^_]US] hN$SYZ¸t,h[5&SYZt;uEuh$vCXZ]US]SZu Sh$j;, ]U譭 u h$j, US] Su ZY@u Sh$j+ ]UEu h($j+ PZu hN$j+ UWVShuE ]E1҉UUUt PEXt SE_=1ɉM[h$nEEZt P1EXh3$-PGE[_EPEPEPVy$W453 ZEU3X4t\RVhx$P&1ɉMEPjP]Sh@J.}yhP#uh $5X4W41 Vh$P Sj=W4tVRUpÉ4$f|<$WURP 7 Wh $S7 WVS7 E(tPX]RhB$?^_}u-hJ$m Yu]SES1XZuhU$ËuV1 uq}u-h]$ _u]SES1[^E8uh$޻ YPhg$聙ËuVO1 uŋEtPhg$O_ZuuE4W4^uxW45@39~Lk3Ph$ZYu0h@h/$h45 p\305X3YCE41E4Et P51EX]tSl_1Et P 1ɉM[]tSCZ1EtPXe[^_]UEuGW4=W4t%5M4h$5X4#W4fHh$E PEP7 UBw W4t E4u E4u)E @tW4t:u h$j.' PRPE pZY=W4t"=`X4t5W4h$5X4j W4j h%h`O43 DO4@O4j h$hN43 N4j h$hN43 N4$j hV"h O4p3 O4j h&h`N4U3 @N4=W4tjjE p UWVS0u=W4uue[^_]=]ȹ 1SjhV$ u}uVh$膸 S 1E0ES XZEče[^_]UWVS,EPu EPn Uȃ u_$ ỦEЋE0ufEjEP1V\X4EUXZ1ۃ=\X4~yjEP VE+E‹E__+Ey@Biy1RjEP u#8t#8#tu#<_#1҉jEPV u # yp#8Eb#8#7ËU9} )‰UEuNX؍e[^_]UE]UE@(]UPEx$tEjURjj0Sf 1USju~ [Zxj0jZYu SA Y11҉P$]UVSPuEj0jPZYt,0@$jjV jEPhhVe ؍e[^]US]t&S13 sPsHSB1]UWVS(]=\X4~jEPT\X4EU_XEE E̋C t 9EsẺEЋ}s)C C)E0}1u&uW3 t}R)EEЃ}um!8v!8#twl!C(b!8uE9Cr">uC,'>!8#usZYCEЉC{uMEЉC 1{UԺufU؃=\X4~;jEPRE+E‹EY^+Ey@Biy1 1҉VjEP] u t 8tj 8#t` C(95\X4Ph$5X40 <C(<1EЍe[^_]UWVSQ} ]{uhCZC{({,C;C C1s sSjjEPu{(uT{,t Cu`EmKSBCEC9Cu3pVs(ZYuQ C(1E2Cs} z뙋s )9|Gs}UC Ee[^_]UWVSSu] }VuS u-~,tu$t$1ɉN(YS ZHˀ; u9UJ9u1VjjEPat} ut $1ɉN(t1҉e[^_]UE PuAjmUE PuAXZ=e4u e4UE Pu XZ=e4u e4UWVSSƉ׉ˉʁv )…tRUWV tUu؍e[^_]W|$wUWVS||xˋ7GEGEhE_u hL$hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}t }}uetWuuL EE)PEW| u hZ$_XC1Ʌ}lj}EU1EMu9}uho$A^_EEu1ɉMCw$<'E8tJ1M9ȋM}uh$XZFh$e4XEE@EO}jjjE 1}Ett h$O@EO}E8t h$+@EO}oEU@EO}O=E.E0@EO}E @EO}jEu E8u$ Eu E8u @E"u  NEO}~j8h$jEPNu [h$1RjEP9PEZYwP$<'}tR}uL1Eh$XEE'h$$h6$hL$uhd$_X+}t Wxơ -9~&)V5-ZYZu5-V XZe4 e4u xh!$2j|PS t"@u xh?$sxho$fjjjS=e4uU=e4uNhh W ƃ uj jö YXuPh #XZ=e4tl1WD;xjj1ɉNlpSZ t hM$_tV= ^t hb$u[e4pu*lu!u PvCYxhx$76jjV à u Vh$xPS_ZtVh$S褵 9pu9lt2RPplh$Se PBxBS@ jxN l[^@uxh #5=e45-xh%hS=v -)A5-=e4u7hh Sdz ƃ u"Sh$h@J.x xlel] Y=e4VI Z@u hb$XxAat`=e4tW =u=u5jx ^_yxh.$ S̳ [xh7$&ZYtt t9Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuV t VP^P5Hx45@x4h?$j F94s4e[^_]UWVS1ɉ /t,$Xtt+i9~d\@1ɉÅu5Hx45@x4hU$k1Ҁ8IuC1tOFH@>uj RP蜓 F 5Hx45@x4h~$j ؍e[^_]UWVS ÉUE9C#u~nu Px4x4@ 445x4$_1,px4=@x4u8#uxnu Px4M 1M I tpx4@x4t]Ut @uKf px4-tpx41ɉ x4=49G 4@x4t1BJM pЍe[^_]U`x4@ t=x4t/=4t;HyPYuԋJ 5`x4Pl XZ1UWVS|u=`x4uQ48u==x4t hH$jo `x4@J.Hx4i$\x4J.Dx4"lx4`x4tQHyP Zt@ J5`x4P˘ 5`x4hdx4hhx4 Ã]F`x4=@J.u 1~1P [=|4tdh|4y'h|45Hx4ٛ t: $='49Ѐ4r4kP544XZ=Ѐ4k 541h 4154{u5\x4sn Y[ =̀4uu = 4 4t54CPj V u 4p @))Ӊ4SPV諆 mj5 454h4;jjh'ت_ZDžtE;5-r5\x4hv%f Y^>'3$Ph$5\x4 _L<;5-r5\x4hv% XZDL<Ph $5\x4趘G 9tE8tcS1:"u#C؍e[^]USPyYt@Ut‹EBu Sh$j ]UWVSÉk<`.AfEE19E~6Q@94:u9E~֍~@kt~UCuBEsD})EKʋEC _9~M{fufSf9} z)f{)MS9|M9~fK)y1fsf9|MS9~/E9}(CPuyRuFYXCuE9}ys(ulXZ1C9uf{th$uQs9*Cujjs蔆 uCuS)Ps]s3e[^_]UE @]UE @]UE @]UE 1҉P]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE 1҉]UE 1҉]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]"U14jA1U14jA1UE uU]U4 -1]U4 1]U4 1]U4 1]U4 1]U4 1]U$41]U$4p1]U$4U1]U4:1]U41]Uh袧41Uh茧41U4 1]U4 1]U4e1]UL4q1]U 4l1]US] 4)thkj<XZ*ƀxj3P?jj354Y]UWVS ]u t/{u)P.vP= t6vWKC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P藀C ZtsPVs 1C sfs1CZY]UWVS`.1AfEE1}9}FQF @tf~uߋ}9}֍~@ksCf;ssfF XtgC,t{uu S_XC0tu SY^{hC E{CE܋Cut 1EEuECutiPEZt[8tVU1ɉMj RUbxYZNMUt)9M}MԍPuRyZEM9}MtFE1ɉ u1uE$CЃEЅy 9}NjC fsfufu EfC  L4M)U)9~(f~CDuEԋ}))y1E+E)fC M΋U9|C@tSf)uu5L4WuCPC Phy$"EU)E)9~fS }}E}t'E܉E;USBu2ZuEC9E|P0^9E}EEM4H49~*u5H4uuh$hJ..ejW}u)MUʋM9})EK uL4}))ȿuWVEQoPCu3{uuWuuuC Ph$hJ.d$j0WjP+p远ZYthshsCtuuWVC }POC TdC tOP5P7PXZ?S{B99fSs C9|)BfSU sV_#@$?'2=.=9=R@Kщȃ$?'C*hJ.j.H Y^\sF "HSB ufCf;CfCs$uhJ.jG 5P7{65P7X6jjWPaNEtbu5P7O5L7\V ƃ11Et9}} < uEF5L7xhQ$jj5L7XVjj5L7H$jj5L7荪5L7`5L7-Y=5R.DBxqz>tKdtF<-u(=t5=t,-v3=Rt=Su%t!+=L4S>tL4|@hJ.jnF XZV/aCfS K)y1fK)y1fC\{f}}S׍ MQ9UK fMU)y1s9~fSUʋMM9ULfKswXxut fCfCjz `~x~Ja (EC99C@ 'fS?u ? =St=V7Yvt1ҡR.DPIhJ.jD V2 oes vC Zt sP-L_Xs8\Y teF t!u S_Zt Cs~ft^F uMsuC ^tsPKs 1ɉK s[s 1C@4XZu W_XF s?uC Yt sP`KXZsk[XCt2P^o1s_$uCD0tP?oC1҉T0YEC9E|ӋC4tu S_XsL 1ɉKC ^tTP9 1C ZFu2uZu 5L7teE9s$[ Xe[^_]UU@4U fP]UU1x9D4~@4]UWVSP.5D49B  MP5@4jY_Mu11@46D4@44uj.t.t)9T4r!DP5t Zt;X4s ..؋]U5t4j1`4\4ZU5t4XU5t43XUS]uTu PmSPjh]US]u+u PmSPj?]UE Puj& UGuPh$ UuPh$ US ]uuPmSuuu jPQ$]Uhd#uuu uUWVSu5t4&5t4&XZugu,u4u(PlVPjjMƃE}t'E8tE$9}u蛏YtEE$t9}=2}Et,~(E8t PaZU$DE9rE} u)@E }y$u{[Ej PcZYtE@M}})ȻEE9~)ω}u uVQM5t4:ÃMu$u uVQh$5t4U11MQS<XMtW5P7 >ZYMM5t4`PS05t4PSjjSg$SrE @PE@PVMQ5t4;:P0S P5t4ΉSmP5t4u'u(PjU,Ru$u uuP$t6SgXtSW7=W S=MVPlSfe[^_]Uhd#u$u uuuuu u3$US]uuPiSuuu jP/$]Uhd#uuu uUS]u5uPiSuuu jP$]Uhd#uuu uUS]uu PSiSPj]Uhd#uXZUS5t4"5t4"؋]UjBUS]SJ hh#x PR }荄k =4t7S诇Ph5r%54O54 j54i14=`4t8SoPhGr%5`4N5`4i5`4i1ɉ `4=x4uhJ.h^r%ӛ XZ]UWVS hpQ#PN_ZuohRjP譋Ph$hJ.GNS^ j@h#SNM _Z؉Ph $_Y[ @'tCVhS/ uW觊$W2 t ;u뵋Ct{ tዅh#RL ZY€:=uZh#SL ZYhur%S衧 ZYWSΨ ;VhXe[^_]UEPE 4UWVS 1ɉJ P ^諣 Zp j hzr%V) uՃ{ uC W. h%WN VWN WujƋ;7P1 yC9C u=CPW|Y_ZuD YaCPsWY_ZtۉC{ CP GC V Y^e[^_]Ã=d4u U4t uP XZj=>Uhh#軰 YtP萮 Zt h%聮 Ygjhn}YZ hZjXUWVS$1ɉM܍}14j5j袆[_ ]߉j jPM =4u:S<ZxEPj w_X}`jhz[^14y`lj4PgZY~>jh8j4Pfyjh_X= 49SE^ujhY[SZu41$Hu_k4Ph$jXjc4)t]SU^/}EEjPUY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEP.e_1;}s7klE@0 t(Pdt!ztHhr2p8p4jG19t4EPZYvGVX_}kSlY^u`S[Ohj]jYju8j]SZYu'lڋS踕Sjj^ڌEP蹚Xe[^_]UWVShPVV hhv%V& hVW4 $hhj%W Vu1EWZt/SSSSSSSSSSSh#h4jj.Y[ WVXZ뷍e[^_]UVShPV覢 hhv%Vv hVS脢 $hhj%SQ SBt VSXZe[^]UWVS}11u܉54jj7_ZyjVPHI e]4$*u u^)uYjhbY[,u>tPZt4$PX4$SX^_ES9bSZYS^]_v%v%S^5P7fjj5L7Ս5L7[5L7fEPj  }tChj_jZj u,jSZYuv%v%Ј贒SʗXe[^_]UWVS}11Eܣ4jjfZY=wjSPyG xpuࡠ4*u$tPV_XEV[[u4EPj ZY}t!hj`jju ޑVXe[^_]UWVS1HH;E E8u EH1LEL0< t tLEL8P脀Y$}1ۉ889E S[Z9$PuS脁 O]1<%rA <%t)R.< u"DB@C8Cuj PPS P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uR.DP@tC8u$C<jK11]UVSƉ5L7Tj5L7|!5L7=`hPjj  vhqPh\PjjHVh$A hN%CPjD`5L7&@jPSR)R5L7&$uhJ.hSw% jY0jPp@uZYt'5L7kwPS;v5L7PSjjSхS^؍e[^]UWVSӉVjbVj(P$P @  d4hd4hpt$i =$.h$.hbt(i ud=$.u[jh&j3. h$.hf@$Ni=$.t"1҉$.h$.hbt(%i $.4tPPWX`4tP@WXt %1d4 ^w%w%u j/ j/ jjhx%. jjž $/ 󥁍 Pj(ڸ (4t#u hw%Pw;54>V14`4t#u h$PK;5`4V1`4h%&3y^_uhw%syZYu s Xe s h4XEt28t(P1 _tSPhw%耠 S3 3hw%g j识41ۉd481󫋍$88EDž1 $tWDž1ɉ Cr81jj P+ 9AX8󥋅 ,014,PjjXPh+ c 8uE 1h]% _=4t 蚆0QPhw%549hVS+ ~IƄuSPV$b* ud#XhB$` ^t@ ?uz4tPW 54lRpSmBËE YXۋplt 3F늅t 3}uWOW& Xu#4tRhB'h:x%P4e[^_]{< UWVS0u 1EEEPVEP7 ] 1EԉE܅ukVhMx%E܍t0SE)Ph"V37 h~x%SV ƒE؀8'uE؋E؀x*h%uT3 ^_]EԊk<'uMCj'SE^_E؃}u SpY؉E؋Eԍ4VuAE_ZRShix%jz j 벋E؍J9d<%u<@Q)IB*B6j/V ZYDžtVs EXuЅt GE/}!up_HEu M܋}ԍYtqUĀx .tx uuW'q uˋU;2tEԋEԍRUu-@EZYUWVE)Phx%E܍DP5 y;2tV:CXuf XtE܋M1ۉX}Whht@jE_ f}ufEf}ufEPEt|e s+L7EjP5L7z5L7rS6Et55L7]Hj5L75L7TL7EEKEfmEURuuUjh@J.#m ]u uAE@ uEÉESESXZ9L7thPjjL7t-9ut hX]UVSh@4\j$@4Nj$h@4h4 =@4tR)~?4.u@4Ph@4BZYt+hhX%h4菉 hh@4h4{ 4e[^]UWVSd1ɺ!iu$xtxܽ jPh 4G 1ɺ%iu$xtx覽 jPh4 jjjà < 1jh@4Vׇ Vh8i(SXS# ugL8PhhPh4蚇 \v$8P,Xt*hVh4O hSh4?  %Íe[^_]ÍL$qUWVSQ-T4LChx%(Pj y,4t Phy%x [^hJ.h9y%x jhb3Ƌ(Y1ۋ(?RXgZX9h3U%WI YZPWV迫 h3U%W1 |R.PDžX@$.XtIQD}g$HDQVh uHPDAu&XhViP C iƄV:(:_Xujrjn[^TDž$Hjj$V(WhQy%:g @u"Dž$ jjVWhcy%g @u/ ;Tshwy%jPZYt,뱸 ;x|s:hy%jPY^u(hdZt4DžLh jSZ5P^_u5 4[DžL9 P‰f@ @ 19uhujjjjjjjjjSPjuH41ɉXTDžhjthPH;h uHiP8XZ{ 4hiPh@4赃 jhx%h@4$ft(jhx%h@4 f x%x%1DžPhy%j@$V"jjPpPVe $@t puh4ݘB'h@4h%h->jbt8DžpjpPjj$Sd @tShy%]^_1@1ۉX=@4su%=A4luB4R.DPX(Ph% ZYu7hM$Pe^_Džu\DžTX/1jv$X󫍽p!1󪍍pi[@u 1ɉ$Nhhy%U_Zthh4h4j=4thh4h4hh7%hz%Y&ÃtϽPhy%j[hz%S[hz%S[hz%S[$h-z%S[h4h8z%S[=4th4hDz%S[ hOz%S[Y^h_z%S{[hmz%Sp[S@hpz%j^[h@4huz%he(h@4hz%h$S S4.hy%h4c_Zhz%h4c[^hz%h4ycZYhx$h4`c^_h2#h4GcY[h%h4.c_Z=4h4h@4hz%jxtnh@4hz%$Pj~ $-^$z4[hh4h4j~hx%h4b414hh`{%qSZYt/h"__t h@4h`{%hm{%ht1i 4hy{%\Pj ~h\h4~ \3j h44 th{%\Pj ~h\h4b~ \J3j h4H4 t=4t 4ht|%\Sj( ~h\h@4} \2^=@4u8h|%Sj ~h\h@4} \2[j h@43ZYt=@4t 4hh@4R^_u =@4u 4,hP$SE} hh@4h@4jx`hh@4h@4jwJ,PSJ`Y[t%4Tujh 4h 4jyXtjh4h4jz_h 4@ Z=4u=w jhx}%"P?w jh}%-wjh}%h4k| jh4h4j{hh4h4j}m4u:1ۉllPjI^Xluhh4h4j|*4XDžD4u DžDx$4=4ux$4=4ux$ 4= 4ux$4=4ux%4=4ux$DVSQRh@4Ph@4h@4h#h,4ux$4=4ux$ 4= 4ux$4=4ux%4=4ux$VSQRh@4Ph@4h@4h#h^(jjj x%x P Y4Rh$h( heZZ?HPN/h}%jtj94_V=4hF_$h}%Y^u>=4th54Pk hvhJ.Pk jh}%j\TpV VVPh}%h~%S9T =@4th@4h~%ST =4th4h)~%ST hpz%jSj8S8= 4"Xh4h 4h@4h8~%jhX~%h4 hh4h4jjFj jh<u`hp~%$S h4Si dh%dP7 _Zt 8tV [^^jj`RP HTuB=4t h4h 4h@4h~%jh 4h@4h~%j=@4th@4DY$h@4 ZYTuY=4t&h~%hh4h~%hwhph~%h[ TT4j64LXXLeY[^_]aUUd#wB']UWVS] }Vho%SZZYuu ƅ?jh%@:jjf@Mjh%ZY9t x/t/@?/uGjh%MXYR4$SRPh!%hue[^_]UWVSƉˍPho%MYZYd#u.%td#VQPSS$4t4PVSWh2%hie[^_]U幀4E]UUS]SUZй4؋]4USPEEPj耱EZYt= 4a4=4/u4萱SPh%hh`41]US]=4ujXE]EPj EZYtt 4w44=4/u4SPh%hh 4#4=4/u4ݰSPh%hh 41]U MhU;$V3M=4th4h%VM hpz%jMYX4Ltd迮SPh%jL=4th4h4h 4h%VLh4h 4h%VLhpz%jLXZh7%h%YX@Ph%jdLhz%SYLhz%SNLhz%SCL$=@4th@4h%S'L h 4h%SL =@4t_ZExN1jSEpye S}WS}Wttg`PR][^tEPPR跟ZYtU6V8t,V8u"E@t$RP]^_uh%EPHY[tEXt p$l(h,`d04t:$VS\_Zt'EPV4Ph%hSEpFjh%Y[@膫h%h%SDVhā%WDWhЁ%S $WPh}DS6S?Ph%8‹ t ?tPh%P߭_Zu>[h%P轭ZYtލRh -&PIC tjj hd#04,,RPj$WA SDR. tHLDJ@tSPWVh %hFP* @41󫍝DžƅDž@4DžDžShQVZ  @4f=tfyfv4f=NE1f=FX!ʉ׃11Ɋv4w4t 'w4$@'w'$@'wt$@(u$@| uu1Ƅ$jj hd#04,,RPjS $PSVh%hFP4J1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VLX j!?jAm.jUjj hd#04,,RPj#W6 (S?PWVh%%hFPL Ljj hd#04,,RPj$S SVh$hFP 0E@8@ue[^_]UVSPjjuVjjh0C'@tbu XtSjjVSjh0C'@u SY2h%S? ZYt PuU ^Zu S[ h%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhIEP%ZYtE1UWVS`NjEw1h%w Y[uF h%w GA[ZÅt#hLC'63AZYG辟t똀\t @BJu Xt@w44$t)tVP҉[Xt4$1҉94PSq@YZtXP,40Sƒt/t#VRЉXZuTRY8puo$uVP҉XZtً$HjjjjhSQRPx jjjjhSQRPx ۍh%S h4PS\ h"P h4PP\ W(R<^pT`~;a9fhGPSa\ hwVPL\ ;h%S< hwS.\ h"S hwS\ (uYh4%V hV[ hwSZ Ph %S à ƅG1ɋÅth"S=ZYu!Ph %j蘐 à uh$S=ZYth#S=ZYth$S=ZYth%S|=ZYth"Sk=ZYtt hh8% hh %VZ hSVZ ƅGw PV謙à wh$jj9k؍e[^_]UE1҉UMU ].UEEMU ]UWVSQ]} E10$hmj6Su E=%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVSE 1ɉ1D󫍕D1҃=45L7苓h@J.8 5L7P=4 GuujjRAXZ1Ҁt,DžfDžDž1Dž=v Dž1ۉ11119tD5fDŽ5DŽ51H5=fDŽ=DŽ=1BC8[ty1t1DŽZfDŽDŽ1DŽBt1DŽXfDŽDŽ1DŽBhjjjjjjjjjRPj轜Ã4uDžRuh$j@DžPS(tuiu5hjjjjjjjjjPj1ƃ4t@DžPV轑ZY^Hy VXSڜ_u?t6hޤhPh$.6U 4$.DžM=4yu4Dž&1ۉ49i8511ɉ9=4t9i854t(~SW7YZ[ڋ44ƀy1҉LPTXjSP)T hCP4"PT jSh4T 54,, 0$4(804DH$u"u $1҉DHQ,RPFP$4()n,, 0$4(804DHu u $D1H$ 4HpuDH9jj hd#RPjV jj hd#4$P@ RPjP 48t$4VHDPh%R| 4$p~ơ4$0hRRVP4Pjj:5Dž1ɉ$Pj躍^_u654h_1Z7$P1$Xu@P4P54 Pz^4$HXDH-1ۉ,048DHƂ(48<=454\44Ytu 4h£4a1X@_yuƆy$tP,40Wg$͋e[^_]UMw1vB ]UWVSDž1ɉ4*)Ph,%hS %#t+hf)/ZSh6%h豾 ju藟h%֋4Ph%hSZ h%Sh%ҍǃ(h%ShjlE0p^11R ZYtsE;klEX{41 Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQh4%hǃBYcLu۝XZ=4CLSSRVǃSRjj\0jj!6?$B'v=IC`,tPhO%hV VhU%P C`,tPhd%hV CXtPhk%jW WVC\tPhr%jW WVST"tJ%tN$VPhy%P CH@%%CX,tS\tPh%hV Vh%P 7%%h%P _X% %h%Pi Y^Ƀ%%hу%PG XZ݃%%hՂ%{Tu%PP ^_%#%:13%%$tt1=161e[^_]UWVS 4*Pƅh+%>hF_$h$;蠆Ph0%j$=4t"4XzSPhI%54{ u6h艚4Yt Phd%; XZjj3_Xh%WQ$4Y[1D)SP-B^ZmPdRL P,V9 dRhɄ%W#TPVAL$TH\@H1ɉD@9DtUh"ZEZURuh4PVSuh%j¸$KEtVS V@à E)ËE9th%hD'h h.%kEe[^_]UWVS EUϋMMjW@Y[tK1MU9t FRlSVPNƃtPEV]XZ]e[^_]Le[^_]USj$u=ZYtD1ۉ]XEPjhjjj EPS<U Vt;M rj$S뱋]UEPM UXUEPM UXUWVS Ɖ1uP$kƅgPh%W- tPkY{%t_%Ph%kXZ%tn%Ph 4 Vj&4W Hv|=4uj{^1+.Dž&.DžjhhN% kPj(Vu1h 4h&.V d#=+.u3h).ho%iZYd#u.%=).td#VWRhȊ%h谉WSП =4uj膒XDžjhhN%3jVj'U(=4+=4= 4h%V< V h 4Vh%S* Vh4h4h%jڈ$WSh%jVh%j讈V1 WSǞ Y^DžVj)TXZS=4tZ=L4tQ= 4tHh%Vs V+ h 4Vh%S+* Vh4hL4h%2;e[^_]USڸxtjS ZYuSh)%jʇ ]US18tjS ZYuSh6%j芇 ]USSJ=tsg1EEPj%SEZYtt`Huȃul"hX%hX t&j hX%hYXKuhN%jTXZ1]Ã=@4uiU@4"K4i%<$4s%-4b$ 4%4r"(4]USE] tP:gYSjR{fXZ@4E],UWVS18Z1Dž@DžDDž<jjklCx4uFtWXF 9sklS9z4uB4@s)XCEe[^_]UVSjhPju蒩t)uu P @u0S40Z1 S"Xe[^]UWS] 1Sh|duw t#S;S t%iSR3$ZYt3\X1e[_]Uu hzd@u)UVSujhPjV踨t(ju jPV)Scy 01e[^]Uu hedAuUU EHJ Ju BM+KQsPR` u&y l[u Ztfa EfxNA t @fFFf9ߍe[^_]UWVS] u@(D=D4u jPD4XklhNA0 y841RPq1l脐Ɖ׋lAdP9QhslhPPlRWVh%Ep貨EXfC u>4ufC ;^Q8tWRPQL }E84u.XfC uVhD 0 tfC txPT41҉`dRPTP_HL|]d`SQX\(lppX\uX\lt4PTd`SQЎX\tj2 t j3ZNXtj4uu赗Y_FhD8L`}Du/E t)E8u!@4uhM@4ZE}`thMXGFhD0 thMYG@PtэL)QWNht18RЃS-Zt49sL}uFEt8u:Spl\XLHh%Ep$fd#`tEt8ud#PEPp4PSRRpl\XLHhҎ%Ep膥8e[^_]UWVSXu} ]=x4hLt4P4ZY9x4}x4hsLp4PZY9x4}x4hOLl4PZY9x4}x4h+Lh4PZY9x4}x4hLd4PZY9x4}x4jGK`4PZY9x4}x4jHK\4PbZY9x4}x4jIKX4PAZY9x4}x4jJKT4P ZY9x4}x4h_KP4PZY9x4}x4h;KL4PZY9x4}x4hKH4PZY9x4}x41ҋ;Q$s+k UA(0JPZY9x4U}x4Bʃx4F@ t_u {4 H X[E#UlEUt(Zt hd#5x4h%v t85$441RPs$s WRP5l4S4C8u%uh u hI_hPR>Y[P5t45$441RPssRP5p4.5$4C S$CS 41SQRP踉RP5h45x4h%vP xHu1C( P/IP5d4gHu!SH1BLPIP5`4HuSH1BLPHP5\4lmu'CHpX5P45x4h%vh "nuCHp\5L4ρYCHP`u&hoHP5H45x4h%vOEERh"&jP= h5HURjPcà P5H45x4h%vŠSbcfx5X45x4h%v蓠CH@Hth!%vzXZCH@Hth(%vbY_CH@Hth1%vJXZCH@Hth8%v2Y_CH@HthD%vXZCH@H thL%vY_CH@H@thT%vXZCH@HE Y%FEe[^_]Ÿ YuCHP5T45x4h%-+{jPMQKQWsPRdk B(0F}WP5x4h%vW0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4WJ8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhI SPXZ1e[^]UWVSu jFHP}W jWWjjjjj IR.E܃,11ۉt}DW@uu@tA~Ht҈Uth#SZYUu GFH`L+/tG/jSFHPjSW? FHHL1e[^_]UVS u vDh"&j ]S裔 j SSjjjjhH0SFDVHB`1e[^]UWVS jj%c[^8hLDC Ih9DCCIh%DC C,I E1҃t^tZ @F'tOE4F I}Ou/UDEjh3}EZYUMB"t}$vuhCF IX}$thb%hD'hhm%gjjjjhHhjj jjj%SjM+:ƃ4xu P/V ;S聨e[^_]UWVSQE @4tt3t.t)=t" u E x8uu u\XZjj ^_x 1҉j4 F'UG JUBXYu؍{sheBhYBChLBC h?Bǃ$ZjjjjhhJhjjjjj SjM8ƃDxu P.V9SK1e[^_]UWVS] B({119tuklKI0΃@jj hd#BJJbRPj!WA jj hd#CKJbRPj'P 8uth9AjPPV E@ tPAjPPVU d#u h@Xp@0@'QWMQVRPpjjA)$4,jB@SPh$j -P舐 $4jC}@SPh$j :Pf $40j-X@SPh$j GPA jD<@h,@ YÃst4Z£p4Tٰ-LƄT 19~-@Vh%jPh 4豏 j.?h 4P5p45t4GP:P-Phڏ%hh4c DhN%DXe[^_]UWVS] 4$DV跲Y_(V胵0(C<@8jP@ x 189}gG\u CP@@<2<9s SklLT<R+A<Q@+QP$@ 09ȉЋ(}fF돋<@} EhujjhMjjjAjjj8@h4E4URP*u5@P}j8Hٞ<_Zj $^DPRH04EZ1ɉ(,~!klSLQA<Q@(,1@8048;HHD88`VpWRLV7uVP 9jj,(40EU+04RPjPPQ,PTEUjVP @V PRLk@8< 󥋽 x08x4@u}u} 40WV{z)׉(,8E@@PEpɝ_Xs$Ep@f E@fx@CklPs腝ZYVCU<8kl4@0E@)Ћ@)P880PzCUk@l( 9s)klPVPz 180(󪋅<18@98tNH0N8HV@8 QPWRL -B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhQhLjj7jjjjF,ƃ4PVH"V-E)PB89B4<PZufLW WPF8PP8 WRPQLP $AZuVh$h%dSbe[^_]UWS0]}ȹ 1E1EEE =4ujjS)@ jP4E܍EPjS@e[_]UWVSM 14f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuhÒ%j]UWVS4}=4PklUVE 0`ZYE UlVSClP>11CC,C0CLCPCT 4$p( u1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC h#V|O ZYS $S7 t hV1 uE<=uV踌Ƅ<$SVhZ%hPJ 1jXu5WSho%4 tYWShh%PO 54j<4tShv%PgO 54WjSh$h%蘀 1e[^_]UWVS]u Cp}SYu 9% :%B4tWh%PN 54iWhƓ%hޓ%VS1e[^_]UWVS}u EC%E2E%1E4ÅujEPYX9uG@<5hRĉZuG@<KtG@;1e[^_]U14jC"Zt%61UWVS]u 1j "Yt5DžPj[XZuC@<=4uh%jYXh4h4h@41h@4h7%hzh@4hH%hW%}~h|%hXtWh%h< jhMőC@;XZ1e[^_]UEJ]U(EPE 4P1]UVSU E0pVSPh%EpFPe[^]UVSu] hqj軇ZYt,hƔ%hoZYFu @8@V1e[^]UVSu] FPjFphՔ%htF@V1e[^]UhhƔ%h UWVS\]D1t=u41ɉ 4h5xjP!N gSbZX@/.1ۃt"tu舀4d/.)4tPw[_th%h4js Ph%h4jW4x/.nth/%Rj) $}vWPhP%Rj=4t$R$Rh%WFJ W<$ZYv /.8./.="FtPVZt F9F:Ch4h4h@4. 1@/.Ct@t!1C F z~uʃ5P7jjj5L7蚑5L7k_5L7bjhKjjhۦhj&jFjjjPjÃLPSS e[^_]UWVSQƉh%)hF_$P%I uA=4th%PhÕ%54H h%PhÕ%9 /OuPh%Ph%菕 _XVh<%SNH Sc]th%hv%Sj h%Phl%Sjh%_PI4ZYtuVh%PG 54bujh"V V,XX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝu1ɉM] u]u]܉uu9u]{ u ;}}w1] 1ۉMԉ]M]x(Ã}t*M 1]1 uM ]M]U9uU9u {;u U| 9u܋U} U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á@4"UWVSXE؉UȉM]E EUE} }}$}}؋wu}9UM}։lj]19؋]| E1ۉ];EE}LuuWVI/ut4EUuuWV!/);uE}u}]؋EUCSE܉U1ɉM̋EUEUE9ƉM ]9]E؋P@MAQEUEM])M]EE1҉UЋM9M+}EԀx EEԋ@1҉MM]]1Éً]1Ӊ]ˋM 9u]9ƉE9Ɖ]E9E܋Eu};EEEUuuWV-);uE}u}E9ƉM1EEO)]9؉ӋM}EUEЃEE9EE]|Eȉ0xUMPH EE̋EU׸;EEu}uuWV,);uEu}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UVSQMAQuRPRPjjjjO IuEU11ҍeY[^]UE]US]sh%ji ]]RUWVS]} j/W ZYƃth)PCDPW ƒuMV`~Dr9s6t'19ty u9t@e[^_]Uju EDPSUEvPEDPu ܜ UWVS]=H4u Y)H4K$9C |b5H49s sW}jjjjRPRP t39r,1tu{(u t @9|1e[^_]UWVSU}119y u 9;] u}t uz(tt}h~t[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS41ۃU U]UWVS]u=4u1҉U1ҋM9bx u 8D;U +}ߋE싃E苃E}t }u{(u1+FV C S$FFlN(1tF$1F,MPFtk9t jPR襖 F tV"}uM9MuǃǃFt$9th.%hHG'hdh%ցF t'uBK 9M sM 9rE1e[^_]US]=4u!w k 4"1;@4s k4D4C([]US]=4uS1wG'E[]UWVSSÉU=4uv!v=@4 D41k 4B9tp4;u(}u1BRQFZYtD4@4k44B@4V 1Sh"&jRU4 F hst~ SPh%jW`4 F'F(UV,~0F((e[^_]UWVSPu]=4u1E1M9z u :;E  1}1ɉKC1C CkEt CCEC S(‰C$EPC,}u uK9Su;u tK }u0~(t*u!K @N 9M sM 9rE1Z[^_]U1ҋE ]USR] j EPu U:tt htX1 k]UWVS0]{Tuhz%h`G'h{Xuh%h`G'hh%M~{\uh%h`G'h߃{`uh×%h`G'hȃ{duhޗ%h`G'h뱋CjCDPVS u h%V XZ{4uD1ttʋ5R.DNuT4@׀{4ujhf"C4PH ؊LD tB:u JN Ph%WY hF_$W{6 ƃiWh%jlPh"%VlsXs\s`hF%Vk,Psdh]%VksThn%Vk19aW 4H'PwP7Phy%VqkG P u"OQPW RPh%VDkH9~hv%h)׉M܋]))EU؉EԋU؉E܉UU9UEU} EE܋EEE̋UЉEU9M̋E}M]ċEԋUڋM̋]M]9ȉ} +EUĉE܉U=H4u H4E1҉U19~W}]Exv(*uutu Ex(uthujjhajjjAjjjRVhE4URP腵uV>.}51Dž<Dž@;us<`RVSPL t$hl`d<@FjHk)4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DPU1]1EEPVJXZ}y1Q1҉Tu1Hùxt%| q1@ 4SG0|GEE;xrB;Us E11ۃ}t E;]sP7/C_P|YV54jXZ}e[^_]UWVS0EDž}uElL4jSZYt jS^_uY13jSn_Zu[^ƅ1;L4P4} tE 9duE(u)tURYu0;$s{ЉuE, EDEHʋ9Ɖ}fjj hd# WVjWhpƃ 3WVPhݙ%V!y V Nj8ƅ3ܶP Nj8XZЉ8@ 6Vw؉1=uRhnFjj hd#EDUH,,RPjWE$hoRjPHVxG$jGY\GL9  $VP V3Gpf $V $SG[f V WFÃ9r$h%hXI'hhU%QuZ1hjjjjjjjjjPӫÃ4tPSi^X19s 419t4@Y؅ttWZ tS&Xe[^_]UWVSljfDžv/ƅujhX%Y^yhhX%S^d z躠t&豠8t觠WPh%hS hWSd =Džp!j/Sy _Zt.xv9tH9s8/tQOk YyߍxPWfYZ%=pujU>hQW iƄ/u%谟QPh%hS $hQSc =@uWj ZuhWPb =hS Y_1Ҁ;/u 1Ҁ{‰hSCp<$CZlhЃpDl=w4uhh%S$c =whWSc =v T?V= _y SV]YSV[= ZVDSX1e[^_]USÍEPSYZy1]EtjS!XZxj `PS t SYS`Z=vf u]UWVSEUPE ^ƃ}t11ɉMVd\ Zt{fx vX jh%SC uSuh%EP( @u h|#k 3Et}tESWuh%jcu[zV9 XEEe[^_]Ujh*Ij~ UWVS h %411tY+ڸ%xuڸ%tu#WS7XZuWS#Y^1yah%hPS_ WS~1u h$%蛜PSh.%jdSh:%j4:hSh%ShPPm_ WPu'hD%SӛPPh.%jhM%hPS_ Sh%jtPhM%hW%juh %S^hPW^ hc%SAPWh.%je,h%S%hPW^ ho%SPWh.%j2,h %SPh%jMh,%SϚPh%j*h%hPW^ h%S薚PWh.%j(h %ΚhPW] h %S\yth%S= Ph%j_ h%shPW] h%Sp141.Ph%hW ttpWh.%jC utjh+bFXZte[^_]UE4fP]USE@k I't!I'ShWE 0-C4 ]UWVS$h.ƍPhW@j-@1jhd%_ZRhW@Ph- 1ڹI'1!tT9u Dž0AVP"?ZYu=4B G jjjjhjjjjjj!ShÃ4tj"PS觗SXe[^_]U辗4tPPRRRhp%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ41RPSQRPh[]$j]S+ ]С$4Eԃ7x6P URjP91ɋu ;Nsklu ^c0AO0}u}u ]u]uutu9]}UEG0uW+EUu FV}t ]U]EUWE `1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A B}ljK'fG G5GHG G,;G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{~S(xE+C$PR蔖XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP3YZuk{8ueEC8EC4FV SVCt~8uklHCBVPDXHXXe[^_]US]5L7e5L7\YX{$ujCP/C$XZC($h4jjhhhRjFj jjPs$h@4yC(4ys$91҉S$Y1-C,SP]os(zs$C(1C$C,]UWVSuV[t$V"Yt&jP~: S uue[^_]}hjXZ1e[^_]UWVS4$)t uiVu`j(PjRƃu1O4jjHDjjPÃt͡4$3t j4PLSЉƃu11P;^ s-URSVPL tEuEt 8uPC΋4@u <@TXuuDHTX=4pjj hd#,1ۉHL,ËHRPjXPwjj hd#jhj^WY8jj hd#jh0jdS8pfH 0T4DP&$WXRHQDjP p H0SWXWHRP4Pjj'm(hN%0lppltDžxDž|}1 EPt!EfEEEDžPf@ @ @f@@@ f@*@,PW=L4v~(u@0f@:@<BhujjjjjjjjjREPhuÃ4t#Pu@,ItPS6kS|v|Cwc 4LPdhTXlpF(t|lQdQP҃ fVYexM|AEAEA Q119~.u2FN<uF EuPEXZC΅juɋEtY_1}z 9u}Wڹ[fB EB h;jjujjj(jjjuSjsjƃ4uP`VXkSEEEe[^_]hj XZe[^_]UVSuE ]wi$M'hDs A[4hE2[ 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph#jS膰 jSSjjjjWd0S ZS Xe[^_]UWVS(]}h#uVv @4XYu81ɉUP'M`PZYU9‹M}ƒ$uӃ@4} E $$O'h4_ Wtjj__h5ku241RP şRPh[]$jEPh h6&tjjI_Yh7u)tjj_ZPh$jEP h8t"u h#jEP֮ h9t"u$h#jEP衮 h:bt"u(h#jEPo h;0t"u,h#jEP= h<2^VP@4Ph%sֶe[^_]UWVSX1ɉt @@D44t=$txuP1$XytƃyjhG%:_X= 4T5|uÐ Dž81T5ktƒ8C1;8 8/T0 RPh%hW 541҅t4҉uFWP}ZYu Ɔyȅ4ƀy1LPTXƀ);T54ǀ,ǀ<jWP hW4"P =4u/41҉4h4aljY t^4tByu/49u4ы9u􋐀뺃:54'xk<ǹ1󫋅PB YsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB Y$CsC C8RPL u;x ruكtЋQ__k<y׹󫋅PB YCsC C8ci1fD @9s=4t1HO'󥍍P{_\O'󥍝PًH^= 4t_Dž DžDžX51҉pO'󥍅PًY=4t1O'󥍍PXX31B iGT3B VD4y @HfFe[^_]UU J E] = 42UWVS11ɉT5PYZNT518t=suB89J4ƅƅ{@1T5k8|<teD@PhO%jPvT5Phj%hvhh%R hT5PRo F8yT5D(~&Ph%hW hWV& T5D,~&Ph%hW赥 hWV T5D0~&Ph%hW肥 hWV PT5؃PVh%hru1Dž88T5kt1;8 8tuÃuTT5B1L VSXhX5jsjh\7h%7-&h5ssjh7hl%:+e[^]UWVS]}11=4t}jh"CP ufK05|tF9Lu@‰5p4t5xt$h`3jY^tjjXZǃ=D4؍e[^_]U=(4tuh%jPR UVSuu1r$ugjjjVcyÃtjjHDjjFPt$4KS;DH} DHe[^]UEx8th#hO'hm h%@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$进ѧ$zuubPCsYtWWPZtNjE@ u WVX_XWPV tjVSnE@ t VPZYVXjjS;ƃxD4 e[^_]UWVSuXYƍ}Ĺ 1uVZt틞$S_xt,jjjSǃtSYt$SPHLPd 1Z} w#jM O'RjP8x u0h#hO'h h%kR1t4Q,1t9E t @11tt:[]UVSQMp@19|h%hP'hhG%U9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s8SrY;C K$}'ujjjjRPRP Ɖe[^]Ã=`4uUhk{XUS]=`4u1;`4s k<X4[]Ã=`4uU`4]á`4UWVSSÃ=`4ut=;t6`45X419t$USF PĭZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h֣%R~ZYuj ju~C,S0hݣ%VVY_uj ju}C4S8h%V._Zu0j(uY^ƅj)P_ZFh%VZYuEh%VͬY_u j(uh%V責_Zuj`u@S^ Oh%V莬Y^u>hn#EPB XZt(S'>ttVP[YZuG C<e[^_]USPQRh %EPj6~-htރuVtjYj jVm uj jVmTuj jV^m u7thh%P hVP  sh]$V$ZYuDG8PW<G4h]$VϛZYu)+h]$V蕛ZYu)j h,Q'V茚 thjh^Xۋu0lY19ȋWl[j`RC@P衷 C,S0C4S8 u+t)CQ RP脚YZuƅu_, G 1%E u= G1ɉOOO_O _$UWG@jhRjP8XƋG,ÅtjP4tKRPPs0s,Vt'8t"P PXZ@8u ǃC4S8)G W$q1ɉSh|dV iRZbZujYSh|dV蹆 u܋1;s̋tpH,9H0u0;u"H49H8u;t밉jSP BrVFMZ1e[^_]U覝1=4t =(4]UWVSE8}fHfMfMfXf]f]X]߈]X ]P Uf@fEExstExlu31MjQk T'RU U؍MudBuDEPEPEPEPEPEPSEPEPEPWhb`$u u~S 8~u Pu׳ ujgFpX1MjQk T'RU U؍Mu$Bbu Pu} uIFu>e[^_]UWVSu] t>u1}ZEPEPEPEPEPEPEPEPEPEPEPh`$V4 uAEyƒt ƒu&UUSCEC EC fEfC1O1k0T'Ut4VPޕZYUu$ T'}EECEfCGue[^_]UWVS@utc T'CPCPC PC PC PC PC PCPCPCP3hb`$j@}WQ 8ssWփ V'ue[^_]UWVSEUM܋}EEۋM );} GEE1EEƒ< ‹E䋀,uF;E9r+F9s,t }P;U u)9sE䋘0 }t%0tt13t]ƒt<tՋ,E39Et:ƒ}u9r&39s#P;U sxU9sډ)9sу@uEE}t(}tE8}tE܉1 )1[^_]USMU Zyu t tR9Qr[]UWVSHXH X$1ۉX p0uu]9]E}u1ɉMUtj}t}tуtat\@ uуt=t8v1]9]t UrH X$9} 1҉P P$ )H X$EE}u}0]Q[^_]ú=tUwB=tGwH w8RXs.'-v=uUWVSUM119}uP0uQjVRjGуtux`ڃuV]0]}tT1ɉ]Ut4u9}u*uu}7SjQWuPEЃuGAuFA1e[^_]UU 1tEMh]UEUUU ]USMEX؃< uʄt E0‰[]UE1҉U:U ]U EEEEEEEPU EjUWVSÉЉʋuˀ{u,C { K?H} K.C { K?H} K KI1ۋ}_ik?19Ή[^_]UWVS u]}1u܉]EPxU Zu tX3%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EMȍEPEPEPUE_E @/EЙ]u)։]u]uEEMԍEPEPEPUE @Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋEԉMϋUeƉωؙMʋEE)׋EU t2 t,EPWVuut2EE}u u}tE}}4E؋EؙRPuu:EU4DH~1ERPWV9uuRP9EE]ÉUӉыUe9E1MȍEPEPEPEi @tKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9[YeY[^_]aUE]ÍL$qUWVSQ1A1҉U1҉EUF0E؉E1Ɋ t,}uÃt$<t ,}u9]t@u0Eu1M]ƒ< RWvWڋEy11AtE1ҍeY[^_]aUWVS,M$](u,}01EEEEEE1U9ЋU| E1E܋EE19M}M9Eyu1EEU ẺUЋEH9M}GE;E]UE0juQu@M]E@E1;EE }Vű}΃Mu uWVK5);uE M}uu)9s ])] 1҉U111*1҉19]]܃}MM 1yAQ Eù19Ee[^_]UVSEP$9p |$1jjjjSQSQjURP),1҉Ѝe[^]UVS]U M1k N( u4؄tfEB 19EtJ @u,1u.R E@M,9du 1dd[^]UEUUUUUUEUUUR4U UEUUE1҉UP0UURU }UEUUEUUP0UURPU LUE1]UVS]MU2U k V(u؄t=&ukE U1uQЃ<![^]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRR $Rh{dЀ3oujhPjRE@ue[^_]UEP0RPJUWVS]E EC0E1xp@u4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@t 逌}WuS yуtu G{0Ea;hhZYoh}SZYa }U׍e[^_]UWVSEX01҉U1Eߊt]t}ttR<tNwtw A,<vxPW/=u7sE@,9uQVP3H &=t1skE P3 e[^_]UVSuE =d4uhd4X>y d4CFU,U9u d4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU PR 1]UVSUEu Nt+t6uXE@VvpSQFD.4t(vtvPS e[^]USR] =l4u0j EPu$ ƒ =w uE8tt h'X1kD 5$5u]U U1vEEUEPU E_ZÅt*UVS14OFZuS OXe[^]UWVSQu>xp19|h%hdW'hxhx%l]9|@89@|ue[^_]UWVS0uU=4]ډ@E =~Mȉ\1ɉ`}ډ1@8;FF| FP1RP|~ tlURjVPL tYEċUȉḾ1ۅuBu>dž9|Ӄ!!ut9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E }uth%hTW'hhx%yhjlH^_W'u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP='@ǃEPu^_t!ẺEЉEԉEȉC1҉؍e[^_]US]=l4u]1Ҹ;l4s)=w9t kD`5B1=w kD 5[]Ã=5u ^,5UWVSƉ $41󫋅 EU RPVh%h4P5 E jhPjV7xShydPg @u V@.X1V5.jSuʕ e[^_]UWVSlu] E EE$EEPSV EPډXE8t%E8h%hV'h hx%Ԁ1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}u }t#1A}tPh%%uPu| "}tPh|%Ph2%uu3 ؍e[^_]UWVSHÉ1jhPjS5J1Dž11҉1ɉډ1ۉ؉!!ׁuO1 RPh/=fU?XqWVS/9u)9u!V!ʍ4󥉅SGX99;ƒ<<„t <uh0101ff=Uuf=u#(,D1ɉKu1󫋽{w%RXuX tHtt7tqiEt,EPFPVC,1RPP Pе~ 돋t6t%C,dDž $t tx9,sbthjo@^Zt31ۉ Dž1ɉ1҉Jx 'Xu&1󫋅fǀUe[^_]US0E }uth%h@W'hhx%zhj?XZE u+ CEUY~11ɉKKCSǃ?ǃjh>RP{@ECǃ1҉oK0SUE Z@u SWCX1d3{ uUC$9K }DURjSPL t1Mt* 519t @D=u=u S뙉؋]UWVSUMtQ0t),0Ut,]))111҉XZ[^_]UWVS}UM] A<t <t11É1uvB? ڈ49'fDžU1 WV)Ӊ1!!ډuAWVhP$x30 14^uP$ƙ9uK9uCH!؍S#ƃS~<Y9k9_'X؍e[^_]UWVS]Euh%h,W'h .1uEE}lj1Ʌuh&h,W'hhx%rs{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{ 519tBDu3{u}s{ u}u}u}v}t 4M1;})ωxMH PC u h"kE UP XZ܍e[^_]UWVSE }Ĺ HUMx}}t}1҉H 51ۅuh+%hW'hhx%q9tCDuu}EB%}}1uuuuE1} u}w2t tu'}\JM1ɉMr1u}}}E}u}0}}u}t7}u }|ڀtu(}E}u }E}9}}u1UMUMUM}9}}u P @|UEUEUE9E}}}pEbE`Mt:EUu9֋}|}9֋}}ً0‰EU,Ɖt1xtx}9ЋU99uE|{}EE,EujSUr }4u9P7u 4XZm1hjN3E_Z EfǀUƀEEl1ɉpplxt2}9}u|H1+EUẺUЋ,E,EEujuUs }t'4}9ttP6u( 4XZE0qEHEUȃƉplRP)׉E9Ɖ}ME,uȋU)Ћu}ƃu}|U9E}}EU+EUẺUЋEEEUEĉUȍEujuUx }t'4u9ttP5u- 4^_E9uh0u_E,9EE}KhjC1ZYuEb 4}uu,fǀUƀ0Ë0}00UMыE`M]}v*}}u }t}iuM9ʹu}UUpx u}EEMEjR}wR‹E@vM1ҋu9Ћ}_EEE1}$tuVME]1uCu}ƃuuWVs )׉u}9]EM} EUEUE1ҋM]M]9ȉ} +EUẺUЋE\EUEĉUȋE}EuuW< }t2EED4u9ttP3u }D4ZYEu0hjjPC,1}?t;_u}E@Eu1EE1}EE1Vt_}9ti@уtuH}0t;1Ɋ_]ttt}t9}t#@AuՋ0U9u1e[^_]UWVSP]E EuEE}t:C,u)C0E1҉UĉUȉỦUЍMċUPX{,4}u1( 1}jjjj1RP1ҋ};}ERPjEPS,tE.5EUEĉUȋEUẺUjuVSUEaUċMȋű}Ѓ uEYUċMȋű}Ѐ}u.hG'sWVQRUMsHH'C,UMtX(C,u 9}8SjWVQRsLH'C,tPC,e[^_]UWVS}Ĺ uE0xE0EEH 519t@D=u€t E1ɉM1Mtكtu‹]9] uEE@uȃwE9t}h=E]1ECƃuuWV$ )9މ}u}1E1҉EtqE9E E˃tuSE`tF1EM t}tȃ<ttE9E tw̋E0h#jP]SA jPSSj S8 ƍ@[=wʡ4EHDEU}~ E1ɉMRWuu,SVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ404}81HDEU}~ E1E}u?9}/jh>uu =~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]4480h9%h}WuVEPS$xuuuh9%hWVEPS>tuuuSЃS@e[^_]Ujj 8aj j P USxbP6S$d#PSh%hJ.\ j U=(2.u (2.HE5fPftP~Z9(2.UWVEE왉U1E}ujEPj&v e^_]U0E E1EԉE؉E܉EEEPEPubƒ xEÍL$qUWVSQ@@u5jhdE5Д XE5dE5(E5,E5PE5TE5XZjP虔 (E5,E58E5 ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=R.DWtDOt uxu[1!tjjEPx  FCE덉뉉؍e[^_]UWVSujujZYt&Vu PW/9uZ7؍e[^_]UVSu huà @tuuSS؍e[^]U|EPu ZYtM EUQ1UWVSEE 0Vj S( DžuVjS( ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U %f~U7h@['hP%GJGH))րx u@'˅iuh@['hb%)<[^T1ɉ PWuEp(@h@[';PUZ8AU8#u1Xe[^_]UVShVp e u hZ';Zu SX PVS 1e[^]UWVS]} uWh ['hn%E;  sVFFtNMEUE UEPEPs C @u19T8 t/T89thZ'h%:^_S[VtPSV1ɉC F0s {u0Shjs C.@uhZ'h%@:XZu s]e[^_]g@ue[^_]US]j$+Yt:XU P UP1҉PPP1ɉHPP 1҉P]UWVSpljӉ΋EftPh ['hn%9 EjEPEPSà jjP twPjS @tejjS tSPjS @tAVSW t/Phjp 5-@u*h ['h%8Y[h ['8ZtSXe[^_]UEM M]UEM M1]UVS]uhU YtShjP,@uh0['h%98XZhU Yt1ShjP?,@uh0['h%7XZe[^]UVS]t P?X틃1t:P,ǃ @؉Ƌu4P,Mǃ- uȍe[^]UVSlM uEPUZt%ÍEP?$VS @u SX؍e[^]UWVS} ~;P7N11;] },E4Vz?ZHw̍CWPE e[^_]UWVSUu }u OVB1ۅttx 9{ s x 9}stKtHJ KUjj(_XۋUuC u1ɉK;Es2Uus_ZUus@S:[^뼉CEC {MECBK1ɉ JKZRhPr B)e[^_]Uh$\'\5jE&. UWVSREP1YutE@$t5s% uuC tUBHEx uC t<v UD&0Ep V<Yw{t)1 E@ȉC,ub Ex txj(Zu hT]'3XYǃ,f@S(P1.1;,s$k(рyus1(D@1u e[^_]UWVSSƉM׋ttZ9t<{ t6 1ɅuufujuP/ t[뷃 S Vh%2 e[^_]UVSËHt2L~tHHHZR1ɉL^Pt2T~tPHPZR1ɉT^`t2d~t`H`ZRj1dXt/tVfG,X11҉Yt/tV-G,X 1Xt/tVF,X 1Xht/ltVF,lYh 1hZe[^]UVSNjjjVnD@PjV%l8@t@4%1҅ut 4%1҅ut 8t48SVlXZe[^]US]E ftPhd\'hn%0 jP t(@t NIhd\'/YE u1҉U E](Sh jP#@uE d\'E%]i/]US]E ftPhP\'hn%W/ j|P t@Hv|y tH7`xv | xYZt>1҉Shj"@u;E P\'E%].hP\'.XE E]d']UVSĀptQPhhxVԟ@u h(]'8.XV ShӪ%- e[^]USË4%1҅uau]h%SXZ{PtS 1Ytk%1҅utSLt%Ju>#PSXZ]UWVSÉ׸r$u2%+1u%PSzS_jSZCt PSXZe[^_]UWVSÉ֋8 Ph%,1ɺhXZu%VSSjjN%1ɉK 4%1҃uuj%XZe[^_]UWVSUM8ttY@@0tM~ tBEU  1ۅut1҉FXZ[^_]USËltu;RSlZYt&hvRpPaPh5%+]Ãx tpUSË%1҅u:u6S]% Y u=uSnZ S.YuS\X]US]SYuj$XZIpQpcvPh=%+j#Sh"jdj#]UVS]E ftPh<\'hn%* |)RxPd uh<\'*X;|t xD8t|xhJ.7H 1tf J.yhJ.j d Y^J.PJ. Sh j @uDE <\'E%e[^])jXZu Ee[^]y"e[^]UVSjhx%ZYuhx%h}#-)[^"VP?XZY@u VhS%)ZYS'Xe[^]UWVSMy t %1 EU}u%1҅ut6`u,QM3Y}Mtu1ۉ1@EU}u#%1҅uZ`LQ.X}t u 8 ى%1҅u1` 1e[^_]UWVSM48%`uu %t%ti utSYt %@utS6-Zt %`ut[1҅u%u! u@uM1ɉȍe[^_]US]'%P'jjUjjU4]UWVSQ]4Ɓ@1utg%@1҅u\uXt0t(VwZ%t4[' Vh[%&NvSq_%t4['h_%%[^8thy%&j( Shj4Ɓ1uguc%@1҅utTS,1ɉMjEP,Y@u h]'%Z,ǃ,Xe[^_]UVSuh(4#%48ӁYt:tt{ u h%SkYX[j+XZe[^] @48ue[^]-UWVSD]u Ctt,PCQPhj@EPt@uhl]'$E_E{ VEPW3bƒuVWh%:$ st#Ej@VCxP L VWh%?$UCxU3`UXYu"D@RWP_׍e[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3=_UM  {Mut';xu;0tQh%n#11҉Y^{ tFEU   t3"Z@uh]'3#Xe[^_]UWV։ϋD@WVXZe^_]UWVSu%1҅ut V%ZuF Ph%z"Y[Ӂ u% 1҅VGEj EPju^ ]PSh%"M1҉-1;,sYk(jQMu荨 Mt5j EPjQPMAPuh%! MQC럋 V4Z@uF Ph%![X ~ u#V3%1YutVdX~ tV#[ӁtK~ uEӁEuEuEuV蝢ZY@uF Ph-% !Y[t ~ uV<Ztue[^_]We[^_]UWVS(]} uS#ES|Ẻ{Ls$S# { }u }s uJS0Yt?Vh=% S SdSj3poE X%]e[^_]@Vhj%h%S*11҉fs$t jjSa" S.#Z@u=98t h<]'X1}E A]e[^_]"}{ tC uPh{%Ph%(Y^{PtRStCQEЍ}ԉƉщUS&CtZU9uPEPu袥 t{ t11҉s{ t411ɉh>#SSFS8]e[^_]e[^_]US]C Pt$ZYts$sLP ]] UWVS];1{Ly)tC$tjjS 14%1҅ututEC$u?tSp!Y@u h\'ZjjAS @u h\'X]e[^_]US]][].UWVS׉΋;M EU K 9}!E4UQM\(YZMUtBu }{ t~EUh%SYjjMtuuSD tSޟZSOSX+9t'C jjMS [e[^_]UWVSP] 48%@1҅utjZE1t6HjEP, @h\'h%!_tm@hB%h%hͬ%@t+XRDLtzh%hƬ%hͬ%I Eh%hݬ%hͬ%& 1Eh%h%hͬ% 1u1h%h%hͬ%t C[h%h%hͬ%<@uuh%%Yhjjjo TPh-%EpE5u>pE54%1҅uu u_pE5XZe[^_]USS]E uPhx\'hn%R jEP, uhx\'jYuZ8t$hx\'hb%j,,ǃ, _w$jPhx\'h|%ju6M8tu h%YuESQXZ]US]E U{ u)C щ‰{ t][]t[]UWVS ]]} utSEtXZu I2w{ tC Ph%Kέ%p^_CStP }tQSS[1pEPjEPu] Euh\'WYASuMXZu1~ WEt YXt3{ tC Ph׭%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh%$11ɉddY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu^ ؍e[^_]UWVS]DžPPhhs @uh\'h%1XZh%Y^1hPPF1׃ u VhR%AXZu/87t/8 tt VhR%^_\XPSǃuh\'[ttlHp VWZYu VjS ϋFVt=PVF PtZYt%Vhjj 7u7W1FtPV2VP~ t11ɉ#Vh WtSPtSttPSP e[^_]US]E ftPh\'hn% S虡Z@uD6.87u ]] .8 t.8Vt .8tE\']]UWVSD]} uMMtFMPVZYt3Mv/-7S UE \'EU#e[^_]EC(f9t { tQPC Phg%f{(K>:Mu#M}tyEPVC*PA Mt_{ tEj<}WQC*P9K PQMh%Yjt S*ȉe[^_]UWVS0EEE EȋEEԋEEЋhѮ%S_ZuEE ۮ%+h%SY^u,Eȋ@0SZ@E] EȉEe[^_]uh%S^_E܅h%SY[u EȃHg1E9}E4`Z\FSX}1ҋE9}?EЋ UQM)Ɖ$MQu9 K)Eƍ@E UB 뺋E@Wh %W1pC.E 1E111E܉EEPha'h %uu$ttktA(NtR4tU6uE뾃UuM@밃ptxtn 뙃M듁M늁M끾wEkpC.E%@1҅uE䁈4@EԉE1}11uE䋀t0tR~ tGߍV }9}~E4RUZYGUu9]uuVj-v EvjEPEp B uoE䋀t0tL~ t-ߍV E4RUOZYGUt}9}9]tvuVuu @uE䁠41E䁠4E@t)E܋Uu9]u)}u#U܋MEtNf}fC(ffGfJuj @ ȋuFZK>s*S>+Ee[^_]UWVSu} lhζ%hPV@à t1=whlhζ%hh% <&8thζ%h$_ XZh}h[u h]'> huPY1l>uZG Ph% tXZt{>u[C Ph% _XhhF% YhuPWhQhnRPhnRK =nwHƄn ƄoPRhhζ%V舆@u-h]'hr%, XZhtjWhà ppe[^_]átE5tUtE5PtE5UxE5]UE@]UWVS]u }uh%h|^'hG}t}uhķ%h|^'hHh%tu $:t 9ptUC tHtJKHjYYu<tBCXCpf@up MH1҉PfxCM1e[^_]UEM uh%hh^'hh%u %$t 9Jt $BH@MUWVSM Ep}y1yy9s)}_+Yyutʚ;1Ƀ}t}[^_]UWVS$Ǎ]Sjv ~ DFu EPj @u11EEEE1;s4sjEPC04# @tF1e[^_]USjPj[ZtÍ@Pjs ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tP>E t9VuFt9t,NtJKNt PKXV^Xs@Q1s@sDCMYC t6HtJKHP!ڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]UWVS ]uCh%h]'hh%%tE5t,tE5HtE5xE5C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t&zLu1t]UWVS\u~>u Vv7EEEE1]Mu_ EMQUE UJHOuԊEEjPS蝹PF Ph %F>PSVD}(u V*N>׉e[^_]USEtS,jSV[ ]UE t E] ]USEtSSG[XZ]UVSEu Ʋ9t t !ʉ11@u1[^]UWVS}] ?jWS" s jWV" wmj:V} ZYDžt?EPjhjjj jGP C8 }t)UC8jVCP#" R. DJu <:tFu}Wjhjjj EPVp C0E t/it.u#Wjhjjj j@P= C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPZYt[u{1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjjURWPVsu ju(C*WtE84%@1 u/t%SrZ@uh%SO qSnC@SCvfCDCCHSu @t CPCHC pSuCL1s@CX_Xƅ2e[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[ ؃4[^_]~ UWVSƋ tC1ۅu)u%O Ƅ  1ۅut1ۅutӃuӃ u %1ۅuu[^_]UWVSljQ?} Zuh`'RÉEhn#EPm ZYtfP } Xuh`'S[_LUj@PV? Uuh`'SsURj q7SQXe[^_]UWVSljӅt΀9u113j/Q ZY…tH@EEPjj jjj ju }t uh%-t SPZYuUUWVܷ ZYUuVhѸ%0ZYtB/1t7!Xe[^_]UWVSÉUQ YE>"ux"MFGVj趬XZt7t9}s 7VS耬ZY1}u>t tCEM9tHM9MsuN\?~Vnt>0bt!# tt:xtBrt#   C  E R.MNMߋUDJt!U߈U~MDyu~~U}EjjEPX$  tE1ҊM΃0wGMLBu}t?jjEP$ t.S=~ttCEE}u$@t9E,1}XFe[^_]Åu À t t @ u1Ått u@ t1UVSQÉ֍EPjjjjjjR  }uȉjDZ~~1CtCHuCЍe[^]UWVSE։M؋ERx EYuh`'j=u\ _ZEu Vh`'h%u1?E}u[ [E܋EE1CEE8j=W ZY)9EuuuW^ uʃ}t'Vx ^tOWE[uXuFW É4$ EBU$W.ZYUMuh`'u[} DED1u3Vw _XjCPuO: uh`'yVY[41҉TMe[^_]UWVS]s {X1;s s WF,Xs1s s{$X1;s(s WF,Ys$1C(C$Ze[^_]UWVS,ljU؋E1=b$$^'E*@1$} $t uh%$;@2.tPXjM 11rXu 1#u1ۉh`'6Y#VQZtjM !^@t;thx%S ZYw#So1ۉ^c#@PYO#} 1# U -#} u#jM Zuh`'h0%t.u h=%u%" "} t% jM _u hZ%1 a"} C"H"<;"u t <P[^""} !h#u @ ZYudž!EPjjjjjju  }!u hh%!} !EPjhjjjju # F }v!u h%]!} K!8M!jh%u u/E܋HL@ư`ijh%u u/E܋PTư$E܋@DFNPpMju PWSuRUSu=ju MQWSu܋URSuju VWSu܋URSD u h%+ }  8 jh%u u2E܋HL E؍`ojh%u L u2E܋PTE؍'E܋@DNF0E؍FpMju PWSuRU~Rju MQWSu܋UR\Rju uWSu M 1'1} tjE 8tbj/P Y[Džt@j/P _ZDžtM @t/O1!t1ۉ/ } EPjjjjjju . }u h% )jM EYu h޹%  T } luh%} Uj,u g _ZDžtxu u h %89E u=E H j[u h`#Q 1ۅut%Ɔ EPjhjjjju K , }t h%%ZO )ǍEPQM蛪 ZYHMu-O 7: U艔) jY  T } E <4t E x4u  E 86tx6u @E @E 묃} zEPjjjjjju  }cu hY%} 8=LHM *L} j,u _Zt u ! P $Uj[Uu hu%RPL 1ɉW藼}}} u ƇhkhU%u ZYu ƇhLh%u [^u Ƈh-h$u h ZYu Ƈhu jy[^Pl裸ZYuh`'iXlu P>p^_} u Ɔ 1h2#u Y[u Ɔ |hE)&u _Zu Ɔ  ]h%u Y[th%u _Zu Ɔ +u h%} t% jM n[u h%1   ~o} Q8Sjh%u u/E܋HL ư@ijh%u u/E܋PTư$E܋@DFN0PMju PWSuRUJ?ju MQWSu܋URJj} <8>jh%u u8E؋HE܋L @ư`xjh%u i u8E؋PE܋Tư*E؋@E܋DNF0^PpMju PWuuRUIju MQWuu؋URlIju SWuu؋URKIju VWuu؋U} j=u ZYu h% @Ej hϺ%u F ud}u11҃uM6Sj hۺ%u u}u<1ۉ$jh%u u0}u 1ɉM1jh%u W tFjh%u A t0jh%u + tjh%u  }u(jP%U XZTEÅu h% @E؋M܍UE@u WM1ҍE@t WY#X3EPRU1EPU܍BP1EPU܍B8P1WURP)%$1ɋU jh1%u  }u(jP$U ^_MM1ҍE@yW"[h1ɉMEPRU!1EPU܍BP1EPU܍B8P1WURPY$$1ɋU 9jh:%u > tjhD%u ( uB}EPjjjjDjju觺 }duhI%Kj hX%u }uߋE j/u _ZDžtGSuj/ HuNt>EPjhjjjjW  }u Guhe%ƆtGuh%!11Ƀ}U jUEM j/u R ZYuEjP`& PJM JM UEM j/u γ [_uEj P%  J M J M b} DITPM 6T*߃  % Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ2Ɓ&E DžtGEM 1?j@P $$  JM E } u} 8jh%u uHLHjh%u uPT@Dju ƐVWQRP7A 8u h% }  $ɯu ` $ZY h`'m}  4%1҅utu h%9FU m@u u hĻ%N K < - ! @   uhԻ%F EEӋ4%1҅utu} t h%\ڀE Lt @Z} t6j/u j [_DžtGEU N@uu h%/ 1,E؊EE19MtIk(P} u*t,]f9Xu#U8uU8PuU8Pu U8P AjE@P(  (,P,k4EfF} FEt'EEFEFEFF}t uF1~FH j/WH ZYÅtCuWjY HtWh%1~_X f~ EPjjxjjjjSF } She%QF[^  }    @EԍD1HEԍL PEԍTXEԍ\E؋E1҉E1ɉ} u^ }t EX]ԃ E؃}  h.%}  EX$]ԍX(]؅uhT%}tlE ƅu u hq% EPjjjjjju 辱 }t u h%j FVE tMh%1E̋E ƅtFj:u ? [_t8URjhjjjj@PDEЃ 1ɉM܃}t)h%j=u [_E1҉UЅt@Eh`$u ZYu'E uh%qp3h<%u [_1ulE Itčphռ%u 诮ZYu. 5E uh޼%qphC`$u nY[u&E uh%뽍phs#u 5[Zu&E uh %넍ph%u ZYu πsh%u ޭY[u @Uh3#u [Zu Qh%%u 袭ZYu h1#u 脭Y[t1h%u q[Zu h%u SZYuh%u 8Y[uh%u [Zuh%u ZYu|h%u Y[u ah%u ̬[Zu@Fh#u 豬ZYu (h%u 蓬Y[u $h%u u[Zu h"%u WZYu @h %u 9Y[u @h%u [Zu h%u ZYuwhN%u Y[u\h*%u ǫ[Zu[h3%u 謫ZYu@h$u 葫Y[ t u h#%}tu h4%uXZ1E s!t@uhQ%NXs"}uhl%1[uu h%urBsthXc$SZYtSV Xu 1E؋Eȋ]ԋ }t&1ҋE9tE9S{IB,j,E@PQe uh`'V]ԉ]؋J k,1CC C$C(Ẻ{EЉCs }t"u _S׋u܉)1S׋E}t5E-}t }pEfE\} >h% `<"- } u 聀^udu h½%@d} E aDžt @khc%u Y[M܉]t&h]%u [Zthv%u ZYu E܋U  E܋U%h%u M Y[uGu h޽%Åt @Í0PWj Ht h%|h@&S _Zth%S ZY@yj[B 3}  jM _u h#%> @} EPjjjjjju  }u h*%} tyEPjjjjjju 襨 }tfu hC%P} tBEPjjjjjju n }t/u h]%WPT[uhu%ZY@1 S Xe[^_]UWVSEu} EEEE1ۉE싀a'tM܉UVP ZYUMtCnuFE샸a'uu u El$EEEEE}  a'EEe[^_]E8uu E%e[^_]e[^_]UWVS }]u1pC.} t[%`EUhX% jjSǃ t:jWSƃ }tG9Et G99EuWS$W* e[^_]US]t"jjSs tu S@T06 ]US] UHSuZY9tS< X1ۉ؋]UE PTuh]%h h'hhX% 2PuUWVSSljӉMBTx t41҅utSWYXu'S$ZtCP^1t<CT9FTuwFt ;CtulSVZYu_FttCttC8PF8PZYt>CPFPZYu+֋CT@$uFx9Cxuy%p%}u?&ٸt[Ftr0tCtt&SjK6XYBuc 8t h%>XVj%6ZY@u 8t h%XSj6ZY@ty 8th%X1tEVWV Ee[^_]UWVSP}tDjjSƃ t)jVSE 9~TuVSiVo uӍe[^_]UVS E uh}&hg'hPTuh]%hg'hhX%d 2uh%hg'h߃}uFƈPVXZt1SVuh%j uVx ى1Se[^]UWVS8uhxh']Shh'EPhh'}Wu WV8$thg'h%w_X14SV萞ZYujEPjEPe[^_]SVRZYt1xjjSqà jSEPXECT x t8jSYtC8PsT!<_Z@u h%豯YS;U t2C9t ;E !SEP_Z CTESPNjC|ZYtwG|tEuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWuW x /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh`&hh'h{uhD%hh'h|h%蟽 Fu#<u;FuFPh$WSrq @u612WSPFDPgÃVWSPFP Ã؍e[^_]UWVS}] uhL%hh'huhX%hh'hh% GS8t)R78s<t<t1&vvRS Q/ e[^_]UWVS(uuh%hh'hFE<t<FVU1QF1 G!)JO9txJ dB@t8tM9r1=8}1ɿ}tAut]@}9s8 /`1ۀ=E5uU}ع1E׈EE5S}W<WV-thd%hh'h'h%= E51ۉ؍e[^_]UVS]C<t<tW /g S'؉U Y=E5t15E5S>Z;E th|%hh'hnh%觺 E5Ǎe[^]UEU uh%hh'huh&hh'hh%\ fPUWVEu uh%hh'huh&hh'hh% fe^_]USi'tPh%+o XZ]UWVSD1}]St[Z@j0S\1uuuu}WS\1;5]'s/]'H>v 輿  DF1;5]'s/]'H>v 胿  DFWS@\\ 1҉u uSjE0EPpƃ S7[YEt ) 0e[^_]UVSuEPu V uVjsV ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh%hi'hC؀xth%hi'hh% u1W9s*jCPUq tًUGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`PnXZ `SqU X4%@1҅ut _t^Fh#Yu%Ph%S @21 Ph!%S @uWh-%S @ydhlh(%W& YZu@ltDžplxDjVYZuGDžph7%Wխ YZWū Z|6h?%W训 ZYuDžph%W莭 ZYh>#Wy ZYh%Wd ZYhX%WO ZYyh#W: ZYdhέ%W% ZYOh%W ZYpDžp Džp_t@F PhL%SU @pi'tPhY%S. @7@t pOdTX%u#Qhe%S @hVL6$&t 0$Ju%Phv%S @9vHh%S @!FPPh%Sr @v$h%SZ @V舨Ph%S>@~Pt?vtFQPhhtRE@ttRh%S @~xuF4%@1҅ 1hxh'tPtXY#FxPh%S @u(z u RuARPXQTtP@ZYT9Pth%Sk ZY@jjtPƒ ttqTjjP T9u-BTT Ph$Sk @T`jR뛉Th%h$S_k @Tu4jPSj$P @h%W ZYu>dTX1҅u%#h(%W蜩 ZYh%W臩 ZYh>#Wr ZYh#W] ZYh%WH ZYthX%W7 Y_twpuhehxOpu VZ;pul/lxDpjV}Y_#%#Ph%S @Wh%S @VvtZ%u6u_%u*Ph%S @umt:u%u @t>(W&tY%uPh%S @u'h %S}_Z@pu^hh@hq PVhk%ST@dk%O@ugpll@LlqPPVhk%SY#@\puPhtfh@tYhqPVh6%SS@d6%pu,Vh6%S蚭 @1d u{puDt׃8tVYtËlpHpDVh6%S}"럃ptpuVS_ZPh$S @tXd 0uST SY^u hi'/Z#_tFP`P u,hi'X_Džp.