ELF( 42N4 ( І"І""CC[!P"\\@0 6QQ O @@( @0 fH!@P@Q?H3~Р -LL/[dPe@c@kdmain() returnedlmd   ! X(@@T @@ 0/|odxodT (/// P-N8d@c@-@PL00S @0080 0 0 0ᢖ gЍX}cCCAP/00S 000/X}cFeA-@MpP @ލ0s <PP _0 00㚱`ᝥV ̂ h߷@ ᧰ဠ 0R(0R $xOoBXBedAA\ 4S/0!8 00 (   !/@cddd@-)rP|偹0 !!X0T0P0H000, !  !A-A@cdddG-bM0SpPpP7P N区ЍG8 t@T 5P3 t  P wPP 00 B4R  04!@a0C0 tT 3t@ tP@ tP P 6P P t)P|$PlPP P 8$ 0@ Ye>A{AYeXB#BHAaAKA@-<@Ṕ$P@ fAAb8BA@-l00: SfT 88S!~q0Y@A 00 i@kd@B@-0@0PS@!@/* 4Sʀ0! 0    !B? SN}e0 !! H|Dz5<w80rcFe-@cdddAAA@BA P00  /$@$0P  000/dPd<0 P0/S/0CQ/@kds@-A0S<`P`]P. XP, SP P0000 8DPЍp@x<P`h@0: S P0RЍp@@P8P0ЍpcAAAp@Xc&A@kd` @ @O-M₵&pP{ ?W Nt!7GR  E/~P00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0ᖺZ6帄P L "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<P$1)0C$1{q0!10C0PU0S 9#9S  @P :$1I)0C*$1,^q1,!p1c001 1 @P :|5*$10C$1Iq 1 @P :$1Du*0C$1;q0! 10C01 @ P:$1t*0C$1(q0! 10C01 @ P:$1t*0C$1q0! 10C01 @ P:$1lt*0C$1q0! 10C01 @ Ps:$1*0C$1p1! 10C11 @ Pa:$1)0C$1pP#IIq㰃 uBIW#;I#7Ix#x3Ip#p/I$p`3`` \3!XT3 0C 0p 00I! 0I 0I "I": I": It:  I\: I0p09 H 0p0 :HXp!I!p0 H<L$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/x/I9- 1 J0JJ010! ,1,! (1(!h$)}I! 1" F Ѝ,A@N> 0 DSBO@kdFeᆳcAmdAiPc)i<c` &A?l?e,wd`@AWAwd(odPododdodhld|ldldld@ldmdwdPe CȔBhmd clmd@vc(c $c @c @- @0 ˆPЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ TTU   ,0PP<0P 008崁@P`\  0<0 0^*0 00 \S 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/@kd` hcp@-dfPTfU@ $ ``06/Tp0`$ p@/hc/p@-0 P T@``06/0 ``6/`0p@ /p@-P@{y@0 T000S 0d00h00p0x0h0x0p@: S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` @kd) A-0PST@ Sq y Bu 00 `0*b6/`P y  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@AA@cp@-P0 ` T@003/U U 0勯  p 003/pA@-00 P Ѝ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-0`@TP Vp V h/00 3/P0T00 T0 `@4/A0T0 `@3A|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~8A@-@00 S @0 P@oЍ@kd@-0 00  0 0 0YЍA-PS@`p ) P PA¯W    P 嵯UA(nAAp@-P`w@PP00lhAd00 P0   0 0pAAcA-p`dPP 0S  W000V0000 @1 #W  R0 W00S 0$2V  R0 0#V00S0 AtHcc@-@d0P Rl T0@0@000@0#3T  R0 0#T00S0 @@LHcc@-@d0P Rh T0000  "!0"T00S0 T  R @%Hcc@-@\d0P Rh T0 0 000 02 #T  R0 T00S0@ Hcc 0o/8md/0@-0M P@ 04bP 000 JfЍ03 p@-0@Tp@tt坮ㅫ$0dP 5/0 dP5/0֯0ӯ 0p@ϯ8mdO>AA-(MPv@D1P<微40100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍAQ05p`WV xxp Pd@ fg0 0@0 0a(Ѝ8mdA@kdcApAt6 A3 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@:A-0@TAԭ0P`dp 7/U fUAn_U[U U 0dP5/[S0dP 5/0 4P5/ 8mdO>Ap@-0@Txx吭PpPP0 4P5/ 0 4P5/P 8mdO>AC-1M@ThЍp`0` dP5/ 0dP5/P pPP p d09/0 49/ ۱0 49/ 0 49/PU 微弮0 dP5/0?