؍e[^_]UVSË2\tPSKd e[^]UWVSQ} utu@GL%t >#Ht#}tE1@ۅt 1ۃu4t&xt HHt}tEP@uCWZt!CE}t7%EE@t]jWb[^t WYuu"Ep}t?%Eƃuًt 8u1W Zt^}t8EÃuˉ؍e[^_]UVS]u tPހ~t9褲 :jh%S+ uSh Sա \ZY9rhJ. X1e[^]UWVSEE} u |UGƃuh|i'蝘Y[jh %W蝢 uu Ee[^_]E1҉UWPE Ph%%ԗEPƃuuhpi'hU# jEPVd @u d 8thpi'h#ܗ1ɉM^_EuƒutSPٜ ZY} -];уM I+ѻ}hn#EP2 ZY;tjh%S蔛 ujh%S} uu1;}1u1;} uJum诪 [EPjjjjjjSs }tG,9uSv ț ZYEPjjjjjjSs }u9G,nFu2m d!umX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9 1E؉EErE,@x  VuQ9uu "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms  7뎉ߋM_.MIE)M܋E9,}vA M}}t ;]tC }uUUt;]tC } t}E[^_]UWVSu EEE}1ۋE9EeEEHes2 j' j'Gesy4EuyR.DBtes R.DB@t: E\t-x)R.DBte/t M M\u/t#w̦ 7f\\t0v\0G0G0OttNGCt*tesUEu EZY[^_]UWVSÉ׉U7(ƍPSɔYZ@Wh$SvX @}uSj=D= _Z@u$p hW#S@X @u@ s=Vu hV wXPj sVu Sn> Y s Vu Ss=ҁ u V( t.Vu PhV@Vh$SshN$SZYsC1D0t<0u FuM  )sSP; Y_@u|u } 9K;} u@tPh"&Sj ; ^Z@u3tPh#SV @G루tffPh"&t&ffPh#SkV @c t Ph"&@tPh#S5V t%7/Ph$SV @sWj.VWjt tcVh$SU @tQ?tGuUWVC*P? U[҃VSo_Zu VSo[^tRXZR軏YtPtˉrVSA_Zu VS貎ZYtXț /1 蹛 ؍e[^_]UWVS,E̋A tӉ΀ytu聛 x1}ԍVx}W}ԉ}Z@$1FCt}ЉF tCUfCF t&EȀxu xtK|@Ft C8UF t CXUF0CxFftPEt虈_ZF tU tUȋECTt14~t 苚 h!%EtCTZYuՃe[^_]UWVS8XCtP>YS_[1ZtEe[^]B[e[^]UWVSUu ]8Z>t F1Dž@jB UPPfDž ˉhPhiUpv UJ>r*hPhipv ,؍e[^_]UVS1ƅ@ CtDžC8P.^CP~ƋƒYu9Zu)CT@fCXP_u tt uC| t Cxt(1ɉ,uCTƅƅfDž1󫋅@p׉މ;tHH t2fDž f󥃅 ZupV耆XZtHHt'CstHHt0fDž f󥃅  t'CXsXtHH)fPR6 @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP4Y@OHuWTY1CPW+QXZ$jjVSjLPX@u4 8 넋H؉@D@9DDx9@s DD9@r׉F u]dEuGuXu hs'wX?$RuhnPmpPC(PSZ뼋F1,1t zuB01$t$uG4h1 jSV襖fDžx,|Vhi@(g @u6O 8tE 81ths'h%nY^<< 4R0R,RSjP(e$4󥍽hr󥃽$t$j4PSƃ u6艇 8t 81ths'h%mXZ31 "4u5uSU ^_u1C YuCtP*ZSFX1ۉ؍e[^_]UWVS(]c{u'ss s(@ S1sSC ЉEԍENjuEEEE؋E܋uЃ9CrHuԋEƋM9MsMM̉MV3ZY{MԅUЉu}ԋEԉC} E܋}؍D8CC;Cr 1CCK%Ѝe[^_]UEEE EEPhgBua UWVS`fy(u} u'󥾠t'Xҍ4uV`t'DžLDžPDžPhBS/a ;ف .xt'DžLDžPjRS e[^_]UVS ]E fy(u/UEfEq*ufI.fMffEк11҉EUEEEEjEPs-%e[^]US]s's %DXZ]]DUE@u(1ҋEp@th~B Ep` ZY@UWVSM}]utDw 蠀 .E C[UU +29sp "1.1U 1ۉ19t9u} A,[^_]UWVSSÉ1҅tލ<}})v ~tCf…t‰Z[^_]UWVSEӁcSct V1E E1}}1EEEtHe{l}܍}u܋U9NQUt9Mu&% Ee{,}܍{l믍~}~MNM9Mr}ʀ}t}4u NɀMU;Uf}}tcuU9s;1t)ЉuRT>ZY}艇} u E苀MNjuu؉uUU} t] u3tMNjuE苀E}u } Ee[^_]USSӉʍMQM QMZYt }u1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]USSӉʍMQM QMZYt}uȉ1҉Ћ]USS\t rXs\1C\ ]USS`t RXs`j#C` ]US]$S<>XZ]]E@UWVSRË1utOC><vGD&BTtt_9t;t1zT9yTu)1uuU U밋@븀{>v P ShT%b e[^_]UWVSÉ։h,j:ZYt:PǀcScufǀ,1e[^_]UWVS@ÉRiY@u Phl%aXZ.Gw*hH Phz%a th, Pj9_Xt@dtVWv<u?(9x u1Wt cScuGhu @G @(GH>A<wOw*󤋅% 1҅ut&x utmtdf@ tStJSjjPSU9Ѻrf‹fP@TȋG,D8ǀcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃf@6Vt4L7Pu"uJƃv9nC,m@1ɉ;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃qf9 ffC tHGY u<)9(CM A 󤋽 \ tC)9C= A󤋽 \wr sb@WuM tB)9iC< A 󤋵 \ttWH4%1҅u/u+@t@Zu)؃fPhPIƃ tjt jVC_ZP)9}QC t  CfCtKSVY^>t/t+Vb Z@)9  CKttdt[%1҅ut)@^u)؃ftC t@)9rhC A 󤋽 \S)‰)=+wD@1,w,)Ѝ4? Ph%+X4 hAe[^_]UVS~\jh߿PF\ uF!q 8u!5l6.h%WY[ Shv'hU#tW 1Sh jpK@uhv'h%?WXZ1e[^]UWVSMuh%hu'hh%8j Ӌ}S OuO 0u싐1utXt Ctw qjSPC u3BC C^PP S@BSjuME"ZY@u 3~BCXSjuME^_@u C CS j3uMEZYtC Sj:uME^_t1ɉKSj;uME_Zt1sSj6uMEZYt1Ce[^_]UWVSu/h4j-ËXZ1C`CH%1CPsijhV%1҃utV0s^_ p11 % 1Y t/@P( ^ A %1҅u1utfpFPg( Y?V @ QP lpS@>p@P' Z W(P O>w*󤋅Ɓ1uTuP%1҅ut3 t)hRR@PP Ph%>@>u1DhRP*PP Ph4%Rhlu'RXe[^_]UWVS$Ɖ1iu1hH%7RfNJ.Xfth$SPXà 1GiPV Rh_%Qh$SP6~Ãuk 8t8iW VhU#,R!w h`u' Vhu%R 1d4@1u$u j5SWY^@uƅS%Zu h`u'QX랍lj󤋅e[^_]UWVSS]Sj8_Zt,]t#8tCP%Zulj1e[^_]UWVS$ϋEE Eh%R[ ZYu}WƅPY $$Xۋuhu'PYuQVhRSV-<@t-PyP6 XZuEu'e[^_]=P1ۍj6j4@uƅx,w n#j@,Ph@hW0u譬WPhn#薬WPhn#SVh%[N$vn#tE8%u)BPWVh% N(PWSVh%M ]e[^_][+UWVS] v'tPh#* XZE1E;s31;Et k, 9t@v 6h% PV|G,1;uts 3h% PSVF,܍e[^_]UWVSEvpE E] P1}tEuSPh#%u @tBE^PPh%u @t E9sT;] us< v!#g Juj ZY@u؍CT9Ubf "uj[ ZY@te[^_]UWVSuE ]xKt t4SWhS"@u{Sh$VO Xt\f S7Ph$V @tuuVj ZYVj ZY@u@uf 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hHMЋ@E؋E E@_tE@oE'EPjyMЋU؋E X^XtEd#,EPhMЋU؋E .Y[E%E4u1҉UMUu X1E1tENjM U)уȉEU~@uCtEPS萣EPCP胣EPC8PvSu  EE9w< v $d #ЍzD9E7c "E@Tt 1ɉMEPj!MЋU؋E XZt؋]u1E9EFEtu ƔXu EEU9t M;At;A u1EEIʸy,%=t%=t 1tȉE@uGtEPW'EPGPEPG8P Wu趕 ]E@PEPjMЋU؋E Y^E41҉UU9u 譓XEEPW胡EPGPvEPG8PiWu ]뤋EԋE؉U%1҅u7u3E @hu$űE Ph% HEԁ Ee[^_]UWVS$]ƅj4uM^_@uƅExux uExl!W Pu h%u7@u1juMqZY@t+W3ƉP认Pu h%uڡ@tV)3Pu h%u贡@yjuMZY@t,E#pVGPu h'%us@ 3 PPu h<%uA@ut Ex,u@GhElPhhV4Vu hT%u$@ut 1;j@E,Ph@hVVu hc%u蟠$@uc;s WF,X鋃@1;Ds WF,Xh1;ls WʿF,X鋀13;⋍T9Pu{@D19t ;t_B,RPMUXZtu-Vdt&F$;BuFhuPSPG Ph%^?v$ݜSPG Ph%p?E苐84EЉU%1҅ut*FH(%h(%W蕦jEY8~HuJFt.Fhu(VJ9Hu~<t>t FH%FH%>u FH%FH%~0uF8F4eWhv4jE6WhMv8jE6(Wh:v0jE6v8v4G Ph%+>$~@u\EEЉU%1҅uY[^hEtGW4ZueE苐84EUt]hy%=jE6 >vHW7juW#*tFdFhӉe[^_]g__e[^_]g_UWVS EEE EEt uujjE5ZEE싀ƃ1ut{%1҅upul ! CiPE0wu@ t@{t:{<t4s$PE Ph %_EHT$%u@v'rt E:tQVC Ph*%:1uEPLt @v@}GLihy ES2>ZYEE1}m5@N&EHT$%u@v'zt E:tVV$QWC PhG%=:MElE@eEEE@ht 1ɉMExdtj$PS& tڋE@$Et͋E@4%1҅uu h&&SY^Sjj01҉UuX}tSuuj@0e[^_]g_UmE]UWVS ]ESjj0Ghu/E$t#tShPj/E1u}}{ u}tEYPWh%6!$%u%QWh%6 ]e[^_]UVSuF Ph%6s b1C CCL ue[^]U幰E]UVS]tVwLShj.v$艓PC Ph%5 1FL]e[^]낍e[^]U7E]=UWVS]{ Wh,%5F0+F8PWhP%5ShjA.1F @tEi@Eu Ph=%0EPj>E1pLp d E1x xE܋ƃ1 utEe[^_]Ɓ1EP E}GG @EjEPuUJ cSc}܋]ԉu؉t t@tQDcScXEp$pEE@@[xYE@ cSctP@ E1p p_!E܋EԉU؁E@ uEEe[^_]cScuE܋% 1҅u΅uʋE;E1{L%1҅ut%u 1^uE Ph%-ZYE䋀ƃ1%1҅ut/s$ĊPE Phh%U-EEe[^_]E䃸C cScs$jPE Ph%,E1C<wPh*PBP uhx  XTTu ~P1ҋPX#\ًP9 tW9r7OPh PhV%s TX#\PˋP9 / 9r̍oj5`hUZY@u ƅoATX\th Ph%(Y[ oX< uBHvW`Vh%W`Vh% duW`Vh:%%uW`VhJ%d1҉PLDžPPPTDpt;jP`h:Y[tW`Vh\%PPuDžPXT@6@t:tj6`h[Z@uW`Vhh%W`Vh%`hKƃ tPh Phs%&V:d8 h4%1҅u.u*ho%hdiPh0ڠhhdpPjh;d@Pud@Pi<wPC*PEPE u%C PF Ph%KuMUd[뚍e[^_]UWVS8EE] }uP8Yt99s&}E EE u'E%e[^_]b)WPS3 nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉʵfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMЍE eUfҋESftu yPE Ph% (fEfu)T3EPE+Xe[^_]UWVS$}E ^\ftPhu'hn% cCubh$RSU u#>t=G Phu'hU#EW*sPRWt^\ue[^_]UWVSE 0xjPu( uEu'e[^_]ËOwvwPw Sh %<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhu'hn% t @`jVP" u hu'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuV4Xt,sss Stttt:uj@苃t$P ǃ tPǃY%1Ze[^]W|$wUWVS }7tu PdYF><vu#%1҅uuF(fu  Ӂt1ۅu uuE0e[^_]g_h{ ÉE1Em5@N&RR$F Ph/%VhnSjt(e[^_]g_UVS]Shnj|t~ht j3.fXZe[^]UWVS E} w]~tuE9{dfG PuF PhS%`VE1҉Pdh%VV *!GuE@ @;Gu}PasPF Pht%%1҃ut V[AV%1YuمtӨtW1~E84%u!uG]9C$uSh{dChTE胸,1ۅutEVZ1҅uEpE@]CO W؃~]CX{F$E}uEUҊM]脄tI_E@Ѐ8t HD)у@v . M@X@E}uE@H%j6cEpHVp{e[^_]UU1t )]UWUBv- 0E 1ɉJI} ډу¸)Ј1_]UE1҅t3Ⱥy(t%=t1҉]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVSdEtE}?Ex 'Eu1E@$ hxh'EPLjju OÃ{E8uǀxhtxduh%hv'h*h%c$ hxh'uVLE@dZYx tWu[Xu1RK|EPdB#B E}WS}iE@d@ EWCPgiC9SV]jjEEPN jjEPNE }E8P\d_uqE0@Z^D$NjuuPZC| SEPq\juEPeNEuEPZY@E@$tvtguvZX1uuVSOhVCPEhE@dEPC8P/hE@dEPCXPh SEP[_Xu[jj}WMà SW#NsxC|ZY uC|E@dEPCXPgSu K9tSYS-WX떀{tjSu BMà uhSb_tߍC8EPb^ujju Mƃ t9tEuVdZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E1u}}G$tN}u>}Ghu5j}Ghu5jLZt tSpPx]UVSu8jjÉ^Xu h$w'UY1[1҉SCC ؍e[^]UVS]Cdƃ CdC`tChPC Ph% uGuAC Ph=%zY^KtPd sҀ(t h7%QgXZe[^]US]u:jYt'1҉@ǃǃǃ1҉Ћ]USPE]UURPDRptPQRP>RP*RuM UuU]UWS]U vp 119t@u1 gw'[_]UWVSUyv  u1΃y tËAdr@t$tt @$u@h[%DX؋UÅtF PSXFP}WWCPXFd@t Kth( u} WC8PWY_C9@VCXPWXZ؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PVJXZ?ˍe[^_]UWVSQEp1҃t<t19sAM1ɻ BAt }ut1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}]Cfw EHfvR f9]u1Ʌtd@w 1 w w w ?w xIÉEU)ЉE9} "uu}u1EEftff@~jVC@P[ ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjS'ƒ ujjS]m ]UWVS} uEtCt=u{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVS} 1EEEE3CdEu u%StVMQS2uCE䋀%u=tuuStPMQSjC@PE0 tK9Ht ESXESut URP'ZYSXu e[^_]UWVS} Et0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UVSEt0t.ttju CPPy t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j]Zuhw'$YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZoECCdUSǃt_{ u Pu uƃ C S@t@sdKQPuR[@u s{ u @t{ u j.EPC K{@u RURY^@s@{ 1UĊ  L @uj.EPC@Pjp tOSRPh#%j.ChPy jC@Pu+ tP`S`Cdt  K`(Cdhv' SXZ1ۉ؍e[^_]UWVS$EEE EEU}uM M؋M$M܋M(MԅuEtLRPEY[8E(uZEЋEt2jWC@Pv uE܉C`}tp}ʃ}jVWu{Px{@u 1C$C {4s(E܉C`1E@CEX}CPt Nju Ȏ(CdE܀t CdtS` ttSX{@t4E4uSu!uSuu}uLSYMCAPu<{*Vhw'Wr tVhw'Wr u    VvEU1Ejj@EPSƃ@$@ 1ɉM䋃%1҅ut6EPSFPF PF@P@u VE䉆F F@FFDf{(uXC><u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLVo VFHtVoU eFHE8V@?jG@PRU#q UuG`t7%1҅uuV 1ZiEGhPG Phr%>V oj.FhPRj0 1E@F0EpjVt8;Cdt,q PjCPPCP@SF PtjR$če[^_]UWVSEtt?u[0tFdЩu1҉t Pu /Y_6ҋEt^tTCƅtDGPEPn8WRV^t @H KUQjsZYtUJ>t/@}wFH r*NjM;rC 1CUe[^_]&W|$wUWVS ue[^_]g_h< ƉE1Em5@N&RR$C Ph% ShMVj(e[^_]g_UU t,t9PuƀRhSjj&UUу1t.w 1#tRhLx'hV% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`P EF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS81ۉ]]]E1u1EEE9CEׄCdt\URSTRP譖 t t0u5CPE Php%+1ɉKd EEt9sEsxF URV4RP; t tlVdtRNh%tV%QPF Ph%Vj_@u! 81t 8t h,x'Z1F$F fdEt9sE6NEtXMPF$Pv苕 t t1F0PC Ph%V tPVujSTRPEċCPEЋCL }ffMM9Ms6 KMɉMMԃщu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u(}uƃEȃ}v1ɺ>]4tuhPWjE}t?E Ph%EEZjE0"h?%u:e[^_]UUt&t9PutƀU]a]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S^ u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EɮEP1ZYtU9pu 1ɺ]GEttu4@t$P躑ǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj$?E _X1EE 9CEuh%j uV诗 CPVh%u* @uosXsTVh%u*@tuuVh%u*@tCtPVh%uw*@tC`PC`^Ed#tEE%"t d#Au]$d# t]#d#@tR$d#y?#uRWVQuVh%u) @&sdVh*%u)@ C1C;s WAIF,Z拀H1C;Ls WIF,XCPECLE}EfE9Ese SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhEPB PEPu2E UU)U0sx1t8Fd%u'~ t!GFhPWEPh9%ui(@6ċ?e[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09XuƀلtKj3n%Y^u=t h?%S4XZe[^]UWVS} 71ۉff}fuEfǀ< 1҉1ЉЃEu.Ef}w 0z'Ph%j ]S4 1:BUP XۋUuhy'XߋMDغuf}f9<t >tuă PVh%R蕷SEf]f< 18f}uVh%}ȃlȎ(Y[Eċ4%1҅utjXZE΍e[^_]UWVSSƋ1;,k(Kfu{u#{u{ u {u{t]fuCUhPCPVUt1ǀ Kf1ɉHG[e[^_]UWVShEw E@EEEE@|tXdÀuXdBEAE1ɉMM}Ef9UrZ9]s#7 E Ph7%¶XZu<}])Ӊ]ff}ftftfu f9s# E PhK%Y_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPj< UtLF΅uE4%@1҅u/u+j EPjEPGsPE Phc%;f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPruSVPE Ph%D(b1ủuEEPM1ҋEPE[tE-Eƀ>f}uEȅEEEPjuWƃiUЍ M))Ufw#% E Ph%谴ZY%EܹEȉEUʉU9s* uuE Ph%QEX|ۍEtjPS׷ u`jhPuhǀEfEĉ{(u 1ECECdu%Cd{4u EC$U9S tKdS t};sC t u9FhsFhE}{}uuE Ph%6 Tf}t21u~`}W9rF`E̅t}OdMQ9rGdE}uE؉EEe[^_]UWVSljUMu w@ Ph%, 1҉u1ɋUYt E1ɉKhKdK`ǃu uVj XZƃ>VuMUZYuC;u}tG Ph0%G[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]= 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύG=DQK wWF(1RPQhQ%~(WQhk%j EPjSuuAtBf}u;8ύG=DQK wWF,1RPQh%蠰~,WQh% e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@%}tQuЋE؃ Ph%ub18ujjE؋謨EPj$`x'8u ǃ8%EPj s@s<Qtf}uʁXsXS`1CdChǃF8u ǃ8%8u ǃ8%8u ǃ8%8u ǃ8%{`tps|t8Fdu.S`F !AtH9sFhPE؃ Ph% 16ċC`tPE؃ Ph"%1CdC` u9t.E1Em N&}fEހ fEm}mދEȉC`{duEt:E1Em N&}fEހ fEm}mދEȉCd ǃ8K%}Eǃ;uCTt>}t8sLъCDCLCHCPCFd rFV t#tFhPF Ph% 1F$upFhPF PhT% Vd s"1F$F VjjF蝤-NtHN rV裰XVBYHC`;}؍w u PVhn%MuVh%,KdSh tRQPVh%u跪)uVh%u蠪 RVhP%u茪jE0XZ}uA}t;WVh%sHsDhWE0% @u Wh%7^_E؋^|tFCdҀ t ujC@Ps tKd Cd uًE؃ Ph%sw8uE0 E؋041ۅu2u.}؋1ۅut$%1҅uuj\Y[XZ렍e[^_]g_W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@,u1siS0,G$u u iSS0S ti;S0sS0udR@ Yd{u1ɋS0)@N& ڽ 1$߭ ٽ2f2 f0٭0߽ ٭2 Љ ,茪Z{ 1߭5@N&u +t d#u¹%ݝC4HH H¸#%݅u%+t %WW$VQ RP, PhR%#,{t 1s,薩Y6Pjs8s4Wf6t調 ,TVjdXZGu 1a8RPVvljփ 9иr781kddȃ9ƾsff+tST1󫋅,@EUUE E)E.E d}TjEPKc @u, Phy'h% C@Cto ?9sS0S9su,S$t%,R jŜP, Ph%d e[^_]g_UE]UE]U$E]U5E]UFE]UWE]UhE]UEyyuj]zU庛E]i twUWVS 1tx 4 u1ۋM9s3ru2u\tffW׋uUuƅtfC [^_]1UWVS@D@H@4tPH1҉P4YH8 w$xx'ƅ< dƅ<;<  ƅ< Bƅ<ƅ<0ƅ<ƅ<D 4u:ƅ<D8%1҅ut,Dž41DhP  14H,X@(fDž11,,9(DPDT19tk,<>98tB9rIpr@uDtDu f,,ht1(4tj(\ZYDu" t\1(fDžD,0% 1҅ut#j@wPB$t @pt1$Dx@1ƋH8G 5bu`(uHX<@D&v P PhT%՜ HP4BbCD_Zu hy'Y#Nj󤋅CH_1҉tjhj|PtP6-sD/j1CDCH| e[^_]UWVS] E1E;s31;Et k,9 t@v 6h%U PV=G,1;uts 3h%U PSF,܍e[^_]UE@|tPd(t1]USEu1X|tuu SC u؋]UVSEt0t-uvX|tuu S u1ۉ؍e[^]1UWVS} G@4j.DVCPjw 4wVh% ~}tE@<"jWu茙< u hy'G8@Pj48Ƌ<% 1҃utjtHuƅ0eDP< Ph2%]j jve[^_] e[^_]UWVS]u t~wtFuu SHt1ujS߬ZYuNjt w1rh묋0t_1[tt1thDjUY_@(@,1҉P|P|0fǀ<fǀ?SjhPjjS8u"C Phf%|ShSƉSaXЍe[^_]UEtQw]UM E]UWVS É׉M苐t 48UMtSjjPt u E ShZt~8 1pp@1x xx$@u Shx'hU#{:SjY(h%SXZP3YXt jjW|P;t j3XZvLWFDFLVHVP1҉VDVHYt=t8EU%u=t}uE%uS4ZYvLWv4WvPhG%> YX؃t w t u F19tAE9uuUM7Ph"&j> XZUM΃^Ѝe[^_]UhJ.hK%j`4 4J5(J5t9W|$wUWVSHJ51B(J515x6.% J7fj7 s fLJ5/sfLJ5 s/fLJ5fI5fNJ5XJ5tJ7 erIHJ5@J5ffLJ5fNJ5=J5tijEP1 EȣPJ5EȣTJ5ZYFIJ5LJ5HJ5 8J5F hF%AFfVRVRPWSPh`%: j.]SFPjX] uj.h#Sԙ Sh%: j.SFPj(] uj.h#S褙 SAF^(ZU)ڃ<,wJ<w1tR<CSPSPh%<+h%"<:tI<%yRhQ%Rh`%6& YXtj,J% hg%& XZ)P\uj,$% hp%% _XRT@9@8j,$ VT@Phx%% j7P!PWh$% T <x2<w><tG<T@8Ph%P ${'<rT@<w*$4{'h%Bh%;h%4hY$-h$&Ph%,T@t <uh$h5%T+^ PhK%$ Y[THFhh%$ T@Z<t%w uh|%<uh%h%[$ _h%Ph%F$ [^T@8Ph%($ THjh%h %h%h#%h3%h%hA%}hV%shl%ih%@*j.STPjF uj.h#S虂 Sh%o# j.STPjE uj.h#Sc Sh%h%/# hn#%# T@f8fZYfw2$H{'h%h%h%h%h%h%zuh%nh%h%" S1ɋHQ t Shr$h*%&uj.VSjD h4%G" [h>%7" hn#-" T@fHfZYfw-$\{'h%!h%h%h% h%h%! Xj7t-T@<m44|'h!#Ph$! ^_j7 j7uhJ.@ [g v狝t݃{)!C2t!#t1 hU%3the%#! C Yhu% ! C HC SRRPC Ph% HlǃxPh% XZ h% XCPh% Y^19~gVH mYZuVh% XZCj.RPjB uj.h#Rl PVh%; F땋L 9؋4J50J5t9~~j7 qm0J50t 90P UWVS]u#j7tP3^1ۉj7j7S_ j7@$#+j7Yu^p U1҉j75R.t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSU}tIB<:u1ɍ4 E  8uAu t<@t:u <:tu9uF~@u1[^_]UE6.]USE] u|À:u%u@C8t9EsH:tt @|u1[]UWVS4}!}u[=j7tQu Wn[^u<5j7P)YtHWP D3XZhY)^1u?n Dž)Etw}xjjjuM !jh@PE xDž1ɉ1ދ9rqhQuƒ ?tuZm 0S0xm 0HЀ u%V1Iu8:ut+<Dž\t-Dž t t11:uΉ1҉V9r)ډ)ށVSv,ZYu"S/^u[Ɖ‰.1<#kcu SZYPFS7/XDž6.M1j=hx%&S ƊtV:t֍HX)ىMAQPuVË tF}t uXWi.^KtF:^Dž@DžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QW_*ZYu:W-Xt uXr-Xj _<ljljƉlj )PVQx SRe ,Ymt u ^)؍P9s&PSD)ZYuS,gi XË Dže[^_]UPUjujM EUj7tPy6 1҉j7Y1j7j7j71UWVS1=j7uE j7=j7uYhSo%j70 j7^_u=`P5j7kY[t?Duz1=j7j7t=j7uj7j7u@ @uP5 1j7j7Pj7@Zu 1ShSo%PAًR.TZ:u#t =j7t|0\Nj7G|0\u j7P1ɍt:uf:Y\tAߍP5j72Y^u'j7tB @R4 1j7ZD돁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u wu ][^]UWVS j=u uy ljd![Edu!Cf l8]EdUru<:<^uFG<:wMu})ߍGdPS%ZYuS([w<\ůG<:HЀw+1ɉMF0MȉE9t HЀvE농w1e[^_]UPEPhh r7h@v7uƒ1uEUWVS} uLu7uuW1ɋU à =$v7u u1Ɖ>1e[^_]UPEPhh r7h@v7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rסv7EСv7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSU} u]RCI $URjW/I $WjVI $Vj$S I ZE] Ee[^_]UVS@ÉjjjQjRP[ tNtL9tHVP ZY@u:KY j@]S0KiW huDC[^]áv7uÀ=w74UWVSS DžDžDžjjPhw7jP-@u w7) v7Pv71 @Hv71t3tShPh7%h t!Ƅ9hH%jXu ƅц t5tv7u v7FtB<97$|'v7}v7}v7~v7~v7볡6. v7Q9}H 6.@6.|v7|v7w6.iH6. v7Q9P@6.E6.7H6. v7Q9@6.{v7{v7zv7zv7yv7yv7xv7xv7ƅP hZ#RhW%P6.GKQ =|v7t h Y=6.6.9}6.׸Év7 v7 v7r5v7v7v7)I v7v7Pv7tPv7 6.v7Bv7 v7Љv74v7#5v7t@v7)‰v7={v7t*1҉j Ph "- h~'hv7rjdv7v7v7h~'hv7q11v7w7lãv7u&w7 1tw71e[^_]1À=w7u1áv7u v7UWVS@É;v7;v7j¡v7_9u739u0PrY;v7u;v7)v7v7jVS` 19Z;P v7PPhv7r=v7XZVS Y_@u:N j@}W0^,M hD=}v7tMjRP_ M95v7sxu@)lj|| >;v7Fs"J| u| | DT>| T 9Ss$EExSWrED CSWp;sss{uISC PrXZ=}v7uE@,t v7EX,v7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC v7‰ى[^_]UWVS¡v7!9t> v7)su܋tu 9t)D @!u܋D UEPhv7kn@ZYe[^_]UWVSQӋv7!‹ v7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS Eܡv7Ћu!9`x }؋ v7)‰Wt~v7]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w ?~'w?~'"1w}'1;SsS |C@C;Fu ;u1ɉHt SFP=pXZNZH9t9sxt PFPmY_SVmXZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPhv7[lPhv7o=~v7t KZ{ SC v7v7e[^_]UWVS9v7tv79kjjhv7nǃ t؋_ jWhv7nEWhv7ov7=v7;v7r;v7rw1ɉÅuj}먋 v71ÅuP=v7@u1jNjv7!‰)[9tP}v7Y9uō3v7t]EPhv7okXZt>G 9r7 39s0jWhv7mEWhv7>nv7=v7}뾉؍e[^_]UWVSÉU v7EC1t}9xts@Ƌuzơv7EF}}1U9s1k`;D't @u-$@'@' sjtt5 0@p00uHP@$u1S$0t9(s5 *\p0믋H@9(s(0띍e[^_]UU%;|(sR.]UU%%;(s4D.]øUS] uShJ._ h"S誯t5 0Phq$hJ. hJ.j lXZEJ.]o UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt 3 )wu PEPà Et z3 1]UWVS ‹@E졐R.E11 =E}9s%9]D{t}tk Y DFɅt}uzuB w7Bw7 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEPÃxuUSˋ@ ى[]ÃxuPw7@w79Ps=UVSÉjRpg u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD P C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$ 'sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj=P.t9s?MjC,@Ps(c Mu e[^_]C(S,z{,f P{<tgFR.0=P.u9sR.0=P.u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E 7.HuVQM2 t uMQ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCCw7 w7w7'8[u"x.u.K9r !f3r9s:.u z]u{uCw7Cw7[^]èu'B R.fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uCw7Cw7{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4ݠ' ZYuCC u1]UUE ft҉UŜ']1]UWVSSɾ=P.t9rC,E5R.=R.113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh;%V u 1ɺjhB%V u1ɺ,S j@B@Pr E^ u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uCw7Cw7w7<-t<]u{uCw7Cw7w7CE؋ R.Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ=P.u˸jE@$E@PEp 5\ u fMA Q$JuN$f8-P9x]x-t A -f9k=P.vNf9~;{uC w7Cw7ff9UPF΃=P.uމEa~{uC w7Cw71E7* UFup>-uF3-U;Cr{uC P8]u w7Cw7{Ex8tC @tEHfE1P.u9}~Ju9sE8}3G8GEx<t4t fEfu-GR.8EuޡR.8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF R.f tNt R. t< R.ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCCw7w7GƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC w7Cw7{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JR.DJt%9~{uC w7Cw7PU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uCw7Cw7<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $p'^[m\p{|;{r{uCw7Cw7S B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)uw7Cw7 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCCw7w7Gu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM R.Dyu},t{uC Cw7w7@}t{uC w7Cw7?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJR.DJt%9~{uC w7Cw7PaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPR.DPt 1e[^_]UWVS} UҀcE tEp9J) W ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEuEDžh1#1DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXR.DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qERGPx u )MuMA}dM)ыU9uG PV{x @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ R.Qu?f_t9f}fMQҋ R.Qu f}_zftQ R.WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgR.OJf_ f}_Zf_ 8u_CfCU R.DQuf}_f}u2ы R.DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVh @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRU{b UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f R.DAu;f_t5f}E R.DAu f}_fEzftOR.DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡR.DHf_ uR.Dpf}_Ɖ 8uaCf7E R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRU_ U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRUO[ UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG R.AuE R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRUX U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVP @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=P.lt1ۉ]tMEAEW YE}M9MP F,EF4EtpF8EtfFu}D$ Ġ[^_]Ëhld<D$,hD$<$9D$lD$<$ D$,hD$<$D$gD$<$D$,hD$<$D$D$<$d9M`D$_D$t<$a`u!phD$,hD$<$'UWVSg } uttEE*hEEEED$E$oQ…PEtZ /ĸ [^_]ÉUD$ED$$:EDžDžDžDžjDžUDžDžDž W}׉ƍWOt%%VF9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$UMDžDžDžDžDžUE@fE@fMIL$D$ D$D$$p t$ D$D$ 4$p EDžDžDžUE@MIMI Ɖȉ } Dž UE$D$D$4$?D$:4$/ U H9EDžDžDžDžDžDžDžDžE@fEEDžDžW19ĸ [^_]øzR%Kwҋ>V9s%u9sF?V?r95+ .hNv.&.&N9sVu鋽 Ex[U DEED$ED$$UU}ĉ|$T$E$ ƃtdE$x ƃt'D$ED$$hU1҃ډذ MD$|$E$軯 跰 M議 8D$ED$$U苰 8t[^_]z UWVSP oDž/devDž/XtyDžyXXD$h$Ut-ƍD$D$FtH4$P 4$oVD$D$ D$D$$N@Džrhp0ƅpD$D$<$TƅtfL$D$<$XuD$<$Xtg$bUnC輮 P [^_]衮 8u)΃wΉ<$;VuD$D$<$S`TEE ut|$E$ BUt#ED$D$ $EtED$D$gt $ 1P [^_]DžUVS ÛED$ED$ E D$ED$E$tKbB ƃt?uE$SE$6:[^]ËEUE$S[^]þUVS e L L; D$D$$w t@ $ ǃ L$ SǃLƃ 1 [^]k 0ǃ L$RǃLƃ t7 0ǃ $RǃLƃ  UWVS<O uD$/4$o D$@4$GQƃ%D$T$$Pv 4$QƄ=D$D$D$D$ D$D$ D$$迅 tVuw: ul<[^_]À uMq Ɖt$)XD$ hD$D$4$]X =蘪 ? 耪 UVS tu 3D$/4$Rn "Lt$ $k  D$D$L$t cD$ D$D$L$ !Ѓ2 D$D$L$ۙ1[^]_LRD$D$%@4$NLD$t$ $4 褧 Ɖt$)XD$ hD$D$4$V =˨ ?G$S tƃ Q藨 8#u͉4$ƃ z j 0_^ 0UE$]ffffffffffffffffUWVS$ &E@ E։υU };EE EU D$T$ $""""D$"""@9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""?]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""?UM]9ȋEE9EE },EU D$T$ $D$>9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""\>9BMϋEE}19}E UM T$L$ $D$>]u9M΋E eƉi`T$L$ $D$=9MϋEEƉ]u덁݉a)u}T$L$ $D$+=UM]9ȋEM""""9""")Ɖm݉]u UWVSH< D$T$|$|$D$$[> D$$H*)R)L$L$ |$M $> tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8X }܉EԉŰR.ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}ŒR.UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$]] E܍ h D$EЉ$] u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍ h t#D$D$EЉ$]諏 uKE܍,h t+D$EЉ$]4 u}g]܍$D$EЉ$ t2,h t%D$EЉ$]֏ u uE܍L]̉ލh tD$EЉ$]蒏 uruЉ4$]{ T:sE܍LD$EЉ$]Q 2u݀}u<E]DCt.E܍D$EЉ$] u1ۋEЉ tC.uu#ỦD$EЉ$]迎 Uus5uD$EЉ$]舎 tu#GW ]ԉSG UWVS\ Ƌ'<'wwEVN)щȉMEED$$e\t_FMȉFD$F$@\t:F]؉F>FDF 1[^_]ÿ'E {UWVS .D$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$`MD$@|$X\$LD$\D$`N|$Txq|$X\$LtL$T=qwT$`9A-D$@tT$T=qw L$`9AtL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$XlGD$\D$`t$\QT$Lk)ЋT$P ‹QD$dT$hD$t ] 1uUT$$]7tFuɿ [^_]UWVS͵ rt: >t M1uU T$$7tFu̿[^_]UWVSf pt:l>t M1uU T$$"7tFu̿[^_]UWVS äE $ ƋE%EE,hUuUT$$$…plU>t M1uUT$$f6t1FűuUEEu54$1E [^_]ËUt }1]uЋu9t!$U] D$UT$4$ E0E렃}tE1҉UWVSdz lu Ex}u 4t+D$4$5uE)E@ [^_]Ë t 1[^_]Ét$HSD$$nUWVS= E D$E$Pm D$ED$4$NjE8tB|m 8"tnB uOt$ E D$\sD$$҉[^_]:m 8"u썇v+B뱋 t[^_]ÍvҋE D$HsD$$mUVS@ uF$/F $/4$/[^]UWVS$ é}E 1t u$ 'E[<$ E܋MAnD$4$*EMA  EU P8E܍,hMUT$${!ƅ>nED$=4$/ HE } M D$4$2uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE j t(E܉$$.E$.EE$[^_]Ét$HSD$$k $-ffffffUWVS8 ùuj D$usD$4${uD$:4$. DžD$D$4$H{hF$Y $$D$$D$D$|$ D$D$dS4$l1$_$6D$D$|$ D$D$4$1+ |$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $H  $2D$$Y |$$ƅOD$E D$ ED$D$$$D$E$tPT$$}$+$+g 8[^_]À>/uEt$D$<$St'D$<$D Sg 8E D$t$E$u}뎋E D$cD$E$vuE D$D$D$ ED$D$lS$.BE D$t$E$urf E D${sD$E$tDž1D$ sD$E D$E$? Dž1ktf E D${sD$E$ot1;$ 5f t$ 'D$E D$E$ <$ 1sD$E$xD$/4$se E D$D$E$sDžDžve E D$XX`e E D$XXUS(訪 MEEED$D$ED$ ED$D$E$,x E([]øUS(< EE>ED$D$ED$ ED$D$E$.,x E([]øUS(Щ uD$ D$$?D$D$D$D$D$ D$D$D$D$ $+x D$([]øUSZ ED$D$ ED$ED$s$Sx E[]øfffffffUS ØE$ U֨ U\t \]Í\M\]UWVS蠨 E}|$E D$E$2q9s [^_]b ?|$ t$4D$$\[^_]UWVS/ Ա}|$E D$E$q9s [^_]b ?|$ t$hD$$\[^_]US eE$ t []ÉEsT$$\EUS z E D$E$ t []ÉEsT$$\EUVS, Ѱu4$ct[^]ÅtEt$sT$$\EUWVSۦ Àu} |$4$ t[^_]ÅttE|$ t$T$$\EUVS{ u t$E$ t[^]ÅtEt$sT$$\EUWVS# ȯ}|$E D$E$ u[^_]É` 0|$ E D$D$$\[^_]UVS踥 ]uE D$4$8 t[^]ÉEt$ tT$$\E[^]USa ED$E D$E$uEtT$$\E[]US óED$E D$E$uEtT$$\E[]UWVS$蹤 ^D$ D$EUD$T$EUD$ T$E D$D$E$9 Ɖ׋D$ u $[^_]^ L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]UWVS$ ÜD$ D$EUD$T$EUD$ T$E D$D$E$'Ɖ׋D$ u $[^_](^ L$ EUD$T$EUD$T$E D$ ED$< D$$\$[^_]U7 U!tSፀL]Íٿ]Í]Í]ÍM]Í#]Í]ÍS]Í|]Í#]Í]Ít]Í]Í]Í]ÍS]Í]Í T]Í]Ík]Í]Íf]ÍF]Í<]Í ]Í]ÍC]Í]Í ]Í]Í]Í]Í]Íx]Íp]ffffffffffffffffffffffffffffUWVS fƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS\} &E}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ  ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s U D$/4$ϑtLrtP‰T$|$t$)D$ StD$ED$E$1$[^_]Åt xruS뵀>ruGt$|$ D$ED$E$X뺉}UE$[^_]e{M UWVSΒ sD$ED$$t{NjE88/tbD$/4$轐…tL)JBU=wsG|wdD$}|$M$] Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSÑ h}UtlƍxD$4$u tD%=`u'|$U ytĄ[^_]K O1Ą[^_]K 1UWVS }U)tlƍxD$4$η tD%= u'p$U tĄ[^_]t}EE u[^_][^_]UWVS4蛈 @L78ủt$E$ϣE D$t$<$4[^_]UWVSR EE}L70E D$ED$4$=t}EE u[^_]p[^_]UWVS4 ÒuED$E D$4$Q=t%}̉|$E$ ED$|$4$ 4[^_]UWVS4莇 3L70E D$ED$4$<t%}̉|$E$觢ED$|$4$4[^_]UVS + АEM thP8t P8P7@:t1 [^]ÁP8:D$D$7@<$)OH8붸 [^]UEt @:]ø]UVS 耆 %$7t^dB.@J.T$XT$$p4D7tE$/2P7$$L7 [^]Í$SXu뎍]t$`$fUWVS(х v}tG{E{EOEEME EM<$bƃ t tu#E([^_]ËE1([^_]ËUGD$ D$GD$<$CE9E9G?@UR. DqEEmUT$D$<$4:E;E :E+m}EE;E tu}MMD$ GD$GD$<$vhD$ GD$GD$<$UhMAE9O~D$GD$<$9iGU9ut$GD$<$^9u7D$ D$GD$<$gD$ ut$D$<$gt$GD$<$9E;E v}D$ ED$GD$<$}gEHU9_E9G5MzUG;U D$ u4UT$D$<$gED$GD$<$P8E E&OL$D$<$f}D$ FD$FD$4$fFD$FD$4$7}tE9} uD$ FD$FD$4$lfFD$FD$4$77D$ UT$D$<$3fG3L$MGD$<$d7MD$ L$M܋GD$<$eM{D$ UT$D$<$eGU D$E D$E$]U ] D$UT$L7$^]UWVS + Њu}ED$E D$4$6tE} u [^_] [^_]UMU E~tEU M]]UWVS 袀 GuL78E D$ED$<$5tEu } [^_]~ [^_]U I E L7~"tD$ED$$9]ËEUWVS Þ}EEuED$E D$<$T5t'~#tuEE }[^_]E[^_]UWVS /EEuL78E D$ED$<$4t)~%ftuEE }[^_]VE[^_]UWVS0 E}GDEEP798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$]fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]cMEE9G~0W,10[^_]Ã]1^E:<$]~1U| L7$]UVS| ~D7p t4$ u N8@[^]ø[^]UVS| 9ut4$ u N8@[^]ø[^]US$X| E UD$ D$D$D$T$T$ D$D$E$$[]US${ äE UD$ D$D$D$T$T$ D$D$E$ $[]fUWVS{ C} uUM=tUG$XUr|7tUF$U5|7tBU$"U|7,048<@DHLPEtE@$|7  $(EtE@$|7TX\`dhlptxE tE @$N}|7|UUUUUUUUEE$tE$@$^|7U UUUUU U$U(Uċ,EȋE(tE(@$Q?|7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉdT|t ʉt ʉ`|Mt ʉt ʉ\UUt%  XŰE@|E@hDž$ */ E@,p1҉,MI, qfL>9<ffNv tv$ uMI,4vD> qxf~g$9O HG 9u͋9 <>f|>y_u$F,HfD99f|9y.NDfHD$F|$NuĴ[^_]Éщ$E@,R|)ƍTxDlx9qf+fG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YMQ, rfVAtωp$0V PF 9u͋tp9l9h\T$xy DžxEP$ty DžtEL$y DžEԉH$ty Dž4$Ly Džx|Ƌ)΋)ȉpl9^p9dE@,H1҉tvf~94>ff~~ t‰ljv$=u}O, I4F uf~0r$i4W PG 9u͋9 Ƌ9l9|)ȉ9~ht|Ƌ)΋)ȉpNj9p9 E@,H1҉lht}f~94>ff~~ t‰ljv$Eu}O, 9I4F uf~k$j W PG 9u͋9lhwDž?lxE@,@xMT6MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bǃ <ǃ ^ǃ vǃ #ǃp :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ |ǃ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$x:T$ D$D$E$o1.t&.&.& Tp=u[^_]USK ÎUM1&.&Tp =u[]UWVS,K NU EƍME$+FF(9u݋uD$$8CuxupD$$$3rT$$ ǃ !ǃ +ǃ !ǃ ,ǃ !ǃ -ǃ$ !ǃ .ǃt %ǃ 0ǃ %ǃl `ǃ %ǃp aǃ ǃ fǃ ǃ gǃ4 %ǃ hǃ\ &ǃ iǃ %ǃ jǃ %ǃ kǃ %ǃ lǃ %ǃ mǃ$ <%ǃ nǃ %ǃ qǃL #ǃ oǃ #ǃ sǃ %ǃ tǃ< $%ǃ uǃd 4%ǃ vǃ ,%ǃ wǃ %ǃ xǃ ǃ ~ǃt #ǃ pǃ #ǃ rǃ d"ǃ yǃ e"ǃ zǃ, ǃ {ǃT `"ǃ |ǃ| ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$x:L$ D$T$$%Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^ $v$ $#t $:z $'h $#V $#D4 $#2\ $- $-L $_ $| $o $pt $r $y $z ${~, $|lT $}Z| UUSE zO ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0aE OEU܉MD772EE4E fEE$Hƒ=4M4%y 4 44fǃ EDPfvM䋑f8;@E fWf^fqf$MdU܅47Q)ʉ$ 2E$N‹E@ @M M4 'UfB 49}} 4% 44;4tf 7f1҉Ѓ0[^_]ËE44%y 4f y4D$ D$D$$ 4449)‹4L$ T$U؋MȉD$E$!4;4U}dž4…f 4xp4fǃ 3E$>0t3E$=E0U,)4fǃ E܅U0tE@ U؋4 E44B%y 44D$ D$E‰T$E$}~v4%y 4 494114M%y 4;4)fǃ Mԋ4D$ T$U؋ED$E$¿U؋M~4y 4 49411x4Wy 4 4947ff @}AEE܅U$-E$‹E@ N@FM MtUB.jE@ U؋4  UfB 9 4,fǃ !E܅{47Q)NUm~ 4}} 4Hx6 44m4%x4뿃ߋ 4}} 4%y  449}fG Ef` @J.D$ D$!D$ $ؽ $ĝU= œGEfǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX= HGuD7MV8у$33`B.EEt\7 E)V8N<t=%G*tE11zE}uAX[^_]Ãt $*tًE$赼E@EFF$ڶ Ut p@뮃$<UVS7 áAƍZD$4$ etD$4$ 4$ 11t)0tGB<1;NVt~΅u׀>u|F[usVmt2t00uVFtJeNVu1UWVS06 )@Uu :uH2tU$1YUF@fu2ML$ MD$T$<$#2M EPJ(N$JN 3jt$1D$D$$ FTst$zD$D$$ FXV  ~$879<7NT47 072P3PB0zp12džp2E싂E苂TEtU܉Udžp2ELɉMEEEUtwD$Eԉ$UiE܋U؉$Mԉ $E܅IH 1$虱t2džx2EE-EED$E$ u džx2EPED$E$k u x2t|$E$J u x2dž|2UtE)dž|2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(EU܋ED$<$ UEU܋ED$<$f Uu p2MU܋ED$<$8 Up22@@,EF@fL$ D$D$<$2XE1ydžt2džx2Edžx2;Et ED$E$^ u dž|2EtD$E$: u |2|$E$ |2LMFEidžt2džx2dž|2Mdžp2EEdžt2džx2dž|2E@tg|$E$ uTx2dž|2EJt|$E$ u x2dž|2dž|2E8ENdžt2džx2dž|2ExOAOU[/ 9D7D$E$]US3/ 8E87H$ <7H 47HT 07HX "7Hl X72 p2 t2 x2 |2 2$4P[]U. =8MD7tJX071]ø]fffffffffffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS - M7}ƉDHfx 4 [^_]Ëf=tyfDN4f>tX$]蓢TP.t&ffB9uǀFF [^_]ËEFf\Nu]ED$$]0MME$ ]UMtZf@f@@ f@@f@@]\]X ]]9Eu] $詭$]@J.D$ D$D$ $ȫ $贋] $P$藋UWVS + i5Ɖ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS + 4Eu^.&9t)fxf8u@$9u׋~1$]`9> $]H4$@[^_]UWVS Xt&.&9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS) Ñ3}fǃ  $P.&ffB9uǀ2ǃ ǃ ǃ T2@tL$" =w4D$T$$N2!9u[^_]Í $?$膈US ( Z2E ED7t+2UT$$U(E []ø []UW( 2UM ~*D7t2t _1]É1]UWVS ( ò1D7te3339}}<31 [^_]à D$$‹3t333뱸빋3L$PT$$ 33]\33u-U 9' 0ED7t%2UT$$1ɋUE]ø]U& 0MD7tJT471]ø]UWVS& \0}<$ƃuOG @tI& 8u?D73t-<7D$87$Htǀ3[^_]UWVS 8& /EUD72E, EE$3= %y   fǃ  LNfu f9q  fmffjMUU$) E$mE@ @ME@ M  %y   LNf    yt鋓  9f  y [^_]ËE$Ot3E$8=DEMR [^_]ÃUfB   9|, <  9f  [^_]Ë %y  ; fǃ  Eu-E$E@ @aσufF 47Q)=  Ef` [^_]ÿ@J.D$ D$ D$ $蝢 $艂UWVS" [,uD7MqV8у$2c33`B.M MEt\7E%F8V<t|‹FLJ3}9t:ǂ3)EEEEEEl D$}܉|$$B ǃ EOD$$U  ǃ  USk  t[]ÍOD$$  ǃ []US  u[]Ë D$$躽 ǃ []US$ z t$[]Í)EEEEEEl D$ED$$ ǃ $[]US$Z  $[]ÍED$D$$躾 l 9Et $[]D$l D$$耾 1UWVS4 ÂD73;3@fT$$(   yP7B$,oD$D$ HQT$PT$@$詧7@|U:E؉D$D$ $cUԋ@t A:zUԋ}؉|$D$$+|$D$Uԋ@X$ @$軋 D$ D$D$@$ǀ343@fuT$D$$4[^_]7@|:M"E܉D$D$$x l 9E P7R뒸 D$$d ǃ  |14[^_]:MvUԋM؉L$D$8$Uԋ@YD$l D$$謻 CUWVS, ã EEEE uԉt$}|$$`EEEED$|$$`D$$aD73tD$t$$W`,[^_]5  D73tUS õ D73u-3@fuT$$f []øUS ] D73@fuT$D$$ []USi  D743@fuT$$ɒ []>US  E U7RtI|t7:T$D$$AD7ǀ3@$ 1 []Ëxt:T$D$$D7ǀ3@$蚇 뵸 []UWVS T ED72tQun7@@tt\ǂ2:T$D$$`@$ [^_]7@t ǂ2뮿 [^_]7@tǂ2{U{ $D72$]ffffffffUS]E  }t J;}R ;~[]ÃUWVS ð}tG8 u^@u[^_]ÍtG~W,EO(G\p;}@ ;~9Uu׋u멉<$G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U091[^_]É봸USEt=H~6X,1".&.&.&9t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًU-9u1[^_]øUWVS}] UG9)9i4utU}t]G,E] Eu pW(9|_9}W(p 9 _9} E E;E 1[^_]É듋uW,G(D$OL$$D9UED$ PT$D$$]UWVS}G~EW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]ta{tZO~[w,1 t&9tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]ffffffffUWVS cЍR4ր33V,U39VG8 L4U;W81҅ZE1EEEEẺEUMD>EED$D$ E3@@D$UT$M $mV,UD>Mȉ$xUV,E3EEE;4ML$ T$D$E$7ED>$TxEENjE94~-D>D$E$5dEE94ӋUЁĄ[^_]Ã4$ D$t$ ED$D$<$‰ЁĄ[^_]ËED$ T$D$E$ED2Mt$ D$BD$$D$M2$P‰ЁĄ[^_]úsUWVS8W ƉEЉU̍R4Eԋ4}8<$ ƀ?EEE4E؍EE'E$vM9Er;UU)ր?Et)E؉D$ t$|$E܉$tEy8[^_]Ë}ԋGu܍WMtFȉ׋uԋ6tftE‹u)uƋ@tQuEt}|$D$ $U} UEЀ4SŨ8[^_] EԍPMtыujuE)ƋEԍPCt$D$ $U} U)u}E)9s뷋E9r7EԍP9UtU?$9Uu~X24H90t…#ȋH90utJ$`2UWVS xlj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$,UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS ÏƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u;u?uGt7@@8tf@1[^_]Ãf@t4$t4$미[^_]US NMU L7t%t X@t @@f%f1[]ø[]UY UL7M u]_]U- UL7M u]]UVS ¨E L72Uu0ÁE% úډ1[^]ø[^]US NUL7M u8tHX2H@H@[[8u1[] ʉP@[]UF L7U]SU( L7U]UVS îL70tFFX2@Ttf@4$4$7@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]i]UEU Mu]5]USEUu2U Á ӺEڋE 1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]aUVSL utFFX2@Ttf@4$+4$7@@8tf@U 1[^] 7PT1 t t t@t̀t(t t8t ttLt 1 7PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS  çu4$ D$t$L7$H [^]UVS ju 4$襃 D$t$E$ [^]UWVS 1uE L7:x<ut&.&9t<uЉD$t$<$ [^_]É4$! UWVS }L70E D$ED$4$|t<$݂ D$|$4$K [^_]UWVS ku}ED$E D$4$'t<$舂 D$|$4$ [^_]UWVSq }uL7E D$ED$$UǍt/Ux0u 9t<uƉt$|$$ [^_]ÉU<$ ƋUt$|$$W UWVS }}uED$E D$E$6tAxEut&.&9t<uƉt$|$E$ [^_]É<$N UVS N u Ex8u9t<uЉD$t$E$| [^]É4$ ffffffUWVSH Æ}EUċEG,4@4E@U {}X E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$藼uH[^_]à zE1H[^_]É$V'EEFEȅE@$VEyEGM+M9E O(U @9~F t$vhF E@ffO@EE %WHUUȁ ‰ЋM ȉFEfFE@EȃvA}$RJMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$gG UMȋE@A%GGfGfwu}G9uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$HjMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$B%UčJ‰Uĉy19uĉ)UBHFBLfFMEy19E0B,4v4BDfFt$B|U$du 4M$zSE u E;GTuO,u u6uč @4PA!EE;GTG8 <$<$2 EE EOT9E M MO(ʋH98OU9U+GHFGLfFfFUO9{UGDt$G|$jcu2 ȅM cUuUȋu6O, 4I49~X}uEFDfG|$F|$bFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 @!78u E<$GG8 <$gEuĉ׉EċE MO(@9/(E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM EG8 3E RW9)ʍBE <$9ENG8 <$n[tUWVS 8uE0E,EP@,Dt@ 1H4 L70E D$ED$4$t&D$D$ ED$ED$4$[^] ˆL7t<7R8tt H@Ëuø /L7t"7Rt`@øUL Et97R8ttH@]Ëu]U ˜Et#7Rt`@]ø] \L7t=PX2R(tt H@ËuøZ L7t @@øUEt:PX2R(ttH@]Ëu]UEt@@]ø]ÐUWVS fuF8 4$lj4$ED$FPD$4$|D$4$cUT$|$4$|P7;0t 1[^_]$ z!78uFָ[^_]U UM L7tx;H}9~ PPHT1]ø] yL7tUHPU PTE 1]øUWVS =u} F8 u 1[^_]É4$E4$ED$FPD$4${߉|$4$*ML$UT$4${P790u$ y!78uFx[^_]U {UT$L7$]UEU Mtx9H~9~ PPHT1]ø]UEtHPU PTE1]ø]Z 7@t 1, 7@t 1UWVS( EUE u79}tP79zH}z}JP9krT9`N)9c\]u܍D;9u׋WE1MfFM9yA,U[4ADEFFfFt$A|M$]Uu([^_]؉9BT9H)9)Ɖu9EMAIB[ωރtftEEE}9B,}4!}#zuŋJ)9q)؉E9E]u=[BI߉΃sEtftzmEm9FB,M4!]؋#zu띉ϋMG9 u9|-׋GD$ D$t$<$]C9w~׉BtU$]U$]1)J)9A:0UM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]OSucE9EuM܉r9M׋GD$ D$t$<$] 9uuE:fS 4fU 5UT$L7$m]ÐUWVSE89tp@EOE)w~TEP,G(UW,΋M4}.&.&y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS$ ø}GDEP798 GH%EWUG,E40UutWUыpG9UfFE9svffEF%M ȉFt$G|$cPu¸$[^_]ËOU9~VUEEGGED01E_GD$ ED$ED$<$<$ӿ1$[^_]EUǽ pL7$]fUS誽 KE]  *t&t A  1[]øUVSu^(~^F,11҃} <.&.&D,~9u[^]Ð.&9tD,y)9u[^]1ɉ[^]UWVS0ۼ ÀEH,87E  E1<7EMED$D$D$D$ D$L$ME$t#UB UUB(ҋM~CMM L$$Vt=9 ~#tyمjE)c)Mǃ 10[^_]UWVSϻ t}W$G(E1Uv.&9w(~hD,tO L$y؉D$D0$uED,yD$UЉD$D0$P tD,E9w(E[^_]EyUWVS ï}G(~"1D0$־D0$$9w([^_]UWVSɺ ju 1~M1$v.&.&.&9t% 9 uDŽ 9uۉ[^_]ffffffUWVS A ]ƉE׉UM$FM ]EPt MA +B A(EEuFF]^]^FT4$] 1ۋN]uF,MzF@1ɉU܉fGU9VUGfGFD$]8G |$F|$=Ku [^_]ËEED$E@,$]i3tыuF,U)D$F0$]>3tF0V]K +J K( <K,[+ZR,UʉUf.&.&rprpP 9MuԋEqU܋zUED$<$]ZLUBEE9F~EP1 [^_]ËVE}ǍD$uF4$]92ÅF4F0V, M܉ً]Ӊ]ut&.&.&.&HXXXX @x9UuҋEo];90G EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS蝶 FE]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$EP791[^_]C:}87P79H79L79S9M 9u M S E<789E9EE)Dž#EH7tS} x }x$}u UM su 9+E<78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1UV E~M ~D79B$t ]1]ËE 9B ]UWVS òUE D7Ex$9}iP7P H4 9uogH$p <19} KCJpH7P H4 9u91H$p <19}  &D$E$u)L7P H< 9H$p <19} E}x$} x 87}:<7} :2u $vt@:u$vuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )8)UWVS ðED7ǂ3~aM ~Z;B$t_M L$$D$P7$t [^_]ËE D$$o$1[^_]ËJ 9M uUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS Ê}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$F|$4$D$<$̵1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8t @P81]Ã⿉P81]ffffffffffffffffffUWVS } &E} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]/CFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HMJ$x9MtH}9űMQ ztQuut duH8 uX8J$UWVS(8 ݷEUMia$S#ƅIǀǀǀE܉$#EF,D$E$&ljF0EF4EFXFF]^EF^ F$EFE F F8F8~xfHf@fuEfx~OE@uFE@#h2u 7:tx}$K t$KutE1[^_]f~E@tfx~݋E@uD7{uGm뱅t}$K u%D$P7$G}$J QiUEPT$ PT$P T$P$11^]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]z뭉U델[^_]UWVS% ʞP7@@Mt7J y :ED$D$7@$,]A@7#A@t2ED$D$@$\B@7#B@~ED$D$@T$\A@7#A@7t $E[^_]uX~t7:ETt:D$D$BL$-\`@7:EfED$D$@L$[`@77[^_]7:EUWVSC ؜uEӉ΋}$EP, 9u;u t5 D$E D$ |$t$$]K6[^_]èuUWVSĀ賒 \ED7Eԋ3 ]P7]JxV HJHUE@8@u B8@] B@ ]:t$D$7E@@D$ZEԋ@@H D$u4$]蕗f8E@PhtzEԋs]sEX78 S,11.&.&.&ȋ ˃9|u 9F Eԋs/E@ Eԋs} EH P,CEfEE}Ǽ7}]qM I, 9quV2xH uV p92fEuu؋sU;z)R,M<} :MMUQыP,UMUhyEE  EuFD]䉃  FH fǃ   ED$F|$#"iFLf FHEċEԋM؅~E@,}D8uF,}8E̋@E;F\E̋@ EЅI}9|GEЋCEE@,]] R]܋]̋[UЍ.&A@uUEPrLuȅ]URu72@ x]9]ΉMEu FuE܉D$4$]u (]ԋHP}|$E؉$E[E؉C{9}(UEH}ȅt}9}E}89^y1ۋE<9|"E@EčPE9E9U܉bƋUԋSuE܋U9}|:}EcUċE܉D$4$]UCEԋ}U9{tSEM9Hb{E<79UR zsC}]9]EԋEP:xE@EH u;F}F(9~E 3tEu;Cw|MȉE3Fu)F)Ǎ)ƅ~ED$4$]utʋMȉ}yEE@@LEEԋHE@8ZZE8tE]D9FEP]9ډUMUȉ$]6 EMЉÉ؉؍][ )؋])9EUr8^y1ۋE<9U܉[^_]ËE7E}G}WX@#h2t $0]:D$D$Eȉ$SEԋ}uW PEw P,u2 R4UE9x]DFfFt$D U$!UDfF4E9u]䍃{tD$ XD$D$rD $> E@ xkE}G}WX@#h2Et @@D$$];[EH7EE@9SD$$]EԋCB[EEEE܋E;E^]9]#}E܉D$4$]$FNj]ԋSuEƋE9~@9M9CSD$$EEԋKiSKD$B$EEԋCCEfED$D$E$]JEԋCEaEԋsSE@9(EPSP$#]7Eԋ@$a ؃[^_]Ëx}HJHw1 ;G}7ƋW,tGD$BU$]UB;G|ɋELME@8s ?9FEЋEP z@tP ]ЅN[]̅  MċEËM)ˉ]D$\$ ]؉\$D$$]g*U܉M*D$E)ȉD$ u؉t$EȉD$4$]%*EE@ ẺD$$]s:t$D$$N1ҋE]E܋E@vE}E;xEԋuFECFCEԋXE7E@Ph E@E$]SK}GD$G$Q+]GEԋE`8@@$]R$$ ]8EH7E̋QY,E1ލ4}R,z9~uLIR~1ME܉]9uT$U<$]EUuՋE܉EűQpY,ЃE u؋E<}܋4;aUR,:z9~_y}R~}419uT$U<$]UuՋu؋E̋Y,QB}9~E@@%E9u~_})E1U܉M0E؋@D%EU׍FUM9ƋPB%M9uU}}E)Dž]9E̋EًU)E9EEE}ӉʋuEEȋE}EЉ]uċ]9]MEȉE܋ZE@,u܋xB,p1҉]M؉M9}L$M4$]<uՋM؋E̋]9]EEEȃE]9\]EE90}уAy9E@uԋsEErE̋Y,E܋4mEpuE܋]؋}̋q,"XQ9M$eE@8MEԋPuFD$FE܃$M:U܉TEK]CD$C$ESPSPM؋E̋EuЉ9}9}}z}ӋBM!EuȉuȉM}ӋB9E܋u9~EEBDu9, tT, #FfFEBLfF9t!BDt$B|$]@u E̋sE;  [?1ɍ, UL$D$ <$]U€w֍V)ƉL$D$<$]eljEЋE̋@  $ EȉEu9~uE})E؋u])؃EEH,E9w]]]E})uu]9}u܉1}9| u9}9}9}E؅,9E܋u9pwE䍐, E̋@=vm EĉEE܋Hىωָ tftEĀEā =wEဃ)ȋ}܋OωփtftE܋uЉpE̋BD$ D$ED$$] AE؉uE\U܉uk|nd`t$D$$]EDd]:t$D$$Ed vMċ]CED$D$ E؉D$\$$]o U܉M2D$E)ȉD$ u؉t$EȉD$4$]- EE@/]:L$MD$$DU܉lE܋M؉L$D$E@$DBE}̋R, }9}uE]E@,E]EE9E|EH,EE}؅'E@}ԋsE؋}9Ef r uv'E܋HE̋@1Et$qt$ $] W9}u܋]䍓, T$UċE܋@$ U(fv[1ɋE䍸, E䋀$ EEpu@E܋}ȋE)NjE@X0ppuCdD}uNű;JH ED$ut$$]g:t$D$$]BD$D$ D$M܉L$M $@t$D$M@@p$BD$D$ ED$D$$M@i|$$ft$1|$$AE̋@D$D$}@@0$]ft$D$$tAD$D$ D$D$E$Vt$D$@@p$-AD$E܉D$ ED$D$$t u]D$1D$ ED$E܉D$E$]1:U؉t$D$E@$]y@U؃9u1҉Ut$D$E@H$]@@U9u|D$1ۉ\$ ED$E܉D$E$]|$E@$d:t$D$$?E)ED$D$ D$D$E$]E@|$$dt$D$$h?D$E܉D$ ED$D$E؉$]4Hu }k D$1D$ ED$E܉D$E$]1:U؉t$D$E@H$]>U؃9u 1E@Ut$D$$]>U9u HH`ppu;t#t}uNű;JXLJED$ED$$]b:t$D$$=D$D$ D$M܉L$M $t$D$M@@p${=D$D$ ED$D$$]M@}؉|$$]8bt$1|$$=E̋@D$D$}@@0$]at$D$$<D$D$ D$D$E\uD>ED$D$ D$E܉D$E$]E@t ]̋ ;qtE؉D$$]Na:t$D$$$<D$D$ ED$D$EЉ$]E@E؉D$$`:T$D$$;D$E܉D$ ED$D$E$]SE:Ủt$D$E@$]D;Ũup jE:t$D$E@$]:u2L# E̋u;p E:Ủt$D$E@L$]:Ũu`D$D$ ED$E܉D$E$]e|$E@L#t$D$E@L$]:uUWVSq 6{]D719X‰PtFC:uk11ɋCD$ CD$C D$C$ptB[^_][C9uP7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]Up izL7$]UWVSp Bzu] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$u>tF9u+P7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSo Ëyut$U$vu[^]UWVSo Xy}GDEP798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$VtD$D$<$$1EUvn xL7$]fffffffffUEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSm ÕwU} w ty1 f.&t6~RutF$Hu1[^_]ÉU$t8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJU @ E]UVSm çvutv$u[^]UWVS l tvMq~X1Q,zQ~>1҉EM׋q tMv$1uME9xԋEM9A [^_]ffffffffUS] t[UӋE+v.&.&.&.&.& ȉt %1ȃ9u[]ËE[]UWVS]} 1115.t&.&.&.&.&.&.& ȉt %1ȃu1&.&.&Lȉt %1ȃuڋK tBu1ҍ.&4Ɓt %1uۋIuċu9 [^_]1[^_]USj YtE t$D$ $}x) 1[]É$91[]øUWVS4Xj sU܉   E苃 E7E@E@pE؅"7EE싳 tRyF%y }93}Ѕy}Ћ})щ})9uM)9IBljы U)y<93}}Ѕ}}A87L9+~ EЅD$D$E$m1ǃ  EE1ҋ u}u!7E8 ; |~)EЋEHAE̅q}؃E9|9;T$D$Ẻ$0E@p ǃ ; QuJ `7lT$D$$i0 E8uuE@@l8 } ; MJ Alu  D$ <$l…y )Љ m t}艻 u䉳 4[^_]ËE1"7EEU苳 u}4y yFȉE!7E8`7)}ЋEHAE̅ ; }tM؃99R D$  $J) ǃ  ; y E 9U Ǎ"t$D$$\. ; ~a x E@@xu XD$<$y)  ;  ? t$D$E@$-  ;  uԀ> u)ʃ<7E EԍEișǍry )ƋE9E@M؉L$D$$,  EE89~1$ & _$U ;  P7uR,r@E؍ E0   } [9 EP, 4v4~}}܅uE@}؉|$D$$+  y}9D$D$E؉$+ǃ ǃ UN;H@uRFuLf~-$^ D$ D$F $V fI E@$ =   tD$ Eԉ$9…y )Љ 늋@lT$D$$v*  E9 ȉljM$ gf t'D$ Eԉ$y) $ Aǃ  D$  $.y) ! E)ȃ9E@D$D$$F) 9  Ǎ"t$D$$ ) ; ~b E@@xuƋ t2D$<$Oy) $ 4$됉Ƌ  t*D$  $y) $  E1UWVS _ diE苃 <7M19|    9 87E79 9`7E:E)$ Eu ǃ E98.@@ltˋM t‹UT$D$$J'뵉  PBh9}d T$t$$ LƅtDE; t4$x U :D$D$4$&uU1    [^_]Ë `7Eu@@h9ME4M䉋 E;0 GE  7p >u~x`7U:t$D$$%mtGUt @@tut$D$$%@@lu$ mu ǃ 87E 9P))Ή  $ 둋 xǃ U\ afU U U  U 11]U|\ %fU U U  U E1]ffffffffffffffUWVS-\ e%D72H7EP7]19u9uVF,E1҉MEF~`CH1U.&.&9F~59uuS9~S 9}͉9FˋU9VMIS[^_]Ë]S~Cs, 9tɅ~UMڋXCӉu.t&.&.&.&΁9u9uu9u_Z ?d7BH8~NHD~GBlthtËuu拐tt 1)Z c7@ xUWVS$Z cƉEY7EBH8ˁ=u,7}@D-=}(7LJ D7Y\A`fAdBt%]:D$D$ $!EBt8]:D$D$ $!P7p2!P@EBlhzǁl2ǁh2BxT2@@Tth2t h2t h2t h2 t h2 @t h2@t h2t h2E[A\sfǁrǁt5Wfǁ~ǁ;fǁǁfǁǁfǁǁfǁǁ|fǁǁt[tfǁǁ~>Rr&.&ff@f@@ 9uǁp"ǁt"~@p"p".&.&.&ff@@9u}싇 %ȋtp"xt"LJ LJ 2H7EP7E ItiE9tE9tE싘 ZHB~&zr,EEz9uuMD$$]R[MIu1$[^_]ø(7ˋtiǁl2w}UM܋HQf.&% ؉9u9ut͋UMD,7놋tǁl2]tOǁl2[UWVS_T ^EM ]fMf]f_(7;7Nftv,7969+D7l2tot"уt>]f9p"t"]fp"]fr"1[^_]Ét"ufp"ufr"ft|WfffufEftoEft\fYfEN}f9r"at"yfufEffEfEfEfEfEu%UVSR m\EM ]fD7;B`N4f1Dfl2t1[^]ft_/ftMfufft2#ftEfuffuffufffff끸yUWVSQ Ï[EM MMUUfD76;F\<@<UfrftMfv7? tV2vtCL$҉T$ UT$D$4$>:T$D$$1[^_]øU Q ZEfx?D7;B\}1@rU f tUf vEf1]ø]P hZD7ǀtǀx(7 t% ǂp"ǂt" u1U勀 %1]UWVS;P Y}M D7l2t^ftfvǀx(7 t) fp"fr"ǂt" uI1[^_]fPfftifuft_Bfthfj` %=1[^_]fuf/%뛻늻O XD7h2UVS N áXD7l2tt f@d [^]7Rt:D$D$$ 7M!A@f@d [^]UWVSwN X tP7} 3x@tOu fD7f9pdt6l2t3P7fpdQ@E % ЉA@[^_]΍N} f_f|SP7UL$2@l$,;:L$D$$UUULf`L$2@h΍N} ff|P7UL$2@$::L$D$$nUUULfL$2@t$J::L$D$$ UUP7$UM fxGUP7$fUM fLL UD7f@dUWVS.L UUD7pFFy ;F|# tH4$ [^_]Ét$$\UWVSK nUUu FFy ;F|# tH4$ [^_]Ét$$UWVSlK UD7x|$E$XƉ<$l [^_]UWVS*K T} |$E$Ɖ<$2 [^_]UWVSJ TUL7tX } xQH9M IX9}Bxp,9!39M t' u pP1[^_]Ë#39M uك׸[^_]UWVSEM UtY xSpu9|Ip9~BXx,9!4>9Ut'PH1[^_]Ë4&4>9Uuك׸[^_]UWVS UztzB EBE wGGtXNjEB_ ])؉ƋEBWU)Љ xыOM9NjO9}_W,9~ ! U9u뗃 [^_]ffffffffffUWVS@=I RE}E E EE E @$]ÅGE؋E @ uWUXts E07E_E))9~ىL$ED$<$]؃@[^_]à u:G1@[^_]ûkEGy1Gڸ@[^_]ËG,M؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9rTU).&.&.&.&.&AFAFA F AF9sڋUB E H %BfZE @E܃vKMȉ]ĉ}}$]cM \_ XG 9uuϋMȋ]ċ}EԃUt3uމr}ߐ)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]{L<$OH<$]7E9GTG8 <$]h~E D$<$], MԋUЉE E9-]ȉMĉ:BD|$B|U$]|UBHGfG9}s*w tUv$]8uUG 뜋]ȉMĉUcE  OUT$L7$]UWVS 9E Nu}ED$E D$4$t} u [^_] [^_]UWVS D ÊNuL78E D$ED$<$Atu } [^_]X [^_]fffffUWVS|}D &NEMu ME $]6EMqM$]lEEÉEMAEȋQUċE @U zދ]07]t_ @ U$ ]ÅyEEę)EEĉEċuMqQ)փE9yUċAEȋE uEE07EEkEĉEE U rUUEσ tu[ $ ]yEEę)E]É]EE E  uFE EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9wU@t)G$fE9rFUv.&.&.&GFGFG F GF9sڋEȋUUċuV}ỦUUĉUUȉUUUu΋^,EEEF@ED$ED$ED$ ED$ED$4$]yE_mEąy1EċG$]y)E'<9}U&FHGGfGfG9}FD|$F|$]uE$]6|[^_]ËyQUEĉAEȉA $]AMyUQE9ATt/EȃE ]u#}5E $]EvMNjEEEEE}MEqE$]聻FU = oGU T$UT$L7$]UWVS= :GuEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U = FD$UT$L7$a]UWVS < ÃFu}ED$E D$4$?tE} u [^_] [^_]UWVS< (FEE}L70E D$ED$4$t}EE u[^_][^_]UWVS < EuL78E D$ED$<$ztEu } [^_]J [^_]ffffffffffffffffffffffffffffffUWVS; &EÉUMR.ljEDWp1҉]=.t&.&.&.&.&.&.&.&]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(E: CEUM؋ufUވM݋U 1ɋU EEԋ}R.Et$$UEx}P$u܀G$R Ut}EMU E‹E Et~MލAf qCXЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wCXDž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS18 AUE t\J;A t];tUZ {$u_Z[pۋtC R(D$ t$D$$b1[^]ûu11U7 /A  D$ ED$E D$E$1]U<7 @  D$ D$D$E$1]fffffffUWVS6 @ÉU:GEG<\<^ЍtR.z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PR. Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVS. Õ87t t~9t $Q EED$D$E $!uI tG@t  Ğ7  @x [^]É댋E[^]É @uUWVS(%. 7UEtBEE7u4$ UT$ D$D$4$bM踵N)‰)`EีNe)‹E)`Egҍ)nUD$4$F ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$ UuG([^_]1([^_]ËH n([^_]UWVS(, o6UEtBEE7Eu4$ UT$ D$D$4$}kLЍB)L`E܉eЍBE)L`E>)<;lmD$4$ ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$ MuՋGy([^_]Ë;pm@x([^_]UWVS(i+ 5UEtBEE7E܋{u4$ UT$ D$D$4$裴}-?L) RЍ)Ѝ ZGEeE)  IȍE) GE*SRЍ)<; aD$4$h E܋;aAQ tUy$E܉uv.&9t(~suED$$ uދF E܃9u؋E܅tЉ)43lmD$E$ jEOMEuu4$ UĉT$ D$D$u4$TuĹ-?L) @)Ѝ ZFUeȋE) @E)4FU։*SRЍ)43 aD$E$ }tux}cur}ul`GEEt}fOMrBEER3n$AE'u땋3pm$B3a$pCk}t EE$UWVSA# ,E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىUi Uƍp@Hπwx9}몋E D뛉U) UUWVS" ,084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0gt,8C,{0K44y0q 1[^_]Ë0 8a$08 t@0@4$0踕8G,tG0ƅ`%0R. 1Dž$Dž(Dža`,4:~Jwɋ0oʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0 pV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0qው,4O&4PD]Em PUT$,0 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$0yF8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0Å8X,4H0@44,-0 1s0 ,40 ,1!4e0 1,40 14c,0_ 14,,09 ,&Gwҋtr1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]UX U|]UWVS> }u >}0D$$M+D$t$$`‹U$4UtUuE2$ƅ_EE[^_]Ë}ut$ D$$M$E2@ x tbMut$tD$$EQ D$$$ Ex tUE9ED$D$ht@E$o tEftUft IA(Q|uEt E1$t!D$D$$=RB($\tD$D$$ RB끍h D$$} D$$_t$tD$$EtD$$/UVSq EtD$ E D$ED$E$ƋEt$0[^]ffffUWVS öƉEωD$$ tB4$ո ƀ?u1)9tXzzt"D$|<$m …uۉ<$蟸 9t 1[^_]Ét$ED$<$6 [^_]ÉUt$ED$<$5 Uu[^_]UWVS$U uEUt E<t] $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%]ˆ]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]'ljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$xmUu$pEE܃@[^_]ËMAOMփ_EtfEtǤ$jpE܉$_pEP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$soEp@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMxn 11EMIuE4$WnE܃@[^_]px11Eu؉4$*nѨu2u>Mu$IEUw r}fm밍u$ E0UUWVS àUJEtB9swt$U$&jUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$pdU[EfUWVS ÓuVzF9sHtT|$$$it8~VM f FHNMLF [^_]Ëu1[^_]É<$cUWVSTd  ED$,E$6 D$|$]a: xD$|4$]l HM4$] =M t<$͗ = E$]贗 =n D$$P]fÉE@ t$$Ut E t E D$,E$*E, EEER.EȋEE u<.tk)ύ)ȍD$4$ t [^_]U £E=w ̛]1]UWVS uu4$谉 UT$ D$D$4$5i}-?L) RЍ)Ѝ̔GEeE)  IȍE) GE*S)ύɍ̛D$4$ t [^_]fffUWVS4 ÆufF(}ȉ|$$Rq t4[^_]É<$PM1".&.&.&t9ufV(4[^_]UWVSd u   ƞ7fV EĞ7 4$&V(EfD$FD$  $U蜦=UwDE |)ʉM싆t7T$UD$E$[U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$Ğ7[^_]ËUыU|UVS ÿutgF$ZF$ZF$ZF $ZF$$}ZF,$rZ4$jZ9  t 1[^]ǃ  ?  @ +  @tÍpffffffffffffffUWVSA lj$U D$$ Et$UT$U$:9UuED$$ 術 1[^_]ÉUED$$ 聓 $<UD$<UD UWVSdf 9EEEEƍEE> tqE9D$t$U$:Utˋ$ <$;UDŽa 8Euu>vt1< tHv0FFU$;$;UDŽUWVS< g9U1ҍ Ӭt"u Džguԉ@!&.&O@6ƒ:uƅ/nFu$W>$8<( .Ɖ$9D$v9t$t$ LD$D$o4$x@E+<[^_]rD$@|$/$r:tW.&P:uVpƅ끋1$a8Ɖ$p;Ɖ$?8D$-8$!8D$/;$8D$7賢$苣趢$8tv$ƅD$/4$/tY1ɉL$CT$/T$CT$ |$D$4$t$}vD$$h1҉T$CT$ |$D$4$u빉ogvIUWVS Õu}D$:4$T t!D$cT$$ t|$E D$4$5 [^_]ËU t考 [^_]UVS m uD$:4$T t!D$cT$$d tE D$4$q [^]U ¶Ewt ]1]ì]UWVSh rEu 9M9}xUED$ vD$D$@U$U<UƒE9~ЉEΉ )t$|$ʉUM$3MUӉϋʉU$4uD$4UDM !}|$t$$~3uU+u h[^_]ËEUWVS`c EM 97upUMED$ vD$D$@U$UF;UD$$ 衊 EED$ML$ED$i1;EUT$$ u>i %!`ut$L$$'1U+uW`[^_]+ U$_3ED$P3UED跌 CUWVS` êEU97t$\pwbtNT$E UD$ T$vD$D$@T$$T$9T$Mt>$uT$ U MT$L$$jk L$\+u`[^_]ø{UWVS = Exw|Mt_TƃtAƍU$1ED$1UED [^_]Ãu$1Ɖ [^_]UWVSp 3}EU 9u]]p3MmLm8@EEߺ81tEI}E )|$t$ʉUM$]~/MUЉ΋ʉU$]0}D$r0UD܉ !\$T$$]h ]U+p[^_]ê0f%CD$D$ ]iD$D$@}<$ 7mo8뎉f>~%E~LSC9u1Yf7k]  ]uUS9 EPw*Ӑt諈 -[]ÃӬu$'2[]US ÉEPw*ӐtV -[]ÃӬuU T$$ ` []UVS ,uD$:4$L t!D$cT$$~x tE D$4$ [^] - [^]UVS  ôuD$:4$K t!D$cT$$x tE D$D$4$, [^]ËE D$D$4$ [^]US .EMPw*Ӑt - []ÃӬuL$U T$$, []US& UBwÐt1[]Ãìu$^ []UVS ÃuD$:4$vJ t!D$cT$$v tE D$4$ [^] - [^]ffffffffffffffffffUWVS Q uE1ҋEL xtGEljу1Uvt 2uU@u [^_]UWVSĀ a}E|9xƋE pLA EL1 E|1E]ELI Eƒx  EB A ǁE9uʋE%u   EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËUL 1ۍ UL @tBEtʍЉʍI$ wu1묋}LA E@1ۍEL1 EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }C\uEL^@]񍘌1҃DD  u̓E9uEL- :*.&@t$ELDu۸@u܋}L ƇL }8LT 8L 0u}L ], ]Ec M{ }~Et M  ЋU 1ҋMDŽ, DŽ0  r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹Elt a1v`,tEUEEt @Eǀ -]UWVS` 3uE EM9ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EEL- EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEE E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋL ]3L ]3L ]3L 3L! 3L" 3L# ]3L$ 1EEԋL% ]3L& ]3L' ]3L( 3L) 3L* 3L+ ]3L, 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}uL u3L u1E䋼L% u3L& E1ljE3L 3L' 3L 3L( 3L! 3L) 3L" 3L* 3L# 3L+ 3L$ E3L, }m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1L E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEE$ UWVSP轿 fEЋ}] ]9EƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍv]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝ, }}̍?tLD$ D$\$$.t&Ҁ09u$?uE]Ј, E؃0 , }EủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝ1 ]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍvN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍD ${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]/UWVS E9EEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]UWVS,k E؋U9E]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSD艹 2U uU9‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$: @D$$  @D $9sӉ t׉D$@BD$ <$L$  $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$譻D$$葻(D$$P4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$vtD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*|UWVSC Eu 9E1D$D$LI $iDžDž4$8$u vt$4$Ɖ$i^ DžD$$8vu[x=uUT$$l D$$: DžDžDž DžDž,h|$4$-pt5tmuIT$$x'멍T$$ye뇋$01U+Ĭ[^_]ÍT$$.x+t$v$^ uDž't$v$k^ DžOD$$ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$t*D$ 8D$D$p$$ .[4$NZ |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$D$D$p$)$&D$vD$@J.$7(UVS Ðuv$H‰)Ѓ[^]øh`UWVS4襮 NÉED$vut$u 4$Y u3D$ ED$$EE8$E $]豳h`)‰UE E h`9t$u+E E܋E$]W NjED$ut$u t$u܉t$ vD$D$blK E$LK t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃vD$D$b}<$WU^D$O O ȉD$$EPU9uD$]^K _K  LK ȉD$$dEPU@D$D$4$E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVS賧 H9ЍPH USM HvH?aЈ>D̯f`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂ L $2?ƂL aD L Ƅ L $,T$ vT$D$$7H4$tI `D$HD$T$14U+[^_]Íxƅ?n)nOPEȉHTDUWVS虞 >u(} 9E14$UH $?$u 1H t $t9u틽)x  @4$$D$(|$4$ D$vD$4$T$|$4$}<$T$D$(L$<$T$T$<$$D$(L$<$v|$0, $}$lj~T$,D$4$&Dž0Dž4Dž8Dž<$D$#,D$<$u։fǃL $1ƃL $ D$D$L $ dD$xvD$ B$et$,$m1<$ʉ)Ѹ%I$))Љ)‰ ;$D$(D$<$ ɋoD$,D$<$|$,$:L 򉓌L D$06 < ȉD$$L L D$17 = ȉD$$L L D$28 > ȉD$$TL L D$39 ? ȉD$$L L D$4: 5 ȉD$$L L D$;T$$L PL @D$D$,$(E+[^_]D$,D$<$ ɋ$D$(D$<$l|$,$y$D$(D$<$6p D$D$<$ ;$D$(D$<$[ D$D$<$ &(D$<$$Dž0Dž4Dž8Dž<Dž Dž Dž+ffffffUWVSڗ MMUu9ƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$ͯD$@|$<$0E D$D$<$|$$,<$耯D$@t$<$D$t$<$ϯ|$4$E+[^_]Éu4$ UT$L$4$qt$4$膱Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfffffffffffUWVS術 FutJD$ED$4$NjE9t58u0M 8"tE 81[^_]ÃuE M UVS4 ͜EU ]~<Ílt&.&.&.&у? H9u[^]UVSג pEU ]~Í у? H9u[^]fffUWVS8聒 &ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$et8[^_]É<$uEĉ|$4$2Eă8[^_]Uܑ }Et'tu-E t: w]ËE t#v]ËM t w]1]Ív]Ív]Ív]UWVSj u} 4$uw[^_][^_]UWVSd" ǚu}$}(E($IEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$<<$ UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$5UtE(D$}<$ E0D$E,$ <$4 jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVS覌 Ku4$u1҉[^][^]UVSn u4$u[^][^]UVS3 ؕu4$Zu[^]}[^]UWVS Ü}u <$…uL}wPU>…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSXk M $C5 ƉEE$ljE4$}ƉEE EEEED$ML$}<$/t.1EM $M $4${EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS Þ}u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVS肉 '}u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVS ç}u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úU茈 -E##+ፂw]Í$]Í ]Í ]Í+w]Íx]Íx]Íx]Íx]Íh ]Í ]Í ]Í}x]Í ]Í( ]ÍP ]Íp ]Í?w]ÍRw]Íhw]Í}w]Íw]Íw]Íw]Íw]Íw]Íx]Íx]Í.x]ÍGx]Í`x]Ínx]Í0 ]Íx]Íx]Íy]Íy]UWVS 2 אEwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu$0 tffUS  (U T$D$U$ []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVSE u Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG U܁ UM ̲tt M U],]UWVS4褁 MMU 9ËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&D̲ɋtxD$$̲ҋtFD$4$2Z ̲tt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$T؍ŬUWVS  ,E}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$]' [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0f~ }wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;Hu̲tD$$]E+u <[^_]ËUEU Mt t]%]UWVSXy DuU 9E1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS [ Áeu} FEFED$E$?$ug$E D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=uztUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$t? [^_]øUWVSX Z ðc}EE9UE1D$E$ƋẺ$E]} Kf$OME Eĉ4$ U9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$YUĉT$ D$D$u҉uȉ4$i4$ ‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$qi4$i 9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$h4$ ‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$_h4$W ‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉf賁UMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVSS à]Ѝ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$L$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSLE ßOuE 9U1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFT#rUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVSB 8Llj(UE u9, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(mUWVSdB@ IML$U T$9D$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$yD$T$0s؍D$$B D$0D$ckyD$\$05D$$lD$0tD$cdyD$كh\$0D$$_ D$0&D$c]yD$\$0$D$$2 D$0D$c]yD$كh\$0D$$j D$0D$$h D$0pكp\$0"D$0Iy\$0!D$0yny_كpyyy<-y^\$0Dw!D$0 كl\$0I"D$0yyzكl\$0!D$0Gzyhكl\$0"D$0yjكl\$0ٞ ؃"D$0yDyXyكp\$0[Z!D$0gy&\$0(!D$0Xgynكl\$0!D$0&yy`yكp\$0!D$0nyycكp\$0|!D$0nyzzyكp\$0R4!D$0d`yzzكl\$0"D$0zyy|y\$0!D$0ytكp\$0t!D$0gyكl\$0B"D$0rQy^\$0!D$0By\$0|!D$0zGكp\$0"D$0zcyكl\$0s"D$0XyyLكp\$06"D$0fyكl\$0"D$04yy8ycy:كp\$0V!D$0`y!كpR!D$0\$0x!D$0\$0^!D$0J"D$0zy\$]$$aED$]݃6/!D$0"D$0y"D$0"D$0"D$0|"D$0h"D$0T"D$0@!D$0p,"D$0\"D$0H!D$04]كl\$0$_t E؋$zt كp\$0>~!D$0 "D$0 r!D$06 T"D$06!D$0f !D$0H!D$0* !D$0 6!D$06@ !D$0I!D$0 d"D$0qF!D$0v, (!D$0Xa "D$0:b!D$0!D$0|!D$0g!D$0Nt"D$0V!D$08!D$0h6!D$0J!D$0,!D$0!D$0!D$0,!D$0mf!D$0H"D$0x *!D$0Z !D$0g@J.D$ D$D$%z$ a@J.D$ D$D$z$ڙ@J.t$D$$Nt$ D$D${$藙 @J.D$ D$D$Mz$e@J.D$ D$D$z$3@J.D$ D$ D$ $@J.D$ D$D$*{$Ϙ4@J.D$ D$D$S{$蝘l@J.D$ D$D${$k@J.t$D$$t$ D$D${$(o@J.D$ D$D$z$!D$0@J.D$ D$D$>{$谗5@J.D$ D$D$z$~@J.D$ D$D$tz$L@J.D$ D$D${$@J.D$ D$D$z$]@J.t$D$$\t$ D$D${$襖@J.D$ D$D$bz$s@J.D$ D$D${$A@J.D$ D$D${$@J.D$ D$D$z$ݕ@J.t$D$$Qt$ D$D${$蚕@J.t$D$$t$ D$D${$W@J.D$ D$D$z$%ffD$1ffffffffffffffffffffffffffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS  ]E81}8tmCC tvS(s$taD$D$$ЉƅtoC@8@4?E D$$tt$C($S$C [^]DK$C C(1vиUED$ E D$D$E$]UVSEM t]X tVP$tOPtH;uDB-4?w7t-x:t&(r@1 w#EB?EEE@D$D$$]@UBu܉F0B??E E@}EmEE@N?EP B M}]؋u.t&.&.&Fǃu}M]؉uKwE*]ЍuFPFX lFTF\FG?} mmUԋE@H?}؃ U E܋]ȉX PUԉxu}~<}~@ỦT$lj$]\/ }ȋPU]ԋ@E؋Fߋuԃ(tftE@t E@ >)UUԋExD})щHDE@uFDF:?E@}W$tB}GDG;?uV$tB$uFЍt&(M9}U؋u.t&Fǃ9u}MU؉uffB " f= fuN9}U؉MuԋE).&.&s9u}EEUȋ]4EuFD]FH?.)W,WUUMЉ‰EE!MUЍ D89U\ uuUԉ}}|;v.&.&.&.&.&.&.&BEME!MMȍ MDM9 uu}؉U)11]؋uvFǃuu)ƋE@DCE@ E@ : t$EԉD$UB$]gUB)uuԅRuU؉]ԋE@$t]XE@t @ E@7?11U؋] MU؉]ԋUvm)E]艃{DE@M?UuMU؉]ԋ}EG<0EЍXu܉FE@Q?EuMU؉]ԋ}uVdFh ^`}mw EЍ E@ E@  t$EԉD$UB$]DfUB)uuԅRAE@G?} EEuFHUVLFK?fM9}]؋u7t&.&.&.&Fǃ9u'm)EU艂zD Eǀ@??N}MU؉uԸЋU!Ћ}GDGDU)]$}}M]؋u)&.&Fǃtu[}wr}M]؋u}M]؉uԋ]̉؋u)}G}G E@O?EpEE11]؋uh}]؉uԋu]^DF$tXVt ]C }G9?EEG}M]؉uԸЋu!]CHu)U[EЍ{EPD@B?} EESz@EЍ|]܉CE@Q?EL}M]؉ut }1uF$t @0V EB))9EEЍX>tBO)ڋ]ڋ_ۉD$T$ $]b]CU܉B0S 1 EH];XEЍ}U܉BE@Q?EEE)N9'}U؉MuԋE4.&.&.&s9u{EЍ6|]܉CE@Q?mmUE}ȉU؋uԋ}Q })EM9MBMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋u}~lbuu}؉UԋU}]Zf]m)uUT$UEԉD$uF$]`FUUQfU_EȋU;B4EE1}}!EED$ED$uF$]w`FEЍ{ ։u!މ Mt M9M]]}}؉EEF&puMu!MM΍ MtM9ou]}؉EKEXL@I?E@l@E?1N9{}U؉MuԋE6v.&.&.&s9'uv}ȉU؋uԋ}Q})E_]MU؋uԋUwHEЍQ&].&.&.&fDSt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]rf|U܉BGQ?uE u5UEP$t EE@t @ E@6?11ɋU؋]E@ TfvPEfED$ED$uF$]p]FF7MM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)u}twruԉփRu=E@l@F?XdPhUuEcE@ y%E܋]ȉX ]XUԉ]؉XEUP<]X@E-UUEEyYEX(u@(D$D$$][uFfED$UT$$[FF5?11U؋]]]EEx@O?]Yf]^}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$] UM|]܉CGQ?pmEUB(uJJ(vLmEЍ|-EfED$ED$uF$]ZFw9ȐruF1ɉNL$L$ $]aFU܉B0eF??1҉UAE]ԋEЍ-}]}GpGTG\L$G\D$T$ GhD$GdƉt$$]V |U܉BGQ?;f tURGmm1EĉUeE@=?11ɋU؋]E@O?UVS]iu9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0t?t*U UMu[F [^_]=>?u>D$D$$^ML$M L$$t^9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ EԋMM9E܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$IExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffffffUWVS cuMx11D rt"E pt&.&fDU9ux.t&fG0UofxZUWVS4 ~}̉ÉEЋ@,E܋{t-Ek@^S,sutftߤEw uEH,@lu6^};s9sӅz}G8‰ىuFl؉Flv,)9_ʋ}?EE؋})EE@,u~89Edž3)ƃj'E@,uFl‹uF\l] Lus<9S} 5E19믺}O\)ȉ9ۋuVlv}4M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^t]FDVLfDPTT$D$$)dž% @9E,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS jEuE E]E}}}}U M$:18FV ~$h}uEMQ~HHtk_} U}KB/&} } M}W} }؉1MD$D$F($V ÅMF0@*x@H0x,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]MDV$MV F(d V [^_]øCE`{-@F4$U ED$ED$D$D$D$ D$E D$E$j]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8 C,{@uv@ CL{DMqD-{uvueu^CMQ+QS $ | 0 E[^_]älfbft.t&eft&W(f.t&fu5AfY{8f3f+0f(-f%*$E1E%ffffffff LUWVS<̗ uEċM uS}׃L]f.&.&2A3Ѓu߉׉MEEEE]čLUȉEuϋ1EԋM3OMЋU3WŰu3w u܋u3wu؃4E‹EE܋EE؋EU} U E34}Nj<1}}Nj<1}}Nj<1}Uȋ1EEUu} m Eu] 1}3؃uU3Q1к}3؃uU3Q1к}3؃uU3Q 1к}3؃uU3Q1ڸ}3ڃu߃ȋ]čL1UM 1ω32P3<H1ω32P3<H1ω32P3<H1ω32P3ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+ øU)9fGHOWGHOW)ULuuJE0LuTUU ھ])9 fOY_wWJOw)ًUML fu苜]u'ME;uMU]u+LƉ кu)f9OWrwWGpw )щfEDE\uΉ.EuLE]؉E$]ˉ]ERD$U_NjFD$U$藎tE 8" [^_]1 [^_]UWVS fg q}GtUD$UN_ƋGD$U$1t+4$艦=yarauE 0! [^_]É4$諣1 [^_]UWVS f Îp}GtUD$U^ƋGD$U$贍t+4$ =tciduE 0(! [^_]É4$.1 [^_]UWVSlf pED$E D$E$.tSEt4}D<$;^ƋED$<$!tE01[^_] [^_] [^_]UWVSe }oED$E D$E$tJEtZ}D<$]ƋED$<$荌t54$=yarauE01[^_][^_]É4$[^_]UWVS-e nED$E D$E$tJEtZ}D<$\ƋED$<$t54$:=tciduE01[^_]L[^_]É4$R5[^_]UEU E MMM]GUEU E tcidMMM](UVSEd mE D$E$gwƉ$舣=tciduE0[^]1[^]UVSc ÚmE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS c AmE$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]USBc lE D$E$dvUT$$c@[]US c îlE D$E$+vUT$$@[]USb ulE D$E$uUT$$A[]USb }HE U$T$t%ƉD$E$wlj4$K{[^_]1[^_]UVS~> #HE D$E$vƉ$}=gntst 1[^]É4$ytU[^]UWVS !> GE$ t,ƉD$E D$E$9vlj4$z [^_]1 [^_]UWVS= kGE $3 t%ƉD$E$vlj4$@z[^_]1[^_]UWVS r= GE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS= üFE $ t%ƉD$E$>vlj4$y[^_]1[^_]UVS< iFE D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS S< EED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS ; ÖEED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVS; 4EED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS4; DED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS: ~DE D$E$urƉ$z=gntst 1[^_]É4$ P$UدDžtڋUT$D$4$ t U:[^_]É<$1UVSM: CE D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS 9 ÕCE$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVS9 :CE $t%ƉD$E$rlj4$v[^_]1[^_]UWVS A9 BE$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVS8 ËBE $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVS8 7Bu t#t$E$qlj4$u[^_]1[^_]UWVS H8 Aut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVS7 ÖAE 0Ft%uFt$s4$k1[^_]Í$M <$fFt<$W1[^_]Ét$@M ${<$3FUSh7 AD$$M $̝D$@M $1[]US 7 @EU 9t8J 9H u(Rt<@t-T$$[]1[]ø[]ÍpˍpUS6 V@E @tUT$$[]Íl D$ D$D$t $USV6 ?E @tURtƉUM썃D$$$ KDž D$<$(qwEGEG t [^_]Í$M E$o|$@M $E9t,$pE$Ct4<$$}[^_]ËE$듃uE$끋G$UWVS 64 =u} D$|$4$|u 1 [^_]ËED$4$yt|$4$} [^_]UVS3 y=$ ƅt' D$4$oFF F[^]UWVS~3 #=u$ 詨… D$$UoUBB BU4$EE$VUt]NjMs"EtfEtBEB Ѓ[^_]׍}D$ PD$D$/ $$Lo1UVS2 6<ut4$m[^]%}D$ D$D$} $UWVS02 ;Etw} |$ ED$D$$ ƅxEH $M5…t1|$ ED$ML$$UәU1{[^_]1[^_]Í}D$ 4D$D$U $Us1 ;UT$8$]UVSL1 :ut4$([^]}D$ D$D$} $DUWVS 0 Ð:utb 9uXFt@~ G$…t>FtAD$$U5U [^_]K4$l [^_]1 [^_]ÍpUWVS \0 :utJ 9u@~ G$…t,Ft/D$$U~U [^_]1 [^_]ÍpU/ 9Et 9t1]Ë@ ]U/ h9Et 9uP@tt ]1҉]Íp]US/ $9Et 9t1[]ËU tH Q9Ur@tD$E $}[]ÍpU!/ 8Et 9t1]@]UWVS. Î8}t; 9u1G $ ƅtGt"D$4$<}[^_]1[^_]ÍpU. *8Et 9u @t ]1]vÍp]UWVSH. 7ut 9t 1[^_]ËU tM 9uFtA F EP$UDDžtŋE HɋUtOFt@L$D$ D$T$<$ F~}~ t$Ssp븍pUWVS- )7ut 9t 1[^_]ËE FtE $8F EH $M{…tFMtI} |$D$ D$L$$UFFUV}~ t$苪op믍}D$ D$D$; $US, A6Et 9t1[]ËM tM 9uL$$mUSU, 5Et 9t1[]Ë@tU T$$[]ÍpUS, æ5Et 9t1[]Ë@tU T$$[]ÍpUS+ R5EU tG 9u=t99 u5Rt@tT$$b[]Íp@uፃpٸfUSC+ 4Et. 9u$@tU T$$[]ÍpfUWVS * Ø4u~(Ft  [^_]D$ED$ D$D$4$tȋUBU$؟DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ oƅt' D$4$PfFF FE 0 [^_]É<$臧D$?fD$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]USX) 2D$ $PM $[]US) ÿ2PM $[]UWVS4( ×2M EpAQAtp}D$ T$L$D$ uԉ4$D$|$E$Bqt2t$E$"nt|$E$7r4[^_]Íg14[^_]ÉD$ T$D$D$ uԉ4$eyD$ lD$D$\$:UVS' Ç1E 0t$lM $4$d1[^]US' M1D$PM $ LD$lM $1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS& Ï0ƍD$ $覐PM <$vt$lM E$Et $Eb<$JUЃ[^_]ÉE<$2$ 贛Ut֍lD$ $MbMAFAFA<$t$E$Mt+$Egb<$ÌM $襣UЃ[^_]ÉL$ME$M9uE<$臌UЃ[^_]Í}D$ D$D$M\$UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVSw$ .utl9u4$`[^]1[^]UE@]UWVS0$ -Et l9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YUh# -Et l9t11]ËP@]U;# ,Et l9t11]ËP@]U# ¯,Et l9t11]ËP@]U" ‚,Et l9t11]ËP@]UVS" P,Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS%" +Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS! >+Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE US0! *Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U e*Et l9t1]ËHP@txE P]US "*Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UVS ±)Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS ')Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS Ÿ(Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U 3(Et l9t1]ËHP@txE P]UP 'Et l9t1]ËPH9иrE ]U  ¬'Et l9t1]ËPH9иrE f]U f'Et l9t1]ËP@uE ]U -'Et l9t1]ËP@uE ]US &Et l9t1]@uP@xM A]ËP@M QU ¢&Et l9t1]ËP@uE ]U i&Et l9t1]ËPH9иrE ]U $&Et l9t1]ËPH9иrE f]U= %Et l9t1]ËP@uE ]U ¥%Et l9t1]@uP@xM A]ËP@M QUS O%Et l9t1[]ËM tM 9uL$$\USf %EU Mt l9t1[]@t Xxx3P3H []US $EU Mt l9t1[]@t Xxx3P3H []UVS v$Eu ]t l9t1[^]ËPH@uxx11 [^]UVS &$Eu ]t l9t1[^]ËPH@uxx11 [^]UWVS$- #uEEEEVt $[^_]À~(u~-+0u xZIE܉D$}|$F$ugEUщ¸9иeEF>t"D$oD$4$VJE@U $[^_]E E܉D$ED$F$fEUE܉U}9EXV8"J&<8"0f,E܉D$|$F$ΙEU!Ѓt4MEFcD$ED$8"ut&4fffffffffffffUWVSP ã!<$WfvH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$c>_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS< ,4$cB BBB$BBB(B8OwuBfn'"H[v*BDžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{BJHJx"t_N[xaucxlu]xsuWxeuQHBzB(Jqxru+xuu%xeuH̃BB(N[P)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{l<$O1USEt&.&.& w u[]US ) E ;Et1 []ÉD$ED$E$9 []UWVS É]u}E E $谻VEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]%8?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]}D$ D$D$$f)щN$x>qUWVS, EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$نprvvxEpD$~t$$t}(u GtLt51E$j[^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVS m$Ghp$|tD$D$E$gǃxD$<$̙aEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$1^Ƌt0<$gd3D$L$d4$ollp ȋdE D$4$aNjtPD$T$l4$llT$4$-t$謃Ĭ[^_]1)<$ft$肃1Ĭ[^_]D$D$D$D$ D$hD$l$ ]lthȋtGL$4$],t$1nUD$E$U]fffffUE 9E]UWVS åƅtBD$$'~Et E$@zDžMu% $]1\$@yDžtED$<$@D$G$lEG,w0G4G8G<[^_]US@ |M $j[]US ÿ sD$,$m|M $j[]US Á D$|M $@jD$M $$1[]US 9 ED$E $j[]USg ED$E $:[]US7 E$kE $k[]UWVS( æ UM܋p4@,EEGEt@E<E tDMUD$E$菮UMtLօuE܅tE܉1([^_]Í(~D$ \D$D$$蓶ϋE܅t([^_]1UVS  Pt@9 u6p 9rW~D$ D$D$$KUWVS ×uFt09u&x<$WeƉ<$Fe[^_]Í0D$ D$D$$ӰUWVSz Ƅt1XƅtptC[^_]ÉUx<$d1ɋU'ƅtpt<$d[^_]Í0D$ pD$D$$8US ÆE xt"D$ D$E$r[]Íe~D$ D$D$ $ѯUSz UB4tB4R,…t8$7[]Í}~D$ D$D$$mD~D$ D$D$$CUWVS4 ÏUM@8t 14[^_]ÉƉ׍PU$DcMDžt6pE$6EG4$67E$c4[^_]ÍsD$,$6d|M <$aED$M E؉$E܅$w6<$`V09V4E$X6N4~,UEE؋UЉMԃD$E$豥MԋUvA)D$E؉D$D$QEF,}܉8}xF4F<<$`E$HE܃,n}<}ܜ$mnEMD$ $F5UT$MA$GEM܉H<$_UT$U؉$kE܅$5<$l_E@,vu1<$/^0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$ D$4$~D$4$=4$<U܋T$4$P tEO49H1,hEq<$\D$4$ ?Ɖ0[^_]Ë}4$Z<E$5m*D$4$9n}эD$ 4D$D$$}E$5n 4$;EԉD$4$|=~D$ 4D$D$$輧UVSd E 0t$M $AF,v u0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃0D$ D$D$$ XD$ D$D$$U HEt,9u@]1]USw Et ,9t1[]ËM tM 9uL$$US 0 Et ,9t1 []ËM9H uU tL$M L$@$} []UWVS xu>t=~(u7Ft=D$ FT$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MPEtFVT$U$MUs9}D$'D$4$ $+Pƅ,D$4$FEF~ E 0%:D$ED$F $ ljEt\UF$F 9:" D$ D$D$$腎E$W [^_]诔8"uE$W$DOƅtEE$W1!1U rEt l9t1]ËM tM 9u9]UVS 2lt$M $ƃM t$M $ƃM 1[^]US: E xtD$E$#[]ÍUVS àuD$L$BtM 4$[^]ÍM UVS Mutl9u4$[^]1[^]Us Et l9t1]@]UJ Et l9t1]@]US þEt l9t1[]ËM tM 9uL$$fUVS vuFt [^]À~(tD$ PD$FD$F$Vu_D$ HD$FD$F$.tWD$L$#AM 4$E 0[^]ÍD$L$@M ǍD$ 0D$D$$)fffffffUWVS fƅtBD$$OEt E$@KDžMu% $T1d$@KDžtED$E<$ED$G$}>EG,w0G4G8G<[^_]US ÞE$o>E $a>[]UVS iPt@9 u6p 9rt 9t%$c$Y [^_]ÉUMGE$4UNjE$3Ut$ M9t;E [^_]_D$ lD$D$T$hA$衸MA8,uA1)UE]UWVS Ã}9GE$;3G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$2UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS åut 9t 1[^_]Í~<$\2v0<$Q2[^_]UWVS Tut 9t 1[^_]Í~<$ 2v4<$2[^_]UWVS^ ut 9t 1[^_]Í~<$1E 9F0r<$1[^_]ɉUWVS Ûu~<$l1Ɖ<$[1[^_]UWVS ^u~<$/1F8uF8<$1[^_]UWVSz u~<$0v8փ<$0[^_]UWVS> ut<9u2~<$0F49E s+F,U 4t"<$0[^_]1[^_]1ލD$ D$D$aT$|UWVS Rut 9t 1[^_]Í~<$ 0F8u`F4;E t\9E seE V,tUEE$N,UEF<U$<$/[^_]1UA܍sD$ D$D$T$({D$ D$D$T$zUWVS Jut 9t 1[^_]Í~<$/U Ɖ<$.[^_]UWVSK ut 9t[^_]ÍFE$.~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$.E$[^_]ËE$-%sD$ D$D$T$zyD$ D$D$T$PyUS ÞEt 9t1[]ËM tM 9uL$$FUS WD$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]USE D$E$A[]US  ýD$E D$E$ []US ËD$E$[]fffUEU @]US CE$;t[]ÍD$ lD$D$p0$wUWVS0E $}`HtыpG$萍`tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$ Ku}DžPtҋ@w4$躌)T$$PtЉ4$~taNjPu냍D$ XD$D$0$uD$ XD$D$0$uD$ 8D$D$0$uD$ 8D$D$0$cuD$ 8D$D$0$9utыt$PD$ 8D$D$0$tUEt]1]UWVSDv $UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]Í\D$ D$D$#0$rEEU D$E D$E$]UE]UE@]UVSB ]C$$;[^]fffffffffffffffUWVS޽ Ãƀ8$gD9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$fP /.pl@istX@XXXXf@ X $;ƃtb|$D$4$(9v84$q$Ӫ1v8[^_]v?1[^_]PƄ$fى4$g^$lj$ׁ|$4$+D$$ v84${UWVSR uM ^t^F9tX^ [^_]ÉMD$$R5…FFM빍D$ PD$D$9$nD$ PD$D$:$nD$ PD$D$;$n1<&M䍙D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$VuύT$ T$D$#$jt][^_]UVS ]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍T$ T$D$D$iE >][^]UWVS( Ѿ]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]ÍT$ T$D$c$dhD$/$9E >][^_]UWVS ݳ ÂUyEx i} _$(ƅI$(+FFF E Ft.ED$4$ׄuG$014$0 [^_]Í,< t~D$4$uD$ 4$tFu.D$4$tD$ 4$wpD$4$_DŽ^OD$D$4$G)D$ 4$Ex 4$/1 UWVS > ED$E$;t>Ɖ$ \E lU4$/lU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSd utFwyM MJ]ZMJ [^]$F&t|] X]XMH ]X뼍D$ |D$D$A$dD$ |D$D$B$d1fUWVSi Uu }t`t`tAtA}tA uutA} $-[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍0D$ lD$D$Z$cUWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ Ɖ) ‰L$D$$_ f1 [^_]ÉM4$aM랹č D$ D$D$>h$U@넍EUWVS ñEhkl ~ptDžxAEEEEEE|(D$ut$$ D]E$D$t$$CDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$XD$4$ |$4$%D$04$c<(9D$hD$t$ D$D$0$U,c4$,4C8D$t$0$tD$(D$$^BD$$D$$@BD$|$$4[^_]D$$X[^_]Dž4cB,Dž4GD$(D$$AyD$(D$$}AD$$D$$_AUWVS@ˇ `t$(D$T$L$,D$,t "|$GD$8UT$$\$(.uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$($D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(?"D$8D$D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(wD$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(H;"D$8D$D$8HL$L@L$8t$@|$D<*tXD$=E$/EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $)u֋U$U9t5EuEEEuU܅/EEUUыr/Eԅ0tC.t*E8:t"UED$ED$L$轹MA70E<-<+<::[B9FB 9F  E;u~#9EpxtC.0tE8:tD$W$7WE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$Ett p1pu-x/ED$ t$D$`h<$EED$ t$D$<$*tC.t$E8:tED$ED$t$7?D$ D$D$ah$4Eԅd}؉:t0Ex pq yMMMyM؋EpxEEEЉpE $MЋtp+t)kExutC.8tE8:tt$4$u70tC.E8:ED$$7qx:#EE9E:E MM؉:ŨE uЋE؉tC.t+E8:t#MED$$谵EЋMq17EЉE<-WKED$ T$UD$`<$EUuD$ T$D$a<$t$ t$D$<$D$ T$D$a<$ pxtC.E8:t$$袴A D$ t$D$a<$*[u x;UWVSe Îo} u*P uǃP |E ;M!8-pxP -pD$-E$ǃP --|$E$tAx:ǃP >u|[^_]ÍrP :u>u|t2E8:t*|$ D$3D$@J.$?[^_]ÀxF|p_|>uTx:tL|9MpE8:t=|$ D$T1P p|[^_]ÍD$ D$D$R$u&D$ D$D$S$E 4l:bUVSRc lutD$ D$4$H;[^]ÍD$ D$D$/$UVSb ÏlutD$4$%e[^]ÍMD$ D$D$/$fffffUSb (lE$1[]UWVS\b lEtVu;U E} Uz BD$E@t$9s0E@ 1҃[^_]ËE@D$Mxe);u EE UD$9sNj]C 넋E EuGE@D$Ex gE UybE E%dD$ (D$D$0$g[D$ (D$D$0$=TUWVS` |jUB Eu1ƃu}9}EE}B269r|])9ErGË}u sJu(u J J ZR9r [^_]ÉfftEË}u rucuk띉UGD$4$\ƅt[UB)ǍD|$D$$U0MJB E2Xf넃@UWVS_ ,iu} D$$$…0x@@ ̓D$D$D$ vD$D$$UDžt1D$$[^_]R1[^_];8U$C$9818US l^ hE D$ED$@J.X$C []US5^ gED$ E D$ED$@J.X$C[]UWVS] Úgu} t(ED$ 1D$|$4$Q[^_]ÍY1D$ DD$D$4\$UVS] )gut'D$ D$D$4$yQ[^]ÍY1D$ 8D$D$A\$=UWVS] ûfu} t)D$ 1D$|$4$Q[^_]ÍY1D$ PD$D$6$UVS\ Ifut>D$D$ D$D$4$Kt [^]1[^]ÍmD$ XD$D$0$FUS!\ eED$ D$ E D$E$ 9[]UWVS[ ËeuttE D$4$~7F0u D$4$[^_]tF0uҿF0뻍Y1D$ `D$D$/$R]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSZ 3dE0x$tu[^_]1[^_]UWVSQZ cu tLEt>?t+fx f@UPp$MH,UP(UPDUP [^_]ÿUuy1UWVS Y tc}u$‹EE Bzr EBttpE tZ%E NEU>UtnMfH f@PM H$x,p(@DP [^_]ÍNE뭋M t%E E딉UU$1UWVSX ybUE trB0~4r,txM q J$tE D$ E 0xt$|$$[^_]ÉUzD$ hD$D$<$4 UYY1D$ hD$D$;$ U US W |aED$E D$E$辶 []USW KaED$ ED$E D$E$&[]UVSmW auf~ D$4$F0tN@9t $F0F0ǀǀ FFF t1FD$4$e1[^]ËFߍY1D$ pD$D$< $ I2 UWVSV *`EU tgP0~4p,tu ~r H$t} Lj $[M׉‹M y!1[^_]ÉEzT$ xT$D$90$ EdY1T$ xT$D$80$ E+UWVSU 6_utFD$4$nx$P8D$4$[^_]É4$ڍY1D$ D$D$7T$+ US U ë^ED$E D$E$iH []UST z^ED$ ED$E D$E$F[]UWVS,T @^Et8uj}ԉ ;$JFHFF )t$|$$踲,[^_]ÉEԉ$E؍*EEu}w끋uUS u]Ex9]Ë]Í]fUWVSTS 6]UE }}9}7uցE0 tS9utOD$2@D$u4$4$PEt8UED$t$E$Uu-p4$PEuȋ}E+TЃT[^_]Ét$ D$D$2u4$׺4$yP볅U@E 7t"ED$G$3ut$ 닺gR}UD$ D$D$$UET$ T$D$$uE7M,ET$ T$D$$E~fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVS^P Zut;F)F3E uF F[^]1[^]ÍD$ D$D$Y $UWVSO ÁYu} Uts~F<FF DWPWPW P F F 1[^_]Í)D$ D$D$v $CU`UD$ D$D$w $ U+UVSN }Xut~u@~w:E [^]Í)D$ D$D$ $뺸UVSqN Xut~uAF u9<.w5[^]Í)D$ pD$D$ $6빸UWVSN íW}u t5u%G u<.w~9|D7[^_]1[^_]Í)D$ XD$D$ $UWVSM .Wu} t*~uPF uH<.wDx>9؃[^_]Í)D$ @D$D$ $<몸UEu E D]1]UWVSL ÙV}utQEu@D69E r4E D$D$<$6GfGG[^_]1[^_]ÍD$ 0D$D$. $UWVSYL Uu} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M $뙸UWVS4K rUƉEԋE} 9uЋU1҅x%PލT$D$<$]wGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍ6T$ T$D$h $E܅ E܋]ԍAT$ T$D$i $Em]wUVSOJ Sut~uEFu=:Fr6[^]ÍD$ D$D$ $뵸UWVSI ÇSu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ D$D$ $fffffffUWVSQI RƉׅtat1>t F9rF9s1[^_]ú䍃fD$ D$D$$뾍MD$ D$D$$pUWVSH JRt4ljփt3Rw0FGT$D$<$8[^_][^_]ÉUYD$ $D$D$$>UUSH ûQE x[]ÉEvT$ dT$D$T$E[]UWVSG ]Qu} Et,tYPσF)F 71[^_]ÍT$ PT$D$b$fEuET$ PT$D$c$2ErUWVSF PEu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃D$ 8D$D$$MÍ)D$ 8D$D$$M}]썃D$ 8D$D$$L {P7f/UWVSD NEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍ)D$ D$D$$ME]荓T$ T$D$$EjUWVSC 6Mu} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃)D$ D$D$$LD$ D$D$$VUWVSyB LU} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]Í)D$ D$D$W$UUD$ D$D$X$aUUUE ttuB]ø]UWVS$A JEEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]UMi1ɉM]썃D$ D$D$$MXMUEE썘\$ \$D$$MUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUS< BFD$D$ED$ ED$E D$E$[]fUWVSPN< EƉЉ9U1҅[ƅD$D$D$D$ T$D$4$Ct1U+<P[^_]Í1ɉ D rFDžDžD$ T$gD$<$EuutjƅD$D$D$D$ t$GD$G$Cut$$tu<$Vt$CtT$ xT$D$„$jgUWVST{: DƉ9E1 ƃ Q ƅD$D$D$D$  Q D$|$4$AD$D$D$D$ L$|$4$A;DžDžDžDžDžVDžDžDžT$ D$gD$$stjƅD$D$D$D$ t$GD$G$@ut$$thuGtLD$ D$D$$L$q1U+uXT[^_]Ë묋$qʍD$ D$D$„$8GeUWVS8 ëAϋEE uE9E1,VD$D$ D$D$<$3B4D$ D$D$$7t6D$ D$D$$zw $ɗD$$D$${$聗D$I$cG$M$?̅~f$N$ t$D$D$$荣U+Ą[^_]Í߄ @$0/q>D$ $HuD$<$2rD$/$T3Pt:D$D$$_#xD$D$D$D$CD$ D$T$$D$D$y$C$@D$D$i$$X$D$P$$ D$ D$D$y„$D$ D$D$z„$D$ D$D${„$bD$ D$D$|„$*{D$D$D$D$ CD$T$$Q@$8u D$/$0D$t$ kT$D$$D$D$D$D$CD$ |$D$#$U*VD$8$эD$G$^D$Y$z$UWVSn1 ;EhU9E1pl 1} } uqƅptBxB |BEBEE qD$D$E $_Džy@E+Ĝ[^_]</ƅptBtfDžrlD$<$$xSrfh뎉lD$ D$D$ „$<ll<$l']U D$E D$E$O]UVS/ b9utD$D$4$[^]ÍD$ D$D$„$~UWVST/ 8ljEE Et9|E1Eh]DžDžDžDžxD$D$$脍_DžDžDž@J.D$FD$$ǃD$D$<$蘎FD$FD$<$Žh<$ҎN80t&<‹F:=4$袱Dž'8#Q$#vD$xD$$|E+Ĝ[^_]ÃNZƅD$D$D$D$ |$FD$F$j4|$$EvƅD$D$D$D$ |$FD$F$4u4|$ɅD$$%D$GzD$6\D$<$uD$6\D$<$Y.0$詰D$ @D$D$@J.$蕘8tD$FD$$DžD$$D$ D$D$4$4$D$t$<$fƋ$9fDžfDžD$D$$^D$L$$;Ƌ$ t0<<4$D$t$<$]4$D$t$<$<4$nD$t$<$D$D$<$AD$xD$$-D$D$D$D$ D$D$ $0u(4$v=4$g=$wD$pD$<$3DžD$ D$D$„$T9D$ D$D$„$D$ D$D$„$D$ D$D$„$D$ D$D$„$tׅ$*$><$6!D$t$$豅 tD$t$<$ԆtƋtt$ɇ뉍d$$談hD$8$j뛍$t$;rSUWVSl4& /uEEEEEEEE9E1MGUqEE fD$ ܒD$D$ UЉ$UEEEEEEM MEEML$ D$UT$$4_=EPt%D$T$,U $UUEML$ML$M $MƋE$c^E+l[^_]ÍD$ D$D$„$MD$ D$D$„$UD$ D$D$„$dEeD$ D$D$„$/6$Q]D$D$$WrQUD$ED$ED$ED$ ED$E D$E$f]UWVSl# ;-uEEEEEEEE9E1xMUEE fD$ ܒD$D$ UЉ$UWEEEEEEM MEEML$ D$UT$$\E@t"D$D$,V $U<U3D$=$tM 9HtCED$ED$E$MEƋE$[E+9l[^_]Ítv$bD$ ED$ED$E$ME 멍D$ D$D$i„$M^D$ D$D$j„$U4D$ D$D$k„$kE D$ D$D$l„$6$XZD$D$$^oNUD$ED$ED$ED$ ED$E D$E$ ]UWVS ?*}lE \EXE`9@E1D$pH$FXp`DžLDžPpR.dR.DlD$ D$D$<$mD$ <$`bdh< Q< t< L .&< t< t t ~ u9P>uXp<+%<-q<@nL'PHD$ D$PD$r$\y؉DžL<+<-w҉ht$`$jhyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$?xDžL<+F<@[hU\l K4$  u9F<@t$`$qU\l<+<-t$`$>qU\؉<+N<- t$`$A_Z<+<-DžLDžP.hHD$ `D$D$4$vhQ7F<@uhHD$ `D$D$4$u؋h]PFF'<@hHD$ `D$D$4$xuhU\1PU\PF]<@UHD$ `D$D$4$u)F<@ DžLDžP1D$ D$D$„$ D$ D$D$„$X D$ D$D$„$aFUWVSt #M(E<}98ƋE1f<!ǃP U@D$D$ D$DD$<$v@D$@ D$4$aD$7D$4$'"M4'0@@ $@@P T$$w@@$_D$4$ͅ,t$D$4$p?,|%=UP $ӟ4$u0$8E+[^_]þ뿍_D$&$…tE|[^_]1䍃ED$ D$D$N($ /UWVSt Y EUU9M1ɅtBE}<$EhM L$ED$<$hED$<$RU+u:t[^_]ÉESL$ |L$D$h( $<EK/US ô E D$E$[]US Ê E D$E$[]UVS _ D$]D$W 4$ED$ t$ED$$薍[^]UEȅyt ]%]]ffffffffffffffffffffffffUWVS0  E؋}u 9EԉËE1|$}܉<$]&1&.&.&.&.& F TFuF(}ԋE+uW0[^_]$)]uƅgы]؍D$ D$D$F$ +],-UWVSÐ EE u}9U1ҍ$iD$@$_E E19xu}_D$D$$'_D$D$$L)׉ 9|KD$D$$^D$ D$$19 })׉ q0$d_0D$$%U+[^_]É裸0$_莸0t1D$ t$|$$՗b$^1농D$$tыptEU**UD$D$D$D$ E D$E$H]UWVSx2EUU9M1ɅtBE}<$M L$ED$<$.ED$<$U+u:x[^_]ÉESL$ L$D$ $躱E)fffffUWVSz#8]du 9<ËE1dENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ ]]Ћ~$|}ԋ^(x]؋~,t}܋^0p]^4H]~8D}v<@u식d3`s\s{ l{LȉEl1؋\!1؋`LyZ؋u\ɉT1`!1l yZTىˋ`MʉX1!1ыXP:yZω}ω}E1ȉ!ߋE1NjE0yZEȉ1!׉M1ωEMyZω9EEȉ1щ!1߉EMyZNjMu}ω}1ϋu!1׋MyZ߉Mɋ}u1!Nju1hyZ׉}ωM1!ߋM1ωuu1yZ]|ɉ1!1lj|]yZωxωxU1ډ!U1׋xyZljutʉ1!ω1߉t]yZ߉pʉU}1!NjU1׋Up2yZ׉4:u‹Hω1Љ!1ωuu0yZE]Dω1ߋ]!1׉EyZωE@ω}]1!]1߉EyZlj}X1u1u1Ƌ}1!ϋ]1߉u]yZ߉MT}1|1u1lj1!ljT1׉uUyZ׉ :X}1׋x1u1lj}1!ߋu1UT2yZUu1֋t1֋U1։‰1މX!1ƉUM yZΉTXMu1΋p1΋M1Ή11MnTƉXEh1NjE1NjM1ω׋X1ϋT1ωEn߉TE}1NjE1NjM1ωXT11En׉h|1NjE1NjM1ωT11߉MXnljh}x1ϋM1ϋM1lj11׉MTnω|t1׋U1׋U1ljh11lj|2n>Xxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVSu ]} 9EEGWEU?@)ƒw)ƒT$LD$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼnUE]UU ft1]ÁE ]fffL$$Yai qyD$A(tQS[èRjj [1Ít&.&T$D$ Zbj rz $z(t RPS[XjRj [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj [1Í&T$D$ Zbj rz $RPS[~jRj [Xt@US 谿UED$E D$E$ []US$D$ D$ED$$'[]USDD$ E D$ED$$-[]US ïD$ E D$ED$$[]ffffffUWVS,fuEEED$D$}|$ t$D$EE$@EE ED$D$|$ D$D$E$Y@EEED$D$|$ D$D$E$ @6EEED$D$|$ T$UD$E$?UEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$&?؃,[^_]bw8 u>ƆUN D$ D$D$<$qfffUWVSn} 9E1}D$D$HtHE$Vt=ED$D$<$Ą;Es1U+[^_]ø"㍅D$E$kNtt@D$E$1Nu[ED$cD$<$T;EsED$|$ H%D$`d$T$UuID$ D$D$B$$BpQUWVS ǸD$W \$E$qƉ؅u [^_]Éku01UWVSpźjU[ ut$$[ @B1NjEEE1UЋUME1EHt$$xx[ @B1Ƌ}E1NjExME1EH D$E$~u([ ]ٸ@B1E1؃p[^_]øp[^_]$'[ 8D$ D$D$H$nfffffffffffffffUWVSAD$rD$E$谄uE0D.".&.&.&@t&tD$E$u܉[^_]D$݇D$E$6t 1[^_]ËEpD$UD$4$E@<-u?EPR.DPtEPD$ ED$$U9MU9p9g^My+th)ƍF߃1BD$+D$4$XE@t<+ !M?!fffffU{E?w0D.t u]Ë u@u1]U@EP>w 0D.]1]UWVS(éu}܉|$D$4$upxINE uG>wl%9EظE! EED$|$4$(p([^_]Ã>w2%9EظE EppUWVS<uYoD$ to|D$D$[ <$My)[ S.t@[ [^_]ÍU T$ t$)‰T$$뵍8D$D$[ <$fffUWVS聵&ƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUT$ <T$D$tD$^iEF!FUWVSu] "<-EEEE}|$EԉD$$$~$E~D$|$$TElD$D$Ẻ$lMẺE0EUR.DPщMEE1E$KTU$U~9E~T$$lƋUfffffffffUWVSTݞEu}]E E bEEE;E܅~ 0MU tEEGz;EGEEUEUEUEUEEEE E+ E؋E$]G 8MЍD9E  0^EUM]L$\$ $T$]9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]=D$E D$E$9} T[^_]ÍEEEE2EEpE7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]Mȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;EpEbEdEE Eg]U]EdEEUM]$CUЍD9E ỦUM܍_׉F u ,[^_]Ë]Uv]uNՃmu$]n,[^_]ÉUE$]UtÅT$D$ $M]LMmD$ D$D$U$`Hn]D$ D$D$U$+H*uf~*u1f~*_lTODlmT*lJD$ D$D$U$>hTˈD$ D$D$U$A>XPTۈD$ D$D$U$>p TD$ D$D$U$=13=qdTCh/p@ @t`<$PG$`$Tk)؋`$TU)lT8UWVSÜ`hl΋}p} M\9dE1h!lKp{pfXlp1 9sYfPftf/u܅t0t&.&.&.&f@/f/u%9rdU+İ[^_]flpP`D$ D$D$oU$;D$ D$D$lU$s;l`ˈD$ D$D$mU$5;p`ۈD$ D$D$nU$:PXllftp‹hG t\SJKt*lfx/t|%=@=t`G\h;FX\D$|$ pD$L$$lh 1h1h C ukG @tKpD$$W([|%=@E9ll/(pD$$`D뫃=u`D$ D$D$SU$X39T$ T$D$pX$ 9``i>1҉l/UWVSD趃SÉ9E1vHf~uQ@ ~ύff/P9uݸx0f"f*ffʃft>f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 `T$ D$)L$pP$gf[!~ʉW-0$P…ZJD$D$ D$D$$T@7pf@!fH9"ۈ|$ 4t$D$U $2|$ D$D$ $2T$ 4D$D$U $i2 T$ D$D$ $92T$ t$D$ $ 2|$ D$D$ $1rͩUWVS4|1gU9U‹)߃r)ڍHPftDΉ1ff}tYFftf[tWf{uFfuM E14[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1Gf,f[uSf]efً99S{f{vf}uͅt8Ĥf}Xׅu9f1TffuM M1B:qQf]tىC)ȉD΃tft FۈT$ <|$D$U4$^.ɋtFUT$ |$D$4$.<UT$ |$D$4$-^<U눋yuI󥉽SًfvfUWVS)x΁ƅtyB tA xy f>{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃ۈD$ HD$D$U$,MUQMU썃D$ HD$D$U$M,MU1NUWVS(wêu} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍ۈD$ TD$D$U$*U} UhUWVSnuEtXEPtF@u=@=~Ӊƍp=[K== }?tD$V$ɱ@D$V$螱K=@sD$V$sp@@HD$V$H}?@UWVS8bcl9U1ǃLh Lh DŽPh r捃Ld lh D$ D$D$$Khh T$$<D$\|$4$NA8t߉Lh 8#mD$\|$4$bNt8t㉃Ph D$\|$4$?Nt8t㉃Th D$\|$4$N8t߉Xh ǃ`h ǃdh D$\|$4$Mt>8t$`h D$\|$4$Mt8t$dh D$Xh D$4$),hD$\D$$AMƅ8tщ4$j uċܳtܳ >t|$$0 uቻ\h ?x{U+8[^_]Í@D$\|$4$LK8t߉Lh 8#wD$\|$4$lLt8t㉃Ph D$\|$4$IL%8t߉\h 8xuxxu xXh 8sxwxLTh D$\|$4$KtQ8t$`h D$\|$4$Kt&8t$dh \h ~hh D$D$$Yx{ElǃLh 171PǃXh ǃ\h 芋HT$$9 hUVS.^glh tJtKLh [^]ǃhh _D$4$~lh ut$ t$01UWVS]]guǃhh lh t3$t$Lh $h tIu1[^_]Í_D$<$lh uˉ|$ t$0Lh [^_]Í D$ 0D$D$$ FUWVS\Äfuǃhh lh t7$@t$Ph $tMt&u1[^_]Í_D$<$lh ulj|$ t$>/Lh [^_]Í D$ $D$D$$,BUVS\èeǃhh lh t$o[^]Í_D$4$Ulh u҉t$ t$.1US[6elh t$zǃlh []fffffffffffffUWVSPI[d}ƉUԉMEԅ}@ER.EEEÃ]}ԃEȍFE]|ЍL]DStER.Eԉh EȉD$BrD$Ẻ$sEԉi EȉD$PD$Ẻ$RsEԉi fEpxEfEbxEfEfxEfEoxEfEtxEE`a i E؉EEEčEEE4$0T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)v,j 9u(Ƅ,j [^_]Éր>/tJd),j ǃs$utǤƄ,j [^_]ftt鍳$fffffffUWVSA:CE$!}LtR.DBt;R.0fkfbfgfE@ E1ɉMQD$ ED$E$|Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZENE0US8ÐBD$ E$胙[]ffffffUWVS8VB}?t<$D9uzf.&9ti8/t9t`sc~/t9u)=v,n ׃rtftƄ,n Ѓ[^_]ød)€8/t Ƹ봸$US<7ÍAEEEEEEEED$ẺD$$tEMt<[]ø<[]ffffffUWVS a7At4ƅu"t$Ut,E t: [^_]$^ [^_]Í$$1E uD$D$$ ǃtD$$D$<$D$<$h<$褗[US6'@Et=tU T$؉$͖[]UVS76?utE D$D$4$D[^]ÍmD$ tD$D$1$붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[4>@ [Ḯ̀rS[>@ [ḭ̀rS[=@ [̀ffff̀ffff/̀ffff^̀rS[ä=@ [̀rS[Ä=@ [Ḥ̀rS[d=@ [<̀rS[D=@ [̀rS[$=@ [ḇ̀rS[=@ [̀rS[<@ [ḓ̀rS[<@ [̀rS[ä<@ [`̀rS[Ä<@ [R̀rS[d<@ [2̀rS[D<@ [ḩ̀rS[$<@ [P̀rS[<@ [ḷ̀rS[;@ [Ḷ̀rS[;@ [ḉ̀rS[ä;@ [̀rS[Ä;@ [Ḛ̀rS[d;@ [̀rS[D;@ [Ḩ̀rS[$;@ [1̀rS[;@ [Ḍ̀rS[:@ [òrS[:@ [ìrS[ä:@ [l̀rS[Ä:@ [t̀rS[d:@ [s̀rS[D:@ [r̀rS[$:@ [p̀rS[:@ [j̀rS[9@ [m̀rS[9@ [̀rS[ä9@ [Z̀rS[Ä9@ [ ̀rS[d9@ [!̀rS[D9@ [S[.9@ [f.&*̀r׋L$Q1fffffỲrJ!QS[8@ [UWVS+/8,r 0r D$$60r 8r +4r D$ D$D$74$sfffffUWVS=EUE E0utt4$]x]pt/9u+]|$t$F$]jN9Mtۋ]E t&t#P9utFE0E[^_]É1]dD$ D$D$IX$z;ÍTD$ D$D$HX$IfffffffffffffffUWVS ǦuU MtUA%.&.&.&t+ ÃutF\$D$$j [^_]UWVS &MtU D$E$ED$}|$E$ƃE $EL<(90t6Eu|1 [^_]ÉL$M$U:UM $…tU $<UMȉ׋usYtftE|=Eu stf`Z뉋E|떍 D$ D$D$C|$U brD$ D$D$D|$D$E$f5Ef,zE UVS õE UtuD$E$G [^]ÉT$D$E$ƅu E [^]ÃTtG01 [^]7 1UWVS/uE 0E,E(94‹E1wD$D$4$njhDžDžD$$VtD$h8$#uhǀPǀTǀX8<$T8Dž@fDžDfFHDžLTDž\W dDž`DžX(D$ ,D$0D$<$ƅx <$uT4E+u[[^_]ÍD$ D$D$D$f/9Uo UT$ U T$Q.D$E$]US ; ED$E D$E$O []US ïED$ ED$E D$E$M[]UWVS, uuw}t}ED$4$4$F0tN@9t $F0F0ǀǀ FF~ >\}IED$ED$4$ NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$UE UπUE댉E䍋L$ M܍,T$UD$E؉$REFEFd9iD$4$舛E,[^_]ËF$薇\}Ef~ FFCFFD$4$.E,[^_]ÃUML$ T$D$E؉$荾EFHUE$~E UtRπMY1D$ ,D$D$?$5ZE(E9Ut'$<~E UtπUEEUVS^uD$4$V(4$F u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$蚙D$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$Q[D$D$D$4$$UVS7uD$4$ӘV(4$ЎF D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$uEUw0E[^]ËVPNTUMutt+FEU<TD$4$D$4$UWVS`}?ew t>Et[^_]Ft$踃V tQFtB1ɉωMT:0$蔃V T:($腃V D: $vMV ;Nr$`F,t$QF4t -$=F8t$.4$&[^_]ÍD$ 4D$D$M$d?e[^_]ÍD$ 4D$D$K$&UVSâ4$kr D$E$y4$k[^]UVS]4$^kr $x4$Hk[^]UWVSy<$kr D$$}Ɖ<$k[^_]UWVS. uED$@$fED$E $g…t?t$U$ӯUt'zu Ńtt$$謯uUEHutU$蚋EUЃ[^_]Í D$ @D$D$< $p7UVSG  4$ir D$E$e4$i[^]UVSç  4$ir $ f4$i[^]UWVSh  <$iir D$$.fƉ<$Ji[^_]fffUWVS0q UR.E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍD$ TD$D$F8 $˵ULuԍE9s11UWVS . 詹D$|D$@J.<$mE tED$E D$<$D$$ >RE$_US÷ 虺UT$ U T$D$E$mffffffffffffUWVS f uEEt.\u* [^_]M %l t. [^_]E } t=Q tME  [^_]ÍD$ t D$D$NJ$ GD$ t D$D$NJ$ٳE TR. } } U R.DPwM QɨE E nE 0<rMЈE} #EEE} ;c‹}Ǎ EEJEu}&dW09uuӓ E} ?U  ЋM ME U R.DPE PEE ЋM}ljE_ EE TR.DE 0M EEu } \Et } %Et } &Et } =2ME E 0<cMЈdE TR.0+E P} ;U R.DPtOEE DЍPE} -} ^u!R.M DHE 0ME\ErEEEE E E pE _E NE =E,}MEu}9tedtH9tud1ɀcFdE P ZE PMuU{R.W0EER.W E UWVS(&E܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]讲([^_]ÉxÍP7D$ h D$D$NJ$U U ]܍7D$ h D$D$NJ$責U ]j  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]ÐUWVSÆu,s n/>3)Ѝ)Ѝ:~ 9w$4s ugP U$Ѓ4s DU4$Ѕt9w$D$ D$w4$[^_]É4$Duljw$t$ YD$D$ w4$:^E t1붋4s t9U$(kNjU4$DY[^_]ËPǃ4s 뭋U tuGEǃ4s Ds hD$$=n,s `ǃs 11UWVSáu(s o))Љ):~ 9w$0s ug` U$Ѓ0s TU4$Ѕt9w$D$ D$w4$[^_]É4$Tuljw$t$ YD$D$ w4$T\E t1붋0s t9U$(+iNjU4$TY[^_]Ë`ǃ0s 뭋U tuGEǃ0s Ts hD$$l(s _ǃs 11UWVSûu4$Dž$s ED1.t&.&P9u/>3)Ѝ)E:WɉM~4T$U4$nUuMG$U 1[^_]Ë4s u$PU$Ѓ4s UD$ t$$Ǻ4$H@G$됋4s u$PU$Ѓ4s UU$(gNjUthP뀃4s ts u/D$$=jE$s ǃs ǃ4s 4$HtՋ@UWVS$u4$Dž s EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$}UuMG$U 1[^_]Ë0s u$`U$Ѓ0s UD$ t$$ָ4$X@G$됋0s u$`U$Ѓ0s UU$(eNjUthP뀃0s ts u/D$$hE s ǃs ǃ0s 4$XtՋ@UWVS3UELtЋ,s t'Ǎt$l9uǃ,s ǃs $s t'Ǎt$Wl9uǃ$s ǃs ǃ4s EPE LEHED1[^_]øUWVSHUE\tЋ(s t'Ǎt$k9uǃ(s ǃs s t'Ǎt$lk9uǃ s ǃs ǃ0s E`E \EXET1[^_]øffffffffffffffUWVS:pUE  DžXEK/tBD$E $p-E $Ŗuv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $p:!%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pJDž`D$`p脔D=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p_?t9E DtX$pBg1Ĩ[^_]tN~uPf/tpڢ?pĢx貢zUWVSì}E ttrD$<$(xX[^_]Et$<$}bDžMtAt$$h(ymt *8"tƉ<$2e1[^_]1fffffffffffffffUWVSA}<$Ls $_\Hs ǃDs 7tyR.E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]ËHs t$dǃHs ǃLs ΍yU͠ UWVS"u} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]ÍMD$ D$D$` $o[lD$ D$D$` $@UUd]UWVSãu} to.&.&8u$ u|:9s :t|tu[^_]Í D$ D$D$` $dblD$ D$D$` $3-1UWVSp ǧƉE 9E1=m}! Mu0Hs t |$$U$X UD$ D$D$E$|DžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$V\ lj99D$D$E$A^Ѐ txE<#=D$ $,#dDžD$=D$$yS<:uA)ljED$L$E$:=w!C:SDžDvD$ |$D$$HD$D$ D$D$@$kD$D$@$?qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$k6L$t$<$U6 $[OދDžމ:DžD))))T$<$Wo<ljljÉtE$>)ȍP9rH8E+p[^_]ÉEDžD$$V됋Ls $Q!Hs D$<$*|70dƋYq0$vY\0DžƋ|$YD$ D$D$` $ZeD$ D$D$ ` $c D$ D$D$ ` $ޏ.MD$ D$D$` $譏tp@a$WDžmE$C;;E$-;n땉Ƌ$W>$ŃD$ \$|$4$V Pu Dž$@H $NDž L$T$$14$V18Dž4$VDž鋝 D$ D$D$` $藍0<$ V0$UtE$<9貒 M4$V薒 1ϋ$Uu%$^U됋E$8UVS8EM ut.t^UD$t$$F[^]ÍlT$ T$D$` $?M EuM EeT$ T$D$` $M ElM E T$ T$D$` $NjM E1US>@s t$^ǃ@s ǃ8s ǃDs ǃ}<:tkOML<^uF<:mu‹M])ىύAdD$$]zJljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]IEEM$[^_]Ë]뽸 y]䍃D$ D$D$` $ÍlD$ D$D$` $调]䍃MD$ D$D$` ${z1*E$]K<$]K]諈 UWVSEu} uE0D$=|$4$Dž$d]Bƅ<:d <:tCZtsu)Cd]D$4$]GUn‰ƹd<:uЉƍX)Ӎst4\$$U]yGU@Љ)ӍsűE[^_]Ë]썃MD$ D$D$#` $́E]썃D$ D$D$$` $蔁ÍlD$ D$D$"` $cZ]썃|D$ D$D$`` $1)D$4$]]Ft-M14$]I։4$]jI]K UWVSH}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/ DžDž)S$K9>:hf  81Ƀ4uA )čD$pxr󥋵t$D$$'D$D$$%|$t$$x%D$D$$Z% D$ XD$D$E ${udurPd)1d)rBvBDžqfzU n<(9D$E D$E$]UWVS4}U 9E1EtqMyu )čD$UPtMP}y:u}<(9T$D$<$%U+ue[^_]ø"fUSÈD$$Jpw D$ Z$Ilw []UWVSH6}}ԋE E؋uu9EЉƋEl1D$l$-.pw }M؉MufuUT$U܉T$ D$ UT$$Luu vU܋9El} u lw tUԉ%9pw t1MЋE+H[^_]Á} u lw uD$D$ $4XƅtdEĉ4$"]AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UAnDžuED$UȃT$Ẻ$蟋;Es4$O[f % ЉD$͐D$ 6D$ED$Ẻ$*x ;Es1"B9EBf9EzJ Uȍ~|$D$ $MnKNMMčD19C9}rỦ׉΃s$tft1V4$rZDUuuB r EfUSXD$ls \$ ED$EU $T$u؃[]1[]UVS_-t$LFL$\=$|$(4t$4D$h$2D$9L$\$D$LD$,1|$(D$$3D$ |$\L$8t$dx-t1+t,D$hD$L$0$qXL$0"D$\D$LD$\xOFF2D$49;|$\yȃ9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -UWVSL}D$<$2ED$ ED$E D$<$D$<$2[^_]UWVSÑ}D$<$-2ED$ E D$Q.D$<$D$<$$2[^_]ffffUWVS 聠&U J}8D$$U 1U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$-U  0Muωƃ}EEu2J0B0upH MHBD$$0E [^_]ÉU U fb ߋrEt9spE9-JUT$ U T$UT$V$Љƅu E[^]S0E[^]ÍX!D$ |D$D$8!$M@U 辘gQ.D$E D$E$2]UVS萘5E$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]R0E[^]Í!D$ dD$D$p!$M@$UQ.D$ ED$E D$E$$]UVS谗UE$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í!D$ LD$D$y!$2L@(UQ.D$ ED$E D$E$$]UVSЖuE$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í$"D$ 4D$D$!$RK@4U%ΟQ.D$ ED$E D$E$$]UWVS(ÔuEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}O0E([^_]Ë$ 1ҍ}uU썃"D$ D$D$!$I@HU]EU썋"L$ L$D$J! $IEIUT$ (T$D$}\"$LIEX D$ D$D$[\"$IUUQ.D$ED$ED$ ED$E D$E$]UVS觓LE$ tKtE@8t>UT$ U T$UT$V$Љƅu E[^]M0E[^]Í"D$ D$D$!$0H@8U Q.D$E D$E$2]UWVSԒyKD$|D$@J.<$Et8ED$ED$<$w|$ D$D$*$5E $rD$xD$$pE$US*ϛD$ ED$E D$E$[]fffffffUWVS0Æ}u t$E$6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw"Nwq\E@VR.PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$qtU@}ظ^DE@uS4$ruV tQFvIE %Fv7 ,-}ԉ}؉xE7R.DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$ rF<gE\}؉xE^E?!} }fGH]&G @E}G(UċrDuG$]EЅEċ@hUZG(UċZDuu떅uEċ@뽅?~t&UWVS$/kt} EdD$,$EƅEF$~(EEt=}1҉Eu׉ $9sǃuEuw1ɍpE‰EM@DEwE1}EBUE$UUQ…U@DEBBTBN(U?fUufBHEuBMEPUEo}}Ut E1ɋUt9xf@H F(EuNE$A}# $uE$F$4$1$[^_]Ã}uω$9sǃuu0UU~8#릋}|\1ɋUYxf@H F(hD$D$@d)$qFN(D$ D$D$$D$ D$D$$1ɋU@f@H F(ZE4UWVSg)q}tH@JHDy$VDxpup$VDy4$wtv$uGt$G$G(t&<$1[^_]Ë@$$dG$ ƃtCG$뻍D$ HD$D$ $Ev EG$k<$Eb UUUWVS*fo}57KW(?FLfFL;NHtlfv$iNDFLf;7tȍD$ <D$D$$Affu@F83G N<3O FJ"Gt uƉv$uuGfFHPp$~DWF(VD{G(G$O(1[^_]ËGt+tEW(uƉv$;uuGGIG)t룃8N?wGGENQ(BI|/u‹E/N,QT$VTT$$7[^_]ÃD$ <D$D$U$1ɉfFHG(uG$F,F(NTD$ML$G$wD$/M $at;9EP$U) @MD$UT$E$+MN,GFFF8V}F)uGHf fű~t$eu} EHDu@8/tF(tF[^_]ÉUD$D$@d)$莿ǃUttF<$b<$ugFF)E@[^_]ÁN(fD$ D$D$1$F߿UWVS^`hutp7u4E4$u(4$(E$臿[^_]ËF$$뿋F$$F$$F$$뵍ˑD$ D$D$Bl#$+aUS ^ågQ.D$ D$D$E D$E$l$]]US ]agED$ D$D$E D$E$l$]]UWVS8|]!gƉ׉t,M=U= =T$E؉D$E܉D$ L$|$4$=ƒu܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1"كl8[^_]1UN\eQ.U E]UMU E]fffff̀rS[ôe@ [̀rS[Ôe@ [ ̀rS[te@ [UWVS[Veu} u !t9u[^_]1[^_]ÍD$ D$D$*#$kUWVSD[du} ttB|$4$[^_]Í>D$ D$D$B#$ uID$ D$D$C#$UWVSZYdu} ttB|$4$[^_]Í>D$ D$D$B#$yuID$ D$D$C#$KUWVS@1Zct$(D$T$L$,D$,t "|$GD$8UT$$\$(9uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(芫D$$T$ D$0T$4D$T$ $D$1D$L$8D$9\$(["D$8D$<$6010 0ƋG$$#G$$臀.& 0UWVS 8S\}D$`<$PtƋM Džt [^_]1 [^_] U4$m U [^_]UVSRd\utD$4$\[^]Í D$ D$D$F#$UVS_R\u|D$4$tOE%=@u5D$D$4$ɲt#1҉Ĉ[^] 1Ĉ[^]ffUWVS8Qv[]E@ E }ԃt uEԨEeEЉ}؉]1E1Ew>E܍ 0MU‰T$UE$]U})ljEuUD$ D$D$E $]MAQt$|$E $@t~")Ɓwf]O 8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$]}…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]qD$ D$D$E $m$뫉EX@$]MA }E@@eBE $]RD$@E$_E |EMH ] ωu]8D$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]uDG uNjUtG~uU܉$]}닋]썃|D$ D$D$#$.$]K‹EE1]vUWVSMtW}G $bwt6$OuG[^_]UWVSM,Wu} t"tL D$ $N[^_]ÍؑD$ D$D$:$$BuD$ D$D$;$$UVS8LÓVut&== =@ED$E܉D$E؉D$ T$E D$E$]=t3w $Ef>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[TU@ [ffffffffUE]UWVS$xKUE։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]Í=D$ TD$D$r<$$EP5D$ TD$D$s<$$!UWVSXfJTEu Ud E' } E EE̋EƉE$]\Eȅ E? Ef UȍBEԋEЉE؃)֋]ދuމuED$E$M!EȍDU؉UT$}}|$}<$U1Ʌ9uWuuEȉEMEEĉ}NjE4u܋E9MuЉEËE9s#ED$;D$$UU9tΉMuЃ\97]ˉ}}܉+uED$|$4$UM9t#+EU‹ErUENjE9r}܉ً}}M܋E9ED$u܉t$)$UbE‹E+EuEuE9EԋM9KEEEUčB}9EU}؉EC‹u)}U92؋u)uEԋ}9}EЉEM]}9}ED$}|$]$U}]UEE܅U؉!ED$|$$UU9~S}E9rՉ߉ËE9M̅fU؋E.& 9r}G9T)E؍LEDEEUv9uM؉E}9}M]U9UU̅U؋E}f.&029r}Gu9!F)u؍DE؋EԉEUEE9'EUċ} :9t?Eȋ}ĉ}ȉEED$E$ME>Eԋu؉0EȉEċEEȋE9E^Eĉ$]=1X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$];}~]5D$ lD$D$y<$$ ÍAD$ lD$D$x<$$k]5D$ dD$D$&<$$]D$ dD$D$'<$$wh]U4?HUT$̪D$ ED$E D$E$]fffffffffffUWVS >HEuVtG~^ЉUv.&.&tP1H1 uN9H u [^_]ËUU$]辳t"N^HXNH UF [^_]ÃUWVS=>Gu7uu[^_]*F$$Ȥ4$NjF$$賤[^_]UWVS=ÆG}E wu v.t&6tk9uFVO9N uO1MO1 MtGD$ D$T$$|GWG1D$<$KtG9F [^_]ÍˑT$ |T$D$i`$$3E GffUWVS=æFu8F}9FiF FD$ D$D$$FVFD$F D$$FtotfxWFvthV uAzN)91F Ju M ]z u F MЃ[^_]1}81F u1UWVS;ÝE}7t2G$$蒢D$<$ƋG$$u[^_]D$<$Ɖ[^_]UWVS ;,EE70E@$$D$E$,ƅ@ ‹} 6@E@$$蝡ptiEM 1D$E$ƅt[P } uWuYu}8닋E@$$t= [^_]äDf9ft8}8E1E xIE xfff̀rS[4C@ [ḃ̀rS[C@ [UWVS$Q9ButqEEE E8D$D$ED$ t$D$E$9ƃt 1$[^_]u8 uk81ፃ D$ D$D$<$$`ffffffffffUWVS0}8&BE̋]} 9E1u9 &t8u)؋U+0[^_]ÍM1D rE̍.&TЃutS؉].t&.&.&t\="t]W$]nI1B]dfffffffffffffUWVSA7@}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU P7D$ D$D$=$$U 끍7D$ D$D$<$$U KfffUWVSa6@M} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$Ɖ[^_]ÉUMP7D$ D$D$A$$UMP7D$ D$D$@$$UMUSU5>Ey |(9~)ML$„R.D$E $1[]ÉD$ D$ED$E $1[]UVS4Å>Ey |(;}.D$@„R.D$w 4$U[^]ÉD$ D$D$@w 4$K[^]UWVS`4>u} taEtHR.EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]Í>D$ D$D$? %$uID$ D$D$@ %$FfffffffK̀rS[=@ [UVSU3<ulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS2z<]l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp4819u[^_]Ë]싃tpu޸UVS1`;L4$aulU4$D[^]ËE4$-[^]UWVS ^1;} lE[LE$lttp)ЉȉB}H}wQǃǃǃGlhEG1E$qE [^_]1뜍Gƃ}?v8}}E?EG EElE艃hE=p)ЋM@G@EE띍 D$ D$D$Y`%$vE$fEEE3UWVS n/9lEEẺEыE)ȉE䍃LE$ٕlUp)ȉAEplt)̋Ep1thE$>E [^_]1끍 D$ D$D$`%$bUWVS8.7L<$ޔƉ<$ϔ[^_]US -ä7ED$E D$E$t []US-s7E$[]ffffUWVS-F7}tHD$<$ƅt&tt$<$[^_]1[^_]Í D$ D$D$A%$9UWVS-÷6uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]*"썃 D$ D$D$V%$kNfffUE U9r 9]ø]UU E9r 9]ø]UWVS+Ï5w w uw <(9E1ɍt-ωD$4$>t w PEu׉MD$D$4$ MtMljMuD$|$E$ w 8Ftt$E$ 4$uMEw 9t$$袨ǃw ǃw [^_]Éw TD$D$$苳[^_]UWVS*I4u} t%~D$4$tt=t1[^_]À=t[^_]UWVSJ*3ut4t$<$ƅtD$<$ 4$踧[^_]ÍD$ <D$D$%$UWVS)t3}G$ƅtx @D$$~[^_]UVS)'3ut/t$$tU 9P [^]1[^]ÍD$ $D$D$%$3UWVS )ñ2U<(9E8s7i1}ƉUE D$ED$<$u E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVSQ&ƍUIET]UWVSh9E1D$<$}AEtFyL$$L$T9~L$ T$D$<$U+u h[^_]>f+̀ffffj̀rS[@ [ÒrS[@ [UWVSæ}u t$<$u 1[^_]D$FD$<$ tۍFD$<$YtȍF D$<$Ft&D$D$D$ FD$t$<${z;D$ D$D$G&$:6D$ D$D$H&$ffffffUWVSv]}E 0|$E$Ctp?9}raeto1Ɖ\$E$U]9suM9u+EE $]E E E8t 1[^_]ÅuUuCtD$$]QƋE 0i]D$s$랃t.t&:똸vLE8qw .UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVS9u 9E1V F\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …x^D$dD$ TD$XL$E$6 …x'hD$t$E$‹\f8tVE+oЁĸ[^_].֍F\DžTDžX\IP\p9{\hD$t$E$x\NP\6DžhhD$pt$E$Fx'q\D$ hD$D$4$d\D$`D$ TD$XD$E$ \88Jffh̀rS[$@ [UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS  óu}F9r+)F|$E D$F $a~  [^_]1 [^_]UWVS ]u}F9r+)F|$F D$E $a~  [^_]1 [^_]USs  EU ]t,HPP UP[]ÍlfUWVS! }u tgt$<$kt6tu*t$<$L[^_]ÍFD$<$诬u 1[^_]Ãt$<$蒬[^_]ÍD$ D$D$(&$菽j;D$ D$D$(&$`7UWVS6}u tnt>t$<$脲u[^_]D$ FD$t$<$腴[^_]ÍND$ D$D$X(&$Ѽ떍;D$ D$D$W(&$襼cUWVS{ }u t$<$u 1[^_]ÍF D$<$褱tF t6u$FD$<$tăt$<$뵸[^_]ËFE }F[^_];D$ D$D$w(&$ͻOD$ D$D$x(&$蛻 UWVSqu} t tJD$|$4$葱[^_]Í;D$ D$D$g(&$.uD$ D$D$h(&$UWVS~}u tet$<$蝩u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$U뵍;D$ xD$D$(&$QqD$ xD$D$(&$BUWVSÚ}u FFt 1[^_]Ét$<$藨tFD$<$ tӍFD$<$qtF D$<$^tt$<$K랍;D$ hD$D$(&$NV)D$ hD$D$(&$'UWVS× }u -t8GunG toFF[^_]ÍL$ M썃XD$D$%(&$U艸GUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ LL$D$$E( GFG F[^_]Í*D$ XD$D$$(&$螷G EL$ @L$D$ $uE   FFfffìrS[ä @ [v̀rS[Ä @ [VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS1 uM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1эdD$ D$D$:L&$pM E9M D$ D$D$;L&$5M fffUWVS(ã ƉЉ9U1҅OD$ |$D$$ċ<$脩@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ ܒD$D$ $)g4t9um΃tft%D012 (T$ PT$D$p&$]v3T$ PT$D$p&$"-D$ ܒD$D$ $fuoN }L$$ te$>ff^N mF.t&*UWVS~ƉE 9E1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$Ї4$营9E{ED$t$$+1F5EDž*FfEMfD$ ܒD$D$<$6c<$ؤ9EED$|$$sF<<p EED$D$D$D$ T$pD$$v~0wDžFȉсI<<9fE<|$ L$D$$U8<$]9Er8ED$|$$$mj$m~3LED$E$NDF <Džytt Eut2ED$ D$D$$st1ED$E$1C%UWVS<êuU EEMEE܋EE؋E E9E8}1w~wF}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ ܒD$L$M܋E$^M܅x9lEE܅t E؅aFfVT$D$ D$L$M܋E$^DžMn9fFfF fV ffuu҉T$D$ ВD$ȉM)D$4$-^Mx 9EtEc҉Uԋ}^UT1pE܍E؍xE̋E܉M܉u ET8ẺT$D$ E؉D$t$ $M]9M)ƃ9}u1hȃiviD$t$E$製1?FD$ ߒ EEEDEԋ}1pE܍E؍xEЋE܉M܉u E8EЉT$D$ E؉D$t$ $M\M9)ƃu1yMFD$ ܒD$D$}<$D\<$M9L$|$E܉$腼MFUU܉D$ ƒD$ȉM)D$$[M9\D$T$ D$L$M܋E$[M UWVS@Glj΋E9EG uY$fto|$$gt9wuҋtD$G $謞u1ffh$}@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$t$ |$D$$gu8u Dž11fBUVS Äut$F $eE $MUYF t [^]ÉE4$cE [^]ø̀rS[$@ [UWVSa}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$>qn8[^_]1[^_]UWVS[ut7D$4$FftID$4$[^_]ÍY1D$ D$D$@&$_띿ffffffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUS5PtSt /[]PtfHuX uHuxuπt[]Pt#u[]@ tOEYD$ ED$4$05uEt8u x[^]ø[^]ÍD$ lD$D$&$eqUWVS(CtƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJ f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.<븍3UWVS0Ɖׅt5tet&u 1[^_]É $GuMT$ DT$D$&$םMuMT$ DT$D$&$裝MkMT$ DT$D$&$kM6UWVST;։9E1|DžDž&F F`FD$$D$ D$D$D$F D$FD$ D$D$<$lu G @u}D$D$ L$D$<$_O @,1ƒ $VD$D$ D$L$<$~QG KD$D$D$D$D$ T$L$<$負E+ȁT[^_]ËQu7Iffft#fFPЃ6tRr D$ D$D$ &${Uߟ+t't܃t&u貟襟蘟UWVS(ÚƉЉ}9U1҅t\D$t$ D$D$4$L=1U+([^_]É4$PPwstP|.ut$T$ D$D$4$eL댉 T$ T$D$ &$fOUWVS4^}ĉÉ9EЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ]OUWVSöƉ׉MEOD$A M$"[…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftugD$ dD$D$&$=0D$ dD$D$&$f mUWVS&b@DϋE$E,9ƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} um>(Dpf@fPff[PD 8Hx LD$ |$ T$L$$蚖…P @@ u+!<$菖f$R莏t,$ډL<$軌 LwdmPu .8tX<9 u拽4t t҉tH9Y PP1 UWVSpyƉ9NjE1>$H$H`11D r틅FFtGGFUCF薍胍1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$蟌8=.t&脌G au$1ҋybK;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$IN$;NU+cp[^_]Ã){$M$M1녃1(@<tcE D$ D$D$$u|d@=1$1ҋ_/@ P$1ҋ|f8 D$ D$D$ &$較$1ҋR@uu*$HDPDE诈E$K茈1gUWVShEdpPt%=~h讈Dž1E1 Dr]`1 DrV]pdMEE`]MEE$E]1 DrFdd<$hdU[^_]É<$hŇh.[^_]ÉЉ`6`fXh\G]1}`X D r틅h HOT`@pPDXLHHX9HHD$ PD$D$L$h)dL$P T$ D$DD$l$:xq]1EDr틅lEEE!$\Xl$h(H9TX\d\$h萅EE؉E؉d<$hIdS|dMEEdMEE‹`MH@A‹@u@<$h軄UWVS`ZljUMMME EEE9E‹E1EE$Uu\WtUL&t89uML$MML$$OMt u܋E01}U+`[^_]ËG;t?OƅE$1ɋU "D@u듍ML$ME$1r"D$E$T4M<MMG;tƅE$1ɋUv.t&@uD$ TD$D$&4$|EED$ xD$D$4$T|%uܸEvWt$D<$DuEaME뺋M#UWEw ]Í<]UWVS*ut(vGt$ D<$Du[^_]ÍD$ D$D$r&$={UWVSøEdE tEpMh9lNjE1x1󫍵1҉D r퍍T11D r틽dpPu x x$9Dž hlE+[^_]ÍD$ D$D$&$y t]DžDžDžDž|wHt;u Džx$tT+ l`XtGt`u\W9tCu+w9 t  | t1҃1҉ TL9G9}Gw9 uuttdx$tTLf.&9u`q@D$%d$e@gd$…^ d)xD$L$4$tPTP `pLH@D.t&.&vZ~u~ x G<_x$tTLt&.&9uiJTƅyx$1ɋtH`phG <t`V9&ut뎋x$+-Ls8vDž:@D$-6`ptu t Džx$y,vGt$5<$5ux$%,Dž|.Ix҉$+Dž>$ 58JhD$ 4D$D$x&$=l>x$z+Džx$]+DžX`A{$0"DžDžt?G t,Gt&H?wB11  ?uNj<$7JD$ D$D$f&$kG H닋Dž(D$W3Dž{vGt$(3<$ 3u DžDžvXx.fǃ 4$1ɋt.GtuŋG@fuXHS$&*D$D$D$ L$D$ $6ȉQH9rs$P) xrHH9s $1GDžPȾtp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$Xx$1ɋD$D$ $y|$L$$ ~D$|$$FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $7ctpD$ D$t$<$~')ʍ0&J9uB<$W.Xt;1AtF0 $+.Ft4$ .X@FXVDž|1dH1׉D$ D$D$$蔢T$D$Ii $IwjNxa 7 $*-x$#5x$#DžFB0$,t2Buቅ߉UWVSpԮmMEׅ M11D rEME EED$ E$]-HMt$E$]OoX@t\}}< < ߉ډt$$]t!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍD$ (D$D$k &$a]D$ (D$D$l &$taUWVSpJuE$腐>FEu11D rE@tmEEEE<$UML$ML$D$ |$D$E$聐twEЅUp[^_]øp[^_]É<$|UMML$UUT$D$ |$D$E$t2E$(RUEetFE$(gMEԋAE܋A EAEAEAEAEEUԋEtEЉƋ@u{Ve!UWVS\ 諪P9NjE1a D$ D$ D$ $3ƅ?8#D$4$D$4$x1҉< tv< tr׉ʋD$$ƅtbHT$$NGFt < t< uσxzT$$uЋAAA AAAADžD$ D$D$4$fU׉&.&t틍tڋ$_D$$}k1ҋE+Ё\ [^_]ËډD$ D$D$ &$\ D$ D$D$ &$S\\UWVS4ðEȋE8Hu11D rM̋]ȍ_D$$nEЉuЋM̉t(Ct&.&Ë@uM̉u؋EЅt $].EUt 4[^_]ø4[^_]UVSQuD$F $tP PH p[^]UWVSDêljE9EG ut$gt$$ctӋD$$lQtD$F $KQue$1O@=wI$ O‰@=wЋЉ=@1U+D[^_]Ë~D$<$Ptu狵1DžЍtftȍtftD$D$ GD$D$@$+9qt89FD$D$A$z<FL19\9PB 9=0t9$9uۉD$D$ $wuD$ D$D$$I(u9u Xu3fvfvB[UWVS«}utHt$F $=E $UF t[^_]ÉE4$E[^_]Í D$ $D$D$X($VfffffUVSÉ13v.&.&.&.&.&.&   lLLLL9r[^]UWVSTNjEGEGEG EM],t&.&.&.&.&.&Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVS4٣ut0FF#EgFFܺF vT2[^]ÍD$ dD$D$($NUWVS轙bEBU oP?ωMM1ÉPHUʉP@)|89]riڋu uwuoxEE);UEމ}E} ]7E@9r})uu Eu sItft[^_]äftX] E]DEvT$ XT$D$($WMEU EcT$ XT$D$($ME\f7u S,f$UWVS$螗CEE} 9E1WEEG?78)‰T$D$<$cD$ED$<$LEyX1tftE+$[^_]úx)rD$ LD$D$($KD$ LD$D$($qKWZfPdUWVS$.˟}ЋME E9EƋE1R.ljEDGtXEE؉ƀ0xC1E 1҉uËutFt9}t`}׍Ty1ME+$[^_]Ã}u1ft* ta) 봻A8w믋u܀.u{E9twVË}DGt03Y؃PuuE @4E [^_]Ã댉U }OD$G$6DžUtf.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴L1EE<2w] EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVSem wljE 9E`M!t8\$ND$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,hhDžD$ D$D$$]j uit_atP%xrt& r; ut$ؔD$$u f})\D$|$D$ D$D$$ g:t$$%t$$ H%88%$D$ŔD$$t$E+Č[^_]}v3.& p;8u}vThl.t& P;8udt$T$ D$D$$U$8<$\=!\$3uD$ D$D$$|$D$ D$D$ $uz|$D$ D$D$ 4$Iz|$D$ D$D$  $z|$D$ D$D$ <$yd) D$D$ D$D$4$y}艽EЉT$UT$ D$)D$$06R.9D$,D$$\)U frffXftD$D$$1&D7D$D$$9|҉ƋD$ D$D$n>$1D8 DAu.L$$*9|ȋD$ D$D$$aD$$ 5 D$ D$D$ $0fuAD$ D$D$$lD$ D$D$ $1&D7D$D$$9|҉ƋD$ D$D$n>$91R.D8DBu.L$$<9|$D$AD$$UWVSdtnEĉED$ED$E $a>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,1`ẺEEfEEEfEEEfEEEfEEE`t3 u'^"lUoUUt& x;uED$|$ `K.D$H)D$E$?E`t eED$$;E`AED$ D$D$r$~D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^;D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,7^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,g]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\aD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,/\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[=E`ek‹wt& puED$ t$D$E$:k‹w p8uED$ t$t$E$jWc& PJ8uED$ T$t$E$jWuf Wz?uED$ T$t$E$aE`t tED$$ ED$$1ɋuEzED$$ E]ED$$@E@ED$$E#Ef Ef Ef EĈ[^_]Í T$D$ D$D$<$=n D$D$ D$D$$UnU D$D$ D$D$4$m D$D$ D$D$$UmUP D$D$ D$D$4$]m<$mD$]D$E$nĈ[^_]ËED$ D$D$$ED$ D$D$$ED$ D$D$$uED$ D$D$$^ED$ D$D$$4QED$ D$D$$ ED$ D$D$$-ED$ D$D${$ED$$ jIUWVS$Z`duE }9U1D$L$ t$U‰T$$}xVD$t# $U+u#$[^_]$.19UED$ D$E D$E$]UWVSYuc}ED$|$ ED$ED$E $x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$LYbE9E1D$|$ D$E D$E$&…tD$<$HE+u Ё$[^_]UWVSX^b}u Gu 4 Gt*D$4$uUt E[^_]ËEtE[^_]UWVSHXauSd~M u7&.& ~t9uUt E[^_]Í L$D$ D$D$<$hEtËE[^_]UWVSWHau} cVu5f.& Vt!9>uMt Ev[^_]Í|$D$ D$D$4$hEtËE[^_]UVSWæ`u cThlt& Bt ;2u[^]Ét$D$ D$D$ $gv [^]Ét$D$ D$D$ 4$Ng[^]UWVSFV_U} tfUBb~U f ~t;u[^_]Í T$D$ D$D$<$f[^_]ÍlUVSUa_ua3&.& Bt ;2u[^]Ét$D$ D$D$ $?fv [^]Ét$D$ D$D$ 4$e[^]UWVSTÛ^}auwX w t&  @Bw- wi ue@w, u86\u(LuB<u),1|$MD$ D$(D$4$d[^_]Í)#捳ލ֍ӕ΍͕ƍ뾍֮붍뮍.릍랍5떍뎍UVS:S\uE_D$(YD$4$_x#_Y[^]_t$ ܒT$D$(Y$UWVSRk\}^Uv.& rt;:u[^_]Í |$D$ D$D$4$Lc[^_]UWVSLCR[9E1E <tmD$UD$ D$.D$M‰ $MbMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$M~UWVS4xQ[EEEE$GE܍U}}؉HEU;EEU t 14[^_]ÃuuU<-1E<+u JMBR.DK+r1&.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF RGEuuESt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVSaMVEU UHMHMHMXˁHɁ@ ='-E썇pE)ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)MEC$yEE-$yEE$yEÅU܋MXE^}d\$DD$@ED$<]\$8T$4]\$0]\$,]ĉ\$(t$$L$ ut$ut$uԉt$uЉt$ủt$ uȉt$x)D$u4${%E$Et $Et $EČ[^_]ú)‰U썇iEESEW- uVE; er@ror:@ unk@ nown@ LOC@ RR @vers@ionEČ[^_]ÍsEs}\$DD$@sD$*t<.tȅx%[^_]Åt<.1[^_]ÉM\T$ h!T$D$)$E[^_]UWVS0HÃRTE荰EEEE$WPlPHH8|$ x|$x|$@ D$L$T$ sD$D$4$觰~ Eƀ0[^_]UWVS9HQu3 Gt-D$4$u?E tE [^_]Ë?D$D$4$aukVR.DPtM@D$ ED$4$讍ҋMyE8m1Ɂ]1VUWVSIGPulTh Gt-D$4$ u?E tE [^_]Ë?D$D$4$qukVR.DPtMPD$ ED$4$辌)ҋMyE8m1Ɂ]1VUWVSYFOu D$4$FFy ;F|/} t)P}D$4$[^_]Ét$E$sUSEÇOEM QQy ;Q|< tZ[]ÉL$$%[]UWVSE5OEu E$jEEEEED$4$F0u ǀED$4$D$4$[^_]UWVSEëNPPƠ%9uV@ttuF*V@uuOFuuFuFf~@t8D$4$Tlj4$kP[^_]ÉFu뺋F몉4$QfF@UVSGDMƠ%9Fu t$@J.XD$ D$ED$4$'[^]UVSCØMƠ%9Fu tE D$ D$ED$4$[^]UVSCJMƠ%9Fu ztED$ E D$ED$4$[^]UVS,XCLƠ%9Fu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$D,[^]ÉED$4${EUVSBnLƠ%9Fu t2ED$ED$ED$ E D$ED$4$37[^]ÉED$4$EUWBL%9U]U9BK%9U]USBKED$%9$?[]UVSAÒKƠ%9Fu t$ED$ED$ E D$ED$4$[^]USA?K%9$mO[]UVSsAKƠ%9Fu Ht2ED$ED$ED$ E D$ED$4$=[^]ÉED$4$EUVS AåJƠ%9Fu t9ED$ED$ED$ED$ E D$ED$4$9 [^]ÉED$4$8EUS@,JED$ED$ E D$ED$%9$D[]UVSD@IƠ%9Fu t4$lM[^]D$$US?ÖID$ , D$ED$%9$9[]fffffffffffffffffffffffUWVS ?&IE8tj׉ƅt|$4$Ot@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS>ǓH}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$E͜T$ D$D$*$ L.EE룤u9sftuu_SfӋ]KUWVS0=ÆGE׉΋UU܋U؋U$EM9L9MyܜE荃EEuuE9D$E$t4$ME*t4$MuuE$EtE؉Eu܉00[^_]ËuE$Etu)y9uΉE+T$ %T$D$*$E0[^_]1UWVS$N<E]Uϋu M MUL$T$ L$U‰T$$"EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂͜D$ D$D$*$ L.Eډ)؋ux$[^_]ÿ뛉댋]썃D$ %D$D$*$뷋]/EE}8UWVS(u:D]}u ӍR9M)ÃM L.E썁͜EЉU u2D$ED$ D$D$E*$EJBs1([^_]É4$E* t+([^_]ËUU]UE([^_]UWVS+Y9BE}E(M,u M0p9tU1҉u$t|$$I:ƀ?YE4$k:DžU4T$|$E$-Eƅ9s9D$͜D$ D$D$*$ L.7)U4E$NjE$|$D$?5D$ D$dD$$HNj $‹>|$ $}wyEt}wvM!򋽤(t#t<.z<7|0.}u$ U$pD$T$t$D$ D$dD$4$nG‹$i9&lxR.|f @)~ DžƋD$D$<$9u׋)lj4$}O<$xJ|$4$1ɺ0f; @|01x DNu.9uՋʋ)‹4$9gƋp)p9D$ %D$D$E*$J}+R"}$4$VD$ߝt$ D$dD$<$D‹$$D$t$ D$dD$$nD‹ $eGD$t$ D$dD$4$D‹$9z9[D$|$ D$dD$$C$utE+-Ĥ+[^_]ÍE4$d)5tD$$1ɺ~ln>8E4$3+D$D$$U &Ƌp)9D$ %D$D$%*$I}$ 4$VD$ߝD$ D$dD$4$A‹<$4|$D$ $Dž- Ɖ$+ H}u ;}$$|u$),D$ߝt$ D$dD$$@‹ $ GGD$t$ D$dD$$R@‹ $IG$D$t$ D$dD$4$?‹$_wGo"D$|$ D$dD$$? $9u}3$+ ;x% nG GGDž====Dž$`lj9w\&79&&Gt1Gta$D$D$ D$dD$$~=‹ $uuO}$<$fOwG$$T$t$L$D$D$ D$dD$$<‹ $$9 E$p}$4$V~NL$T$D$D$ D$dD$4$;‹$TD$ *@D$E$pt$<$C-Dž##?#+ 1>)0~0 $a09"$,‹ $#u|$D$ $U R<$+ 0|$T$ $ + 9$sƉ9$)u}$@<}$D$ߝt$ D$dD$$9‹ $GGD$t$ D$dD$$K9‹ $BGD$t$ D$dD$4$8‹$bGG<o"q"}4|$ t$D$$軳4$9s?D$͜D$ D$D$*$ L.։)׉}49)= $ĝS@u$D$D$ D$dD$<$y7‹$t6c'92@Dž@DžDDžHDžL@)‰t19rE4D$ |$L$$賱<${9s3D$͜D$ D$D$*$ L.)U494$+ Pt$|$,ED$D$ D$dD$4$5‹$@t$$4$A븃}$u$f}$v}4|$ t$D$$.4$9s?D$͜D$ D$D$*$ L.։)׉}4FD$D$ D$dD$<$n4‹$iF9|Dž1pƀu2$BDž |$D$ D$dD$$3‹ $|OP9w|$D$ $U v<$+ T|$T$$U Y%<$?)‰Ѓƍ@t$D$E$$+4$)D$D$$U r)j1K:f.&.&.&.&.&.&.&9t؉4$QD$D$ D$dD$$$1‹ $u}$4$F$$D$t$|$yD$ D$2D$@4$x0}$<$.G$ D$t$|D$ D$2D$@4$ 0‹$q4$Mlj4$+ $zlj$H$0lj<$]|$D$$U ^8%<$cG$UOWT$D$t$D$ D$(D$4$8.‹$3E$p VUUU)ȃ= $ĝ[Ht$|$$U C4$+ z4$2~$bD$ED$ D$dD$$ -‹ $o<$~$D$T$ D$dD$$,‹ $<$IfF $7 4$)D$|$D$yD$ D$dD$4$,t$|$$U a4$+ CF$~t 4$o4$dD$D$4$4$j9E4s3D$͜D$ D$D$*$ L.>D$D$$U v9pF9Gt1Gta$bD$D$ D$dD$$5*‹ $,uOE$ VUUU)ȃ=F$ĝ>+}$e}4|$ t$D$$裤4$k9s?D$͜D$ D$D$*$ L.$}~F$B= g$ĝ}$+4$%VD$ߝD$ D$dD$4$(‹<$}$ )ƍG GGG GG GGƅ=t9yG GGG Gƅ=fDž==fDž==Dž====W GGW GW GGW G$g<|$ݝD$ D$dD$<$$‹$eD9D$|$ D$dD$$w$ $kuD$ @D$t$$Dž  + 1F)0~0 $K09 <$譼‹$uD$ @D$E$D$$ + 1F)0~0 $09Y <$‹$uJ}$ߝ4$lj$}|$YD$ D$dD$<$5"Nj$‹*T$ $1ɺyk$ CC4$Nj$u4t$D$<$9Dž9s3D$͜D$ D$D$*$ L.)u4t$$1ɺm_4$ M=$Nj 4$u4t$D$<$3Dž9s3D$͜D$ D$D$*$ L.)u4t$$1ɺgY4$X7$Nj4$u4t$D$<$-Dž9s3D$͜D$ D$D$*$ L.)u4t$$1ɺaS4$ a/$|4$u4t$|$$+9s3D$͜D$ D$D$*$ L.lj)Ɖu44$kMt$$1ɺ7)4$ n}4|$ t$D$$$iH)$qT$ @t$L$$X…$ЉPzD$D$$U 9ȋ$rk s}$ f<tu$n>!<$r $D$E|$ D$dD$$x‹ $o4$-r$WD$|$ D$dD$<$‹$ t4$D$ߝD$ D$dD$<$‹4$t$D$$U )D$ *@T$t$$ + 1F)0~0 $D09<$覲‹$u $n>xY}4|$ t$D$$Z4$"9s?D$͜D$ D$D$*$ L.։)׉}4<$n>~($keD$D$ D$dD$4$$ w$n>O;|79})$n>v$n>CD$ @D$L$$ƅ[o+ 1>)0~0 $097$~‹ $uu$d)5<u덍D$D$$U R$l'1$n>|UWVS8P E  U8ud)E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$P8[^_]UO M8E#ʬʰ]UWVS}" u}'|EtG9E r'Gf|t+E D$<$պy躽([^_]9} r+Ey;}uET$ 0&T$D$l +$E뵋E9E r1UWVS] EE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]~(UWVSv Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]07F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,bxM]`]P(UWVS M Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cAN])](ffffffffUWVS ]E}]} 1E䍘l&;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃T$ X&T$D$H+$аEE1F]䍃/D$ X&D$D$H+$萰1ÍP7D$ X&D$D$H+$_=-M uUE1|1UWVS E}U GE11]ƐR.u荳l&uuMt;}f]):.&.&.&Ftn]DC@u=U MD$E$]xMU tFjt;}M):1ɃFuutȃ [^_]Åtv;}sW])؉ :;}sN:AtC;}s)M)ȉ :;}s :tȃ [^_]Ät؃f룍FEuȅu].t&CtuDA@u띉U ]䍃/D$ L&D$D$H+$U ÍP7D$ L&D$D$H+$έU ;}<: M.t&.&ADC@u=AE}]䍃ZD$ L&D$D$ZH+$)M"fffffUœEt,]Í,]UqEtwt#t]fÃu]Í]1]Í{]UVS %EuVp΋E$L$t$UT$D$E D$ ED$D$@J.$Qd蘈誱$#|*UWVSÛuWE >0u Fh+${zMUWVSI}u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉET$ &T$D$gh+$EEL UWVuL o^_]ø1 fffUWVS\fϋMM9uM1t$D$GD$ D$2D$M $MaƃM9r,ML$$A7M)11}U+u\[^_]ø\ UWVS EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: E E+Ju}: w) ]u$M EÉ$SrKE}~=Ut3}ƐR.njR.w\DAtu܋E Ƌ})x [^_]9u]䍃D$ &D$D$e+$ [^_]ÍM U$WEM E$DtiEEM E$HEbt?EM EÉ$MM7tEMffUWVSvu4$豚H9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} q(yUWVScE 9E1D$|$E$tGD$T$${tT$<$4NU+u [^_]MfffffffUVSçEuUMx#L$ T$t$$Vx9s[^]ÉL$T$$[^]fffffffUWVS 6utcEt\E $)ljD$4$*u?|$4$Q&u%džt$|$E$# [^_]É4$%f謨UWVS äutcEt\E $(ljD$4$)*u?|$4$%u%džt$|$E$" [^_]É4$O%UWVS ou t\E$'ljD$4$)u?|$4$6%u%džt$|$E$! [^_]É4$$蓧UVS ÌuD$4$o!tD$E D$4$5 [^]D$E D$4$ [^]UWVS$u} tAv-u3D$4$'tD$4$3(F1[^_]軦USøEU tttu P1[]vUWVSn}u t' td@t/tZv{Nw u6(D$<$&tD$<$R'71[^_]D$<$&tD$<$"'΅uʍ&UWVSôu} tPD$4$a&t͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈$\$8؉ȃD$xtD$xj݄$D$|'tru|$T݄$L$PtT$0D$4)‹D$|(Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|;ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|TH$$Lt$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـx\$8ـ$RD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|(S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|SMD$`U|$p|$$N1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$|'D$4$.$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|9LD$`Z|$p|$$rM$%|$x==p$$\$|DD$h$DD$p$DD$H$DD$`$D$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaUEQ.U E]XUMU E]Fffff̀ffff̀rS[@ [̀rS[@ [̀rS[ô@ [̀rS[Ô@ [UWVSvu Et"4$tEExu4EE[^_]ËED$t$<$utGt8Eu׍GEE[^_]ffffUWVSAu} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]Í+D$ x(D$D$e+$}+D$ x(D$D$f+$}UWVSru} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í ,D$ (D$D$C+$|@,D$ (D$D$D+$|d,D$ (D$D$E+$|1sUS6E ,T$ D$PT$$>[]USÜE$uE []1[]UWVS$[EpEEEEEE1ҹEEuxw88 w38'E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`USqEU} ~\wEBu - t wJt Bx1[]ùr u-JuB-袀萀 UU1Ʉtt'4$nD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US[Ut/9E t*ڞD$ (D$D$p,$dxE []USãM E%t.9t*ڞD$ (D$D$p,$x[]UEtt]1} ]ËE ]USaE ~>uTEtKڞD$ (D$D$p,$`w~Ewǀ[]ËEǀ[]US}EU tt 1[]D}UWVS<$ 7Etc@@|D$D$4$&|u E[^_]|84$?|81EUWVSëuthF~O9tHNM 1[^_]ÉU^|ED$|$E$U7|u=FUF맍D$ (D$D$Z,$~vi|UWVSJ}t;t-M tWt1$>;wr$><$>[^_]UWVSÑ}tJWt7E1U9}t#E4E D$4$lu߉[^_]1[^_]ÍD$ (D$D$,$uUWVS[E@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(2D$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 D$D$4$Hff D$4$>[^]ÍY1D$ ()D$D$6l-$bUSܬÁED$ E D$D$E$$>[]ffffffffffffffffUWS肬'Džt)tYBfBfB B [_]ÉUP7D$ )D$D$M-$7aUuU7D$ )D$D$N-$aUrUWVS֫{lj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]ÍD$ )D$D$`-$-`UD$ )D$D$a-$_E+D$ )D$D$b-$_UWVS\衪>ÉEEE 9E1fjDž9E]qA D$.$(zR.8tGt3\_u<.uuy.u}fD$:$(tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $3R@)9x‰ ȉ@ ME4$'QL$D$t$LD$D$ D$LD$$蕏A,Dž9E0a D$ )D$D$B-$~[D$ D$D$$DTIf ugx.fcD$:$u$?fnUWVSlaZ‹BcB $(>DžmDžDž D$$DžtUpЉD$D$$<+Gt< tu򋽜$H@)49O)9y )ЉA V1ҍ;tftH<@ lj)9t?9rr ΃rj놉D004$L@9U$n @ E]Džl[^_]à f.&< t< t򉍼CD$4$j P8 t$$ N19<)׃ D$$#T848#Iu‹tft‰)‰DžNtftR :)9&44$J@9‹f&B0tP< t[< tW< <9s>z2D$4$ tpu׋)ʉ׃ (D$ $ 8f cFt$$]K'9Dž1Ct$$Kz90CD$ \)D$D$^-$SwP$3f0x0k$Gtxf\>0N7L1UWVS``E‰Eu9E1FE@ D$ .u‰t$L$E$')}5EE4$FML$ML$D$ t$ED$@ $q‹Et]$GE@ U+`[^_]ÉM@ $躀M<ʍ(E`MUƋE$u눍D$ h)D$D$-$Q$UWVS(ËuE>FE苳@ }tgUE<$EML$ML$D$ |$UT$4$9‹Et)$E@ ([^_]Í뗋MUƋE$t([^_]Í@ $_t:@ ED$ L)D$D$ -$OqUWVSh跚\։} }}U9E1} om>$(p 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$#<))9yrtft1'$1U+ h[^_]?z 7t$$l*D$t$ D$D$$BK@ 9N04$==3׉T9E>f t$$c9P }u,04$=tp9J90Љtftפ9P'$1;NjE$$;$[<|$t$D$ D$'D$$%6<$;=9D$ )D$D$-$F. D$ )D$D$-$qFD$D$ D$D$$&Hg@ 399x04$:=1Ɖ$}:P)9| At$ D$ *D$$%r<$ :p)9L$L$<$X8f&($ЅwDž$ I1Ht$ D$D$ D$D$$EDž8@ ?9$8x9D$D$4$W>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $Ulj$ FfDž 1DžD$D$4$T0։9^f 19s<04$CJ})σ (D$ $ljUWVS$èu}6EGBEB $E+EDžD$ED$ED$ D$ED$<$R…F D$FD$FD$ D$|$E$MElEE$<$lEEt $[^_]ËF t:$[^_]øEE$u<$E$[^_]ÍD$ )D$D$-$>E$&F 뮸xUWVS@UMu9‹E1kFB FBPƋ]}ۉ\$D$ D$)D$<$~HNj9s4$u@ D$ x)D$D$-$:`4$$@@ -$@@ t҃$S@2fJz UWVS迄d?ƋEtvF u>ED$ ED$ED$E $Elj4$?[^_]ËED$ ED$ED$E $EDžt뼍 D$ )D$D$-$9[E1UWVSLj>t@ËED$ ED$ED$E$ًU EƉ$>[^_]ËE1[^_]UWVS0oE}u  t=/10[^_]Ã} uyMMUUUUu|$M L$D$LD$mD$ D$ D$E$skuE0[^_]Ã} t==a8t{bPWPtD@ 7 E #T$ )T$D$-$97Ex{UWVSXÜ}E EЋEEEE9E‹E1$(1 E؍EEȉMԉ}܉<$2D$D$ D$D$E܉$qDž E؉D$<$XƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$zPu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$)@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$(@9Er7‹}ԃrsSt}MԉM܋E$iE܉$^D9E1uU+X[^_]ÃỦϋU)׃E (D$$t 8E܋UEȉD$|$$79P@ EĉỦ $R9ŰEMEЋPEEE$tE܉$iEaf{E̋EM8Mԉ $EE7ufiK1E܉EUS|yS7D$D$@, D$, D$ ED$E D$E$[]US~|#6D$D$ @, D$, D$E${[]UWVS<|م6'7tDÉt$ D$@, D$, $ًU EDƉ$07[^_]1[^_]UVS{^ tpǃ, ǃ0 ǃ4 ǃ8 ǃ< 5D$D$ @, D$, D$ $?Ɖ[^]Í $ t5ΐUWVS0{æƅAqR.8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]NȃE@ fu+-dt ufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$E@0E@}Gfg D$<$1İ[^_]Q}Wf9xD$$3‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09FE E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$yE 1[^_]ÃuEt$RE ԅtEuT$U$EM U_%D$ `+D$D$`h.$M;D$ `+D$D$^h.$U D$ `+D$D$_h.$`+D$s$$UWVSQG[}u t'tQD$ t$t$<$ [^_]Í;D$ T+D$D$h.$XuD$ T+D$D$h.$*UWVSQèZ}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃MD$ H+D$D$h.$XUpU썃3D$ H+D$D$h.$#UE1U썃AD$ H+D$D$h.$UU썃;D$ H+D$D$h.$UUWVSO+YuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$E 1[^_]Åt<$E냉<$uE ωЃttkE녍D$ <+D$D$h.$;D$ <+D$D$h.$dUD$$NjE 8Ut Eo<+D$s$ UWVSMÕWu} t tJD$(#|$4$4[^_]Í;D$ ,+D$D$?h.$uD$ ,+D$D$@h.$UWVSXMVu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í^D$ +D$D$Xh.$B;D$ +D$D$Wh.$k UWVSALUu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í]D$ +D$D$|h.$B;D$ +D$D${h.$T UWVS*KTu} tt@} u[^_];D$ +D$D$h.$u^D$ +D$D$h.$UWVSJATu} tt@} u[^_]';D$ *D$D$h.$cu]D$ *D$D$h.$5UWVSJóSu} tt@} u[^_];D$ *D$D$h.$u^D$ *D$D$h.$UWVSI%Su} tt@} u[^_] ;D$ *D$D$h.$Gu]D$ *D$D$h.$ffffffffUVSHÇRuED$t$ ED$E D$E$E~>.t[^][^]USH4RED$ED$ ED$E D$E$[]UWVSNHQ}E D$E$St u)x[^_]9u􍃜.D$ 8,D$D$.$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]USFêOE D$E$[]USEÀOE D$E$[]USEUOE$r[]USE2OE$@[]mEO%9U\ENE M7]UEf]UE]UEfU f]UEȋU ]UWVS$DNEE EEE0PE }썿l-}Uuu9E }9sux.tb@tx U9sS@}AnVUBc} 980]($[^_]uuG뒍V>[U|$M $jU:M)ȍ<FtOD$ $=t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\] ( [^_]ø!!"UWVS(F:CEEEE܋E9ErME 9EsEEH0}}]EEƒ@dt(]n(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]sD$ T,D$D$.$=EKuV]ڋ]9 }9;] }|>}uE~΃s/uuUED$D$<$tE+uЁ$[^_]ú^UWVS$1S;E MU9E1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]É@^US]E M9r 9s9su[][]UWVS0w:EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS0ǭ9uE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉT[^_]É=()[^_]UWVS/19EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]s[^_]Ë]X(1[^_]UWVS .F8u}E9E |2&6D$D$$umtF;Gt1 [^_]ø [^_]UWVS>.7U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]ÉO(;,?UWVS-,7EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]É(F[^_]øUS-ê6E D$E$( []UVS,6uD$D$$NtD$T$ tV[^]øffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS(),5}EU܉΅lt F"}uFEUT$$]@uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVS"Ç,}D$<$#|$ ED$E D$E$ND$<$[^_]US"),D$d $*[]UVSS"+7uT [^]ÍD$L$d $訋ƅu$BƅtD$d $\FFF US !^+@U T$UT$$ []UWVS!'+D$|D$@J.<$脎E t8ED$E D$<$|$ D$D$*$E$ D$xD$$[^_]ffffUS x*E D$E$[]US J*E D$E$z[]UWVSu *E։ϋUt%T$ML$$Xx[^_]ÉD$4$膚ƅtU1UWVS î)u} GD$F$uD$$~[^_]UWVSc) l$^xD$4$mFE9l p ELh$_D$4$݌ (9d Džt`t\Os1Wp΋ t $胜pP9uዽp$eGt$Ptt ; r`t4$&ǃ ǃ | t\1tt:$Ft)NtF D$F$ыF9pt$g; rtt$蚛ǃ ǃ| Kd$˥ uAEUl p h$*l$LĤ[^_]ËWT$ D$ D$ $UWVS,H&9U1DžDžDžDžDž$Jt3D$D$ D$D$<$=~h$ | | |T$ D$ T$$1U+;,[^_]D$<$zT$$rT$T$$Љt6t,$DL$ D$T$$=;pt$Dž$Dž$t5tD$$ҋ;pt$vCHUWVS(ê$u} tmNV$VFE|D$D$  D$| D$E${1ti([^_]ÍʠD$ -D$D$~L/$uiP7D$ -D$D$L/$C:델UWVS í#}SG<mL$ D$D$֠$^GEE썃hE荃kE+E$EE;GE4G0D$E$GD0t‹E$˂GD0tQt$讂GD0x $葂GD0c$tP$aGD0$ m [^_]ÍpʠD$ -D$D$L/$~UWVSg "U1 u; v <D$E$wu΋Ot5GEt1 t $蘕O9uu $腕GD$ ED$<$o1[^_]$ Et7 ύʠD$ -D$D$L/$| UWVSlK U EIEj7EVt Pt LE$sEEčD$D$ D$ D$Eĉ$w"HM@EE|EDEEU<ЋM E u D$<$/uuNVZED$L$E$ҋUBuM}#TuEMU9sE$l~E t ul[^_] E(4$_|x U .9PuMEAx x E4$|a}ED$D$  D$| D$E$vtMPtFMMЋMMԋUT$D$ P T$@D$EЉ$utH P1EUM9EFD$TT$Xt$\L7k9)B)Ӊ))ʉ)щL$T\$Xȉ"D$TT$XL$\_u)Љ))щL$LD$H/D$ i)\i(\ËD$T)\QD$dFEUED$ ED$ED$<$ƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F.1'Xe]؉ E܋؉ }<$}؍4 1ƅ F(EUjUWVS$|$8ljD$T$\L$XE \$\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}Q)à u\$hT$P.׋T$h(.&.&.&)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 qL$@t$<;t$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9\$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 D$pT$t9#D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`6D$D$eЉ t$x|$|KD$pT$tD$xT$|D$pT$t D$pT$tD$pT$tD$xT$|É։D$hT$lD$xT$|D$pT$t9؉D$xT$|D$T$D$xT$|D$D$ ED$D$HD$D$X$D$\ЅtE D$xT$|e[^_]Ë\$8`TD$<=9Ћ|$$)D$xT$|$$$D$ ED$$D$D$X$D$\Ѕ$;$D$$9$;$$D$pt$0)$t$h|$() ‹$|$@D$`) $Ƌ|$4) 5T$<;$$$$t$x|$|$t$h$|$p$$|$@$$$$$$$D$$$$$w\$hL$piF\$p9hFdN-00dFD$xT$|L$hdF)ډ$$D$PD$ ED$D$@D$<$D$\ЅtcD$,;$uV$T$0)Ћ$L$() ‹$L$`) Ћ$L$4) uD$<;$u \$p9$t\$hL$p$$UWVSDË\$ljT$(9D$Ë$@1΃ ~G \$1D$D$D$?D$$D$E$T$(Bщ€|$?t>T$4L$8\$\$T$4L$8\$$@+nЉʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$[1ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0x$@L$ @D$ D$4L:f.&.&.&.&.&.&.&9t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Oщ€|$? D$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G 9t$ tG -t$\$49t$ \$|T\$a\$UWVSHO|$`ƉT$lL$49D$PNj$D1fB:/ t1P.tt!P.u.ux/ >|$p|$X40>D$HD$h$t$|$tȃ|$dw|$T8.&.&.&.&.&.&.&%1 ڃ9t$tuމ|$Ty\$pC\$hsK\$l\\$T\$l\\$L9D$Tt$hL$h\$lDT\$d߃D$pD$p\$t9D$Ht$D$l>71D$t":tD$l0>D$t9yD$@9|͸!9tx/aN?|$P$D+ e[^_]ËD$`D$84$\$`G,뷋볉D$0AL$<L$@lD$,/ \$X))D$8t$8D$ t$|$$\$`9|$t |$ DD$40|$8%|$x |$8G|Ft>8t$|$lG$D$\t$lD$dk XPD$T1$D$L\$hD$X$(D$TT$dT$t ;H Pl$ty1pYD$tT$pFP~L\$t9\\$p}3=H\$t\\$p\\$L ;N>VD$\9W\$hD$lP~7|$ldF$ _tft|$lGD$l@11D$h ؃ux\$T9؉ӋL$LT\$p|$lw|$ldFT$|$@u)D$lJD$ht$t|$hwT$xmD$`tD$lD$XGtt$TDD$Pt$p@dPdPltftߤ1ۅqD@|$p`Pp@D$LD$pf@D$`<EPHЅut&.&>u)׉|$HT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$tVtftt$l0e[^_]r1D$LD$`*t -~0 wNjT$`)׉|$HL$Hy|$8u|$X|9|$@ ,;T$|;D$d$|$$8,$|$ g8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d/D$Dt$<uVQ9L$X\$\{9L$TT$PL$XD$\tD$XT$\v9D$Tt$PI=D$XT$\_1ɋt$pD$dt9D$TD$P11D$L4D$x-D$|D$pD$TD$PD$px|$dt$xt$Tƍ>>>!.&.&9iFuD$pD؉D$X1T$p>4iF>kFuL$T\$X)ىL\u dFىL$X|$d9uD$T؋t$pdFdžhFD$|؉lFD$lpFƆqFfdžrFFD$pt$@p dN\$lډNjt$ttft|$l 8D8\$HډNjt$`sFtftt$H0|$xT$|p,g;^1fc뛨{2Oi)\= ףt$D4)L$X\$\9L$Tt$P|$t$CD$<D$DșD$XT$\D$D$0T$4T$4T$ D$pT$0TT$ Tp-\$T$T9Ӌ\$PT$ |9t$dt$<0>FD$<șt$9Ћt$L}D$(D$Dt$,D$XT$\D$XT$\poD$DD$(9}\L$T$$D$dL$T$ D$,3QL$dlD$,9Pt$pD$dN$]=uҿT[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]M1DžuAM荆dNdNt_9t:*~+uـZ@̓avÅ1t&wUVSP4 D0tu[^]1ɉ򍃣[^]7USÙ7t̿$^[]øUS軲`}u[]Í̿$%[]UVS舲-}u 1[^]Í̿4$4$[^]UWVSDEuM V~KhFhF1.t&.&.&P9u dN9ut [^_]Ë]rl1[^_]UWVS˱hUM Z~>dFdF&.&P9u09ut[^_]Ék[^_]UWVS(KEEM E3 mEE1u,H0ǃ 1}tME!}tL0ǃ Gp7>袼u U1)Љ3 ([^_]ÍE؍3 E܉΋E؉$YNjE"D$<$EE3 ~|$E܉$[tm}tM썳̿4$4$MN([^_]ËWr觻y}D$,0D$<$HOGщ돾Bb0vUVSíMu tE[^]CD$$E4 [^]UVS虧>Mu tF tE[^]jCD$$(E4 [^]2UEt@ E]UWVSéu} tF CD$$}4 [^_]UVS4諦PuD$FD$ FD$F D$FD$FD$F$D$,D$ D$(CD$$&D$$4 4L$ xLL$L$ NL$NL$N L$NL$NL$ NL$$NL$(N L$,N$L$0N(4[^]UWVS]u } IXP& ;r B}y[^_]ÍIlP)׉[^_]UWVSn7̿$  3 D$tQ|$RXPL$u} &&.&.& ;p H}!yL$u} t1EU [^_]ËL$u} R|$lP)EU uύ̿$ 1L$D$D$ D$$ L$(3 t7D$oD$^L$PUWVSET$RuXP$M ]*&.&.& ;H p|yE U $\$,.&.&.& ;A yyƉ;u ]9u ] $\$,.&.&.& ;A qyƉ9u ]|M 1]1 ȃ[^_]ÉƉ;u ]}# $\$ ;A y}&yϋM 1]1 )ȃ[^_]Í [ulPƉ)똍 [ulPƉ)L [ulPƉ)RUlPE UvUWVS7̿D$$} ƅ3 t<t`UM T$L$$Ɖ׋D$$9 [^_]D$D$ D$$&uu} 벾[0ffffUMU t"1&.&9t<u‰]ffffffUWVSæ}u tSR..&.&t(TSNLKf9t)ȃ[^_]1[^_]ÍID$ P0D$D$Bp/$U끍>D$ P0D$D$Ap/$WUNUS/ԩt u#$p tЋE$>YUWVSÍe=t:F$V FtD$$]4$Huƃ[^_]UWVS聟&}ƃt $tCƉxtD$<$\E FEF e1[^_]ÃUWVS ðuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍD$ \0D$D$H/$rS멍D$ \0D$D$F/$FS3D$ \0D$D$H/$SD$ \0L$MD$G/$ERUҋEMT$ L$D$H$RffffUWVS聝&ƉUM <$EtC$pupMH  <$1[^_]Í̇ 1#.&.&#txu8u돍СD$ d0D$D$/$Q7<$TuUVS胜(EU Mt [^]MUEݡt$ |0t$D$/4$IQMUE[^]UWVS Ƶ E$  1̇ E0E}M D { uZMUCЋMU 9u` tgߋt}Ct9K ttFߋteC9K ut2 MUCS$ЋUM 9tV uE9rRE9sKu}샮 E$ ut?$tu[^_]ËE]1 tߋtCU11ҋE]ffffffUWVSnUE0}E,9E1M zhEED$E$D$h8$PhǀPǀTǀX71DžD8H@L,D$ |$0D$8$"8U+d[^_]ÅE ((hEED$E$D$h8$ShǀPǀTǀXE (ҐD$ 0D$D$Q/$MW(D$ 0D$D$P/$nM((ҐD$ 0D$D$Q/$3M(RT'UUT$UT$ Q.D$E D$E$>]U誗SUT$UT$ Q.D$E D$E$]UED$ED$ ED$E D$E$]UWVS<D$@J.FX$w(F`F`y ;Fp|4} t.FXPVX}D$FX$f([^_]ÍFXD$E$HUS跖\E@J.Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US _E D$ED$@J.X${ []US(͟ED$ E D$ED$@J.X${[]UWVSÍM} }E EEEeD$E$&E@ E@U~5M19E}EtfEtME)‰UE$UE@몋U tE eMOTEfH @1[^_]ËUulj7wWU<$\UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $%E[^_]ÍlD$ 0D$D$Q0$(IlY1D$ 0D$D$=0$HE)1u E MOuo U80D$ 0D$D$0$pHE@UUD$E$$EU)1u .fBefm7MyHMUS ŒjED$E D$E$w []US蔒9ED$ ED$E D$E$x[]UWVSZEED$E $ƅwDžt}D$ED$E$9xY=?fGfw S G$W G, G( G Eu/[^_]É$CLfG 1[^_]D$ D$D$<$)[^_]ÍD$ 0D$D$>X0$\FUWVS2ך}t6D$<$o"G ƃD$<$|"[^_]ÍY1D$ 0D$D$;x0$EUS 跐\E9ErD$E D$E$ []蠽ffffUWVSqu F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9u0D$ 0D$D$W0$D+V9Vs4$u^4$qgY1D$ 0D$D$<0$ODI fffffffffffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS GUM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$ F0`UWVSL îljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw 0t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$80821ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$?L$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$!L$D$$9$L$D$$9$L$D$$9$L$D$$9$UUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$ HL$D$$98$+L$D$$9$L$D$$9$L$D$$9$L$D$$9$L$D$$9$rUWVSHvW$M$} |$8}|$<]\$@9D$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$$D$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$2⋼$<$$ "SG f A$fx/D$<M$$DŽ$DŽ$D$$$$SD$$8$$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$ 4 󥋔$\$l{$ [L$8L$ D$T$$4$$$FD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$ @$4$ $RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pdM$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$1$$|$D$$4$$H2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$$$D$l@$3$"$T$p$$$ÉD$d4T$p$$D 4 t$8t$$DD$ $D$$D$$<t$d$$h$$$ $$$4$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$4/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$ $5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$ $4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$:y$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$4DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$ 4 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$NPvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $ҐD$ 4D$D$0$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$謡$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVS{"}ED$E D$EE$$©4E܋\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$ܠD$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$;$B@Ɖe[^_]ËED$E D$2$@Ɖe[^_]ËED$E D$g$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS,ã}m|$D$%U <$Y!4m܋|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$;$d=Ɖe[^_]ËED$E$D$2$2=Ɖe[^_]ËED$E$D$g$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`#E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$X¿4፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$ 5$U:ue[^_]ø랸뗸1fffffUWVSp9趋==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$Pأ܋$܃,݃4T$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$`(\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$`(D$D$PD$ D$`|$Nj} t$@ ;؋\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$;$6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0ك$ڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$`(D$X (.&t u)D$@L$$~YD$`D$؋TT$HL$H؃\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVSëu} G9F}uuFV|9s]B9EE)ׄtdD$D$$UhREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVSø$}<$FD$t$rD$dDŽ$ݜ$DŽ$E$E}É$-wʋ$6牜$}D$p0E@D$0D$h/$D$xDŽ$15$DPЉ$K$C‰ǃ/ ˃9?~ыL$xDPЉD$xU tE u0e[^_]ÃL$t8et ED$PD$TL$hA$Et$LD$t1|$F$ߍN L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$D$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$(1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$*=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈$T$@$L݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـ$D$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈LD$@ؠ$TD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$ب\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$;yD$$4$$$iD$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$(݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$(݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`l7D$h$$$ $$D$x$$G)‹$(݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$(fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(=E܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<=E 9Ex0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVSæuEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS0Þ}u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSEM]E TsCD9sf9r)؃L9s&)D$D$ $]][^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVS ª0)ˉf.&.&.&, u썊?a)ˉ.&.&, u썊A)ˉ.&.&, u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVSÕUBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS 聊&7} w.L U4tfMt@ P.$0E $kƅEFEFuFF [^_]øMEP$UуL ‰)U= w$| P.$It P.$0xUWVScut"F w"7u&L 4[^_]É4$[^_] P.$UN?L 4tU$[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8&ˏ} EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $MnMUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVSGu ,  P.Eut?t|$E$EE$`EtsEu7Eu?|$<$r‰EtUE$7Uu P.$u먋E[^_]D$7D$E$ E1[^_]7EuO$rDžt@q@, E P.$} P.$g, u딋En P.$=1Xǃ, Eu1>UWVS$Tu EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVS{qutD$E $zDžD$D$4$(ptt ʃ9t*xD$4$ t|E%=`t`fx ttpu ffx fp@S P$W P,² P(™ P Ĕ[^_]K51Ĕ[^_]ÍD$ 9D$D$E02$/514O1USMzE UD$T$ D$E$[]UWVSz÷utFD$4$O nx$P8D$4$X [^_]É4$TڍY1D$ ,9D$D$=T2$.UVSy+ut&nxP[^]É4$[^]ÍY1D$ 9D$D$IT2$@.ffffUWVSyöut2$'- ffffffUWVSwÖuf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $F0F0$F0ǀǀD$4$FFF [^_]ÿF yF$i4$Lǐ8Y1D$ @9D$D$82$+81 fffff̀rS[$@ [UVSbvut8F0u ǀ4$uAnP[^]ÍY1D$ H9D$D$;2$ +뜸fffffUVSuwut#1V ҃ t[^]É4$[^]ÍY1D$ P9D$D$;2$*UWVShu u!8FF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $^F0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$ e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$QW8t6D$D$ V\$D$4$ ?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$AuwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS vlvEU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVSkÞuƋ4D$D$4$-EtE$EGu͋$$tMtf~ 18t$9⋎t $?4$uu&E[^_]%U9%8}%]EUWVSj}t]tCƉ$^[^_]þUWVSj=tljUD$@$:ƋUu 1[^_]ËOD$M$…1]~˃Mt|tatOt=t+tt9EGX<^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ S$ ;F@tNO$跺4$?%81[^_]ËXP.NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$puXPx lH єXFP؉p[^_]Ë8f8F8FF F FFFF4XP. ~D1 󫍾$F~ 818t181D$4${dž0M8?8UWVS$V=`uF(x~(V0!UN9F9MUD$N $MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$EEtlE܋UT$ML$E$袭ME)UЉL$D$$AM $ EUVU(_US]ED$U $ #C,9C(}#C0[]fUVS Uç^EpFtD$D$$F u  [^]IUWVST>^EPwhHtwSuNP L~8xpXpTPtYtQ1[^_]1DžLDžPNXDžTHDD$$$ƅtǀHXdž$$ljFHDt dž w@GjGLG :G XGNG?GE UtAtCf\ Ft$\t$賳4$A XxD$ ED$E D$E$XE EUuM, Pdždž QXTtt!ЋTDTT9QX1XA1L=f+fdžXD$ L$D$$T PD$D$$fxuu fxD$D$$E t @E@t E DžLxpX]pTPO AfXmxD$_$s XD$`D$$` =b1уX`abcddefghhijkllmnoppqrsttuvw `b1d}h=f]t_LX Љ lp&D$$ 88D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$O,t$ ‰=T$@;T$$X +NXFTcT$ p9T$D$* 3${TfUWVS$>LUEpFtD$D$$FUED$E D$4$kDžEtuD$D$ED$D$ D$|$4$踜‹!@u FЃ$[^_]ÉUD$D$$LUЃ$[^_]D$D$$'Ѓ$[^_]fffffffffffffffUWVSKæTuE U VfFFVVfFFVV f F F V V fFFfFFfFF=6F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\Nt&.&"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]Í|D$ |9D$D$bH3$F lUWVSH]RuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\Nf.&ɉHɉH@tH ɉH H ɉH "B9uȋF m|D$ |9D$D$bH3$F ƒl'UWVS(vFPEpFtD$D$$%FE  D$D$$kEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$f$u ([^_]1([^_]UWVSGEN}wFtD$D$$FD$<$tr$tcFt$t$yt$gE4$V<$NE$譥[^_]øUS }D"NE9ErD$E D$E$* []fqUEtu]11ɍT9r]1]fffUVS!DMUE X91rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS41CLEE@Et } 9x 1}EEEEE*EP}GA у@3=0fuftpfuE@E܃!‹EH}<}0}}Gu kUzu@G GGBPWxG8GBW}O ME9kOft DAfEtD$D$ E܉D$L$4$蔨V1ۉ]E@Ex#} EHU ꋀEEƒUƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$޹E0E@ D$$轹MAt MM} y AUtiUJAUQ}Q D$ML$D$ M L$D$<$耣E4[^_]Ë}GMWW:D$UT$D$ M L$D$E$!E ]}؉0fuft tpfuu^/Ex }OE@D$ 9D$D$l3$D$щT$ |$D$E$lE@E܉dU܍D$ 9D$D$l3$U/B $fUSEP M TH}[]UWVS>öGuE9G Ut OuhM Gt"V T$D$$vG$AGB<$/9}thG tkMtOtD$L$ D$GD$4$wn"?9}tG tUE?9}u1[^_]1G!,USUE @@ @HKYXBP[]fffUWVS <FF}ED$E @D$E$諜t7ƅt|$$t [^_]84$V8UWVSD&<EuE 9‹E1k*lt$D$ D$D$<$ =5DžDžDžDžD$D$$|<$*ƃtI<$)D$D$4$tntD$4$tSD$D$$E+uqD[^_]Í"$ L8D$D$$諙4$裛8?gUWVS,d: D]ƉUM܋ED$T$4$YNjE  &ЉUUD$L$$]̷EGfEf}UBM (9tD$T$$]肷UBD$D$$]cXMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉ME|\$ 9\$D$bH3$E؋M7UE:98uDE܉ufp뛋PUD$D$$];UuT,[^_]ÉUD$D$$] UE܉ufp5UE:98to!D$T$$ZtfGUE]|L$ 9L$D$bH3 $UED$T$$]bsUWVS 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MU|D$ 9D$D$bH3$ZMU.fEEfF fE~EUč|D$ 9D$D$bH3$U'UM|D$ 9D$D$bH3$UMSfffffffffffffffUWVS8]&0EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋|L$ 9L$D$bH3 $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸|9H3E܉U|$ L$D$bE܉$]UE@(EuU]䍻||$ 9L$MD$bH3E܉$rE9EM؋UB=VVU]䍻||$ 9L$D$bH3$UUfEED$E D$E$rUEH(EH(]䍻||$ 9L$D$bH3$U;U1҉T$t$E$]8UUWVS J(}u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0@(ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃|D$ 9D$D$bH3$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃|D$ 9D$D$bH3$UMUWVS@C%}EpFtD$D$$JF Tt:t@[^_]F(tڨ1EE|E؍9EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$bH3 $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃|D$ 9D$D$bH3$7MTD$|$$ו럍|D$ 9D$D$bH3$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfE|}Ѝ9}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$bH3$MMԋU<|D$ 9D$D$bH3$D$ED$$D$T$$術D$FD$$Dž]2FM䍓|T$ 9T$D$bH3$tVMM|D$ 9D$D$bH3$>BHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍|D$ 9D$D$bH3$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[@ [UVSRut5D$D$ D$ED$4$Ot6E[^]ÍmD$ :D$D$53$럸fffffffUWVScUE pu9lE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]ËdrL:d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?hmD$ ,:D$D$X3$hMX\pD$E  D$\$n8 X9hƋ`L:d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS< Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS 'l4$(sD$$D$F $3 [^]UWVS > }$ L$K#1$KD$$D$<$h3t$<$2 [^_]US ll$mr[]US, FEEVEEED$D$ED$ ED$D$E$腍t}u E,[]ø,[]US l$q[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9t9t,EȋU+u0<[^_]D$$D$$.#ԃ $Zb(UWVS`/EE9E1} w6}̉M UERE9t~9ue $aXM̉MG} EME9tX9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $Ia'UWVSDz9EE1uUč}̉qMȉM}ǹU7UȋE9r}9t"9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $`U&UWVS8b9>}}̉11҉EE9t9t)E+u18[^_]D$$D$$ ׃ $ `fx&UWVS<:U9E1E x;Uȍ}̉/M UȉEFE9tK9t[E+ua<[^_]ÉUȍӢD$ :D$D$<3$̭UD$$D$$ 륃 $E_%ffUWVSy}lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]PMUBfFF F D$t$$]u1[^_]ÃQʋ]C ^)fFfF] H@ L$J UL$ $]lOUBeD$B D$$]rtH D$D$$t&KUWVS$Ǟ}E΋x!fzfz:EF~ =(M9AfZfZۍ E@ EE@utN=$1EAfBB B D$T$E$]s$[^_]É=ft1MM\A4f9rM됉=w+f81&\F<f9rZUM]|D$ x;D$D$bH3$蚪MU룉UE]|L$ x;L$D$bH3 $_UZEUEME|\$ x;\$D$bH3$UEMUM]|D$ x;D$D$bH3$שMUU]D$ l;D$D$ 4$蜩UUWVSL u܉E։MM  fMEE=EffEFEfE=f}EfE111EEf}u։ʋME@ EǃtVE}TG:z Z]f;u]9fEA)fAfDY|$T$UȉM؉$]MKUԋM؃f}Ef;ErE EȃEȃ]f9]f9u}EE\E9E]9f9u9tMԉU؋]܍cD$ ;D$D$ 4$MԋU6E}TG:,E}TG:EE]TCE}}uL1ȋMfAE@(t 9Hf;UE f)8EEf;}ǍFEfEu}l&gEHEA ÃW)fW]fT_D$L$$]IIfEEf;uf;uu fEfEE@ EhEHEo}uLMU]܍cD$ ;D$D$ 4$蚥UMMIUѻEHE E4w(ufFMf9MuufFEL[^_]Ë]܍cD$ ;D$D$ 4$fEf;}'1뗉@f;ErfAf9stEMA]܍cD$ ;D$D$| 4$菤9]܍|D$ x;D$D$bH3$]8M ]K)fCa118a\t&Sv.&CUWVSÑ ƉUMED$4$!YǍED$4$YÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS(  ƉUMED$4$UXEljEfGE}fyUzyAB A u.E B=f9mEU܋ED$$fEUMEABAfAEfAB A BtHUD$D$$hUU}HD$D$$jUED$E D$E$MU܉RE䋆U܉׋usOuCu1u9ut2U܋E$BjEU܉E]E([^_]äu9uuΉUftt֋E$iEE([^_]ËuBfF] fu]EvUM썃|D$ x;D$D$bH3$UM%f] z>1D$ED$$`iFUWVSpq EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN y EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]Ѝ|L$ x;L$D$bH3 $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]Ѝ|D$ x;D$D$bH3$ϗM"M]Ѝ|D$ x;D$D$bH3$藗MTME̋]Ѝ|T$ x;T$D$bH3$\MEMUEEЍ|\$ x;\$D$bH3$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]Ѝ|D$ x;D$D$bH3$nEMċU6MU]Ѝ|D$ x;D$D$bH3$'MUrM]Ѝ|D$ x;D$D$bH3$MUԋ]ЍD$ ;D$D$q 4$贕UűEԉE}EEqqqUWVS4\ }G,EЉ|E؍;ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$bH3$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oM|D$ ;D$D$bH3$M:  GEV@Uȉ]ԉuu}}ЉMً}}̉uƋE ʋE؉E  1É1؋}Љ׉}!]!1Ћ]؉ 1Ӊ 1Ӊ]U}1!]!1ڋ]ڋ]ЃEEU}܋}Љ}9UWuE܉]؉MEEԉEE؉EԉM؋EEE܉EU܋uu]41J 1 ]ȉ׃]< 1u1ȋu؉ 1ʉ1ʉы]!ىu!1ʋMċu(>‰EЉ‹}܉ 1 1MЋ]؋M1!!1؋]؋M‰}̋]]Ѓ@E}x}x}x H}x}xX0[^_]UWVSӉʋp x$?utm@)M|0(9MރEE} H P$MTUp(t$$EEU]?vIzt @}߉ÉU|$$C S$@9u}؋UM\9@?t*Ux(ރBEtfEtP P$[^_]Ã?vōJ΃|3@p(M}UމËFGFGF G FGFGFGFGF G F$G$F(G(F,G,F0G0F4G4F8G8Fu\uBMEt H(x)Z]fmfm sMM Z]IUWVS: E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀ# |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVSj } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVSn } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVSô MDžDž<<,?z DM E5 @x  D$D$D$D$ D$t$$(uVD$D$D$ 0D$T$4$DAt0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$y@L0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$$'3DžDžEDžDžDDžDžCDžDžBDžDž>Д DžDž DžD$D$D$ 0D$D$$>t0Д DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$ƣ$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$O$$2D$D$D$D$ D$t$@$#4D$D$D$D$ D$t$$$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$1$"3oiD$D$D$D$ D$t$$!D$D$D$D$ D$t$g$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$8RPLDžDžDž D$D$D$ 0D$D$$8D$D$ 04$T$ 1t&=S,vD$c$ `DžDžyD$D$D$D$ D$t$$D$D$D$D$ D$t$$7SfffffffffffffUSf \ []UWVSPJ EEEE}|$EԉD$$Ẻ$1u} }Ƌ u%1 uBfEʍ M MM9MMfJM^MHHu u p Puup0@1Ẻ$D$|$$P[^_]j D$D$D$D$ D$D$$ ‰ f@ fN9fE@EU tdM HUPMH Uup 녋uMHx0<@\ uM M  M310t ED$D$EЉD$ D$D$@$2u}u tE E E~ vMiM DUWVS O <$t V6u.j$Et+.t V6u<$E [^_]-t V6uD$<$<E [^_]US$襯J t$[]EEED$D$ED$ D$D$E$1t uӣD$ AD$D$AH4$$d mfffffffffUWVSÆ E }0@DFƅtGFU M U9BFD$F D$ $GEUtRFE VJE}9OT$T T$$EFMAE1[^_]ËM!@]GF MtFuV]SF }WT$|$ MQT$D$E$ u>E]놋ED$ED$ GD$F D$E$LE!@F aD$ $'t̋EUBL$$'t}VWVUVSä uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 舫1 E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$]%Et͋]E0U=UWVS(萪5 E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVSn }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[T @ [̀rS[4 @ [US s EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[þ @ [f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVS0հ tMƋuA~8t:F4@9s3`V8F4@9r$$F8[^_]ÉUWVS踦a E}}u9ENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]F86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$]'NjUN8#UV4V0] OD$ D$`T$ $F4~81.& @rPu B8~8BX;F4rE,yF8$]"F8UȉȍB=]I_8 4U]0_UF8$5"_UF8$]F8tgD$`||$t|$ D$xD$E$o&DžuUN8]^N]^{]UWVS@ܣÁ EE M9NjE1lI%;E" = ,9#ƅDƅdHD$$"8BƅC8 D$BD$d<$Ylv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $jt[U+ @[^_]Á},d`@ Džh1Dždd ׉<$D$`D$D$ t$D$$"f 9? OD$ D$`|$4$`d9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$[Ju"dhD$T$<$gFPp @?.T$Ge``697nV4P4~0x0~8x8NFwPRTP׉) tGPǰ9 fG`9u Yt&D$dD$ $gctIt70tfttG1VD$D$$&p8tD$D$ $Zbt"T7d$TCt18S4$D$BD$d<$bFttD$D$ $bat ,S"A!D$DD$ $ at$-B놋rD$D$ $`S$`6 Nj@8@P1q`D$AHDž$`Af$ AjtStD$D$ $_zn4$@\tNj$@D$BD$d<$`tUWVSR <$E D$ ED$ED$E$MU E(Ɖ<$[^_]US Ú EU BJ  D$T$$ []UVS 衕F utxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E El4D$ AD$D$l4$>5D$ AD$D$m4$>Uj UT$LbD$ ED$E D$E$9]ffffffUVS "ǒ EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS(шf ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$]ӋE111 ufEUD$ T$ED$FD$$]&;u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVSće Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$Åt@C؃[^_]ÉډSu1V룋KT UWVS× u xD$4$HE%=D$($Džtz@@&@9uE ED$D$ EЋUԉ$T$EČ[^_]@1Č[^_]UEU U U$]UVSƎ ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D @J.D$ D$%D$4$U D$E D$E$]UWVSã E HMPpt)rP@t6B E$m1[^_]ËxMt P@uʋMAUWVS4芄/ }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$%U11MM1 MMEԋU؉D$ T$E܉D$AMD$$9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVSâ ut PtH J H ${u4$m1[^]UWVS跁T uu2&.&[tCtډu[^_]Ë$[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS 貀G U EtUM"t&.&.&.&t.ZYutD$D$ $ E [^]UWVS %ʉ } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS(= E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]/E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍY1D$ AD$D$G4$.u ]܍٣D$ AD$D$H4$.bf%BBff+E XffE]F3G]33 4UWVSx- utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]Y1D$ $AD$D$Z4$,[UWVSwm utWD$4$ F u#f~t(1D$4$ [^_]É4$2 E.4$}$Flj4$[^_]ffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVS1v u8tfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉FUZ1맋V0 t~@9t $,V0F FV덍Y1D$ 0AD$D$< 5$T*=fffffffUWVSuó~ u}E FftRxT$$<xF0PV09t'Pt($ [^_]ÃT1݉UUPV0ǂT1UVSoóx u7u[^]ËF0$F0Tt$[^]ǀP8$F0UnCx MU 7u]É]sUVSpnx u7u[^]ËF0$F0U t XtTt/$[^]D$\$F0ǀP8$F0UVS8muw 9EEȉD$E$>U+u 8[^]f̀rS[$w @ [UVSbmw u tt$D$t,@E$[^]ÍtD$ BD$D$9h5$$"UWVS4lâv D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"'D$ 'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]9&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍ID$ BD$D$K$ L$(=e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(OD$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 }1th|$ D$t$E D$L$T$ <8D$D$4$D$t$$ҩpljUED$ D$E D$E$4UWVS8J}T Eu}9E1X>'T$ t$D$E D$D$|$ <8D$D$$Xu(u~E+8[^_]:|$D$ D$D$4$ND$t$$uXt,KH󥋅D$ 8D$D$$OX:pǃX$…X1A<+wLLuىDX9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVS<*HQ uE EEEEEEN>wN# t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USFÚP ;UT$$L[]FuP -f̀ffff7̀rS[DP @ [>̀rS[$P @ [UScFP D$p@ D$ ED$E D$E$[]US FO ED$ ED$E D$E$[]ff&.&$D$4̀D$̀fffffffT̀rS[DO @ [PS[-O [USeE O 7u '9[]&[]f̀rS[N @ [USEøN $1[]UVSDÑN t [^]É4$buF1f1ø11D@N \1øUWVSƅUu't<uF=f t/tv=uF ދF ӋF ȋ t@ 9s0.&8u +P 9rt Iƃ Uȍ8D$ LD$D$p8$FU.D$ LD$D$p8$<=ƋUfffffffffffffUWVSWBL D$0}|$hu }]\$89D$Ë$1M}D$hD$DD$,D$08\$ND$<%t,P D$,t$h\$D9s FD$h<%uԍWGD$CD$XD$<D$\HZwt$0MT$(D$$ D$l1D$X|$lD$Pt$P\$<9}L$,L$\  \$P\$HT$Ht6\$DT$h.&.&9s  sT$hD$\|$(1ۍHЍABHЃ v\$< T$(D$$D$\0|$8GT$`D$d|$8\$Xd$\t$`|$d D$X\$\\$4|$CD$HD$P$3D$Pt$P\$<9}L$,L$4t$hL$D9sL$Ct$h|$4L$X\$DL$h9s0sL$hr\$`T$d\$d|$Xxd$\D$C- t$`|$d9$D$4\$`t$d)щ1҉ىD$PT$T)iiƸ1҉D$HT$LD$HD$P0T$`D$dL$`\$dc19dÍxD$`0CD$4)D$HD$Pt$X9}t$Pt$H)t$XD$XPF\$\\$4|$C@D$\hD$Pt$P\$<9}L$,t$4L$D9L$hAt$hN0\$D9 L$$N^\$h|$4L$<\$P)ٍYt$DL$ht&9s0sL$h\$  }E E9‹Eҭ&Gbt&ED$ ED$D$$>tD$$D$ D$D$D$ED$ED$ D$D$<$x ƅ u G$@ED$D$ t$L$<$jƅ,Gƒ @1u`$yED$D$ D$t$<$ƋG~U=2D$D$D$D$D$ T$t$<$ƅGD$<$E+NH[^_]ÅD$<$|ȋPu@fffuGtwp fHfHff$衵t$ɉL$ T$D$p9$qPtIthtRD$<$$+x $xD$<$yD$<$gD$<$U4UWVS,B }U ME9E1GED$ED$ L$T$9$pL$T$ D$D$$Co=E D$D$ED$ ED$T$<$qU+,[^_]Åx$腰=wttH|.uT$L$ D$D$$nU"D$T$9$oqD$<$9$3UWVS(È E E9‹EE@ pc($M_T$$s-ER.D$ D$D$4$KS ,t&.&.&.&DA@tD$4$j.t&DJ@utSFNu tDJ@tEpt$|$<$调7$N$<1U+u ([^_]L1UWVSP u} E9ËE1fD$4$^1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#^8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$HED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$AFDFD`DžDžD$4$虹,fffffUWVSlv u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$TxƉt$E$踸EEFD$ $蠸U(fBMЉU(E,) X}|$}|$ D$t$E$д,Ɖt$$ 0FD$E$FD$$FD$$ U(fB )Ѕ9E4T$ NT$D$9$El[^_]ËE$訥EE$ߦML$D$ ED$`K.D$9$fU(E H E, 9(B B U(D$E$$U(BD$E$U(BD$$ U(BD$E $E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS h  U }E@4E)Ѓ FD$$)FD$E=s$VfFE@ uG1T$$ǵF D$$贵 G fffG )~ [^_]èu2밸9u1 [^_]ÍN$jU *U\$jU븸UWVSN M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$GD$u4$说W׋u$ssuXuQ}׉+u9~ED$4$V+E~[^_]äft9}u1[^_]urpUy$HiUM 9}t:D$ ND$D$=9$SgMAyEtflffffffffffffUWVS(& ljUM܋EGkE8u䍃EE썃E.t&< t< tD$ED$4$;D$ED$4$D$ ED$4$)D$֮D$4$ۢG~Ӯ$g< t< vtu([^_]À>6F$~d ʈdGtD$$`띍F$蹃~GtD$$}`iD$ ܮD$4$tD$ 5D$4$ܡuEO!F $=~GGD$î$_D$)D$4$ytjD$D$4$[uXO@E܉D$ED$X:$_O]L$T$4:$t_zO TD$D$4$t*D$ D$4$Ǡug OD$#D$4$葠u O@D$6D$4$gu OD$D$4$=uZU D$4$Yƒ?v?T$U؉t$E$tEUƄ4D$D$4$şuZE  D$4$ƒ?v?T$U؉t$E($sEUƄ(D$ D$4$M D$D$4$(u OmD$*D$4$Kg?UVSTQ $@it."|xEEE%EEEEND$D$D$ D$ED$t$}tT[^]UVSè Et4D$E$nEEFEFh!fF [^]Í UWVSxK 9EEtbUD$E$Ef3EfF}<$XD$t$<$}X|$4$ZFUM+ ux[^_]Í IUWVS ð }x$SLJft/1t$RDŽ9Ӄ[^_]UWVS5 u4$`t&tuOxu:<$odžt$ndžf[^_]É$0R뼋|E9Eut$ RU— Et]Íd]Um Et(]Í"]UWVSu] }4$sfdž1҅~!1u.&{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVSÉ uD9 E1D$4$PF u uD@@$dD4$U4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$hF WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$*$ w`D$D$4$jmƇ_WHwDG` \Dž01< t/t 201Ƀt&9c< [< uuDž(_D$p$[8 Dž4DžHT,8D$ D$D$H$8;s<;t<#tH8domaH8searH8name%H8sortH8optigxionsZ< t< GOcD+<< ~< uvfxinJ< t< I(  t t Dw`D$D$4$"kƇ_CD$4$VtDž0]t DF 4DdLʃ Јd8$D$D$ $Kx8$&s,D$x$x}t<hlp ė ȗ DDx`0DpHH`HD@H@`tg.&<.ǃu~DD$. $hDFHGD$.$hDqPALD@b$?t7‹DHDH U+h[^_]Áxservfxer< t< 9 < t< tAD$4$谰< X1DžX DrDž\DžTD$5ܒD$ D$ D$<$PD$ ,D$|$4$v"MPB=9Dt/RωփtftPBj@D<ЉT$L@$dLt׋$ˆL,D$ $OL <4,LTDD|$@$%d<mFV9xDw@ut;u㈕$<,t$$N<$TDLD 44 K}D$ D$4$!D$.4$2cD$D`$2Dǀtǀx|Dž0Dž(|:$4TDxD@Dt$4$}Mu덃P$S< tt< uDž0]L$,D$ $=MLtċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž0)@DDumuT>uvuYLpD$D$1ɉyffL LsUD$E$]UWVSXv }u h3 l3ė t;D$<$t ė Fȗ FX[^_]Ëȗ 9puttl|E9EtztIND$D$ED$ D$D$t$kBt ė Fȗ F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]ffffff̀rS[ @ [UWVSdã ._D$t$^M@$TDžDžDžDžDžx@ N L$T$ VT$D$$]T$$=F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$=ut G74$͇@9 W ‹Atft‰)@0Dž'Ztftlj)@#tP4$@9r5‹zV$d@ $=Z#Džd[^_]‹)ʋ;Wf)f f{\ D$ ND$D$:$蝐$tc0P@~~ 9V)ȋ 9cVʉ)ȉA1҉=tftH<@ lj)99h΃r낋$ib@ $WŔ@ 4$@9:ƒ{tft‰)‰DžJtftR<lj)944$@9`‹wShf`f% PD$VuKu2ifM/f릋$_@ XUVS{ 08t$J*[^]Í_D$t$5E[^]UVS, 08t$n_[^]UT Ut]UVS; ut$)[^]Í_D$t$D[^]UVSÔ ut$^[^]UWVSb u}t5W¸t[^_]ËF [^_]ÍD$ OD$D$|:$eUWVS> }uENH NH_D$t$Cƅu!yH L$UT$@$mtEG D$GD$ GD$D$4$Su4$]G [^_]É4$][^_]ËG [^_]ÍD$ ND$D$:$UUWVS + EC(98 lS.:)lj}싓 u2E D$ $边  [^_]Í]t$E$3t$ $3t{ t1= ;txED$D$E3uًED${D$ED$ D$0;D$$Y [^_]Í:D$ED$ D$;D$$Y [^_]ÍnD$ pOD$D$:$ĈED$SUWVS - ''w} )ƉT$U$Mtn  UT$ $qMtG  D 1 [^_]ÿ'y qUWVS(X LJ̗ LJܗ LJؗ z 11ҍLUE W 5 )Ћ ԗ ڍAw ,OD>ЉD>]T>ӉT>lWMHL>@CD>ԗ Cؗ dU։‹ؗ xztؗ =w ;OEtؗ =w ;Oܗ tH~kؗ LJؗ ؗ yU) !ȉؗ UeUv$̗ ܗ ULJܗ  M싗 1ɍO]MEUtwM<9ErMtu艷 Ѓ([^_]LJԗ 5 LJԗ D>ED>ЉD>]]Ӊ\>lW ULV;D> rU=UsD>HL>PD>HL>ԗ HV=Ë ; eLRH P H З HLJؗ ܗ Vܗ MULJ D>UMD>ЉD>]T>lW U]ف9OLRLJܗ 롋З LJ LJ D>ЉD>]T>lWoMUlS.E(9E $µUMD$1ۀ} ËE)؉D$ D$;D$$SUMLJԗ D>ELJԗ D>ELJԗ D>ELJԗ D>EqMUD>@E싟 ]X] É %LJ LR l mUUxzؗ Mt ; r tXLR H P H З HVЋ]!LJؗ $:fffffffffffffffffffffUWVS0 EЋ( u䋸0 }9E[u؍LZLXu썰 YuԍZu̍ZEE]]Ef Ux]U}& U ]Ue U ]P  U< U ]UWVS* < u"$D uމ4$6LJ< LJxLJD LJ@ LJ0 LJ, LJ( LJ LJ 1[^_]USt E$-[]USQ E D$E$2[]US' E$5[]øUSã D$ED$xD$ D$LDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$WaDžH V€ʀ UTL@pD$ D$D$T$OM P!ЃLPoo0<$oT$7o01[^_]À Voxo0<$o  PxD$T$ GP^E E DžTED$D$ D$D$$_Džt HƁ Snn0En01  G G?G G !G G GD$D$L$/PLPP LЃHtfD$PD$L$1H  D$ $PP D$rm8LlPu  P|D$T$6PD ƒ@ uv h0 ffffUWVSA }EpFtD$D$$/F p\  D$4$uc  t$un  T$U4$DžU9B(E kb1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$7.[^_]fffUWVSI EpFtD$D$$-FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$-UЃ[^_]ÉiUWVS$ö }9EUEEEE;E MmG$~4u݋M…tEL$D$<$G7UUD$ ED$}|$4$9uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$$R(t㉇UWVS(˭p uE䋆EMM܉;E E苷EHMU$H3ƃUtY9Euȋ})lj}苊U|$$'U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$a7u@EE9E 1([^_]D$ ED$ED$$%7l([^_]UWVS$A M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $Mp6}9} MUu1$[^_]Åt#UD$MD$<$64MU눁 $[^_]ÉT$$%Mt$[^_]UWVS( EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]G5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVSƳ EU EpLB< D ?ZU )ىL$D$$]f}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]jMU ̉EU ]썋L$ \L$D$$= $]EU QEU ]썋L$ \L$D$$= ${]EU U E]썋|L$ \L$D$bL= $=]U EUWVS ò D$T$$tV@D$T$U4$NjUuD$T$$%[^_]D$T$$o%UWVS 肧' }EpFtD$D$$.%Ft:ta [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSD车b }wFtD$D$$l$F}  8GuD$4$D$ D$D$$%@ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$G;EtD[^_]ËMN$tD$ D$D$$T?Љ!ƒtL$D$$*u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$‹E؃9tD$<$]D[^_]UWVSN u~GtD$D$$!GD$4$C uUEu@t*$+u*4${^tME[^_]Ë$tE͋D$$E EUWVSg uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $U]C1[^_]Ë]C鍆D$D$ ED$T$4$ul}D$$M UtEdžU|$ $tU#DfffffffffffffUWVS ݡ EE,E}1EED$ED$$]ƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃|D$ \D$D$bL=$UU]ZE}E9}twu})D$D$$]9utAFD$FD$$]OtVTP‹}u뙋u]RZ}8 [^_]ËEpE )}fG w [^_]fUWVS$葟& uƉЉfMy} ~ϋX9U)ω\$D$M$]BEffEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]39E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]D$ ]D$D$x=$ <Mt !EEfEE:M]D$ \D$D$Tx=$;MdUWVS$耆% Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$^Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$6B…t EME$EPEwD$ |$UDBD$4$A tʋ@f8 $dž ?UWVS,ۄÀ uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$:UU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍D$ @]D$D$y=$7M UaM D$ @]D$D$=$7M VuM DOƃ=Fu u䍳@]uDG)fET$UUT$7$%U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$=$5UED$ E܉D$D$=$5D$ @]D$D$=$5ܰD$ @]D$D$e=$h5E@ED$ @]D$D$k=$05D$ @]D$D$b=$4FE!UWVSq EE @u E1OftsDPND$ t$D$E$]D<ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃D$ 0]D$D$=$(3E@ M]f\Q=맃1fM1UWVS}r U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$9…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$lUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS|< Eu} 'D$ D$DJD$4$]#9tDPfzuft,ˍ< fED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$U0EZUUT$L$$H#T$ $GE$]]fff]߉D$ \D$D$\$4$ US oòx }xsn]f$ZUPKFAfff]2].t&%].&fffUVSxnx EEEEjuVjZ uǃ d9tj'jj%jVjj'j>'UWVSEE] }3t>ub|j/VlZYtp A&t0MPVZYMu}] EEAe[^_]Vh"hU"hJ.{UWVS]u 6_h"VSX tfu7$T.ۋ=pC.)u|$T.u%h"e?Zt$T.$T.""hjP T. @u5$T.hǔ"j(h*Xu4'hД"j(MUW6ZYMtUBk D&u6h"j((VKSWD&P)UWVS] 3hd#jhd#Su@@t h"pC.DP}DU.ZuDU.i$1HU.TU.F&5TU.F&jjPHU. y 5DU. U.` U.莉=0-v@U.u h"jE'U.u#U.U."U.F&U.F&hT.HthRPmU. yQU.PhT.HthP5U.ңU. U. y5U.h$j&T.yT.览hT.u/T.u8U.Hã U.ujT.D5`T.8U.91>Ph"hJ.jU.U.=U.t t7h"Bt U.t+h",t=U.thG"U.pC.jWU.ZYu hn"|;R=U.u6=U.u-=U.t$=U.jWg[^11ɉ=U.u >=U.t =Ci ȉ=U.y"=HY.thY.h$hJ.B uY= uh".XZQURPW x%uSh" ,URPWɅ ySh$j-Phģ"jjUWVShu E1E1ۃ}~F8-tEhԤ"T(_th"PZYu 8[.h"*(_th"PZYu h"Xjh"h"Ds!EPZuh"\0考E_t<1ɉMMMMMMBh "d%! 7Mt&t"Qu+ZYth+"jEhQ"WE)PE @}w}c}6t^%}4E뷋Edwy$L&}8tEKv_7Eh'"57 EXZnEbEVpC.pC.}uCpC.Eu4>tj@uY[t}u U9sUPUxtă}uEE1ۋtPZ\tS0XzEt'U)RPSpSÃ~t C}u"h'"h19%EEZYu ha"K}uEEuh4[.WuuEpEP-u yj=4[.y h|"}tLjuVjhSPy h"%XjVjh54[.Py h"%Xh'"EjuVjpSPjVjw54[.P,uI1ɉM̉MЉMԉM_18M&H>v   DGu΍EPEPjW =8[.t}t.D1}tEjEP48M& Gu褡Ey hQ#j Vh~f54[.Vh~fSUSME}u j u XZjkUE 0NjRUVSEU 4TJ @p.uc1E1ۋ4HO&VhA#޺uUR`J.HJ.Y^yhJ.j XZJ.PJ. Cu  `1e[^]ÍL$qUWVSQpq1t.x.....p...l.DžDžDž1h<"Vg @I&/0$`O&S'$O&1=---r-cl.jP57ԕ :uy57h"/-p. \....|..14݄P&4݀P&h"蚸C uD.v.kx.=7j/WsY[ÅtC?t tPc@tj/S2_ZDžtG;ttc@tqtj/WZYtA?t(tb@t.t9h"Ot.Ph`.hd.hh.h"57qAu7<t h"jC =h.h.Ph.Ph.h"57 A~!7<u..9sh"뉅.=7j/WY[t4PWs_Zu!%=@u7-Y7pt..6--7.57.-[=~ PPh$"j  pC.)ˋ.=.t . . . x.t#a=p.t t$h\"4t=.t=x.uh"=x.t=-uh"6`Ku -n=\.DžtDžxjjVjjtS@t,YtjjVPjS@t=-=\.u4P5-r_Zu%=u \.p. . .1 .t1=.-=\.uRjhhp.PR -y'D8uhp.h">hp.h"--p.-jPR謪- u5-h#M[^ =\.tRPZY@u5-h"E̋UЉ1ۅuthRP5-h "]M̋]Љȉډ%1 .1[...... .nh.hrdAPn @uX5-h?"fh.hedA5-C@u-5-hQ";^_5-P-[ .1ۉ .ĕ.=.=Е..ȕ..- .̕.?w=...!ȉډZ ...tJthVP轨- @u=5.h$`5-w- --j-~Sxt.Yu Sh`"j.11+^t m.1Fp.ĕ..+pt.t#h..d..`..DžDžjjVjjSd袼t.Zu hN"j jjVPjSty5t.1t.X-j/S:E^_ޅtptZYtk'Ãw#EP< } wt= t0u #u u#PSh#hJ. C'<1󫉕<Ĝ~j2~jTXZ1ɉhW4kWMuthƠRPWjC9uu79trhW4 WuŃu .=-tW;Zh?RPWBO5g7jEX=T.tj8joUWVS] }蹔C.S.jhh .jPBz .uG|¡.:u)jhh .jPz .u5.Ph$j. .h.hQ@Po -y@-.t1MPRUQZY UMu܃ SEPQjo"@-u4#RPh4#jUWVSXu] 3XC_tj PhQ#j7.h%Q#SVۨ Dtb$q&. .0..,.$..{(.l.] .N.?pC.9蜯=.t,. (.u (.=0.t=.th3Q#6\Z=,.t,=(.t#"=.t<5&PhRQ#\%4EPhrQ#Sw u$1ۉ@.D.EU8.<.ڀ;+u[CKR.DJPܙk<@.D.EU8.<.Y}Qȋ=R.DOt Bu/<:0RUʶZUBBBBhvQ#EPY[t h9S#jw1҉UUUUčEPudXUWVS8]u 1E6OXh\#VSb x`At$Mt.ăa$s&.|.x.Л-rz#덡7X.!p.vl.kh.`d.U`.JpC.)Ӄ=`.t=h.t虫. =|.t =l.uu t. x..#=X.u |.U1T.P.hlyXUu h\#j=|.tEčURWjj11%1X.tjhpQ#Pjq[Xu5X.h$j蔿1ɉ \.jjh\.jV谜Ãt;tMS&ZVwX"4~MFSK1=L.؛-J.e[^_]UWVSE p.EX1=.h`#IP7JZYu .hՐ"P迮ZYu .jڔ.Jp" 15.ghՐ"P`u 7/`#=7/t{#P낃 P/v7u)h#hĻ&h0W P/h#SfZYÀ;+h#S^_ƿ&t&VRS! u <2t&h %SZYSPh#G  P/ G P/O3u<=fRhΝ# <=tRh#G_X\3h %SnY^Ɖtt t.iSZS&^h /#HjPS>‹ 3 9r(<,tuxG P/QRh#SV7h>#F;57uh]#h&hKhӜ#n1k$Q/t!VPZYuÀQ/(P/kGhl#Vho#GFjW7h#h&hq둃 P/'=pC.u) P/ u=<~=$P/u,P8Y@u h#j7Ş#9< P/$P/Z!Ãt~&t%Ft!á$P/0Rh͞#pE  s$P/0h#QEXZ s$P/0h#8E_Xt Sh/##E[^jҀ uh\#tth#DjQVE uCvBeR0G.f"$l&H $&a$V/V/(V/G0V/1$V/,V/a,V/1$V/ V/?$V/1,V/10V/"(V/ V/1V/V/1= V/V/V/V/ V/pC.)ӃoP(V/=V/t*th#0V/ ,V/ $V/tih#jt:Dž|=0V/u Dž|=,V/t=||)Dž|=$V/tDž| Dž|4赲4V/j)V/PCx<hSh-`=v Sh`#h-聐Y--X/u!-= -vx/uP-@ߣ-1hjXZ=$V/t Ph- Ph- ZY@u覠8t%E%=@tkxtHZxM=V/P6 Y_@%=@t&/h-hr#j>Džx0Džx=(V/u1=V/x/lt$P4ZPvЀ8/uj|Vyt 1pluv6h$jʠlQh- ^Zh-ċCHfuFs iPshU#3lDžpltC~Zu)wfush#2Y[ftf tx)-C,--=~TSh-h#w2 o{DsC(huTxtClj/VYZlt)xlhS#>P譏YZlhl>h)8/t z/t/Bс-vPh-hdz#1 VPRl躶l- -= -vx/uP-@ߋl=$V/xt Ph-U Ph- ^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-h#1CP@% =@B%=@t,M1@ush-h#1Jl΁@w `||t {DPS&IZY+= V/(h-sh1"7K sH (V/ V/u&fNushB#/Y^jSt脀fuV58V/V8V/@V/Mhb#h&h6kE%=@V褛Bfuk=V/u%8V/H8V/@V/y/h#hܾ&h?jR AZY+hu#CPph-.E^Xsh#.Y[=(V/t'PRH=(V/tPRPHPSA{Ӛ8t hѲ#j txp?1x=(V/t,V/ 0V/(P6K#x:DžxxUWVS|]u >j/WYZtxh6&W荋_Zu^hd#VSy @uipC.)Ãu]p0\BZY@u jj9je;LtEPtIFu'|f0h5#VS5y w~Hfw$&1pf0pf0f01tf0df0xf0tf01f0lf0thf0edf0VpC.4)Ã=lf0t`f0-=|f0t,`f0=1=|f0=tf0uf01ɉ df0ttX%V1ɋ5GP|=xf0xt)SWRYZuE%=u iSWXZt Wh$j菙E%=@9tF ÃSF=XWUWVSu 6'hd#j_j褩ЉÁt1hht%Vu3w tVmtDžhptc579*Xu57h#jĘhW(tWxZ 딡pC.E%=@t d"st/$tS>@^Z@uStSZYy7h$v[^DžlOt?t7?ZY@)l;UWVSu] 3$hd#j\ h#SVu tUit)ft5huT8g0σvuC0g018/tj/WZYtPRd蒃Y dv1Wh#'XZDžplt5>WVZD@PRha1g p p8UWVS@] 3"01J.Su]Sj]0uEUEUSjҥ^_Sj80ZYuEUEUSj讥^_Sj0ZYuEUEUSj芥_XSj/Y^uEUEUSjfXZhV#躪H1411=81=<1=@141P]1E؍}ȹEľ uVSj譑xVSj蝑 x"}ujVj脑 y}tVSji xjVjV y}tVSj; xjVj( y{}tVSj xjVj yP}tEVSj ސ y1jVjː yVSj蹐 xsy y蠑h^#0j ^=-tUjhX%7-[^y eh~#0jX1 #=-u=x-t y@h#Yt8u`"VjZÅt @|/tCPK,1_uh#j'X1ZYtlj؍P(1/hHg04h) j؍- t! ttBGuB茒@y9=Pg0t h#j訑艐=-u-螉t X1X1e[^_]UWVS]u 6)hd#j&W 1h$VS`o tLtPt9pC.th`#n_8/u|h#P# Y^ukh#S _ZuZPSY^@tHxPhX%_Z@t2|9u;xuM9 u;EtjjsY^uj SDhJ.\XZJ.@t h"j1j4UWVS}] 3hd#jU 1h]#SW!n ft]/WPtwR)dD1벃vtbit6rtxu{$1<1181p1<181Z41K,1<(1-pC.9=<1zu8Quthg# Xt@1؋Ht ʉA?jud01[<1 81u t1=(1t =$1t@jPWfǃ uh#C =<1t.u)WkXCHHf $P&PDs VPshU#jM=<1tC ƒ?uts VPshU#@1k=<1^KPSC HjSW;pC 1ɉK +{uD{ u>=<1tCHSft\wlfucKPSC us語Z=<1u&sh$艣@1Y[RT28X=41usZuKC1n tl=<1tЊ8UŠ8?G贊8r4,1  1#1 1s@X{8t hѲ#j贋W@h[\xVS ¡(1YYu3t>jTPShU#@1_uEE%=@u"=D1uSh#@1Y[뱃=<1u=uE%=uS02ډ uv=@uS=41u SgZtX t?=<1uSh$訡gA838? %8u=,1S>X5@1*.1e[^_]UVS@jj^X1EĉEȉEEjEPj:- E9u 觼9EE`1j j.Y[h1H h1j d1$d#jOZYh#V-1ۉ]$h1k ^Z41tt3Hu:P1.1111E 1P141t.U=-v=1i`A=41tEP½X101,1tA:-HyP; X-H J h-X,EHm811)11<@'(EP藼Xu uXZu u,Y[}um=-t,Eh#譹^E=`1u PEuE=-u}rEj^^=-'7=`1u+hh#.[u&jh#PjIÃP$葻Y|=V-uL=`1uCEP袻$)#-Zu EP$X8tEP$輸XE"11ۀ=n-t$=1uEPsX1n-u'j4&^XC̈́RP 4ZY=n-=14-"15P1h=<$1tzj:WDYZt@0j.WIYZ`t!hD$1W_Z@`u B]`>t0<#uA%_D$1hD$1WZY@u ۉ%`8xPWZY@u Wh#jk=<$1tED$1E@$1jSV0Zǃ tl`1hȲ#>pu jSWQd W^X CHHf wg$&s JPshU#[Džl=s IPshU#1ttDžl` DžlD$1ht)KPt9Qu@$1t;Au A<5@$1RslЃ t"`tsh$.Y[dsH4Z~8t hѲ#jV#UWVSu fH1H1 H1 ʈH1H1NH1 ʈH1H1H1%d$1fH1H1hL#趕[t_h&$袕Y&t7GtPS(oYZu _ShT$Whe$j~1h$Vu] A6$`&H13h$1H1H1 H1H1ˋ=7h\#WjnYZuhs$WRnYZ<4^댡7^j j57Pǃ u|8"u 57hv$D=H1Ej j57ǃ t =H1!m|8"u57h$j}j j57ǃ u8|8"t=d$157h$뺸l57=~Z@_PH1H11H1yH1jH1_t9t ` d$1v jh$uh$ H1tt h3$j_|`$1H1ǃ;=H1u/;H1u"H1;H1uH19rt1= -H1H1  -=H1ttPu=H1tpC.U)…4=H1tt  1LjhhD1PQ)PLy hD1v=H1uJLxPPQZYLu&%=uH1H1w($<&J$H1PhJPIth#I^u`"hE$Ph%hS'SmǃuSh$覑Y[hF_$PBXZthW"hD1hH1Vg5h$1hH1V诉 ViFX1\`dDžXhVXPjE Džy0x8#tjVj#hQ#j,B_jVj‰P 觉P聊h`#ƃuH$SVh4%TP-Tu h "jjPh_n#h5%h5%wÃuV>YSxTPZ9ujVjPTH hpQ#V*LY_uVh$XZH1e׋H󫋅LfLDXtPrDžu V2[ghR$6&hJ.DDJ.HDJ.ZYyh@J. FX@J.P@J.0t- t( DJ.y h@J.E_@J.P@J.΃߃NP蛪^ JPIq=lI1u lI1 =pI1u pI1 PhH1|~Y[JH1H1Pp=H1X=H1t H14\,hD1hH1hJ.X5h$1hH1hJ.蜆hH1^Zxd-hpQ#v([_uvh$jLe1JPhmdPo h&$jv^~WwYu Wh ${H1eȺH1t jSR9 hH1]ZIP~pWUWVSjj]Sjjh&]<@u h$juuM/YtjjSPjh&*<@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ ;MQh$$#U1G맅u) J.yhJ.j (XZJ.PJ. 1e[^_]UWVS ƅ]-ƅ_1ۉJ1J1J115J1J1J11=J1J1J11h?$u uR ycPtJTtgxPl$& pK1뫃 pK1q pK1 e pK1Y pK1M57ExK1Ye57>Vj:V6[Zuh $SHJ1t)XV3 dZYXu C[ӉJ1=J1t h?"js7tuhd"1Ҁnuxou-h %P^_td#J1>֋=7u pK1id#7J1Ojph@&Ph$hJ.Y$j^]tK1pK1t pK1t xK1pC.M Tu)tP1ۉXhU hcT 5xK1PJXRrRh#RLqbZYTLS[jjLRPVDž9X}XTPT0VhPà uj/S0ZYuSh"h%hS$VXXu"VXXu9SW^ty2LhVcà LVh$juh"LRUaZYh$LR:aZYShP$jjhVjSXǃu Vhq$jphJ1hzd@PN uWXPK1`PhedAWN @uVh$WV^H__9~Vh$( jh]Y[1ۃ}=R1uPd4PEXZ PEX}u6hk($3YXE tKEPjW6~y6h{($|XZ6Eu4UY9ËM}QwZU܉9}u-MXDT1t؍e[^_]ÍL$qUWVSQ`AT1l0iL΋HƉ1ۉDd 7tPSSZY@tEUX\f1ɉjpPSX\p 9u>f1҉jjSX\ \]XP8uof8u:`f8,ShW$$8pC.`9)ЃPu#@pC.TP`9PpC.T`&@HtPS,WZY@u֋Hxu Sh-W$SYt h'jeh-E>h hp\1=hp\1>h@-h`\1y=h-hh\1j= h`\1=hh\1=XZUh-=XUh -hx\1-=hx\1[=h h\10=h\1x=UWVS$1t1󫍽p-tT1k8]1u;JDž]1AuRh-]^@uhq$h`-][@u hr$jchx-]YP-@uhr$ޅtsh-h^XZ\1\1\1}t x-1 -ƅh-u uUAǃ z=`Ntu&At/CG$`'Wh2r$O_Mb1Lb1wKb1k\1-Z\1NJb1Ib16\1*Hb1Pjhjjj j57;Db1 6Pjhjjj j57l;@b1 57hJ&o\1D8u9ƀ\1z{k Lmm _$'-L-B-6-*`- -ƅ--=pC.=\1uu =Hb1t_;jm:^+=\1=\1=\1uu =Hb1tjL:Y\1t Hb1t t Dž PPtVSE PE)P#Yt菴Džuh,'hRm$PVY @u hCr$_t*HkttWP)XZuh,'hPr$GS GS2+YXuV]Z@u h,'h]g$S;)Yuh,'hLh$j_Vw9Zuh,'hlr$j<_@ uhr$h,'h*WSй%1󫍅Phr$SAuhmp$Ss_XuzkhV%S^ZYuh!&h'hqPƍH_v󤍅PhiS_ @uhr$uYS ,j|V+Z thr$h'hihHk$VV.ƹ󥍅Phui SS_@uhr$Ujm7Zt h@'j^hU) hPb16hPb137 Uh-hdb16hdb16h> htb16h> hlb16htb16 hlb16XUh`-hb1?6hb1m6h{H hb1B6hF hb1A6hb1{6 hb16XUh`-hb15h-hb15hb1 6hb16hCN hb15 hH hb15h-N hb15hb15hb15hb16UVS8my h$sYhД%(:Zy h$sXjh$q[^]Au[jjph)$p u=jh$pXY$u$jh$h.$Ph"h5%j 7jSP @t-Et Ph2$s^Xjh$XpZYtj ;YhI$rj *Y -Pb jj hBa )zjjjj j jjjha z0jjjjh` yjjh` yEEEE jjjjjjjj j j jjjuV}8jVjV1EEEEEEjSjXjSjX$j jjEE EjjEPEPjEP!ƒ$BuUY8b1 -te[^]UWVS]} DžhDžT1ɉL11PXDžDe h$WSQ8 ubfFt/RODžPg7$t'57ʁDZu57hl$Xu78#t57Yu[ j dR@Pu d:uh$WF?ZYu%FKw\u vh$WhPƒ NFjjLWv XP6x j\P)^_1u?h;$jNi T\PhZYu \~F9|1hSW[j/W膐tPRT. ZYu Sh$$j1i1i1ȋ=i1Ɖσ=i1~SWPh>$)19}89މ}Pj uh$j?AXi1 di1=i1t ؙi1ti1~o5i1i19и})?9и}9и}i1i19ji1~lt i1i1i1MtIi1=~!i1=~1hPh֒$ hPh$ =di1uÃ=i1u=i1i1=i1u i1i1=H-,=i1t#jh$h7$h_$yi1=i1ui1=L-i1wt(9uXXu݃=i1(0Vp_Xtۍth$j ʯPhj$jdWbMj jjh%(Qxi1i1i1 jxlPi1@PVh$N@g=;0Shj$jdWj襯0PV y Vhф$jXGyh@j1h$SA_Z@t=$j1jjh@j1 yh@j1h$$VjPz[^uh@j1h7$-Dž@j1jh@j1h"& u DžEj1xnjVh"I& u ƃrVW&ZYtVRW&ZYuSh@j1hF$ 늍`PPjh@j1j@uh@j1h41'>=j1uj1u hZ$j6tX uuh@j1hq$u.h%P&^_@j1th"Wh.'j5@j1t(j11RP5j15j1pj1j1j15j119|z<@u t#j11RP ؉ j1j119| h$t0 j1j19sSQWRPh$j4tOtF j1 j1j1%j1RPl @u5j15j1Wh$j4*0PY[@uWh$YKXZ $19Ћ}N9}PVJ u h$ja3)VZ j15j1j1j1j1u_t j1Z@19} j1 19| j1=j1j1t1RP@j1iދ1SQRP@19}! 19} j1W29ttVXj j1 j1 L$qUWVSQ\yDžxƅwjjj[lx3 yhi$Cjjj=hx3 xjPZY@u h~$XHX4APB^@u h$j)17Y1ۉd`1h$W\& [C4$ 2'|x3̀"j|P57L |:u 57h$zv2뉁 |x3z xx3n |x3bpC.pU|P57ɨv2XZ|8u r57h$j/N&PP$h٦$j/j|P57$L |:uy 57h$릣v2 |x3 |x3|x3t h$@|x37px3j|x3@u |x3 |x3A xx35j|P57jKà |8uy57h2$hN$j. |x3 |x3 |x3@j|P57d |8ud57hg$`j|P57J |:u Pv57hy$#w. |x3jj8x37# |x3 jjHx37$YX|P57[Xv2XZ|8u57h$|x3Dž`|x3v2zutN&v2tL=t hӧ$Ov2v*=t h$1=v2~=t h$ٽrfr fpv2٭p߽h٭rhlxv2|v2PT߭PTtjPh$j\}tVS/hQ#jn}DžuI%P3_|$t8=3tj jh Q#Wh9$=3t j jhP#WhF$j8j jhQ#_ tVWhX$jWhk$j hd#h!"hz$jjhd#h!"hz$y }ujjljjcjjZjjQ jjEjj <jj۸@u h|$j4jjZY@u8th$=jeX}u藶jR_j j聸ZY@u8t+h$*Y2 u h$IZ WXVS`hܯ$* O0jjƒ d#Bu$SPh%j<UWVSDu]  '3h8'SVh v~jm cStITtbLu܃3뼃dw$\4'3؃3ԃ3̃3z3kȃ3\Ѓ3Mă3>pC.)ƍ;3=Ѓ3tjjhx%诶3 >Ejjj"3jURh@hP8T @u hT%&)Y=3y h&j;u=3! . WZ) '    ms / =3t1ɉڸ"1ɉMhjE؉EhjE܉EhjEȉEhjEĉE hjEEhjljEhjqEMU ʃ} ʃ} у} хuu ha#E1҉38gtj53϶_X1ɉMEd#Ed#FEȅCEċS:-%BRUZH3U$4'3"0-30-30-30- o3dY3J3;30(  @uCEċSEP1ɸ uCEċSEP1ɸxuCEċSEP1ɸSuxCEċSEP1uXCEčM̋SEPECEu$CEċSEP1ɸ~X3uCEčU؋CEusuċs t^p3hw$x5']1Rx3F3:3 .3@"33 h3 @3 3 3t `3 d3t13jjV蔗1s R3uM̍EPUPEuM̍EPURYuCh[5&s^Z=ԃ3uh$h$h֬%G 3DHw*=ԃ3uh$h3$h֬% 1ۉ3SEP1ɸY]ċu3Ã]uhO$1];au uhq$33t]ȉ]th$j uąu}t }ċ]=3uMEȉE 18E0 1҉31atctguTEÀ3EģȀ3€303@03Ԁ33̀33`3@33tyUU9sHxt)Ј3tKU؊B<w r7ED T 9sJU L }؍W9sIH 833tM}tHpVWh83Ԧ =ă3t =3t83$A3tKMtHxWQMV =ă3t =3Mt$3tKMtHxWQMV+ =ă3t =3Mt´$3tKMtHxWQMVץ =ă3t =3Mtд$E3tKMtHxWQMV胥 =ă3t =3Mt$3 tKMtHxWQMV/ =ă3t =3Mt$3f53=ă3t!=3u=3tj3=3Vh353P u($87tPh2$ښY^9~kPhP$ĚXZu83u =3tH8t[X}t(u2=3uEpIPhq$ u j $YPh\\#XZuuuuuuu1>܃3 ؃3 ȃ3 ă3PSV 11ɉډe[^_]WWe[^_]UWVS }hM$PZYƅh"u W t.at"t=T37T3þ뼡pC.)Džt>upT3t&h,D$S,^_tho$SZYt2=T3u)U @38ujOuShT$hJ.Shq$hJ.j~=d3u.d3h$u W t@YA3w$P9'z=d3ud3먃=d3ud3듃=d3ud3{=d3ud3c=d3zd3 GL38`3)\3`3 =d3"d3@`3D3H3X357@3X=d3d3=d3d3j=T37T3h!%PY^>P3/=d3Fd35d3)pC.EU)tHt:t#u =X3=L3t =H3=T3tEt h,D$WYZt&ho$WYZth!%W_ZE U @7@tCƀ5\3jj5X35`35@3e5\3jj5X35`35@3u>5@3Sj ISh$j@3? =P3jEPj4 @u h$EUuuh$[h`RPƃhʻ$t S薵YE  1SQ%1RPhڻ$ήf1=P3t~Tph%V_Zt)h$VZYtuSh$yj Sh$jj蓤j茤UWVS u] 1h$SV tRtfu23ֿϡpC.9td1ۉ`XVSVZYVxPVkZY%=`h=@uv:u^Ph$H[^Dž`ddPhS耓 FSh$js0hٺuٺÅjhh$hV芫l=3u Džp$lPVC}ZY8t Vh"$^X53S裤ZY@Sh$`e[^_]UWVSd:hd#jlXZE 0W1ɉ ̫3E4o%E4,o%1ۉE4$$^u $E4W4W4W4W4W4W41ɉ `X4 X4 W431ۉE4E4X4X4X4150N4,N41=(N4$N4N4N41N4 N4Ы3E43h $Xt/hSh3 =vj?q$Sh&$9\3h#ZN4u N4`"h6$m_h$PY^u W4h%S_Zu15W41ۉW4Qh$SZYu W44h!%S^_uW4W4 Sh>$Y[hd$P__ZuW415W4h$S:Y[u W4hi$ZW4t8u W4d#=W4tW48uhs$]X1W4h%8_th#P[^1ۅfNJ.ftPYdX4X4J.fJ.ftPZt!`X4umt X4N4111Bh57h3 =v#j?8$57hU#jE4U Ehb$RP HP̃D1$P:'E41=W4=W4tt1j5e42hJ.׺ t h"j54}UWVSP}1ɉMM1h$u W t3gt!utGu.7E7;u7E85pC.9!t3SwZt@E%UMM@uSh$j1}1ɉM}t EZE1}t6h %EP3tYZt"8tu h$jwGDʋE 46Z@u6h$jwhX%Y@ttEPW_Z@uh$}tu薓Y@u h$j1tuZ@uh$FtVRPYkvh$jh#eXu5%jh$SS3Sh$jUWVS] 414H44%14h£4a1X @'lt2Ft&V =4uRh4lY_ RvP 44444h%lZ1u"hJ.hr%gjGDuG 4ht%Su tsmtW~ԃptXrthJ.hr%jzft$Cuh4h4hr%57J#뚡7N뎋574w>qxPh t%/V[_uUu;EE|Ch!t%YY1t:SZt@ <uOtS)Xu 1hjhN$h$B Džh2tt25L7no5L7KojjSPN@4uhJ.h4t%tI5454PY[5@4YEh蛓hjhjhj 5L710hh4UEj@*j@!ǃZRjFP[1XZt1x|1ExMx|uuSx|1ExڸX%mMutx|ڸOt%LMx|ujDXjVXpZY؋pQ lJIl9ujjjjjjjjj jVpj;l4@t!jEWln1l<pl1l Y9t}&t4t4tXZSשWѩjlDà tPjЭjShc#v4j5D 4j")D$47[^u.ht ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:more than twoexactly twoUNKNOWNdisremainstat failure on: %sinvalid device: %smirrorFor RAID level %d the number of columns must be %s. RAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%ubusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGutf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260220120551Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%jx %*jx %*juBKMGTPE%s: %lluen_GB.UTF-8 (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: Long_Type: %s Attributes: %s Could not find index %dDetails for index %d: StartType: %s (%s) None %*s index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]gi:b:luaxAhHpW:wGPT not found, displaying data from MBR. %ju %ju %u %5dshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addresspltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSPriorityCapacityDevice%-*s %*s %*s %*s %8s %s %-*s %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresvvmresered/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: ND options: DHCPv6 options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %snd_dhcp6_unknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completemulticastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s%s%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist-> !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZ2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqj7>=?{=X=?=&= =<<<<>>8p8W8A8X;?;77:::g:N:5:::9n9U9<9#9 98;q;77j7=8A<;;`>>>77:@7???j7j7j7j7j7j7j7j7j7j7j7j7?@?@?????@j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7j7.@?_getpagesizeqsort_r__sfvwrite__sflush__swsetup((((((((((((((((((((((((((((((((((((((((((__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sclose__sseek__swrite__sread_int__strtoimax_lCtolower_ltolowertoupper_ltoupperisxdigit_lisxdigitisupper_lisupperisspace_lisspaceispunct_lispunctisprint_lisprintislower_lislowerisgraph_lisgraphisdigit_lisdigitiscntrl_liscntrlisblank_lisblankisalpha_lisalphaisalnum_lisalnumc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtocs_citrus_NONE_stdenc_mbtowc٭VVVVVVVVVVVVVVVVVVVVVVVVVVVVVNVVVVVVVVVdl_iterate_phdr_setupnߴߴaߴߴߴߴߴߴ@3ߴ̸ߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴߴNߴߴߴߴߴߴߴߴߴߴߴߴٸߴߴߴA1ߴߴߴߴߴߴ0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nopt_rdata__res_nmkquery/&_hf_gethtbyaddr_hf_gethtbyname2_hf_gethtbyname'''J$J$.' )(J$J$(4&((|(4&(_nsaddsrctomap]:[=              2'2'2'2e444l4s4z44f33424;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::   9876543210/.-,+*)('&%$#"! :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::DEAE216+-.99+&%/ /E!()*!!# E          clearerr ED ED E EaDE EENEXTINDEX__rec_dleafNEXTINDEX__free_ovflpage__get_page__add_ovflpagesqueeze_keyputpairugly_split__split_page__delpair__big_split__big_delete__big_inserẗ́̈́ ̈́̈́@̈́NEXTINDEX!!-!!!! !P"%#% % 7% <9# x$ # 0]# ,$ h]" " $ % X]$ " 2& ($ <5& L$ pQ# # m# \"&  R# F_$ i$ l& 0R# % /4# % % %% <% x% u$ %i$ U%d% ,n%,P% hZ%h% %% %% %% X%Xi" X% Xy% % % % % %%  %% %% % L_% .% #% B# '% & \+%  0%  5% :% ?%  C%  G%  K% i$ O% T%Y%^% c% h%m%r% v% 0z% 0%0$ 0%%`%rQ#% %,$ Q$ a% # \# % \# % \# % \# " \# % \# % \#  %  \#  %  \#  %  ]#  %  %% %%N%`'%đ#<#3&\# )& %%%%%%%%% % % % % !%(%+%2%5%=%w%B%L%S%%X%a%g%f%l%#s%5#P%}&L$#&&%|#e\%&&G#&G#&&5#&&(#8(9!&t('&( (-&(4&(U~~ ~! !! ! ! !; &K &d#V &)$a &l & & &d#`(@|((|(@(OOgntsPNyP#O3#;&;&`^rbmn`^O]\\)]#܂ yekdޒb0tcidЄɊ5W ))&;&;&&B##%atadաc$loobw z<(<(D(D(yara͸,Js#$#% & &&/&:&U&b&|&&&"&&&&&& &*& >&H& d&o& &k"& &'&&&'&<'&&d#`'O$"Y"c"m"v"}""""6$&""""""""c%"""a$"""""""""#"6$&J"N"S"f"["`"f"l"r"y""""c%#""a$"`b#"q#&&&"&()%&&*&.&(&%ɬ%$&&&&&&& &&&%%&$&#&(&-&2& "7&<&A&H&M&[" % %S&W&[&_&c&g&k&o&s&w&{&&&&&&&&&&&&&&&&&&&&&&&&&&&&!&,&5&N&U&_&r&&&9#&&&&&&& &&1&J&`&x&&&&&&&&&+&>&Q&d&w&&&&&&&&&)&=&Q&e&y&&&&&&& & &- &X(Z6Z{{|3|zz?{zB{{k{|3|zz{zB{~ }'"%$#%Z#&%0'\'#&'#&#&'Է''#&,' $&!$&>$&0#&$%%'"%'"%'"((((I%&&&&&,&&&&&&&&&&&\:&&&?9&&&&&&&&&'& '& !'&)'& ;'&C'& d#d#O'&V'&d'&k'&s'&{'&H%V%a#p%n&'&&'&'&'&'&'&%'&'&'& (& (& <&x% (&ع' ?)&(& .(&4(&&E(&Y(&\(&k(&$&o(&(&(&(&(&(&(&"%(&(&(&(&R'&Z'&)&)&(&(&(&'(&%]B$<#(&'(&<' )&`'!)& )&")&!)&#=)&C)&$%I)&%V)&+&&H%[)&'w)&})&))&#*)&)&+"$)&,)&)&-)&)&.)&)&/)&)&0)&)&1)&'2*& *&3*&*&7+*&/*&cF*&J*&b*&m"g*&l*&*&*&*&*&*&*&*&'*&*&#=)&*&$%*&%V)&+&& +& +&'w)& %(+&+&))&;+&H+&L+&R+&V+&s+&x+&+&+&+&+&$+&Q,&+&+&+&+&+&,&,&!,&,,&X#9,&>'&U,&b,&i,&,&t,&{,&i,&'?&2#,&",&H+&y$$%#&#&$$Q1&Q1&$-C^(^(^(^(^(^(^('----C4&G4&K4&O4&S4&W4&[4&_4&f4&m4&u4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&5&5&5&$5&5&& &25&X%d#d#d#d#d#d#d#d#d#>5&D5&b#ۼ"J5&]5&u5&5&5&5&5&5&5& 6&6&06&a#J6&\6&h6&~6&6&6&'6&6&6&6&6&' 7&7&(7&@7&M7&c7&&'r7&,'7&7&P'7&7&p'7&8&+8&E8&]8&'{8&'8&8&''8&8&8&9&('L' 9&49&p'G9&Z9&g9&x9&9&9&9&9&'9&9&9&:&&:&@:&S:&'l:&:&:&:&':&:&:&:&;&%;&9;&F;&[;&o;&;&;&;&;&s#%q#qc$n&#l3#N[$ %#&$ %>#&[^(^(^(X%d#d#d#d#d#d#d#d#d#14&R.S." V.H7%ð"ڰ"""("N"\"m"""ɱ"ӱ"_s"|""""&"d#*"d#"d#˼"ռ"*m"d#%d#޼""ىj""L""m-"" A #..##$A%5%5#d# 5#5#BS#5#1#5#$5#5#6# 6#6#Wu%d#V=`#d# 5#d#>&e%*6#d#26#d#q%d#"d%d#86#d#"d#޼"<6# O6#d# Z6#c6# k6#d#m v6#<6# 6#6#AIS#%e%\#\#\#\#\#\#\#\#\#\#]#]#.J. (prog_root)`-  * . ` d f o 04?4sz `-z_##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|@-  ( ( ) ) -boK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJf]$d# d#d#d#d#Fd#%Ud#%^d#ed#md#ed#xd#ed#d#ed#d#ed#d#ed#d#d#d#ed#d#ed#d#ed#d#ed#d#d#d#d#d#e# e#e#e#ed##e#ed#.e#ed#5e#ed#Ae#ed#He#ed#Te#ed#[e#ed#ge#ed#oe#ed#{e#[$e#e#e#e#e#e#e#e#e#e#e#e#e#,$e#e#e#f#f#e#f# f#%-f#d#` /=f#ed#Sf#d#ff#d#f#d#f#e#f#e#f#e#!g#2g#9g#e#jg#e#g#g#g#,$g#[$g#f#g#e# h# f#.h#e#Ph#e#h# - - - -8-8-8-8-P-P-P-P-""    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ n#n#n#n# is not a regular file (use -f to see it) is a directory-- (p##$q#0$b % #p#p# p#6%fp#"0q#q#:q#% q# q# +q#5q#@q#$Mq#Wq#gq#^#sq#q#"q#>>&I$q#q#b %q#;q# #7q# q# q# q##q#2r#8r# r#,r# 8r#(W#Jr#Vr#!br#kr#9}r#r#x#r#&6%fr#)r#r#5r#er#:r#t#%r#r#6p#r#4q#r# s#+s#,#s#-2s#.Es#*Rs#[s#?19%ks#E #rs#/~s#/s#'s#F &s# WmkRkRkYcWbkCkc kG ky wb YMYrWca-7/{#{#{#b-@7/=|#!|#B-7/@|#e|#cx-7/|#|#|#dp-7/|#|#p-A7/}#/}#Dh-(>D}#e`-7/Q}#k}#}#fX-7/}#}#FP-7/}#}#gH- 7/!~#@~#k~#h@-7/~#~#i8-7/=~#~##j0-89#G#J(-!7/T#r#k -H:-H%;K-|7/##L-7/##m-7/###n-"7/*#A#R#o-7r#O-8}#p-H<P-<#q-7/##܀#r-"7/##G#s-!7/##S-!7/#́#t-[;܁#T-<#u-7/##4#V-=w-"7/J#l##x-(@Ԃ##Xx-A7/##yp-7//#F#zh-7/g#|#"`-}A#~X-!7/#ȃ#?P-B#H-:##@-A7/##8-t7/+#M#0-x7/o##(-p7/#߄# -( B#-d7/+#L#-`7/Bp###-\7/BŅ##-X7/#(#-$T7/CC#W#-$P7/TCu##-L7/#ņ#-!H7/ކ##-!D7/C##-!@7/*#]#-(D#-!47/##-07/LJ##-,7/ #+#-DL#-$7/]##-7/##- 7/ӈ##-C#-!7/3#O#x-7/d##p-7/###h-7/-#X#n#`-7/##܊### ##0##9##B#W#f#u##$####Ë#ԋ##### ##"#.#6#@#x#F#L#q#S#c#4$k# &y##y$###ʌ#-Ќ###3#׌#######'#4#B#N#Z#j#x#aq######>$# (press RETURN)8/&& &---tags643`#t\##đ#<<!19%t<ɑ#>#bt#p#|3#$D#Cf#+f#c#ڗ.#s#s##sؒ#7?#ڸ##kx#J/#Et#FH#P#c)5#a"l$s#h#J/ !"$'(+-.03569: ~#b#j4#jq$cV"f#h#k#l#m#o#o#p#p#p#q%r%uc%t|#v#w#w#x$x%zm"z(#B#C6$J9#OC#PR#SY#TyA%Vqy%Vd#Xs#Zq#Z|##### ## # t"### #6$## #( t ɭ # t Z  ; P AU * #(y s - # v `  ; P AU  /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin1}-+?=###%%%}11#a##EV#eQ#F#I#i#LP#l#m #C%n#f#!#p(#b/#u7#"@#K#qi$sX#d#h|#vQ$VVm#x@= 1--d ##_> g$H%@ w$#sB $$? $#:D $"? $I}$? $$E%o? 3$"p#e#> Q$"? p$%$ ... ...!$2$2$ G$>G$H$2I$I$d#S$S$X$d#S#>Z$Z$![$\$!]$7$_$_$_$7$3`$I`$7$S#c$ e$f$i$C t c R 8'#i$ '$-8'1i$-i$'d-X'%-%X'i$-i$~%  | k 8' j$-Aj$'D-H'3 t$$H'r$ -$@'r$- -@'r$-0-@' s$4-@-8's$`'-8'6 M$l$'-8'U i$-Ak$'-8' mp$-l$ 'D-`--`-8'r$--#]1-8's$@--#]1-H's$-$@'1s$--@'>s$T--@'!s$---`---- --`- ----@-`----P-X-`-h-p-`' Wq$-Wq$P'G Os$-i$k$i$P' ms$-k$V%k$P' s$-V%i$V%8'%s$--#]1-h'# s$2#h'C s$2#h'm s$2#`' s$-s$P'G s$-i$P' i$-k$X'r$- r$X'  "$- "$X' v%- v%X' %- %AabCdhlNsuvW:w:z8'gv$'-`'1( =7%-=7%`'' v$-v$`'' v$-su$X'( u$- u$`')& (u$-(u$8'w$'-P'v$ -v$P'e= w$-w$8'x$`'-H'G y$-y$X'IG y$- x$`'M ~$-~$`'K ~$-~$X':K y$- y$`'J c%-c%X'U {$-* {$X'U Y%-* Y%X':S ~$- ~$8'~$-'-8'~$`'-8'~$-c%'-Pb K$vg $vg $-i $ g $h s$vg $vg "e Í%pf $g o$vg $Qh $vg $vg Ń$Qh ʃ$vg %$  '@@)"3"#"!%8$bu%#%>"E" K"R" Z"_"%@%k"@v"...... ...... lost+founddA%$c$$M$9&$q#$% " % ٴ$ $ Fv%$t$$$$~%i$6&%$##v%$i$$"$ $! $"$#%$$%!$&5#'($(_$)1$*$+:$,>$-B$/K$1U$1a$2m$3v$4y$5$6%H%ۿ$#$#e#$$"`N43$<$F$Q$]$$##f$n$f%@:'Y&@:''sz$@:'a%@:'B%@:'A#@:'[Nۿ$@:'A$@:'+aU#@:'c%&@:'R$@:'h"@:'g_Q#@:'`D%@:'L$@:'c>&@:'Q$q#@:'St%@:'V#@:'`H%@:'}N$@:'f$@:'Ef$@:'zf\%@:'+a$@:'q$@:'L%@:'xBo%@:'$@:'yP$@:'I#@:'Q+&@:'Nx#@:'Y$@:'8`$@:'A$@:'NS#@:'n$@:'m$@:'\ #@:'V$@:'Yj$@:'ST)$@:'W$@:'-J"@:' ]$@:'W $@:'V$@:'"rK$@:'DB$@:'lՐ"@:'n$@:' D$@:'-J$@:' D$@:'m$@:'V$@:'bd$@:'c˔"@:'$@:'n$@:'Ve$@:'Vw$@:'V $@:'V#@:'Q"@:'%P##@:'WP$@:'b$@:'B$@:'4\p#@:'+a$@:'^cT%@:'h%@:'o$@:'I$@:'I$@:'r(&@:'U5#@:'&@:'Pi"$@:'`($@:'].$@:'>m6$@:'f$@:'B>$@:'P?%@:'pG$@:'_:L$@:'l$@:'o #@:'MX#@:'BL$@:'f5%@:'j$@:'BT$@:'hn#@:'N -&@:'@!#@:'_1#@:'Cq]$@:'YA%@:'Z|#@:'O $@:'o#@:'Y@$!y%P#?%9%z$$ $$d#{}abcdDgGhHilnNpPqrs tw xy !:#=44oGl0l6l$k$k$k$k$ l$ljjjk1k+Kkׇusllsl#t>}ukluO]<y{$zJ|2#VjF%ijH$|jbI$j%j$jD$iV$ic$ jn$jm$0jx$Cj0$i:$i $ri$i$i#$ibntiunoupqutetuulvmIvnuoupvqrytsx8iLiy`i<=[>?75%i$i$(i:mml~}$UhSmmm}m~bmsxhTh$h$h$h5%Rh$eh$xh$y$x4$xZ$x!܄Nn3nnmHnninL5n1ӆjpk"n ?%2h%Bh ˄h ongփooo~ocoAoeh~&oHxԅ zyy$zzzzzzkzWzCzgg hgugP{/{{ză;gOg&{'{({)q{{|^x{{%{E|9|-|{|%Pf%jf%f%f%f%f%f%gK . .{  .υ%  .d# .#gd# .d# ` .ag( .ng} .g @ .  .pd#F @ .y4sd#F .oy-r  . @ . .d#F.tpqd#F`.yxqd#F.Lyqd#F.)yp   .# .$ .d#F .Ldp|wd#F `.NTpv$  .; ..d#2$ .~$ud#2$.~$d#2$.~$d# @.d# .d# .d# .d#  .x.w.ud#F`.|d#F.rd#F.Dp| @.Q| (-hkd#-d# -$$$##v%$^$2#%f %$ $SN$$# %$*$2$$$$$%8%%%%%""%")&%%%]%%%%%%%R$["%$%7%d%u%%%%%%-%% %? %\ %| %" % %^$J %N %V %i %O"u% %Ɲ" % % % % %f % % % %% %Y %d %x % %a %%%% %%%%n%}%%Q%"`%%%*%%%%%:%%I%$%4%%%%%)%8%J%^%k%|%%%%%%[%p%}%%% %+ %J % % %!%!%h"%"%[#%#%#%!$%%%&%K'%d'%'%'%m(%(%(%(%)%*%a*%*%*%*% +%(+%7+%X+%^+%w+%+%+%+%+%+%+%+%+%,%,%",%.,%>,%T,%c,%p,%~,%,%,%,%,%,%,%,%-%0-%-%.%/.%c.%.%:/%X/%00%L0%1%2%2%83%3%&4%=4%_4%i4%q4%{4%#4%4%4%4%4%4%5%!5%L5%`5%m5%y5%~$5%5%5%5%5%5%5%6% 6%#6%<6%W6%v6%6%6%6%6%e$6%R$7% 7%7%7%7% 7%C7%J7%W7%g7%7%7%7%7%7%_$7%7%8%8%)8%<8%I8%N8%W8%]8%n8%>%w8%8%8%8%8%8%8%$8%8%8%9%!9%,9%79%D9%S9%b9%p9%9%4:%Y;%<%>=%>%>%>%?%;?%Y?%k?%%$?%":#?%?%?%?%?%?%?%@%B@%o@%@%@%@%@%A%A%CA%XA%A%MB%eB%6C%MB%GC%mC%C%C%F#D%ED%sD%D%,$D%D%!%D%D%D% E%9E%`E%E%E%">F%F%F%F%F%,G%}G%G%H% H%H%Ϭ#9H%bH%iH%wH%H%H%H%H%H%H%I% -&%:L$b %$JJ%I%I% J%J%7J%XJ%:"rJ%J%J%b$J%J%%J%J%J%J%K%K%\N%wN%N%N%^$R$N%N%N%N%N%#O%O%O% P%#I}$#P%# %P%P%bI$P%F$P%`%P%Ey$P%P%P% Q%&Q%RQ%Q%Q%Q%Q%Q%Q%R%T%ST%hT%T%T%T%$V%6U%SU%lU%U%U%V%?V%W%W%X%Y%Z%`[%[%<\%M\%d\%i\%o\%x\%\%]%]%^%^%6_%%m"y%[_%s_%%&_%_%_% `%D`%`%`%!a%a%H$a%a%a%b%1b%[b%b%b%c%.c%Pc%pc%c%c%c%c%c%c%&&c%c%c%d%"d%Jd%Zd%kd%d%"e%e%e%e%e%e%"9"e%e%e%f%;f%Cf%Kf%Uf%`f%rf%f%f%f%f%f%R$f%f%f%f%g%6%g%'g%2g%Dg%Wg%lg%wg%g%g%g%g%g%g%g%g%g%g%g% h%h%1h%7h%Jh%^h%rh%g%R$f%h%h%h%h%h%h%h%h%h%i%1h%'g%i%4i%Bi%Ki%`i%ri%{i%sD%i%i%i%i%i%i%i%@#j%j%j%0j%Ql%rl%l%l%l%l%n%n%o%o%1o%@o%Vo%o%o%o%o%o%p%p%,q%Eq%q%q%%%%%C&!%%%;$)%-u=/&a$k%p%o%p%o%t% ftp%@+%$ʍ%5%Ս%ݍ%%@)$ $%%%%A$ %+%# ,%U%-%3%+&9%s$A%H%$0N%T%Z% _%e%10m%&##'t%(}%)%*>&+%.1/h%_6>#n?7@~QƤA%yB%yC%yD $BE %yF "yG b$yH A%yIաd#vɡd#d#1u1eui%%˚%ؚ%%%%%%,%9%F%U%]b\W(]Sb\R'%>%dA. X%d#d#d#d#d#d#d#d#d#CI%M%Q%U%Y%]%m%M"a%g%#& # # Ԋ# j% m% z% }% w% % %h"$%%%%o%%% #a"%>d#%"%i#%Fn#%e#S % %!%"%#%$%% %&%' %(1%)C%*L%+V%,\%-c%-p%.w%.$/%/#0a%1#2%3%4%5"6%7%8%9%:%;%<%=%>%?%@%[$\ %\%].%^9%^K%_V%__%`l%{w%{%|%}%}F#~%  -dd-ddTdd:dd:dd%% % ^#@%@t#%%%\$%# v$ % %@%@$@%@%@%@#%`(%`4%8%>%#E%K% P%@T%Y%!%z%2##d%#l%#t%#x%#~%$%$%$%$%$%%%%%%%%%%%&%&%&%'%'%'%(%( %(%)%)&%),%*9%*C%*I%+T%+_%+f%,r%,%,|%,%-%-%-%-%.%.%.%/%/%/%6%;%;%0%0%0%1!%1*%<0%<<%=G%=R%>I%>\%?N%2d%2n%2t%3%3%3%9%7%8%:%4%4%4%5%5% %! %" %# %$ *%% 5%& @%' L%( X%) d%* o%. {%+ %, %- %/ %0 %1 %2 %3 %4 %5 %6 %7 %8 %9 %: %%; 1%< =%= I%> S%? ]% @f%!@o%"@z%#@%$@%%@%&@%'@%)@%*@%+@%&`%'`%,@%-@&.@&/@!&0@-&(`:&1@F&2@S&3@`&)`m&4@y&5@&6@&7@&8@&9@&:@&*`&;@&<@&=@&>@ &?@& `#&!`0&+`=&,`J&"`W&#`d&-`q&$`~&.`&/`&%`&C&C&D&D&E&E&F&F&c&c&d&d&et%e&#&#%&&2&&@&0O&]&a&e&i&m&q&v&{&&&&&&&&&&&&&&&& & %@&@%` &&&Y%!%&"&&&*&-&2&7&+B 6$&33333333d#d#&&&&h'3333"$#$%"&UTC3333-- fB33@(99㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž33@E.D.D.D. - 33UU33UU33UU,J.@J.`8@J. S  W F.J. S  W `G. J. S  W H.,&,&,&,&,&b,&b&u&&w"&&&&,&,&x   @ Ž333333333333333333333333333333333333 3333 dO.3333 @(@(p80000000000000000 @933330B3333  33P.P.P.33 (root)`-C^(^(^(^(^(^(^('-----((((S.6 ]9 7 z8  7 7 b7 7 7 2 2 2 2 3 9 P3 `3 : 4 "5 U5 y9 6 6 ^9  4 5 Service unavailable}%%@6x!oAٻ8R@K`  [BH\4( K%oSyIRҜ)oX +g<ѕ2n]ԅȻm}Ns+(G?ˍOd7d {,ur7[R:8_~<Ȟ1<\ya^O"gw<߯ӈݢ"/ww&üWl^fϽH_wl:˽Z3+Vkm2M򬆽}Zpu~[bqPiǢf?eWK[XZONo_}wͮ~{vEQj1 Duw Z(;+u`YI++h`yX%|s8D5t`.ܸP$pc AmmRfW%iLQpFs߉ D49gW:}^x5nbRAk3QV;eE#X\UBm*dTv ^ramdiskbin.debug .shstrtab.note.netbsd.ident.note.netbsd.pax.init.text.fini.rodata.tbss.init_array.ctors.dtors.jcr.data.rel.ro.got.got.plt.data.bss.SUNW_ctf.gnu_debuglink ,,/ 5@@#@;p"p A"z] In-n$On-n$ [ o- o$bo-o$io-o$n o- o$ {ԏ-ԏ$ -$ -$p S.pS% pS%0V%HV%MSGTXTS656 5264 5289 5306 5328 5331 5336 5344 5351 5359 5367 5370 5373 5376 5380 5392 5401 5414 5443 5458 6001 6035 6718 7006 7714 7770 7844 7940 8115 8138 8161 8167 8176 8198 8202 8206 8209 8212 8317 8520 8759 9200 9638 9673 9688 9700 9706 9718 9767 9787 9827 9844 9861 9876 9923 9961 10009 10091 10215 10351 10392 10430 10467 10502 10512 10561 10711 10717 10722 10726 10746 10856 10876 10882 10896 10908 10919 10956 10990 11014 11116 11153 11175 11274 11329 11387 11398 11414 11466 11634 11841 12012 12076 12128 12399 12948 13476 13907 14245 14578 14691 14706 14715 14875 15046 15196 15360 15383 15407 15422 15497 15637 15814 15969 15981 16061 16162 16208 16234 16304 16315 16324 16337 16363 16378 16394 16407 16462 16473 16488 16692 16925 16954 16969 17038 17112 17185 17215 17253 17307 17726 17752 17781 17885 17991 18176 18288 18403 18507 19194 19453 19593 19629 19799 19840 19976 19999 20036 20081 20332 20428 20482 20581 20592 20629 20666 20693 20702 20736 20743 20768 20795 20830 20844 20858 20887 20901 20918 20927 20949 20967 20984 20995 21014 21040 21058 21081 21098 21113 21128 21146 21173 21200 21222 21261 21279 21311 21539 21613 21656 21702 21849 22005 22049 22328 22355 22714 22898 23050 23231 23378 23536 23557 23605 23615 23623 23634 23645 23655 23662 23677 23689 23726 23756 23795 23848 23906 23927 23934 23953 23974 23981 24003 24025 24045 24067 24098 24135 24157 24171 24217 24246 24280 24320 24355 24383 24431 24440 24449 24454 24463 24472 24489 24493 24498 24504 24508 24546 24555 24582 24602 24625 24644 24671 24693 24725 24741 24746 24756 24779 24801 24818 24835 24848 24857 24866 24872 24899 24906 24930 24951 24975 24988 25007 25032 25055 25071 25077 25089 25119 25127 25167 25178 25189 25200 25217 25234 25248 25265 25481 25785 26233 26449 26713 26985 27037 27073 27109 27160 27177 27215 27229 27236 27253 27256 27261 27270 27282 27293 27302 27323 27365 27403 27419 27450 27475 27510 27566 27606 27627 27647 27688 27717 27765 27998 28033 28240 28259 28296 28357 28395 28434 28590 28605 28651 28699 28722 28758 28768 28778 28789 28794 28857 28905 28949 29010 29043 29144 29162 29301 29323 29446 29460 29470 29493 29598 29654 29770 29801 29806 29832 29871 29881 29924 29934 29950 29965 29983 30006 30036 30057 30083 30280 30323 30327 30333 30339 30344 30355 30369 30398 30430 30442 30489 30539 30579 30606 30622 30631 30674 30680 30688 30692 30712 30729 30741 30772 31028 31077 31653 31680 31712 31740 31792 31798 31804 31809 31830 31846 31868 31897 32038 32172 32185 32321 32323 32325 32327 32344 32357 32375 32402 32406 32412 32417 32425 32431 32471 32473 32483 32498 32515 32549 32581 32619 32648 32677 32699 32742 32768 32812 32948 32950 32952 32967 32970 33019 33293 33306 33344 33356 33379 33392 33417 33442 33467 33492 33527 33558 33597 33652 33759 33788 33819 33849 33886 33942 34057 34093 34517 34540 34810 35116 35426 35642 35753 35852 35869 35892 35896 35903 35912 36034 36103 36391 36529 36670 36751 36798 36804 36813 36826 36849 36895 36898 36943 36986 37051 37113 37183 37251 37344 37563 37588 37592 37628 37646 37674 37716 37760 37824 37874 37950 37972 38024 38068 38107 38141 38171 38202 38227 38236 38248 38256 38267 38279 38298 38322 38371 38388 38412 38455 38777 38780 38794 38807 38819 38826 38837 38844 38851 38860 38870 38887 38903 38953 38961 38969 38979 38990 39008 39025 39046 39068 39077 39087 39114 39120 39130 39149 39165 39183 39203 39212 39223 39230 39247 39266 39287 39297 39314 39320 39336 39351 39366 39387 39409 39428 39438 39443 39448 39466 39485 39504 39510 39529 39549 39569 39587 39592 39598 39615 39631 39652 39665 39673 39693 39717 39734 39742 39753 39774 39780 39792 39814 39828 39837 39858 39876 39885 39919 39942 39969 40001 40024 40044 40055 40087 40103 40114 40127 40150 40172 40680 40710 40741 40769 40783 40984 41206 41373 41460 41477 41495 41512 41541 41588 41599 41618 41640 41719 41911 41939 42057 42079 42220 42239 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? TastaturschemadeInstalliere die Tabelle der defekten Blcke ... Mchten Sie normale oder serielle Bootblcke installieren? Normale Bootblcke benutzen die BIOS Konsolenschnittstelle als Konsole (meistens der Monitor und die Tastatur). Serielle Bootblcke benutzen den gewhlten seriellen Anschluss als Konsole. Selektierter Bootblock: BIOS KonsoleSerielle Konsole an com%d mit %d baudUnverndertAuswahl der BootblckeBIOS KonsoleSerielle Konsole an com0Serielle Konsole an com1Serielle Konsole an com2Serielle Konsole an com3Serielle Geschwindigkeit whlen...Vorhandene Bootblcke benutzenInstalliere die Bootblcke auf %s ... Diese Festplatte entspricht der folgenden BIOS Disk: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- --------------- ---- %#6x %8d %5d %8d %13u %3u Das ist die korrekte Geometriedie Geometrie von Hand setzenBenutzen Sie eine dieser FestplattenDiese Festplatte entspricht den folgenden BIOS Disks: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- ---------------- ---- %-1d: %#6x %8d %5d %8d %13u %3u Achtung: sysinst hat festgestellt, dass die von Ihnen ausgewhlte Festplatte einer anderen - dem BIOS bekannten - entspricht; damit sind obige Werte mit hchster Wahrscheinlichkeit korrekt, sollten also nicht verndert werden (die Werte fr Zylinder, Kpfe und Sektoren sind wahrscheinlich 1023, 255 und 63 - dies ist korrekt). Sie sollten nur die Geometrie abndern falls Sie wissen, dass das BIOS falsche Werte liefert. Festplatte auswhlen: Der NetBSD Teil der Festplatte liegt auerhalb der vom BIOS dieser Maschine adressierbaren Bereich. Eventuell knnen Sie von dieser Partition nicht booten. Sind Sie sicher, dass Sie fortfahren mchten? (Antworten Sie mit 'nein' um die Partitionen erneut zu editieren.)Sie haben mehr als ein Betriebssystem auf dieser Festplatte; allerdings ist kein 'bootmenu' (Eintrag fr den NetBSD Bootloader) fr die aktive Partition und/oder der Partition vorhanden, auf die NetBSD installiert werden soll. Wollen Sie die Partition zum Hinzufgen eines 'bootmenu' Eintrages editieren?Sie haben eine erweiterte Partition in das 'bootmenu' eingetragen. Doch scheint Ihr BIOS System den 'read' (Lese-) Befehl fr diese Version des 'bootmenu' Codes nicht zu untersttzen. Sind Sie sicher, dass Sie dennoch fortfahren mchten? (Antworten Sie 'nein' um zum Partitionierungsmen zurck zu gelangen.)Ihre Konfiguration bentigt den NetBSD Bootselect (Bootauswahl) Code, um das zu startende Betriebssystem beim Start des Computers zu whlen. Dieser ist gegenwrtig noch nicht installiert; wollen Sie dies jetzt tun?Der Bootcode im Master Boot Record scheint nicht gltig zu sein. Wollen Sie den NetBSD Bootcode installieren?Wollen Sie den Bootcode im Master Boot Record auf die letzte Version des NetBSD Bootcodes updaten?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypOrdnerBootmenSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivBootmenStandardbootPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition, (S)tandardauswahl$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.c operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chio chmod cp dd df ed ln ls mkdir mt mv pax pwd rcmd rm sh stty sync . ..MAKEDEV . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS656 5264 5302 5319 5334 5337 5340 5345 5353 5361 5369 5372 5375 5384 5396 5408 5417 5426 5452 5463 5998 6025 6591 6891 7532 7579 7692 7785 7819 7838 7856 7864 7873 7898 7902 7906 7909 7912 8034 8219 8447 8967 9318 9347 9360 9373 9378 9398 9417 9438 9497 9514 9528 9550 9595 9621 9662 9740 9858 9972 10026 10055 10087 10126 10132 10165 10288 10295 10299 10307 10331 10413 10419 10426 10438 10452 10461 10494 10513 10525 10635 10697 10716 10835 10886 10938 10950 10969 11021 11225 11433 11624 11684 11733 11999 12457 13122 13544 13866 14291 14423 14455 14467 14645 14842 15003 15137 15157 15190 15204 15273 15386 15558 15693 15713 15825 15917 15940 15963 16022 16037 16058 16073 16094 16114 16139 16153 16177 16189 16207 16417 16667 16688 16704 16757 16825 16898 16935 16961 17037 17494 17520 17542 17649 17756 17957 18030 18114 18214 18709 18947 19098 19132 19267 19311 19450 19491 19536 19583 19827 19960 20022 20116 20121 20155 20189 20204 20232 20265 20272 20297 20315 20341 20348 20363 20378 20398 20438 20455 20475 20496 20518 20533 20553 20575 20590 20603 20617 20629 20641 20655 20678 20701 20719 20762 20813 20850 21035 21098 21134 21183 21274 21404 21457 21717 21764 22125 22275 22444 22584 22704 22836 22876 22923 22933 22941 22951 22959 22970 22981 22995 23020 23061 23094 23127 23162 23216 23241 23260 23282 23287 23293 23322 23339 23366 23384 23405 23427 23446 23456 23486 23512 23539 23588 23616 23643 23696 23706 23716 23722 23732 23741 23761 23765 23770 23776 23780 23815 23824 23855 23872 23899 23920 23940 23959 23985 23998 24006 24022 24053 24084 24105 24131 24144 24152 24163 24169 24193 24203 24215 24233 24244 24264 24280 24306 24328 24344 24356 24376 24402 24408 24438 24452 24466 24489 24508 24527 24545 24563 24786 25092 25510 25711 25951 26135 26213 26268 26335 26375 26398 26432 26443 26451 26474 26477 26480 26486 26497 26509 26522 26552 26596 26609 26622 26659 26673 26684 26695 26706 26723 26734 26781 26804 26853 27094 27127 27382 27403 27436 27489 27515 27542 27698 27704 27747 27767 27786 27815 27822 27829 27836 27841 27890 27928 27962 28019 28047 28092 28109 28210 28215 28292 28306 28316 28340 28463 28544 28654 28682 28687 28703 28732 28740 28781 28788 28802 28815 28823 28842 28875 28895 28915 29131 29162 29167 29174 29181 29185 29199 29211 29226 29259 29272 29327 29385 29421 29439 29457 29475 29512 29518 29526 29530 29551 29568 29579 29601 29779 29823 30525 30549 30583 30602 30647 30654 30661 30665 30689 30700 30705 30768 30889 31012 31025 31159 31161 31163 31165 31175 31184 31197 31224 31228 31234 31239 31248 31253 31280 31282 31295 31307 31322 31350 31394 31441 31457 31479 31490 31523 31543 31592 31692 31694 31696 31712 31715 31757 32026 32039 32072 32084 32108 32126 32149 32172 32195 32218 32239 32265 32307 32361 32464 32491 32521 32546 32571 32628 32737 32770 33143 33158 33398 33649 33962 34116 34234 34354 34371 34394 34399 34405 34414 34523 34582 34833 34974 35101 35169 35206 35213 35222 35230 35257 35303 35306 35353 35398 35449 35508 35577 35624 35729 35872 35897 35901 35935 35952 35976 36028 36079 36151 36217 36315 36332 36363 36399 36433 36457 36481 36514 36534 36544 36552 36560 36570 36581 36595 36621 36669 36692 36712 36753 37052 37055 37069 37081 37088 37107 37121 37128 37135 37144 37154 37171 37187 37235 37243 37251 37261 37272 37290 37307 37326 37346 37353 37370 37387 37394 37407 37442 37459 37478 37498 37508 37524 37537 37555 37575 37596 37606 37626 37646 37659 37678 37691 37715 37738 37751 37762 37767 37774 37792 37811 37830 37838 37857 37877 37902 37920 37927 37934 37947 37956 37977 37990 37998 38018 38046 38063 38069 38080 38111 38119 38132 38154 38176 38185 38206 38224 38231 38254 38273 38300 38318 38338 38351 38366 38387 38401 38408 38422 38437 38456 39001 39034 39062 39091 39099 39136 39448 39625 39702 39719 39737 39752 39774 39824 39834 39851 39873 39932 40090 40114 40244 40269 40395 40413 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Tipo de tecladoesInstalando la tabla de bloques malos ... Le gustaria instalar el set normal de bootblocks o bootblocks por serie? Bootblocks normal usa el dispositivo de consola de BIOS como consola (normalmente el monitor y teclado). Bootblocks por serie usa el primer puerto serie como consola. Bootblock seleccionado: Consola BIOSPuerto serie en com%D en %d baudSin cambiosSeleccion de bootblocksUsar consola BIOSUsar puerto serie com0Usar puerto serie com1Usar puerto serie com2Usar puerto serie com3Baudios puerto serieUsar bootblocks existenteInstalando bloques de arranque en %s.... Este disco coincide con el siguiente disco de BIOS: BIOS # cilindros cabez sectors sect. totales GB ------ --------- ----- ------- ------------- ---- %#6x %9d %5d %7d %13u %3u Esta es la geometra correctaAjustar geometra a manoUsar uno de estos discosEste disco coincide con los siguientes discos de BIOS: BIOS # cilindros cabez sectors sect totales GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Nota: como sysinst es capaz de concordar unicamente el disco que escoja con un disco conocido por BIOS, los valores anteriores son probablemente correctos, y no deberan ser cambiados (los valores para cilindros, cabezales y sectores son probablemente 1023, 255 y 63 - esto es correcto). Solo debera cambiar la geometra si sabe que su BIOS reporta valores incorrectos. Escoja disco: La parte NetBSD del disco est fuera del rango que la BIOS de su maquina puede acceder. Puede que no sea posible iniciar desde ahi. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicion de particiones.)Tiene mas de un sistema operativo en el disco, pero no ha especificado un 'menu de arranque' para la particin activa o la particin de NetBSD en la que lo va a instalar. Quiere re-editar la particin para aadir una entrada en el menu de arranque?Ha pedido que una particin extendida sea incluida en el men de arranque. Sin embargo la BIOS de su sistema no parece soportar el comando de lectura usado por esa versin del cdigo del menu de arranque. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicin de particiones.)Su configuracin requiere el cdigo de bootselect de NetBSD para seleccionar que sistema usar. Actualmente no est instalado, lo quiere instalar ahora?El cdigo de arranque del Master Boot Record no parece ser vlido. Quiere instalar el cdigo de arranque de NetBSD?Quiere actualizar el cdigo de arranque en el Master Boot Record a la ultima versin del cdigo de arranque de NetBSD?Ncleo (GENERIC)Kernel (GENERIC_KASLR)TipoMountBootmenuNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activabootmenupredef.Tipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctiva, bootselect (p)redefinidoConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS656 5264 5300 5317 5332 5336 5340 5345 5356 5362 5368 5371 5374 5377 5381 5393 5405 5415 5445 5457 5886 5913 6489 6849 7534 7595 7673 7768 7808 7830 7848 7854 7863 7889 7893 7897 7900 7903 8025 8210 8438 8967 9385 9414 9427 9440 9447 9467 9486 9509 9552 9572 9591 9614 9658 9687 9728 9794 9906 10020 10074 10103 10135 10174 10180 10213 10291 10297 10301 10306 10347 10484 10494 10502 10521 10535 10544 10576 10617 10630 10755 10813 10832 10951 11007 11059 11070 11086 11125 11375 11547 11719 11774 11809 12058 12461 12759 13026 13387 13567 13886 13906 13919 14108 14252 14448 14582 14602 14635 14654 14755 14910 15098 15285 15305 15384 15482 15520 15543 15633 15654 15677 15696 15720 15750 15794 15827 15850 15862 15880 16148 16467 16498 16533 16597 16672 16742 16773 16803 16895 17386 17416 17433 17573 17714 17911 18030 18177 18344 18902 19198 19379 19424 19587 19641 19776 19812 19872 19922 20213 20322 20379 20476 20481 20516 20551 20566 20590 20623 20628 20653 20669 20692 20699 20716 20731 20750 20782 20786 20806 20824 20836 20849 20867 20891 20909 20928 20955 20982 20994 21015 21045 21075 21100 21133 21168 21206 21459 21528 21583 21644 21762 21921 21975 22236 22287 22663 22818 22962 23102 23210 23395 23425 23468 23478 23486 23496 23508 23529 23538 23544 23576 23616 23652 23690 23727 23775 23799 23811 23825 23833 23841 23868 23885 23914 23935 23958 23967 23986 23998 24042 24080 24107 24151 24179 24206 24259 24270 24281 24288 24298 24307 24341 24345 24350 24356 24360 24395 24405 24435 24458 24487 24509 24531 24553 24580 24592 24604 24623 24657 24690 24711 24735 24748 24760 24773 24779 24805 24815 24826 24850 24860 24880 24900 24917 24943 24967 24980 25000 25034 25041 25070 25093 25116 25132 25147 25162 25177 25191 25379 25684 26115 26306 26541 26729 26771 26821 26875 26923 26945 26986 26997 27005 27029 27033 27037 27046 27057 27068 27083 27114 27160 27173 27186 27216 27230 27242 27254 27266 27284 27307 27352 27375 27435 27687 27714 27976 27994 28021 28070 28100 28131 28263 28270 28319 28342 28366 28395 28403 28413 28421 28426 28479 28528 28568 28634 28667 28711 28734 28835 28840 28917 28931 28941 28965 29088 29169 29279 29307 29312 29328 29357 29365 29406 29414 29428 29441 29449 29468 29501 29521 29541 29757 29788 29808 29814 29821 29825 29840 29859 29885 29894 29906 29960 30018 30053 30072 30089 30101 30136 30142 30150 30154 30175 30192 30203 30228 30406 30460 31151 31170 31205 31235 31281 31287 31294 31298 31322 31338 31344 31419 31569 31688 31701 31769 31771 31773 31775 31785 31798 31815 31842 31846 31852 31857 31866 31871 31898 31900 31913 31925 31940 31968 32012 32059 32075 32097 32108 32141 32161 32210 32310 32312 32314 32330 32333 32384 32706 32722 32753 32773 32809 32826 32842 32858 32874 32890 32912 32957 33005 33056 33175 33202 33227 33247 33276 33330 33455 33488 33714 33738 34020 34303 34577 34764 34888 35013 35030 35053 35058 35064 35069 35172 35224 35470 35631 35786 35857 35910 35917 35935 35942 35969 36019 36022 36065 36111 36166 36225 36294 36341 36446 36589 36614 36618 36652 36669 36707 36760 36800 36876 36941 37035 37056 37094 37134 37170 37194 37217 37256 37286 37293 37302 37310 37318 37332 37348 37376 37428 37445 37466 37510 37852 37856 37871 37882 37890 37909 37921 37928 37935 37944 37954 37971 37987 38041 38049 38057 38067 38078 38096 38113 38129 38147 38154 38172 38189 38196 38206 38237 38256 38275 38295 38305 38324 38337 38357 38377 38398 38408 38427 38446 38456 38473 38487 38510 38534 38547 38557 38562 38566 38584 38603 38622 38627 38646 38666 38691 38706 38710 38717 38727 38736 38757 38771 38779 38799 38825 38842 38850 38861 38892 38897 38910 38932 38947 38956 38977 38995 39004 39048 39072 39099 39114 39131 39145 39176 39200 39231 39238 39252 39267 39286 39831 39864 39892 39921 39929 39966 40278 40455 40532 40549 40567 40582 40604 40654 40664 40681 40703 40762 40920 40944 41074 41099 41225 41243 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Type de clavierfrInstallation de la table des blocs dfectueux ... Voulez-vous installer le programme de dmarrage standard ou sur port srie ? Le programme de dmarrage standard utilise les priphriques dfinis par le BIOS (en gnral le moniteur et le clavier). Le programme de dmarrage sur port srie utilise quant lui le premier port srie. Programme de dmarrage slectionn : Console du BIOSPort srie com%d, baud rate %dPas de modificationSlection du programme de dmarrageConsole du BIOS port srie com0port srie com1port srie com2port srie com3Vitesse du port srieConserver le programme de dmarrage existantInstallation programme de dmarrage sur %s ... Ce disque correspond au disque du BIOS suivant : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %#6x %9d %5d %8d %20u %3u C'est la bonne gomtrieEntrer la gomtrieUtiliser l'un de ces disquesCe disque correspond aux disques du BIOS suivants : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %-1d: %#6x %9d %5d %8d %20u %3u Note: puisque sysinst a pu trouver une correspondance unique entre le disque choisi et un disque connu du BIOS, les valeurs ci-dessus sont probablement correctes. Modifiez-les uniquement si elles sont manifestement fausses. Choisissez un disque : La partition de votre disque rserve NetBSD se trouve en-dehors de l'espace que le BIOS de votre machine peut adresser. L'amorage depuis cette partition ne sera peut-tre pas possible. Voulez-vous rellement faire ceci ? ('Non' vous ramnera au menu d'dition des partitions.)Vous avez plus d'un systme d'exploitation sur ce disque, mais vous n'avez pas spcifi d'entre dans le menu de boot pour la partition active ou la partition NetBSD sur laquelle vous allez installer. Voulez-vous rediter la partition pour ajouter une entre dans le menu de boot ?Vous avez ajout une partition tendue au menu de boot, mais il semble que le BIOS de votre systme ne supporte pas la commande de lecture utilise par cette version du menu de boot. Voulez-vous vraiment faire ceci ? ('non' vous ramnera au menu d'dition des partitions.)Votre configuration ncessite le selecteur de boot de NetBSD pour choisir le systme d'exploitation dmarrer. Il n'est pour l'instant pas install, voulez-vous l'installer maintenant ?Le code d'amorage dans le secteur de boot ne semble pas tre valide. Voulez-vous installer le code d'amorage de NetBSD ?Voulez-vous mettre jour le code d'amorage dans le secteur de boot avec la dernire version du code d'amorage de NetBSD ?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypeMountMenuVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activemenu de dmarragedfautType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (Ac)tive partition, bootselect (d)efaultConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system withMSGTXTS656 5264 5305 5321 5339 5343 5347 5357 5366 5372 5378 5381 5384 5393 5403 5416 5424 5435 5460 5472 5980 6012 6504 6793 7338 7384 7488 7574 7610 7625 7643 7651 7659 7686 7690 7694 7697 7700 7811 7996 8224 8700 9034 9063 9078 9093 9101 9115 9133 9154 9205 9221 9231 9251 9297 9327 9380 9437 9548 9669 9713 9746 9785 9819 9826 9859 9936 9942 9949 9956 9985 10097 10103 10114 10131 10148 10157 10186 10198 10208 10309 10371 10391 10511 10548 10604 10618 10639 10676 10886 11061 11210 11245 11297 11513 11826 12349 12710 13000 13393 13528 13541 13552 13698 13877 14008 14142 14162 14195 14214 14297 14412 14553 14678 14692 14800 14893 14922 14942 15018 15035 15053 15069 15088 15108 15125 15137 15163 15175 15193 15394 15633 15660 15677 15733 15795 15855 15886 15910 15969 16315 16345 16362 16470 16580 16720 16794 16870 16948 17440 17660 17771 17802 17929 17965 18093 18120 18160 18206 18422 18546 18614 18714 18719 18755 18791 18805 18828 18861 18865 18890 18909 18935 18940 18955 18970 18989 19014 19026 19048 19065 19078 19090 19108 19132 19147 19164 19177 19188 19199 19219 19248 19277 19301 19336 19371 19398 19585 19634 19666 19714 19811 19944 19990 20182 20212 20534 20663 20803 20943 21060 21195 21239 21282 21290 21300 21312 21324 21332 21343 21370 21404 21439 21470 21505 21541 21588 21608 21625 21643 21648 21655 21680 21696 21717 21734 21751 21769 21786 21799 21830 21855 21886 21917 21952 21979 22032 22042 22052 22058 22067 22075 22090 22094 22099 22105 22109 22144 22154 22183 22199 22225 22242 22261 22282 22298 22311 22316 22324 22339 22365 22384 22412 22430 22441 22447 22453 22474 22484 22495 22513 22535 22552 22565 22586 22606 22626 22637 22650 22672 22679 22704 22719 22739 22751 22768 22785 22805 22824 23001 23285 23595 23775 23986 24174 24240 24287 24342 24386 24406 24435 24447 24453 24469 24473 24477 24485 24495 24507 24522 24541 24577 24588 24599 24638 24650 24660 24670 24680 24696 24714 24763 24784 24829 25073 25099 25353 25368 25394 25451 25485 25520 25662 25679 25728 25749 25765 25794 25799 25804 25810 25815 25854 25889 25919 25974 26007 26053 26067 26146 26151 26205 26219 26229 26253 26339 26387 26493 26527 26534 26549 26576 26585 26624 26631 26653 26672 26688 26706 26738 26757 26774 26931 26962 26969 26978 26986 26993 27007 27025 27044 27054 27066 27107 27152 27181 27202 27225 27244 27282 27288 27296 27300 27321 27338 27347 27366 27512 27554 28064 28072 28096 28114 28158 28163 28168 28172 28203 28216 28225 28271 28397 28488 28500 28564 28566 28568 28570 28580 28594 28609 28636 28640 28646 28651 28660 28665 28692 28694 28709 28720 28735 28763 28807 28854 28870 28892 28903 28936 28956 29005 29105 29107 29109 29123 29126 29165 29265 29278 29309 29319 29336 29354 29382 29410 29438 29466 29479 29508 29543 29589 29694 29721 29750 29774 29801 29845 29956 29988 30256 30271 30504 30717 30977 31143 31233 31319 31336 31359 31366 31372 31382 31481 31537 31813 31937 32048 32110 32148 32156 32173 32182 32204 32253 32256 32299 32344 32399 32458 32527 32574 32679 32822 32847 32851 32885 32901 32926 32974 33010 33071 33125 33206 33228 33267 33304 33336 33360 33387 33413 33427 33435 33445 33453 33467 33480 33492 33516 33557 33583 33600 33629 33953 33956 33970 33982 33988 34004 34016 34023 34030 34039 34049 34066 34082 34125 34133 34141 34151 34162 34180 34197 34210 34236 34243 34251 34268 34276 34293 34317 34336 34355 34374 34384 34395 34409 34427 34447 34467 34476 34499 34519 34530 34545 34557 34576 34595 34606 34616 34621 34627 34645 34664 34683 34690 34709 34729 34754 34771 34777 34785 34795 34807 34828 34844 34852 34872 34892 34914 34922 34933 34956 34963 34977 34999 35016 35025 35046 35064 35073 35104 35120 35147 35166 35186 35204 35225 35239 35259 35266 35285 35300 35319 35864 35897 35925 35954 35962 35999 36311 36488 36565 36582 36600 36615 36637 36687 36697 36714 36736 36795 36953 36977 37107 37132 37258 37276 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Keyboard typeplInstalowanie tablicy zlych blokow ... Czy chcesz zainstalowac normalne bootbloki, czy te do uzycia z zewn. konsola? Selected bootblock: Konsola BIOSPort szeregowy com%d, %d bodowBez zmianWybor bootblokowUzyj konsoli BIOSUzyj portu szeregowego com0Uzyj portu szeregowego com1Uzyj portu szeregowego com2Uzyj portu szeregowego com3Liczba bodowUzyj istniejacych bootblokowInstalowanie bootblokow na %s.... Ten dysk odpowiada ponizszemu dyskowi BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %#6x %8d %7d %7d %13u %3u To jest prawidlowa geometriaUstaw geometrie recznieUzyj jednego z tych dyskowTen dysk odpowiada ponizszym dyskom BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %-1d: %6x %8d %7d %7d %13u %3u Notatka: od kiedy sysinst jest w stanie unikalnie rozpoznac dysk, ktory wybrales i powiazac go z dyskiem BIOS, wartosci wyswietlane powyzej sa bardzo prawdopodobnie prawidlowe i nie powinny byc zmieniane. Zmieniaj je tylko wtedy jesli sa naprawde _obrzydliwie_ zle. Wybierz dysk: Czesc NetBSD dysku lezy poza obszarem, ktory BIOS w twojej maszynie moze zaadresowac. Nie mozliwe bedzie bootowanie z tego dysku. Jestes pewien, ze chcesz to zrobic? (Odpowiedz 'nie' zabierze cie spowrotem do menu edycji partycji.)Masz wiecej niz jeden system operacyjny na tym dysku, ale nie zostalo wskazane menu ani dla aktywnej partycji ani dla partycji NetBSD, ktora bedzie zainstalowana. Chcesz zmienic partycje, aby dodac wpis do menu?Wskazane zostalo, ze w menu zostanie zawarta partycja rozszerzona. Nie wyglada na to, ze system BIOS wspiera polecenie odczytu uzywane przez te wersje kodu menu. Czy na pewno chcesz tak zrobic? (Odpowiedz 'nie' przeniesie z powrotem do menu zmiany partycji.)Twoje konfiguracja wymaga kodu rozruchowego NetBSD, aby wybierac, ktorego systemu operacyjnego uzywac. Nie jest on obecnie zainstalowany. Czy zainstalowac go teraz?Kod rozruchowy w MBR nie wyglada na poprawny. Chcesz zainstalowac kod rozruchowy NetBSD?Chcesz uaktualnic kod rozruchowy w MBR do najnowszej wersji kodu rozruchowego NetBSD?Kernel (GENERIC)Kernel (GENERIC_KASLR)RodzajMountWpis menuNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaw menu startowymdomyslnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partition, bootselect (d)efaultKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographi#!/bin/sh - # # Generated from: # NetBSD: MAKEDEV.awk,v 1.29 2020/06/13 19:46:23 thorpej Exp # NetBSD: MAKEDEV.tmpl,v 1.238 2025/11/29 18:39:15 brad Exp # NetBSD: etc.i386/MAKEDEV.conf,v 1.37 2025/03/28 18:41:26 riastradh Exp # # Copyright (c) 2003,2007,2008 The NetBSD Foundation, Inc. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # ########################################################################### # # # Device "make" file. Valid special arguments: # all makes all known devices, including local devices. # Tries to make the 'standard' number of each type. # init A set of devices that is used for MFS /dev by init. # May be equal to "all". # floppy devices to be put on install floppies # ramdisk devices to be put into INSTALL kernel ramdisks. # std standard devices # local configuration specific devices # lua Lua device # wscons make wscons devices # usbs make USB devices # virtio virtio(4)-related devices # # # NOTE: # # * MAKEDEV is used both as a standalone script (via "sh ./MAKEDEV # all" or similar), and as a function library for MAKEDEV.local (via # "MAKEDEV_AS_LIBRARY=1 . MAKEDEV"). Because of this, the script # should consist almost entirely of function definitions, apart from a # few lines right at the end. # # * MAKEDEV may be executed in an environment that is missing some # common commands. For example, it may be executed from a minimal # system used during installation, or it may be executed early in the # boot sequence before most file systems have been mounted. It may # also be executed in a cross-build environment on a non-NetBSD host. # usage() { cat 1>&2 << _USAGE_ Usage: ${0##*/} [-fMsu] [-m mknod] [-p pax] [-t mtree] special [...] Create listed special devices. Options: -f Force permissions to be updated on existing devices. -M Create memory file system. -m mknod Name of mknod(8) program. [\$TOOL_MKNOD or mknod] -p pax Name of pax(1) program. [\$TOOL_PAX or pax] -s Generate mtree(8) specfile instead of creating devices. -t mtree Name of mtree(8) program. [\$TOOL_MTREE or mtree] -u Don't re-create devices that already exist. _USAGE_ exit 1 } # zeropad width number # display number with a zero (`0') padding of width digits. # zeropad() { case $(($1 - ${#2})) in 5) echo 00000$2;; 4) echo 0000$2;; 3) echo 000$2;; 2) echo 00$2;; 1) echo 0$2;; 0) echo $2;; *) die "bad padding" ;; esac } # hexprint number # display (base10) number as hexadecimal # hexprint() { val="$(($1 + 0))" hex= set -- 0 1 2 3 4 5 6 7 8 9 a b c d e f while [ "$val" -gt 0 ]; do eval hex=\${$(($val % 16 + 1))}\$hex val="$(($val / 16))" done echo "${hex:-0}" } # linecount multiline_string # count the number of lines in the string # linecount() { local IFS=' ' # just a newline, no other white space between the quotes set -- $1 echo $# } # nooutput -12 cmd [args...] # run a command with stdout and/or stderr ignored. # "nooutput -1 cmd" is like "cmd >/dev/null"; # "nooutput -2 cmd" is like "{ cmd ; } 2>/dev/null"; # "nooutput -12 cmd" is like "{ cmd ; } >/dev/null 2>&1"; # except they should work even if /dev/null doesn't [yet] exist. # # The "{...}" wrapper used in cases where stderr is redirected # serves to capture shell error messages such as "cmd: not found". # nooutput() { local flags="$1" ; shift local junk case "$flags" in "-1") junk="$( "$@" )" ;; "-2") ( exec 4>&1 ; junk="$( { "$@" ; } 2>&1 1>&4 )" ) ;; "-12") junk="$( { "$@" ; } 2>&1 )" ;; *) warn "Incorrect use of nooutput" ;; esac } # check_pax path_to_pax # Check whether pax exists and supports the command line options # and input format that we will want to use. # check_pax() { local pax="$1" echo ". type=dir optional" | nooutput -12 "${pax}" -r -w -M -pe . } # check_mtree path_to_mtree # Check whether mtree exists and supports the command line options # and input format that we will want to use. # check_mtree() { local mtree="$1" echo ". type=dir optional" | nooutput -12 "${mtree}" -e -U } # setup args... # Parse command line arguments, exit on error. # Callers should shift $((OPTIND - 1)) afterwards. # setup() { PATH=/sbin:/usr/sbin:/bin:/usr/bin:/rescue : ${HOST_SH:=sh} : ${TOOL_MKNOD:=mknod} : ${TOOL_MTREE:=mtree} : ${TOOL_PAX:=pax} status=0 do_create_mfs=false do_force=false do_mknod=false do_pax=false do_mtree=false do_redirect=false do_specfile=false do_update=false opts= while getopts Mfm:p:st:u ch; do # Note that $opts is only for options passed through to # MAKEDEV.local, not for all options. case ${ch} in M) # "-M" sets do_create_mfs; # "-M -M" is for use from init(8), and sets do_redirect do_redirect=$do_create_mfs do_create_mfs=true ;; f) do_force=true opts="${opts} -f" ;; m) TOOL_MKNOD=${OPTARG} do_mknod=true opts="${opts} -m ${OPTARG}" ;; p) TOOL_PAX="${OPTARG}" if check_pax "${TOOL_PAX}"; then do_pax=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -p option:" \ "${TOOL_PAX} is missing or broken" do_mknod=true fi ;; s) do_specfile=true opts="${opts} -s" ;; t) TOOL_MTREE="${OPTARG}" if check_mtree "${TOOL_MTREE}"; then do_mtree=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -t option:" \ "${TOOL_MTREE} is missing or broken" do_mknod=true fi ;; u) do_update=true opts="${opts} -u" ;; *) usage ;; esac done shift $((${OPTIND} - 1)) [ $# -gt 0 ] || usage u_root="0" u_uucp="66" g_gpio="29" g_kmem="2" g_ntpd="15" g_nvmm="34" g_operator="5" g_wheel="0" dialin=0 dialout=524288 callunit=262144 # only allow read&write for owner by default umask 077 # Set fdesc_mounted=true if the fdesc file system is mounted # on the current directory (typically "/dev"). # Later, this will be used to suppress creation of device nodes # that are supplied by the fdesc file system. # fdesc_mounted=false if [ -d fd ]; then # Parse the output from "mount -u -o nosuchoption .". # We don't parse the output from df(1) because that's # less likely to be available on install media. # # If the current directory is a mount point for the # fdesc file system, then the expected output (whether # or not the current user is root) is: # mount_fdesc: -o suchoption: option not supported. # # If the current directory is not a mount point, then # the expected output is: # mount: .: unknown special file or file system. # # If we are not running on NetBSD, or mount(8) is not # found, then we should get some other error message. # case "$({ LC_ALL=C mount -u -o nosuchoption . ; } 2>&1)" in *mount_fdesc*) fdesc_mounted=true ;; esac fi # do_force requires mknod if $do_force; then if $do_mtree || $do_pax || $do_specfile; then die "-f option works only with mknod" fi do_mknod=true fi # do_force and do_update do not work together if $do_force && $do_update; then die "-f and -u options do not work together" fi # If no explicit method was specified on the command line or # forced above, then use one of mtree, pax, or mknod, in that # order of preference. # # mtree is preferred because it's fast and designed for the # purpose. However, it's unlikely to be available early in the # boot sequence, when init(8) may invoke MAKEDEV(8). # # pax is usually acceptable, and it's likely to be available # early in the boot sequence. However, it's much slower than mtree. # # mknod is just very slow, because the shell has to fork for # each device node. # case ",${do_mtree},,${do_pax},,${do_mknod},,${do_specfile}," in ( ,false,,false,,false,,false, ) if check_mtree "${TOOL_MTREE}"; then do_mtree=true elif check_pax "${TOOL_PAX}"; then do_pax=true else do_mknod=true fi ;; ( *,true,*,true,* ) die "-m, -p, -s, and -t options are mutually exclusive" ;; esac # If we are using mknod, then decide what options to pass it. MKNOD="${TOOL_MKNOD:-mknod} -F netbsd" if $do_mknod; then if $do_force; then MKNOD="${MKNOD} -R" else MKNOD="${MKNOD} -r" fi fi # do_mtree or do_pax internally implies do_specfile. # This happens after checking for mutually-exclusive options. if $do_mtree || $do_pax && ! $do_specfile; then do_specfile=true opts="${opts} -s" fi } # specfile_before # This is called before the bulk of the makedev processing, # if do_specfile is set. # # It simply prints ". type=dir optional", which must be the # first line of the specfile. # specfile_before() { echo ". type=dir optional" } # mtree_after # Output in specfile format is piped into this function. # # It uses mtree to create the devices defined in the specfile. # mtree_after() { nooutput -1 "${TOOL_MTREE}" -e -U } # pax_after # Output in specfile format is piped into this function. # # It uses pax to create the devices defined in the specfile. # pax_after() { # Run pax in an empty directory, so it pays # attention only to the specfile, without being # confused by the existing contents of the target # directory. Without this, pax would complain "file # would overwrite itself" for already-existing # device nodes. tmpdir=./tmp.$$ mkdir "${tmpdir}" || die "can't create temporary directory" cd "${tmpdir}" || die "can't cd to temporary directory" "${TOOL_PAX}" -r -w -M -pe .. pax_status=$? cd .. # back to where we started rmdir "${tmpdir}" return $pax_status } # makedev_main makedev_name args... # Perform most of the work of the main program. makedev_name # is typically "makedev", but may be the name of some other # makedev-like function (if we are invoked from MAKEDEV.local or # some other script). The other args to this function are the # command line args with which the MAKEDEV (or MAKEDEV.local) # script was invoked. # makedev_main() { local makedev="$1" ; shift # Parse command line args setup ${1+"$@"} shift $((${OPTIND}-1)) if $do_create_mfs; then # Count inodes and create mfs file system. # The makedev call merely updates $count_nodes. count_nodes=0 $makedev ${1+"$@"} create_mfs_dev $count_nodes unset count_nodes fi # Set before, middle, and after variables, so we can do # something like "( $before && $middle ) | $after", # except it will have to be more complex so we can capture # the exit status from both sides of the pipe. # if $do_specfile; then before=specfile_before else before=: fi middle='$makedev ${1+"$@"} && (exit $status)' if $do_mtree; then after=mtree_after elif $do_pax ; then after=pax_after else after=cat fi # Actually perform the "{ $before && $middle } | $after" commands. # # We go to some trouble to ensure that, if any of # $before, $middle, or $after fails, then we also # exit with a non-zero status. # # In the block below, fd 3 is a copy of the original stdout, # and fd 4 goes to a subshell that analyses the exit status # status from the other commands. # { exec 3>&1; { { eval "$before" && eval "$middle"; echo $? >&4; } \ | { eval "$after"; echo $? >&4; } \ } 4>&1 1>&3 \ | ( read status1; read status2; case "$status1,$status2" in 0,0) exit 0;; 0,*) exit $status2;; *,*) exit $status1;; esac ) } } # # functions available to create nodes: # # mkdev name [b|c] major minor [mode{=600} [gid{=0} [uid{=0}]]] # create device node `name' with the appropriate permissions # # lndev src target # create a symlink from src to target # # makedir dir mode # create directory with appropriate mode # mkdev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then case $2 in b) type=block ;; c) type=char ;; esac echo "./$1 type=${type} device=netbsd,$3,$4 mode=${5:-600} gid=${6:-$g_wheel} uid=${7:-$u_root}" else ${MKNOD} -m ${5:-600} -g \#${6:-$g_wheel} -u \#${7:-$u_root} $1 $2 $3 $4 fi } lndev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $2; then return fi if $do_specfile; then echo "./$2 type=link link=$1 mode=0700 gid=$g_wheel uid=$u_root" else ln -f -s $1 $2 fi } makedir() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then echo "./$1 type=dir mode=$2 gid=$g_wheel uid=$u_root" else nooutput -2 mkdir $1 chmod $2 $1 fi } warn() { echo 1>&2 "$0: $*" status=1 } die() { echo 1>&2 "$0: $*" exit 1 } # makedev special [...] # the main loop # makedev() { for i do case $i in # As of 2005-03-15, the "init" case must not create more than 1024 entries. all_md) makedev std wscons wt0 fd0 fd1 makedev wd0 wd1 wd2 wd3 wd4 wd5 wd6 wd7 makedev sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 makedev flash0 flash1 flash2 flash3 flash4 flash5 flash6 flash7 makedev tty0 tty1 tty2 tty3 makedev st0 st1 ch0 cd0 cd1 mcd0 vnd0 makedev bpf makedev ccd0 md0 random makedev cgd0 cgd1 makedev amr0 iop0 mfi0 mlx0 mly0 dpti0 dpt0 twe0 icp0 makedev ed0 ed1 makedev nvme0 nvme0ns1 nvme0ns2 nvme0ns3 nvme0ns4 makedev nvme1 nvme1ns1 nvme1ns2 nvme1ns3 nvme1ns4 makedev nvme2 nvme2ns1 nvme2ns2 nvme2ns3 nvme2ns4 makedev nvme3 nvme3ns1 nvme3ns2 nvme3ns3 nvme3ns4 makedev raid0 raid1 raid2 raid3 makedev ld0 ld1 ld2 ld3 ld4 ld5 ld6 ld7 makedev xbd0 xbd1 xbd2 xbd3 xen makedev usbs makedev ipty makedev local makedev cfs makedev lpa0 lpa1 lpa2 makedev lpt0 lpt1 lpt2 makedev ss0 uk0 uk1 makedev speaker joy0 joy1 makedev apm makedev cmos makedev audio makedev radio makedev music rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 makedev scsibus0 scsibus1 scsibus2 scsibus3 makedev ses0 ses1 ses2 ses3 makedev sysmon makedev bktr makedev tprof makedev ttyCZ0 ttyCY0 makedev agp0 makedev pci0 pci1 pci2 pci3 pci4 pci5 pci6 pci7 makedev pci8 pci9 pci10 pci11 pci12 pci13 pci14 makedev pci15 pci16 pci17 pci18 pci19 makedev altq makedev cir0 cir1 irframe0 irframe1 makedev dmoverio makedev kttcp makedev io makedev bio makedev acpi smbios efi makedev virtio ;; xen) makedev xenevt xencons xsd_kva ;; floppy) makedev std bpf wt0 fd0 fd1 wd0 wd1 wd2 wd3 sd0 sd1 sd2 sd3 sd4 st0 st1 makedev tty0 tty1 tty2 cd0 cd1 mcd0 ttyv0 opty ld0 ld1 ld2 ld3 ed0 ed1 ;; ramdisk) makedev floppy md0 ;; all) makedev all_md makedev std fd ptm makedev dk0 dk1 dk2 dk3 dk4 dk5 dk6 dk7 makedev dk8 dk9 dk10 dk11 dk12 dk13 dk14 dk15 makedev dk16 dk17 dk18 dk19 dk20 dk21 dk22 dk23 makedev dk24 dk25 dk26 dk27 dk28 dk29 dk30 dk31 makedev ccd0 ccd1 ccd2 ccd3 makedev cgd0 cgd1 cgd2 cgd3 cgd4 cgd5 cgd6 cgd7 makedev fss0 fss1 fss2 fss3 makedev md0 md1 makedev raid0 raid1 raid2 raid3 raid4 raid5 raid6 raid7 makedev vnd0 vnd1 vnd2 vnd3 makedev iscsi0 makedev bpf npf makedev tun0 tun1 tun2 tun3 makedev ipl pf crypto random makedev lockstat clockctl cpuctl makedev atabus0 atabus1 atabus2 atabus3 atabus4 atabus5 atabus6 atabus7 makedev srt0 srt1 srt2 srt3 makedev tap tap0 tap1 tap2 tap3 makedev gpio gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 makedev gpioirq0 gpiopps0 makedev pad pad0 pad1 pad2 pad3 makedev bthub makedev putter makedev drvctl makedev video makedev dtv makedev drm0 drm1 drm2 drm3 makedev altmem makedev zfs makedev lua makedev hdmicec0 makedev dtrace makedev veriexec makedev autofs makedev fw0 fw1 fw2 fw3 makedev ipmi0 makedev qemufwcfg makedev sht3xtemp0 makedev scmd0 makedev local # do this last ;; init) # unless overridden by MD entry, this is equal to 'all' makedev all opty ;; audio) makedev audio0 audio1 audio2 audio3 makedev hdaudio0 hdaudio1 hdaudio2 hdaudio3 lndev sound0 sound lndev audio0 audio lndev mixer0 mixer lndev audioctl0 audioctl ;; emcfan[0-9]*) unit=${i#emcfan} mkdev emcfan$unit c 367 $unit 660 ;; gpio) makedev gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 lndev gpio0 gpio ;; gpioirq) makedev gpioirq0 ;; gpiopps) makedev gpiopps0 lndev gpiopps0 gpiopps ;; lua) makedev lua0 lndev lua0 lua ;; pad) makedev pad0 pad1 pad2 pad3 lndev pad0 pad ;; qemufwcfg) makedev qemufwcfg0 lndev qemufwcfg0 qemufwcfg ;; radio) makedev radio0 radio1 lndev radio0 radio ;; video) makedev video0 video1 video2 video3 ;; dtv) makedev dtv0 dtv1 dtv2 dtv3 ;; iic) makedev iic0 iic1 iic2 iic3 ;; altmem) makedev altmem0 altmem1 ;; ramdisk) makedev floppy md0 ;; sht3xtemp) makedev sht3xtemp0 ;; scmd) makedev scmd0 ;; usbs) makedev usb usb0 usb1 usb2 usb3 usb4 usb5 usb6 usb7 makedev usb8 usb9 usb10 usb11 usb12 usb13 usb14 usb15 makedev uhid0 uhid1 uhid2 uhid3 uhid4 uhid5 makedev uhid6 uhid7 uhid8 uhid9 uhid10 uhid11 makedev uhid12 uhid13 uhid14 uhid15 makedev ulpt0 ulpt1 makedev ttyU0 ttyU1 ttyU2 ttyU3 ttyU4 ttyU5 ttyU6 ttyU7 makedev ttyY0 ttyY1 makedev ttyHS0 makedev utoppy0 utoppy1 makedev ugen0 ugen1 ugen2 ugen3 ;; virtio) makedev ttyVI makedev vio9p0 vio9p1 vio9p2 vio9p3 makedev vio9p4 vio9p5 vio9p6 vio9p7 ;; std) mkdev console c 0 0 600 mkdev constty c 0 1 600 mkdev drum c 4 0 640 $g_kmem mkdev kmem c 2 1 640 $g_kmem mkdev mem c 2 0 640 $g_kmem mkdev null c 2 2 666 mkdev full c 2 11 666 mkdev zero c 2 12 666 mkdev klog c 7 0 600 mkdev ksyms c 101 0 440 $g_kmem mkdev random c 46 0 444 mkdev urandom c 46 1 644 if ! $fdesc_mounted; then mkdev tty c 1 0 666 mkdev stdin c 22 0 666 mkdev stdout c 22 1 666 mkdev stderr c 22 2 666 fi ;; usb) mkdev usb c 55 255 444 ;; usb[0-9]*) unit=${i#usb} usb=usb$unit mkdev usb$unit c 55 $unit ;; uhid[0-9]*) unit=${i#uhid} mkdev uhid$unit c 56 $unit 666 ;; ulpt[0-9]*) unit=${i#ulpt} mkdev ulpt$unit c 57 $unit mkdev ulpn$unit c 57 $(($unit + 64)) ;; utoppy[0-9]*) unit=${i#utoppy} mkdev utoppy$unit c 174 $unit ;; ttyHS[0-9]*) unit=${i#ttyHS} for j in 00 01 02 03 04 05 06 07 08 09 10 do base=$(($unit * 16 + ${j#0})) mkdev ttyHS$unit.$j c 196 $(($base + $dialin )) "" "" $u_uucp mkdev dtyHS$unit.$j c 196 $(($base + $dialout )) "" "" $u_uucp mkdev ctyHS$unit.$j c 196 $(($base + $callunit)) "" "" $u_uucp done ;; ttyY[0-9]*) unit=${i#ttyY} mkdev ttyY$unit c 172 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyY$unit c 172 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyY$unit c 172 $(($unit + $callunit)) "" "" $u_uucp ;; ucom[0-9]*) makedev ttyU${i#ucom} ;; ttyU[0-9]*) unit=${i#ttyU} mkdev ttyU$unit c 66 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyU$unit c 66 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyU$unit c 66 $(($unit + $callunit)) "" "" $u_uucp ;; ugen[0-9]*) unit=${i#ugen} for j in 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 do mkdev ugen$unit.$j c 64 $(($unit * 16 + ${j#0})) done ;; umcpmio[0-9]*) unit=${i#umcpmio} mkdev umcpmio${unit}ctl c 366 $unit 660 for j in 0 1 2 do mkdev umcpmio${unit}GP$(($j + 1)) c 366 $(($unit * 3 + 128 + ${j#})) 666 done mkdev umcpmio${unit}EEP c 366 $(($unit + 256)) 660 ;; wscons) makedev ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 makedev ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 ttyF6 ttyF7 makedev ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 makedev ttyH0 ttyH1 ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 makedev wsmouse0 wsmouse1 wsmouse2 wsmouse3 makedev wskbd0 wskbd1 wskbd2 wskbd3 makedev wsmux0 wsmux1 wsmux2 wsmux3 makedev wsmouse wskbd makedev ttyEcfg ttyEstat makedev ttyFcfg ttyFstat makedev ttyGcfg ttyGstat makedev ttyHcfg ttyHstat makedev wsfont ;; wsmouse) mkdev wsmouse c 65 0 ;; wskbd) mkdev wskbd c 65 1 ;; wsmux[0-9]*) unit=${i#wsmux} mkdev wsmux$unit c 65 $unit mkdev wsmuxctl$unit c 65 $(($unit + 128)) 200 ;; xenevt) mkdev xenevt c 141 0 ;; xsd_kva) mkdev xsd_kva c 141 1 ;; xencons) mkdev xencons c 143 0 ;; ttyEstat) mkdev ttyEstat c 47 254 ;; ttyEcfg) mkdev ttyEcfg c 47 255 ;; ttyE[0-9]*) unit=${i#ttyE} mkdev ttyE$unit c 47 $unit ;; ttyFstat) mkdev ttyFstat c 47 510 ;; ttyFcfg) mkdev ttyFcfg c 47 511 ;; ttyF[0-9]*) unit=${i#ttyF} mkdev ttyF$unit c 47 $(($unit + 256)) ;; ttyGstat) mkdev ttyGstat c 47 766 ;; ttyGcfg) mkdev ttyGcfg c 47 767 ;; ttyG[0-9]*) unit=${i#ttyG} mkdev ttyG$unit c 47 $(($unit + 512)) ;; ttyHstat) mkdev ttyHstat c 47 1022 ;; ttyHcfg) mkdev ttyHcfg c 47 1023 ;; ttyH[0-9]*) unit=${i#ttyH} mkdev ttyH$unit c 47 $(($unit + 768)) ;; wsmouse[0-9]*) unit=${i#wsmouse} mkdev wsmouse$unit c 49 $unit ;; wskbd[0-9]*) unit=${i#wskbd} mkdev wskbd$unit c 48 $unit ;; fd) if ! $fdesc_mounted; then # Create the "fd" subdirectory, and devices "fd/0" to "fd/63" makedir fd 755 n=0 while [ $n -lt 64 ] do mkdev fd/$n c 22 $n 666 n=$(($n + 1)) done fi ;; wt[0-9]*) name=wt; unit=${i#wt}; chr=10; blk=3 for sub in $unit $(($unit+8)) $(($unit+16)) do mkdev $name$sub b $blk $(($sub + 0)) 660 $g_operator mkdev n$name$sub b $blk $(($sub + 4)) 660 $g_operator mkdev r$name$sub c $chr $(($sub + 0)) 660 $g_operator mkdev nr$name$sub c $chr $(($sub + 4)) 660 $g_operator done ;; md[0-9]*) makedisk_minimal md ${i#md} 17 24 ;; fss[0-9]*) name=fss; unit=${i#fss}; blk=163; chr=163 mkdev $name$unit b $blk $unit 660 $g_operator mkdev r$name$unit c $chr $unit 660 $g_operator ;; ss[0-9]*) name=ss; unit=${i#ss}; chr=19 mkdev $name$unit c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev n$name$unit c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev en$name$unit c $chr $(($unit * 16 + 3)) 640 $g_operator ;; ccd[0-9]*|cgd[0-9]*|raid[0-9]*|vnd[0-9]*) case $i in ccd*) name=ccd; unit=${i#ccd}; blk=16; chr=18;; cgd*) name=cgd; unit=${i#cgd}; blk=21; chr=93;; raid*) name=raid; unit=${i#raid}; blk=18; chr=62;; vnd*) name=vnd; unit=${i#vnd}; blk=14; chr=41;; esac makedisk_p16high $name $unit $blk $chr ;; sd[0-9]*) name=sd; unit=${i#sd}; blk=4; chr=13 makedisk_p16high $name $unit $blk $chr ;; wd[0-9]*) name=wd; unit=${i#wd}; blk=0; chr=3 makedisk_p16high $name $unit $blk $chr ;; fd[0-9]*) name=fd; unit=${i#fd}; blk=2; chr=9 makedisk_p16high $name $unit $blk $chr ;; ld[0-9]*) name=ld; unit=${i#ld}; blk=19; chr=69 makedisk_p16high $name $unit $blk $chr ;; flash[0-9]*) unit=${i#flash} flash=flash$unit mkdev flash$unit b 199 $unit mkdev rflash$unit c 199 $unit ;; spiflash[0-9]*) unit=${i#spiflash} spiflash=spiflash$unit mkdev spiflash$unit b 208 $unit mkdev rspiflash$unit c 208 $unit ;; altmem[0-9]*) name=altmem; unit=${i#altmem}; blk=182; chr=182 makedisk_p16high $name $unit $blk $chr ;; bio) mkdev bio c 181 0 ;; ed[0-9]*) name=ed; unit=${i#ed}; blk=20; chr=79 makedisk_p16high $name $unit $blk $chr ;; xbd[0-9]*) name=xbd; unit=${i#xbd}; blk=142; chr=142 makedisk_p16high $name $unit $blk $chr ;; dk[0-9]*) name=dk; unit=${i#dk}; blk=168; chr=168 mkdev r$name$unit c $chr $unit 0640 $g_operator mkdev $name$unit b $blk $unit 0640 $g_operator ;; tprof) mkdev tprof c 191 0 ;; ttyCY[0-9]*) # Each unit number creates 32 pairs of {tty,dty} device nodes: # ttyCY0 => device nodes [td]tyCY000 to [td]tyCY031; # ttyCY1 => device nodes [td]tyCY032 to [td]tyCY063; name=tyCY; chr=38; off=32 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=000$minor nminor=${nminor#${nminor%???}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; ttyCZ[0-9]*) # Each unit number creates 64 pairs of {tty,dty} device nodes: # ttyCZ0 => device nodes [td]tyCZ0000 to [td]tyCZ0063; # ttyCZ1 => device nodes [td]tyCZ0064 to [td]tyCZ0127; name=tyCZ; chr=73; off=64 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=0000$minor nminor=${nminor#${nminor%????}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; tty[0-9]*) unit=${i#tty} ounit=00$unit ounit=${ounit#${ounit%??}} mkdev tty$ounit c 8 $(($unit + $dialin )) "" "" $u_uucp mkdev dty$ounit c 8 $(($unit + $dialout)) "" "" $u_uucp ;; ttyC[0-9]*) # some archs call com_chr ttyC traditionally unit=${i#ttyC}; name=ttyC; dname=dtyC; chr=8 mkdev $name$unit c $chr $(($unit + $dialin )) "" "" $u_uucp mkdev $dname$unit c $chr $(($unit + $dialout)) "" "" $u_uucp ;; opty) # Create 16 device nodes, [pt]typ0 to [pt]typf, # same as "MAKEDEV pty0". for j in 0 1 2 3 4 5 6 7 8 9 a b c d e f do case $j in [0-9]) jn=$j ;; a) jn=10 ;; b) jn=11 ;; c) jn=12 ;; d) jn=13 ;; e) jn=14 ;; f) jn=15 ;; esac mkdev ttyp$j c 5 $jn 666 mkdev ptyp$j c 6 $jn 666 done ;; pty[0-9]*) # Each unit number creates up to 16 pairs of {tty,pty} device nodes: # pty0 => 16 pairs, [tp]typ0 to [tp]typf # pty1 => 16 pairs, [tp]tyq0 to [tp]tyqf # pty16 => 16 pairs, [tp]typg to [tp]typv # pty17 => 16 pairs, [tp]typw to [tp]typL # pty18 => 14 pairs, [tp]typM to [tp]typZ warn "$i: creating BSD style tty nodes with ptyfs is a security issue" class=${i#pty} d1="p q r s t u v w x y z P Q R S T" if [ "$class" -ge 64 ] then warn "$i: pty unit must be between 0 and 63" continue elif [ "$class" -lt 16 ] then # pty[p-zP-T][0-9a-f] offset=0 mult=0 d2="0 1 2 3 4 5 6 7 8 9 a b c d e f" else # pty[p-zP-T][g-zA-Z] class=$(($class - 16)) offset=256 mult=2 d2="g h i j k l m n o p q r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X Y Z" fi start=$(($class * 16)) set -- $d2 nt=$# s1=$(($start / $nt)) set -- $d1 shift $s1 t1=$1 if [ "$t1" = v ]; then warn "$i: pty unit conflicts with console ttyv0 device" continue fi s2=$(($start % ($nt - $s1 * $mult))) set -- $d2 shift $s2 t2=$1 unit=$(($start + $offset - $s1 * $mult)) end=$(($unit + 16)) while [ "$unit" -lt "$end" ] do mkdev tty$t1$t2 c 5 $unit 666 mkdev pty$t1$t2 c 6 $unit 666 shift t2=$1 if [ -z "$t2" ] then break fi unit=$(($unit + 1)) done ;; st[0-9]*) name=st; unit=${i#st}; chr=14; blk=5 mkdev $name$unit b $blk $(($unit * 16 + 0)) 660 $g_operator mkdev n$name$unit b $blk $(($unit * 16 + 1)) 660 $g_operator mkdev e$name$unit b $blk $(($unit * 16 + 2)) 660 $g_operator mkdev en$name$unit b $blk $(($unit * 16 + 3)) 660 $g_operator mkdev r$name$unit c $chr $(($unit * 16 + 0)) 660 $g_operator mkdev nr$name$unit c $chr $(($unit * 16 + 1)) 660 $g_operator mkdev er$name$unit c $chr $(($unit * 16 + 2)) 660 $g_operator mkdev enr$name$unit c $chr $(($unit * 16 + 3)) 660 $g_operator ;; ses[0-9]*|ch[0-9]*|uk[0-9]*) case $i in ch*) name=ch; unit=${i#ch}; chr=17;; uk*) name=uk; unit=${i#uk}; chr=20;; ses*) name=ses; unit=${i#ses}; chr=74;; esac mkdev $name$unit c $chr $unit 640 $g_operator ;; cd[0-9]*) makedisk_minimal cd ${i#cd} 6 15 ;; mcd[0-9]*) makedisk_minimal mcd ${i#mcd} 7 39 ;; lpt[0-9]*|lpa[0-9]*) case $i in lpt*) name=lpt; unit=${i#lpt}; chr=16; flags=0;; lpa*) name=lpa; unit=${i#lpa}; chr=16; flags=128;; esac mkdev $name$unit c $chr $(($unit + $flags)) mkdev lpt${unit}ctl c $chr $(($unit + 256)) ;; bpf) mkdev bpf c 23 0 lndev bpf bpf0 ;; npf) mkdev npf c 198 0 ;; bthub) mkdev bthub c 175 0 ;; tun[0-9]*) unit=${i#tun} mkdev tun$unit c 40 $unit ;; joy[0-9]*) unit=${i#joy} mkdev joy$unit c 26 $unit ;; ipl) mkdev ipl c 44 0 mkdev ipnat c 44 1 mkdev ipstate c 44 2 mkdev ipauth c 44 3 mkdev ipsync c 44 4 mkdev ipscan c 44 5 mkdev iplookup c 44 6 ;; pf) mkdev pf c 161 0 ;; crypto) mkdev crypto c 160 0 666 ;; cmos) mkdev cmos c 88 0 644 ;; speaker) mkdev speaker c 240 0 ;; lockstat) mkdev lockstat c 177 0 ;; cpuctl) mkdev cpuctl c 188 0 666 ;; audio|audio[0-9]*) unit=${i#audio} audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit : ${unit:-0} mkdev $sound c 42 $(($unit + 0)) 666 mkdev $audio c 42 $(($unit + 128)) 666 mkdev $mixer c 42 $(($unit + 16)) 666 mkdev $audioctl c 42 $(($unit + 192)) 666 ;; hdaudio[0-9]*) unit=${i#hdaudio} mkdev hdaudio$unit c 195 $unit 644 ;; hdmicec[0-9]*) uint=${i#hdmicec} mkdev hdmicec$unit c 340 $unit 644 ;; gpio[0-9]*) unit=${i#gpio} mkdev gpio$unit c 173 $unit 664 $g_gpio ;; gpioirq[0-9]*) unit=${i#gpioirq} mkdev gpioirq$unit c 365 $unit 444 $g_gpio ;; gpiopps[0-9]*) unit=${i#gpiopps} mkdev gpiopps$unit c 344 $unit 664 $g_gpio ;; lua[0-9]*) unit=${i#lua} mkdev lua$unit c 209 $unit 664 ;; rmidi[0-9]*) unit=${i#rmidi} mkdev rmidi$unit c 58 $unit 666 ;; music|music[0-9]*) unit=${i#music} : ${unit:-0} mkdev music$unit c 59 $(($unit + 0)) 666 mkdev sequencer$unit c 59 $(($unit + 128)) 666 ;; radio|radio[0-9]*) unit=${i#radio} : ${unit:-0} mkdev radio$unit c 87 $unit 666 ;; video|video[0-9]*) unit=${i#video} : ${unit:-0} mkdev video$unit c 193 $unit 666 ;; dtv[0-9]*) unit=${i#dtv} makedir dvb 755 makedir dvb/adapter$unit 755 mkdev dvb/adapter$unit/frontend0 c 200 $(($unit + 0)) 666 mkdev dvb/adapter$unit/demux0 c 200 $(($unit + 16)) 666 mkdev dvb/adapter$unit/dvr0 c 200 $(($unit + 32)) 666 ;; iic[0-9]*) unit=${i#iic} : ${unit:-0} mkdev iic$unit c 201 $unit 600 ;; spi[0-9]*) unit=${i#spi} : ${unit:-0} mkdev spi$unit c 347 $unit 600 ;; amr[0-9]*) unit=${i#amr} mkdev amr$unit c 176 $unit ;; apm) mkdev apm c 21 0 644 mkdev apmctl c 21 8 644 ;; random) mkdev random c 46 0 444 mkdev urandom c 46 1 644 ;; cfs) makedev cfs0 ;; cfs[0-9]*) unit=${i#cfs} mkdev cfs$unit c 60 $unit ;; sysmon) mkdev sysmon c 67 0 644 mkdev watchdog c 67 1 644 mkdev power c 67 2 640 ;; scsibus[0-9]*) unit=${i#scsibus} mkdev scsibus$unit c 61 $unit 644 ;; bktr) makedev bktr0 bktr1 lndev bktr0 bktr lndev tuner0 tuner lndev vbi0 vbi ;; bktr[0-9]*) unit=${i#bktr} mkdev bktr$unit c 71 $(($unit + 0)) 444 mkdev tuner$unit c 71 $(($unit + 16)) 444 mkdev vbi$unit c 71 $(($unit + 32)) 444 ;; io) mkdev io c 2 14 600 ;; iop[0-9]*) unit=${i#iop} mkdev iop$unit c 76 $unit ;; mfi[0-9]*) unit=${i#mfi} mkdev mfi$unit c 205 $unit ;; mlx[0-9]*) unit=${i#mlx} mkdev mlx$unit c 78 $unit ;; mly[0-9]*) unit=${i#mly} mkdev mly$unit c 80 $unit ;; twa[0-9]*) unit=${i#twa} mkdev twa$unit c 187 $unit ;; twe[0-9]*) unit=${i#twe} mkdev twe$unit c 97 $unit ;; icp[0-9]*) unit=${i#icp} mkdev icp$unit c 102 $unit ;; agp[0-9]*) unit=${i#agp} mkdev agp$unit c 82 $unit 644 if [ "$unit" = "0" ]; then lndev agp$unit agpgart fi ;; pci[0-9]*) unit=${i#pci} mkdev pci$unit c 83 $unit 640 ;; dpti[0-9]*) unit=${i#dpti} mkdev dpti$unit c 84 $unit ;; dpt[0-9]*) unit=${i#dpt} mkdev dpt$unit c 96 $unit ;; altq) makedir altq 755 unit=0 for dev in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq jobs do mkdev altq/$dev c 77 $unit 644 unit=$(($unit + 1)) done ;; wsfont) mkdev wsfont c 81 0 644 ;; cir[0-9]*) unit=${i#cir} mkdev cir$unit c 86 $unit 666 ;; irframe[0-9]*) unit=${i#irframe} mkdev irframe$unit c 85 $unit ;; pad[0-9]*) unit=${i#pad} mkdev pad$unit c 189 $unit 444 ;; qemufwcfg[0-9]*) unit=${i#qemufwcfg} mkdev qemufwcfg$unit c 342 $unit 660 ;; vio9p[0-9]*) unit=${i#vio9p} mkdev vio9p$unit c 356 $unit 660 ;; fault) mkdev fault c 357 0 ;; clockctl) mkdev clockctl c 89 0 660 $g_ntpd ;; kttcp) mkdev kttcp c 91 0 ;; dmoverio) mkdev dmoverio c 92 0 644 ;; veriexec) mkdev veriexec c 170 0 600 ;; vhci[0-7]*) unit=${i#vhci} mkdev vhci$unit c 355 $unit ;; ttyv[0-9]*) unit=${i#ttyv} mkdev ttyv$unit c 12 $unit ;; # arm, acorn32 mouse-pms[0-9]*|mouse-qms[0-9]*) case $i in mouse-pms*) name=pms ;; mouse-qms*) name=qms ;; esac unit=${i#mouse-${name}} lndev $name$unit mouse ;; ipty) mkdev ttyp0 c 5 0 666 mkdev ttyp1 c 5 1 666 mkdev ptyp0 c 6 0 666 mkdev ptyp1 c 6 1 666 ;; ptm) makedir pts 755 mkdev ptmx c 165 0 666 mkdev ptm c 165 1 666 ;; atabus[0-9]*) unit=${i#atabus} mkdev atabus$unit c 166 $unit 644 ;; drm[0-9]*) unit=${i#drm} unit2=$((unit + 128)) makedir dri 755 mkdev dri/card$unit c 180 $unit 660 mkdev dri/renderD${unit2} c 180 ${unit2} 660 ;; drvctl) mkdev drvctl c 167 0 644 ;; isv) mkdev isv c 192 0 644 ;; tap|tap[0-9]*) unit=${i#tap} case "$unit" in [0-9]*) mkdev tap${unit} c 169 ${unit} 600 ;; "") mkdev tap c 169 0xfffff 600 ;; esac ;; srt[0-9]*) unit=${i#srt} mkdev srt$unit c 179 $unit 600 ;; tpm) mkdev tpm c 204 0 600 ;; dtrace) makedir dtrace 755 mkdev dtrace/dtrace c 207 0 600 ;; fw[0-9]*) unit=${i#fw} for j in 0 1 2 3 do mkdev fw${unit}.${j} c 171 $((${unit} * 256 + ${j})) 660 ${g_operator} mkdev fwmem${unit}.${j} c 171 $((65536 + ${unit} * 256 + ${j})) 660 ${g_operator} done ;; # create putter device and symlinks for all subsystems using it putter) mkdev putter c 178 0 600 mkdev pud c 178 1 600 lndev putter puffs ;; zfs) mkdev zfs c 190 0 600 makedir zpool 755 ;; iscsi[0-9]*) unit=${i#iscsi} mkdev iscsi${unit} c 203 $unit 600 ;; nvme[0-9]*ns[0-9]*) unit=${i#nvme} unit=${unit%ns*} subunit=${i#nvme${unit}ns} if [ 0$subunit -le 0 ] || [ 0$subunit -ge 65536 ]; then warn "bad nsid for $i: $subunit" break fi mkdev nvme${unit}ns$subunit c 341 $(($unit * 65536 + $subunit)) ;; nvme[0-9]*) unit=${i#nvme} mkdev nvme$unit c 341 $(($unit * 65536)) ;; nvmm) mkdev nvmm c 345 0 660 $g_nvmm ;; autofs) mkdev autofs c 343 0 600 ;; kcov) mkdev kcov c 346 0 ;; ipmi[0-9]*) unit=${i#ipmi} mkdev ipmi${unit} c 354 $unit 600 ;; xmm[0-9]) unit=${i#xmm} makedir xmm${unit} 755 mkdev xmm${unit}/rpc c 358 $(($unit * 65536 + 1)) mkdev ttyXMM${unit}0 c 358 $(($unit * 65536 + 2)) mkdev ttyXMM${unit}1 c 358 $(($unit * 65536 + 4)) ;; acpi) mkdev acpi c 359 0 ;; smbios) mkdev smbios c 360 0 ;; efi) mkdev efi c 361 0 660 ;; sht3xtemp[0-9]*) unit=${i#sht3xtemp} mkdev sht3xtemp$unit c 362 $unit 664 ;; scmd[0-9]*) unit=${i#scmd} mkdev scmd$unit c 363 $unit 666 ;; ttyVI[0-9][0-9]) port=${i#ttyVI?} devunit=${i%$port} unit=${devunit#ttyVI} mkdev ttyVI$unit$port c 364 $((16*$unit + $port)) ;; ttyVI) makedev ttyVI00 ttyVI10 ttyVI20 ttyVI30 ;; local) if [ -f "$0.local" ]; then umask 0 if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + \ $(linecount "$("$HOST_SH" "$0.local" $opts -s all)") )) else "$HOST_SH" "$0.local" $opts all fi umask 077 fi ;; *) warn "$i: unknown device" ;; esac done } # three variants of disk partitions - max 8, max 16, max 16 with highpartoffset # hack; only the one used by port is retained in final MAKEDEV script # routine is called as: # makedisk name unit blk chr makedisk_p8() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator } makedisk_p12high() { ho=524280 # offset for partition 9 to 11 (same as ...p16high) name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator } makedisk_p16() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 16 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 16 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 16 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 16 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 16 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 16 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 16 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 16 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 16 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 16 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 16 + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 16 + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 16 + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 16 + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 16 + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 16 + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 16 + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 16 + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 16 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 16 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 16 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 16 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 16 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 16 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 16 + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 16 + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 16 + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 16 + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 16 + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 16 + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 16 + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 16 + 15)) 640 $g_operator } makedisk_p16high() { ho=524280 # offset for partition 9 to 16 name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 8 + $ho + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 8 + $ho + 15)) 640 $g_operator } # make only the very few basic disk device nodes - 'a' partition # and raw partition makedisk_minimal() { name=$1; unit=$2; blk=$3; chr=$4 doff=8 ro=3 rn=d mkdev ${name}${unit} b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * $doff + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * $doff + 0)) 640 $g_operator mkdev ${name}${unit}$rn b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * $doff + 0)) 640 $g_operator mkdev r${name}${unit}$rn c $chr $(($unit * $doff + $ro)) 640 $g_operator } # create_mfs_dev nodes # Create a memory file system for a given number of device nodes, # and mount it. Attempts to use mount_tmpfs, or falls back to # mount_mfs. # # If do_redirect, then also redirect output to the console. # create_mfs_dev() { ndevnodes=${1-1200} dev_mountpoint=${PWD:-/dev} # Number of inodes is the specified number of device nodes, plus # a margin to allow for extra device nodes created later. ninode=$((ndevnodes * 11 / 10)) # Add 2 reserved inodes (needed for both mfs and tmpfs), and round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"} # A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . .. dhcpcd-hooksdhcpcd-run-hooks  lfs_cleanerd#!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook" fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi ...# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... . .. chown dhcpcd  disklabel dkctl dmesg fdisk fsck fsck_ffs gpt halt ifconfig init mbrlabel mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_lfs  mount_mfs  mount_msdos  mount_nfs  mount_ntfs  mount_tmpfs newfs  newfs_ext2fs  newfs_lfs ping ping6 raidctl reboot restore route rrestore scsictl shutdown slattach swapctl sysctl umount ... ... . .. bin!mdec"sbin#share . .. ftp gunzip gzcat gzip less more progress sed tar `tip! . ..$boot% bootxx_ffsv1& bootxx_ffsv2' bootxx_lfsv2( gptmbr.bin) mbr* mbr_bootsel+\mbr_ext~Ҷxx%Ȏff|Ѷxuf xvxf\fмV$f$\Q)1 u1USR $Pf^fBoot2 failed: v$UE;]W=[tYUSRRc>uRX]Uhe>h@B))hq>UWVS}j,W!Y^tC$tPW YZtFt'uE>e[^_]SXZxvHY.h&h&O e[^_]Ã=Z~QUE>]MUjuhT, =TtThTh>XZUS]h>S2 ZYu QLhLS ZYth>S ZYu Q!h>SZYtE>]]UWVS ]E ?RuRPh?j(h`R`R}R}RMRu"j:SY^)؉E'~ h?Sg^Z9u6E@PSh`RE`REE_ Pw1҈`RBHvƂ`R9U~SHоe w{1ɉMkM UB0ȉEpЉ v9U~PfwCUa1E1M9u%u`RuMM_;tE1e[^_]US ];u>7R RRt QRPh!?RaPQRh:?zj:SMZYuE;]EPhRhREPEPSu͋]j(ShQ^ RQh?S 9u RR]USEPEPEPEPEPuyƒJ?uV]h?Sa ‹EYY9uPShT?jPhR PEaPuShZ?jPhRR]UVSÉsP_VPhd?h/1=QPVjS y$5QDSVPh?N h}??Xe[^]UVSÉvSh?hS3؍e[^]MUSPPu\ 1ۅtg8tbPhAhSij/@P(uRh?hS0*ݠ%ݤ%Cu֋]USu1SZUVSuVZPV y)5QVSPh?e[^]E}?e[^]UWVS]u }\5ZSr"Q QXt"EQ5Q=QhRhRhRhRWVS&R@ u h?JX [Zt PXh&h&ĺ^_\=Z~Jh?[1ۋ4ݠ%V{Ph?j[y1PT< w $rC umO3h觻Yth @bMOZh'@PX1҉ݤ%{C]e[^_]OUWVS]E UEUu}UM ؃Àt,MUV9؋UM} D1>AAAMUEUE U][^_].UWVS]u }WEPEPEPEPVC$Q=\SujP7hR4jXjhRMh?uU_Y9u C$QPhDARh}ZY9uC$QVS%>[^Uuh>AW ZYu/hAAWZYthDWXYu5QuVS< e[^_]UWVSƉU]< uF< t=`St8_t V7ZYujTV@ECYtu hIAZ7uVP;1C EC`S u`S ‹@ uZ e[^_]UVSƉj:PaXY1t#@:t T>u:De[^]UWVS@É։NJt<< t< u1hSR)߃ wƄ=Gj:SZYtt h[BX :/uB뭍e[^_]UWVSSƉ׉M]GME-} u}PSVެ uQ>P[Yt jP/XZdDCCCT\S1e[^_]UWVSQu< uF< t `Åt"V'@EKZu EqBe[^_]uVP;EC1CXS uXS ‹@uZe[^_]UWVSL] u|U1҉j jhUD =TtjjhTD ETjj}W =SE/preEkernEEEE]jMWEPK t9PL}܉]܍ EX}@t-@PEPu uQ{P u)ޡ[Yt jP^XZ S 5SjjhSCuBA}܋EET\S "MUWVSEn |UIEE1ۉ]5|UE̋EEЋEEԋ]]^=Qt"E1St5Tj PZC XS1tF@kP Tu hBYDVjP_5T5T1҉V=XS tjO7VT@PߡTt5Tj PB EUEUEEjjEPB:j8j h SB}tU SEPju$@hBQ1҉1|Ue[^_]UWVS uV ZÅuV_uVhB[^PMԍU؍}Wjj u/=QtE C E؉CEԉC1҉S{SS(YSS,Xe[^_]TuUE PuNXZUWVSH juZY1ۃhD WP Cvy:ubZZORuT0ECDCC$;C(;C,jDRP~  )9r1VX؍e[^_]US]CD0[]UWVS(EX]t u H<H0 hBE <}̉9E}u3E܋p1HXM]H X$M]HXMЉ]1ɉM.U؋r1J 1ۉM]J1ۉM]J1ۉMЉ]1ۉ]܋M] E]M  ]u619rMM}u }܉O1ɉOu؉N @(3e[^_]UWVS@]xFCACA{ tIMs s |s shCWPVn MA SttM@ESp}1ҋMS@9~/MUFXFTGV G1҉W \UBYMŃ AMu MAXC@Mj4}WPHjhCWMuMSEBEUEЉUuPuLHC@-@PVW|uuVH$UXEMAEA EA$EA( q Q# h+VPCpN;1e[^_]US]CtPC tt PC t 00[]UWVSLffd$%1ɉ CDž%s %fDžsp pWjjƃ@ Cp pWFPSfC!h&h&h&Wjjdƃt,@ Ch&h&h&WFPS2==S]11S;H7WRHZt5HKOhKOdK @PRCPà 덅2A@A@A A UA$UA AW9xU1akPrRsC1ɉK <9/HSKPH SKHtw ttK 1҉S$볅=AfFSfAfA 1y AP PCP =,Su =(StPFSP Y^OuC(fC(S,Su5u1C 1҉S CCPCfC(SC SCCBCfC 1*T"*T#*T$=u9@@t1j@VPCjhCVu<t <tN1 $1"1&1E01҉.1ɉ21…VPtcIq S{{ {PSVoB@pSPr11jWR!Bh CPh CW`u։hCsPhCW5uut/jPVA 71tUjPpA pt" sKS PS2A !tA @Ab@ @tQ@uKxW9tX9u11WNG@915BSC ?SC!CSC"@SC#DSC$ASC%(1}7e[^_]UWVS,EX }Ծ@&|U10Ctxt.E1TuԍEP1ɋEqYFu܋ẺEȃCpET}ԍEPE(ZuxM9Ms h7CGuЉ1FE@ppp phUCCu E@xxEX Vvhb6SPW2e[^_]UWVSju1ZY1hVPƒ w118PRxHH *0UEF<F0/F j0jPF$"F(!F,j1S9u9u9=-hyC~WSƒ G9t hCQf vHQЉ)9rB$`&V BӋV B ˋV BËV B뻋V B볋V B뫋V B,룋F P t BuhC@,t@uhCVV,ZYXSXe[^_]ffffO&7%fPfRf1ȣ%f1Ҍ҉ %f)ff %f $$$$$$f$f%fZfXfP.% "u% ؎% %XPQjYYf0؎%( f"..%Ȏ؎ %f+& %UFu]fXfþ%AfFAprot_to_real can't return to X1f%D$`WÈfÉD$a`t$,fL$(D$0T$$\$8D$4Sf[f%D$a`R[s Àu1Of ȉD$a`fUAfrfU ȉD$a`ֈ}ff؎؃BÈf2ÉD$a`ֈIff؎شHfÉD$a`1ɺO11fa`fa1`f\$a1`1۴f\$a1`1۴fm\$aUSQRVWf1f tȉӝf:}1fȫfЫf_^ZY[]USQRVWEPAMS} -Wf_f fE1_^ZY[]USQRVWf$f_^ZY[]`ffЉD$aUSQRVW}Wf_Ofa%_^ZY[]USQRVWM} lWf_Of&%_^ZY[]USQRVW]@.Of%_^ZY[]USQRVW]Of%_^ZY[]USQRVW]U }Wf_ Of%_^ZY[]USQRVW1ǸOf_Ou_^ZY[]USQRVWU} UWf_Of %_^ZY[]USQRVWPf11r&G$u&o&Of QX_^ZY[]É1`r&&G$ufffЎشfL$aUSVWff\_^[]USVWfT$fL$lĈf31_^[]`Nf\$a`:ffD$a`"ffD$aUVSƉhj0Pk$ 9t<9t/Y t'@q01ۉ4181<$e[^]UVS13Pt $ $u [^]UVSƸ [t'h jP3jSE4t 1ۉ؍e[^]Ã=|Ut$Uj(jhUG+jNf O5hO 5dP5pY`9uu1ɉat.;uGvtt܋9u9t#fw@Pfz@ VQB Z 9`t#9tuƉ9ű1ɉGu&`VfX1e[^_]UWVS uM]} ~uȉډЃ1N ^$M]E1vDžt$juPSQV=-t} tvE 1҉mE1vtMU^0jSjEURPV,Mt} t5FNjU (QS~EP } u1E Ue[^_]Ujh'ul Uju uR W|$wUWVSƉX\W~8X\ tD t>X\hlX\ptlDžh1lzPV.ZYu4Ft.EUptEf=vPuFFHpt1LLlhPTF0djPjTPV;+u+j\d}WjWhC`tLDžLr]1Ej\WjE 9uȋX\EUT9uP9uPTTTT1TVdX\EU8FuTtH\XPt h>GvYFt8tPh]D^XZHaPPhgD@ F tpF!4`)hAPhLXZhEY1PH$H#PhKΨ^3Gt1ɉDD9THC9Džhps3hpDx {tCPhDaXZC aPPhDF C@SDHL1RVjh9HLr*@11RPLHRPhMD(11RPLHRPhUD跧 hK誧C8S<@sDs@щ‰r 8DžHaDžP~u >FFV<@Pt h>G XFt8tPh]DYXH3hD F tpF!4`)hAPhL¦XZ@DuKQh3C蝦ZY1P$HH{Pu hKjXDHe[^_]UWVS401ۉHj'PLSEj:StDžD ÅuhDYh jP`DjS{jj11ɉXZ8u?ttGtmuHtV/XQGtJLRPuZYu74k$ދ040W8<F$tbDDt1ɉ<<9HF\ÅF8V<@vDv@щ‰uD_Z`8Dž8Dž@u ?O@uWt D@8uu D8GtFLRP*ZYu3kuR{uLjj11ɉXZu58u?tuptVXF$uщ3hhClaTth19p4`h9FƅhP<@8@hsDs@щ‰\ZY08DžlDždzu:t{JXtnduZtdluXul9Tu/kH|P@kT$Z@$mdu ltq dlkH|P@kl$04LW8<MQf]GhHQ\e[^_]UWVSE lÅu U5$UUTTTjj11ɉ^ZYttk$ߋ@tq04C S$8<C(S,u >C S$TTC(S,TTEX1 fBe[^_]UWVS] h?S^_9thDASZY9u0MUEP>_u%MUEPYtShDb[^EÅu  U1҉$UUTu}=TuK=TuBK0jQMjWVSuZ5T=TT1TSEs {$5T=TEUTTEX1 e[^_]UVS]s~uj?Z1C1e[^]øÃ=hUuUhF<X1ðUVSƉEEju tUutU=pUu1PjxZYOujEP5tUx upUtUB:%J8 ȉB=%R; Љ1e[^]fр uҀuxu @1<UWVS thhF/Xt hFXt hF_t hF^h G֛ hGɛhjSHjh#GSS Oth(G葛[jh3GS0 u܋t11Ӊ %fGdu h8G7YxRPYZOutuhKh=GZP PPh@GǚF1ShK誚Xe[^_]UWVS hjSjh#GS<SOt1jh3GS u勽1tω %ftFdtQSZYOuȍkt19u 9u9u؍e[^_]UShjSjh#GSUSOu%jh3GS uhU1lU]áhUUSP]¸t;CECEEEEPu h O]UVS8]t!VSEZYOtShNG谘Y[uShaGSIZOtShzGȀu1Vv*P%FYXuj8jV!1  f f1҉fV1e[^]álU~/UPZt5lUhGpj: øUt]]UWVS ju]SLhGSEu Yh>S)^_u 1ɉ lU;h>S _Zth>SY^uU܍Eu-hLS_Zt"U܋EjhGS ujjS jxSY^jjSƃ tjxS_ZuShG[^kPjjRU[ǃ tjxURZYtjj@P6 u뱹(t=~lU hG譕Xe[^_]UVSÉЊ w$rP3@~# Zq@9|A2`~`9 a!0 v1ɃSrZHx9Z~1Ƀ=[t0 vue[^]UVSu] h@V,ZYu]e[^]ޱhIV ZYu]e[^]Jh@VZYu]e[^]h@VZYu]e[^]h@VZYu]e[^]e[^]UjhhsRukUS=Z~Z;PZt8u =[hKX1=[uT19Z4ZCAPh8HC ً ZXK>GQSRhDH趓9ZtZhpH蒓Z[=[APhHq[Xj5[u \ƅ]\ZZYup[ƅ\=[xZ=[u APhRH@PhaHXZjP\SZ9Y[ @PhHWxhHX 4 ZZYu- uh @蜒Y^hoZu܋ ZEt ;t@PC}t%H8 u9r@;;uCQX uCuU]ߋU] MЉPQ؎UËENjM HEMӉSQێUWVS 1ۉ]1ۍ}WEP[ZYuC}uCk E蘐xU1E19t&WEP#jWkxUD P0F֡xUXuj P e[^_]UWVSL kp|H119耉PP ZYkpjpjD P+kp4F FFF$jPjjjP5$tN GWtVNN 1ɍ4@=ukpL(j@EPD} u }u ?ȃuMQщ‰ZYu,[4 t Uу tUuʁe[^_]UWVSPӉ:/uC-;j/ScZYujSO_X)߁WSSgƄ= F ~x4 u F lju5$Jt#Ju-=ZtuLoZu x4 u @$u@1ɉ11uO@,2;9x8,GI B09j ZơZZƍu F <$@u$@9F 9F ȃ?H1ۃ?Ik 1ҋՠ-դ-19t4Kt C_v?AuϋFButͨKuF11 C u9u%#Z < uK1 @9}덄~ t_ڍJ.~ u 1ɀ~ D )Ӊ@\9u狅Duƅ单QH1ۃ 9hƅu:P4 tu9eZk1Z48/u-01 ?e[^_]UVSSËBuuB toBuC_$1$wK4 u+9C8rt,Fͺu9sK t11Y[^]UWVSEU<Ujj,dhj,jPEإU:G zEP[I ؍e[^_]UWVS(UԉM؋XS BuaC$E)M9MsE؉ECEz4 u C E}tBH!EC(EEE}}uEE1tCH{$71}*UEO9B83uЋ}}t~E)9}s}EE܅t01ҋN t1ẺUЋF01 EU F,1 EWuԉщ‰ ZYu"{$E܉C(})}1E1}tU؋u)]ڋue[^_]øUWVSƉˉыEv~ t t u#1F$119r F$1ɉN([^_]US@K ,f{ u#1[]USӋ@mA@u$SC1҉SSPCXS\Bu@t1҉[]øI+ZUWVSSÉ։ʅ1D7E11; uJC< /~9}| ƍD8A9Z[^_]UVSƉˍBc [^]UWVS$ljUMEG}L M)ʉ,I}tEEHRUjV[E썘(Uփ E ^1҉,IhIeXMEtkGURVSuujwPEűE9tSPhI^e E)Et"&dEEEE1 Me[^_]UWVSEUM܋pIt" I9U|,IH)9E1ۉIIEE䋆 I1}E]9]hIdYE@PhJzdXZ t uhK_dM1ҋE-X2h.!PWh.Ju%h.M&JEX_W$I11@=Hu93h*JcYCShMJcXZ*EI H1)1ɉEeÅuo,IEIE)Ѝʉ IdžI9U|2H)ȋ}9~#hE)ȍPu 1 h^Jb؍e[^_]USX(It1E11u81BHu퉃$I,I- IǃI[]UWVS8/u0IaËGh0IjPǃI`ǃIDƃ GDžjC|~JjdS4 0yJBt)֍DžIDžhPSpjhsJP裚uaǃ Ih.MPh.S|h.,غyJ I0I`@e[^_]ËIƉe[^_]øUVSыuXtt…uII)ЉI[^]UWVSEU˸_EEpI;I}uȿ׋I)эMEuKI)+I9s9sRU}PuҜUIU)Ӄ u1Ƀ}tEME[_Ee[^_]ÅttUVS Ӌpj|jR2MFdJC랋VNEM?E~?e[^_]UWVS8E؉UMċXCE3{M芑UUt!ЉEԋU苒!ЉEԋE苈 tu w%C t19KrE}t@$@!Ћ}}t!ЉE܋EE̙UЋE;uE;rE}  t4 EE;t v1E?9)}U9~勻1t`+MnIE؋HEPWEXRVjEpQ$EU9X EM4t H!EhEPPEȉ uuj芆E܉ 4HE؋HPu܉WVjEpQuyE̋UЉE}E܋})‹Eĉs{ [M]U1E+M]9щEr1E)NjEĉ8e[^_]UWVS EUBEX}ut CHSLC4Ut-E1M1҉U܋K 0{w shK|E1M1E܋KE1׉֋EEԋEMuVMUE:9}EtP@@utkE؉U܋E苸FEHuVWXE؋URPjEpQuvU9XuftSd CJtƀ}9~u} }LJLJLJe[^_]USX1҉Pt1tSXFC FF1[]UWVS4ljFhjPvp EFE@X1҉RhdPuuRh 11RPjpӉƒb 7x'8bك ȋX=CptBDlDž!Dž?d@PPDt 9(~S|P@p|6PPp0Hd t1WVjpRǃSRXt /u DžǍUE1҉P[e[^_]UWVSE׉ˋptGFN9F }:MUEu*U9sRUuW}sUV)Ӄ 1}t}e[^_]øUVSƉЉʋ]NtttQYq )։؉Q[^]UVSӋpj|jRrF CFCFCFV CXS\1e[^]UWVS$EU؋p1҉U11҉V;FF MUE}];E܋E9s[EtJC<w .u hIn5XIUЍKQM@pEURuQMԋU'C랋VNET(E(e[^_]UWVS E܉UBExE1U؉1ۋGЙ!!ډEUOڋMOEgEUM䋏șƉEԉӋEËGӋEUډÉ֋E1wx1ҋO` t1Od t1É֋E싀E3E@URuw0VSjuvPÃuJE9G0u=E1wxu֋Ex ǀǀǀ؍e[^_]UWVSu*U9sRUuWhUV)Ӄ 1}t}e[^_]øUVSƉЉʋ]NtttQYq)։؉Q[^]UVSӋpj|jRgF CF|CCFVCXS\1e[^]UWVS$EU؋p1҉U11҉V;FFMUE8}];E܋E9s[EtJC<w  /u hI*XIUЍKQM}eEURuQMԋUC랋VNEEe[^_]UWVSD}] jjjWK$Bu@3j@uVW" u=hJ *Q_tPPh?) hK)^@tDhJ)Q[tPPh?) hK)YQOjhCV2d u&}u ZEZuSVW8jhCVc u}uZEZuSVW(u EtES+RhJWXZEQe[^_]UVSujVV [ZyAuJVhA(QZYtPPh?( 0hK(#uu P3ƃ tS 5QX؍e[^]UWVS}]hjh Zd[ 15[juƃxPVZY@u}Љ]!19};}]}V YE@&ÅuhJ'VXZ y}1҉vPtPVX`hpx t~)DžV^1l1;ppt1< pQt<#u ppҋppttt7<=txtPZtyuZFp`[tHt(9 ~=[~ [[ ~=[~ 5ZZy 1҉Z19~1N5Ztt t@hjh@S3_ u/@9Et 1CC>KQMWVssU؋E@tw+EUCSMAƃE@WuЋE@%]PuWUЋEEƃ E}xp1UЋEq}1ۉ_fE @8k8EEE P$@ EЉUuuщ‹EZY@u1EEȉẺEЉEEEEE @89E>wFltEunEts] CuF%MȉCV L}tKRPh LKv vvv vU؋ER @FEt Eu'cEtZExuF%Mȋ]CFVM9ȉ]sEUF V$EЉUԋE9EȋEEs EЋUԉEȉŰV N$F(9N,s2Et,)PhLJF V()RF%]PBN ^$F(V,9s-Et$)EUԋE9EȋEEs EЋUԉEȉUE8eUEVEȋŨEU1}}E tEUE@UEEEE @<EwEЋE P,@(EȉUuuЉщ‹E,[^@EUEEUċE @>f}px@ EEuVEuPEZY@VE H>EU+EU}ЉDTEȃEU(uuuWVUE@u1E1ۋEЍp@EE P<9yE @>9aFt?w t,7/j hLP3S t'EЃD8u;x$t A@9rEu1EU+EUFVF V$EU1EV L}tLRPhL(Hv uuvvUE @uE@tw;F F$s]FVjMQщ‹E%ZY@}u6}u0}u*jh/EPS ujEPh ZU 1FFG@xEt-uE%}Pu }u hFKG^UE<t Uȉ.EUĉEU*1ۉ]1ۋUEt UȉE%}EE t(E 1҉P P$@(@1ɉH,H6j@uPe E%}}E @%}}GG E%]؍4UEfe[^_]UWVSÉ΋}j1RPSBu=@u:hKQZtPr Ph? 4hKsXWVS t19tQhK뤉Ѝe[^_]UWVSÉ׋u j1RQP=Bu=@u:hKQZtP Ph? >hKXVE%PS t19tQhK뚉Ѝe[^_]UWVSH} EE؋GeIfHtQE@EG0k(ElEЋW uԉEzZ@Eu)E1ɉOG 41ۉ_*%Ej4PWPEuԍ03%EЃE 1uG09ECCEȾ =wD1D)ЉEċtuXuȋE%UP谏XZK uuċU؋E2ZY@ E؋M)ȋUЉC EȍL0щ1)E(R%Eċ]1EW09Utwt1 u_*E1Ƀ8uu9ptA(9|G29Et1s 3sK VuċU؋EZY@tsE؋M)ȋUЉC uEȃ(quԋE4%}Pu躎UԋEE%} }ủwG1UԋEu1ɉNfG,E-E̋WuЉE;Z@]1EȉE1EG,9E9;%CtEudEtiM AuC%MȋMAKLtKQPh LBKssU؋E)@1Ct Eu'=Et4ExuC%uuFsE9sus9usuԋKC9s8Et2U)PhLACK)QC%UPUċKC9sEt )9usuEȃ UЋE,EԃE1uE t E4EEEEG0k(EaEԋW uĉEo[@^Eċ]؉EG2ftyk(]؋X@EEuEEuЉڋE#Y@G2k(Ű])ڋ]ԉTEЃE$uủًUEs^Z@u1ۉ]1EԍX(EEG0E9ERG2M98Ct?w t, j hLPRJ t-Eԃ,8uU;PtA(U9rEu!E̋U)ЉCCE1ɉML}tLsPhLR?KsűUEg@uE@t_{vTM܋SjEZ@}u6}u0}u*jh/EPK ujEPh ZM 1CE(Et-uċE%UPuK }u hF>XUċEt UЉtẺE'1ۉ]1UċEZt UЉLyE%uEE t1҉WG 41ɉO*j4PW迉 E%uuG%}FF E%}UЋE{e[^_]UWVSujV_Zx-xPSZYxE%=@S _j/V)EXYthЉt)p@l Dž.tBtpVWjKpjWËljhKY_ty5Q(Ph%L; xPS_Zy5QPh-L  E%=@t jPVh? \1ɉtk[[u Q 0t Q-P Jt t h7L ZSXe[^_]UWVSWË} u.MEc ƅMu,uQuWh[L7 \RQM Y^MuGxEF~ uQWIED t PWHZZy3ڍe[^_]USÅu hD XsC PshjL u]ÅtUSÉ؋1 u[]UPhwLj XZUSMkw [tu[H U Q -Q[]UM/Pt 9tQhLj$h`\ `\UEPuu u UWVSW]E E߉)؋U9u Ge[^_]xtwAwo$P0taE e[^_]ƀ9sOj躀j 賀j謀 j 蠀^9yP茀FYj 聀Z]wQpXLUWVS]u CKFVuC?uu 8tڀ*t1+tۃVSQFZYtXWSZYt붍e[^_]Ãx<u_USË@u?1QhsDs@ C<=QtC8SDHCP]ÃUWVSz=CLaljXƃu t C85Out$#ljDžt O@ut @wt @wtC^)^)~ tSv v@' t^)É^E)uI~<uC1ۉQhvDu F<=Qt F8FFDjV F8ZYHu`^ )PWvH FH7lj.9~Hu9Ft F88~8u+V} jjjCFH߃~8u~<ߋF )PWvH FHE+Fe[^_]W|$wUWVS?pxP vQ k[u!P px8e[^_]g_9\{Lu(RWVPƉ׃u e1҉S[t/t 5sC9Ɖ}jjjjBu @u S;SDjPjSgAj8hNjS SDC@ wC19s)Ӊ9ȸ}Dž1P 9u"9u+19rQiQe[^_]g_UWVSQEuwk[[u Q =EtGqKEPu VsFV RPjsQQt,EFV u{ PU WQZuԉ+Ee[^_]UWVS 1ۉ][?u2E @1ɉOO OOMEPuWX%à tE}uwƃutdMt 9u]uC9 P~#kEM@PMuց@PO (uG@ tWZ15QEEe[^_]UWVSQMAQI wk[[u Q t1tIuFVQik[[^ Qщ‰SYeY[^_]UWVSukw [u Q V[uW t R1k[[uRt WR Y1k1҉[t Q tQe[^_]À=\u)U塘\NPavjZv\XZUWVS‹\1\t39r tL9sύK[@u7QsJ\Qv RPhN'Pe[^_]Ë\\U=\u\E Pu1hK)US1k[tS4XCu]UE PuXZ\á\;\sUP\U]W|$wUWVS?1EE{u2E}ԉx u܉p}8upEC?t)R>?t>EWt2CR?+jjjWVPƒ9StCe[^_]US] EuMQB t Z$1҉S0[]UWVSuE^~u {@{S?tICS?S@уC<׃MtAC<1҉S@SlUCl>NCl)Flj>FljF{luMS1tC UC NMV~MNUSC??XEEEEe[^_]UEuMQzA?u1z@]UWVSQ} }whjw(W à t,V8t/jN(Pw(W ƒ uSw(W$XZUj8WuY hVSM EFP49ȋUr!9r4)CPFT)lj{TFp)ȍ4CptN(Pv8RU US8EX1e[^_]UEx¸uE@ǀ]UEKu MIQ } t tQ ]US]¸u1KYC?uQD1ҁL?u +QD[]UEƒuE@4@p)]UWVSĀ1fDE@u1;Et} GfDU@EE}fE1ED$ut 11҉W1ɉ1EfUut 11W1ۍNut !ًEO]'˃)΃vt EU W1E1E OFD$ ) $Њ $D$ފL$ $L$ D$Pue[^_]UVSUu M1tBBF^8t)9u1[^]ËD$t8t9@€tuuuuH+D$VS\$ t$tCFtD8t>u(CV9u!€tފCFt8t)[^VSD$ L$t 8tft`@͉ ыލ1΁ €t8u.t(8u!t8ut 8uHu1[^V|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊ҋL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_V|$t$ L$uD$^ÃrfftFG8@;@@@E@J@O@W@_@g@o@t@y@N>{@f@@S@{@@9@Aq@@r@AP@@I@@@@@@@@A@AA$A z7h?A   6$>$F$N$V$^$$$$f$11.99.5NetBSD/x86 BIOS Boot5.12 (Fri Feb 20 12:05:51 UTC 2026)P)D@)D0)D )D)D)D(E(E(E(E(+E(7E(EE(QEp(dE`(yEP(E@(E0(E (E(E(E'E'EHah!IdontNeedEFISFU0eCSFH0eCyD<#*=(mWC 3KOO;Mt?=rGy=iG}`1bOh3qJiX~B4ϳ3Dh&\ M}-|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+AM3iǁ(s*K>;-чH-чH2IчHIчHZIчHIчHEEE FFF#F2F9F?FFFNFSF@[FE`FiFtFDDyFE}FFFFFEFFFFMEbbbbbbbbbbbbbbbbbbbbbbb|bbbFFIIIIIII. !.. !USTAR.volsize.USTARFSFFIIIIIIIJFFIIIIIIIJ FFIIIIIIIJFFIIIIIIIJ=`||NetBSDNetBSDcLdLeLfLgMhM(M>MVMFpMOMMMMMiM N k kk kkkk?kk^k^jjjjjjjj2jjjjBj0123456789abcdefZz:g:b7>QA:a0NA@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler    strtoulcommands are: boot [dev:][filename] [-12acdqsvxz] dev syntax is (hd|fd|cd|raid)[N[x]] or NAME=gpt_label (ex. "hd0a:netbsd.old -s") pkboot [dev:][filename] [-12acdqsvxz] ls [dev:][path] dev [dev:] consdev {pc|{com[0123]|com[0123]kbd|auto}[,{speed}]} root {spec} spec can be disk, e.g. wd0, sd0 or string like wedge:name vesa {modenum|on|off|enabled|disabled|list} menu (reenters boot menu, if defined in boot.cfg) modules {on|off|enabled|disabled} load {path_to_module} multiboot [dev:][filename] [] splash {path_to_image_file} userconf {command} rndseed {path_to_rndseed_file} help|? quit /Exiting... Could not reboot!invalid console device. No menu defined in boot.cfg truncated to %s enableddisabledoffinvalid flag, must be 'enabled' or 'disabled'. ufsNAME=%sNAME=default NAME=%s on %s%d default %s%d%c (invalid)%s:%s%s%d%c:%sbooting %s (howto 0x%x) boot returned %s.gz%s/kernelmultiboot: %s: %s boot.cfgPress return to boot now, any other key for boot menu booting %s - starting in type "?" or "help" for help. Wrong password. pccom0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdautohelp?quitpkbootconsdevrootmenuloadmultibootvesasplashrndseeduserconfonetbsdonetbsd.gznetbsd.oldnetbsd.old.gzonetbsd/kernelonetbsd/kernel.gznetbsd.old/kernelnetbsd.old/kernel.gzdiskhdfdraidcouldn't allocate module %s%s/%s/%s.kmod%s%sLoading %s WARNING: couldn't open %s (%s)i386amd64generic/stand/%s/%d.%d.%d/modules/stand/%s/%d.%d/modulesWARNING: couldn't stat %s WARNING: couldn't allocate module list FAILED WARNING: %d module%s failed to load module name too long couldn't allocate command WARNING: couldn't allocate userconf commands list exec returned%s is not a multiboot kernel Unexpected ELF class%s %sELF_SM3__SM_%s, Revision %s (from NetBSD %s)multiboot2 info size mismatchStart @ 0x%lx [%ld=0x%lx-0x%lx]... lseek failedread failedUnsupported multiboot address header Unsupported multiboot relocatable header EFI PARTUnexpected raidframe label version , bootmeOut of memory disk cd0 cd0a fd%d fd%da hd%d%llu GB%llu MB NAME=%s( hd%d%c(raidframe raid%d serial %d in NAME=%s size hd%d%c size raid%d%c(%s not found NetBSD RAIDNetBSD FFSNetBSD LFSNetBSD SwapNetBSD ccdNetBSD cgdEFI SystemMBRFreeBSDFreeBSD SwapFreeBSD UFSFreeBSD VinumFreeBSD ZFSMicrosoft ReservedMicrosoft Basic dataMicrosoft LDM metadataMicrosoft LDM dataLinux dataLinux RAIDLinux SwapLinux LVMApple HFSApple UFSBIOS Boot (GRUB)unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660ADOSFILECORELinux Ext2NTFSjfsvinumUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedVBE not available DDC [DDC1] [DDC2]: no EDID information : EDID %dx%d Modes: VBE2none foundVESA[?] 0x%x=%dx%dx%dmode 0x%x invalid mode 0x%x not supported mode 0x%x could not be set WARNING: failed to set VBE mode 0x%x list0xmode %s not supported by firmware invalid flag, must be 'on', 'off', 'list', a display mode, or a VBE mode number %c. %s %s%d. %s Option: [%c]: Option: [%d]: Choose an option; RETURN for default; SPACE to stop countdown. Option %c will be chosen in Option %d will be chosen in promptbootinfo too bigunknown command > com%d seconds. 0 seconds. -%c: unknown flag invalid arguments diskbufp %x diskbuf crosses 64k boundaryufs/ext2fsbad dir entry REGDIRCHRBLKFIFOSOCKLNKmsdosdosfs@Warning, unexpected short transfer %d/%d Please insert disk %d, and press return...%9oDisk is not from the volume set?! remove disk %d, ustarfs read512blockustar%99o%12o%8oustarfsCD001cd9660lfsWHTread header failedread header short=0x%lx Could not allocate memory for boot configuration bannertimeoutdefaultvalue:%c clear \\-__,------,___. \\ __,---` %s \\ `---,_. Revision %s \\-,_____,.---` \\ \\ Password: lseek section headersread section headerslseek sectionread section+ [%s%lu+%lu.SUNW_ctf%s%ldls: %s stat: %s no ls support for this file system %d: %.*s (%s) %d: %s (%s) The ls command is not currently supported for %s Unknown error: code %dbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryinvalid file offsetPermission denied1.3.1|/-\heap full (%p+%zu)unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check%s: invalid base %d>aׄSˇIoVɻϻRU Su/ͤ@Fɥ Wnk k=rrrr6s)|dv~ـ9A0GJ.J/Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f Wx*))1_WVRVRfp* ufZf[fYfgNP 00<0u ^Boot failed (errno xx): &$ rjh@)KZYUWVS$P**$)h)jh)ƒ E)Ã1*@*yÃ5*=*D$;EFI D$?PARTD$Cj$SjWVh)t1ۉ$\$7f$Uu怼$FujSjRPh)zujSD$CPD$ u$u$w$D$,$D$t$ |$$=v D$  t1t$D$ D$ 1|$11҉T$T$D$01ɉL$4L$,9L$$j$Sjt$0t$0h)1t$(|$D(jD$HPS% S4tS C$|$u|$uC D$C$D$|$D)t$D$jVS t 9u1D$ ut C D$k$D$(D$ËL$ 9L$(-L$0\$4L$ \$$|$ |$$#u|$t D$$l$D$$D$D$$T$**Ãuo=WEVt T)=WEVu=tᡘ1ң**$W=u@**bÃt$PSZY@t$VhSTƒ g)9u{)=Ҷxu1Ą[^_]ËD$L$|$uNuBtt6jt$ PD$T$**RPh)@u1҉ËD$` ffaËD$`faUWVS$\$8l$H|$DD$D$<T$@$T$CtHupKș9 $L$|_CuL$u؃fD$f|$fD$UfD$D$@T$DD$ T$$T$ZuSt$Xt$Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W+L+)1_WVRVRf+ ufZf[fYfgNP 00<0u ^Boot failed (errno xx): &yIjh*ZYUWVS$P++$`+h+jh`+ƒ *Ã1+@+yÃ5+=+D$;EFI D$?PARTD$Cj$SjWVh`+t1ۉ$\$7f$Uu怼$FujSjRPh`+zujSD$CPzD$ u$u$w$D$,$D$t$ |$$=v D$  t1t$D$ D$ 1|$11҉T$T$D$01ɉL$4L$,9L$$j$Sjt$0t$0h`+1t$(|$D@*jD$HPS S4tS C$|$u|$uC D$C$D$|$D`*t$D$jVS t 9u1D$ ut C D$k$D$(D$ËL$ 9L$(-L$0\$4L$ \$$|$ |$$#u|$t D$$l$D$$D$D$$T$++Ãuo=WEVt *=WEVu=tᡘ1ң++$W=u@++bÃt$PSWZY@t$VhSƒ *9u+=Ҷxu1Ą[^_]ËD$L$|$uNuBtt6jt$ PD$T$++RPh`+@u1҉ËD$` ffaËD$`faUWVS$\$8l$H|$DD$D$<T$@$T$CtHupKș9 $L$|_CuL$u؃fD$f|$fD$UfD$D$@T$DD$ T$$T$ZuSt$Xt$ÃuSD$9F0uED$1vx4$֍} @DžDžDž Dž$؃[^_]UWVS8D$$T$0L$,XkS8|$!lj|$(MP t$T$ <$9|$|'CS 4$|$ t19|E0L$!@#ELD$D$9$u$9 2 <$9L$|t |$T$D$T$ D$T$D$;u D$;t b< u1м|ؿ|PWˀ~RRJ*Ft ~u. uƋu-P^ Z1fluCZRDPBTЃ?Z?H9tGUAZRerUutf. BZRAr|t}=UQufZ ZtL||Error NetBSD MBR bootNo active partitionDisk read errorNo operating systemInvalid CHS read`uaUѶx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W8,+)1_WVRVRf0, ufZf[fYfgNP 00<0u ^Boot failed (errno xx): &l jh+ZYUWVS$P++$+hW+jh+ƒ +Ã1+@+yÃ5+=+D$;EFI D$?PARTD$Cj$SjWVh+t1ۉ$\$7f$Uu怼$FujSjRPh+zujSD$CPD$ u$u$w$D$,$D$t$ |$$=v D$  t1t$D$ D$ 1|$11҉T$T$D$01ɉL$4L$,9L$$j$Sjt$0t$0h+1t$(|$D*jD$HPS S4tS C$|$u|$uC D$C$D$|$D*t$D$jVSb t 9u1D$ ut C D$k$D$(D$ËL$ 9L$(-L$0\$4L$ \$$|$ |$$#u|$t D$$l$D$$D$D$$T$++Ãuo=WEVt +=WEVu=tᡘ1ң++$W=u@++bÃt$PSZY@t$VhSƒ '+9u;+=Ҷxu1Ą[^_]ËD$L$|$uNuBtt6jt$ PD$T$++RPh+@u1҉ËD$` ffaËD$`faUWVS$\$8l$H|$DD$D$<T$@$T$CtHupKș9 $L$|_CuL$u؃fD$f|$fD$UfD$D$@T$DD$ T$$T$ZuSt$Xt$t$D$:t'~uf>?tV4fX uftfufff:2BZR}s0״t 00);v堐,;:us ZPf1$ffu?HBbZ1ZRRf.:2BZR2r۠|t}=U3ufZ|Error Fn: diskn0: I`uaU . ..- db. log/ run0spool- .... .../ ...0 . ..1lock1 .0..