<#8mdAO>A-1@T  PP0` dp7/ 0dp7/ 兮僮厮ㆱ0dp 7/0 4P5/ u0 4P5/ 0 4P5/P]8mdO>AO-,1P@`(l,i0f4c0p,(0464 ? 7@P0 + 0(' ,(0 ([P0)  (ŭ ,­0忭4弭OP8md0S@- S S@@WV'A0 @o/@kd@-嵴@PЍG-@Ђ2PRp`0CRdh2R 3C7CR0 0 $ G,2RW 3C7CR008#8S800 0G &F004004 0(0L00P0  , Q  !% b ,R!X , % , h0l0& d  '!00 !11  2P008#8S308#8S0x`0 pF p(`8p<F00500``5008#8Ss308#8SmSW HdHdOA_B iA@-@`sPh @ `0 0X 0P0 P0H000c04 4P$|ЍpP>cDr,,P>cl@ @ A@-s|@-s@h00: S/^@kdP>c00@o/@kd` @-]@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gz2RS 3C7CR008#8S800 0E &E1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011-P008#8S308#8S0x`0 pE h(`8p<E151``5008#8Sy308#8SsSW HdHdOA_B iA@-@`rP@h `0 0X 0P0 P0H000b04 4P$yЍp4P>cDr,

XcxD D A@-rv@-r@j0 0R/  Y@kd` 4P>xcp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/4/-/-/-/-/-/-/A-PpX`f0@ 2/ p 0S0@0 @0000@A-P M@`!0 0 0  p7/0P   p*7/0P  d Ѝ "( p7/ P\ 000 00@001 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd   ,|000040J> 0 0000Ȅ 8/0$@0\0`  (QAAAAAHmdN !AN N N @-p@A@- p@@-p@ |0 0@-o0 0@r0 0@l0P/fHmd@-<0@TP [0 0 @SHmd0P/QJHmdp@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  ppHmdRW SW 0o/Lmd///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S Ǩ@ĨP0T00S,0upG-M`Vo@P2`0pg봂ǦXP*J J0* Rp "Sk pd2d P00 000!h8" p-PAP0຋0$ഋP(0SHP㰑0SKP 1@宧P 1@妧P h1@垧P H1@喧@10S h ,00h0 01@0b0!9^dЍ0!p P_ a` P0p 0٧P0qw Ч0* R t0@YP S T0@LmdA@kdT ` Q>cT AP T Q c ccX,P>cX dX @-n//G-s@dVʀ 0! $"0""   !P 0x ާP0S ϪP0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y ឧ ᵧ 㠪0S 㬧 㗪P0p xP ,0S -0S (05#0x uጧP0p P Q 0R(0l0 S$00 S YX0S`P\ d$0PX0 0 0?cH 0!D d08 0   !H@cdddLmdEcgfffp@-T0P@0`0\00`X0`0s X 0\00pLmd'@-@0HP @-0 @o/@kd//0000/QR R / /@-MP`@pT0 P0 S0 P @0S*0 TQ 0R @Ѝ帩`@VUUU'800: S/@-@@@kd// 0!< 04 0 (   !/@cdddO-`@~P eoax0pS㘀|P xPW PL t0S 0S ʌH P00 0SӀ0.X01 S5p,`pP< [ p0S7Zy0S2W 1x0: SK1!0?Ac4GSڀ t&pS9PipX c 0&h0W00 S00S Z W  0O|0S+ p0 |PŏX 'Sd d C 00PECV 0 0C|0`  0 pX0  ЍO}P0 ЍU>@kdEcgfff:U>Q@-MpBl`@ pV巣G4P qGG jG  p10: SRZ e0s(852@  1忤@  1幤P0P0P 00P0@7 0@0 0@) 0@"|0x 0t00 0@D[P <@00FЍGAA_ _ @kd_ ` a Pcg#Ec@-@-@<0 @0FEc@-7@-0@P1 ip00200 `p0000 0000000000 Fp000 Ѝ0\ P/0 !8 00 (  , !/@cdddp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000U>U>U>0 @o/@kd@-) @P0%٣@-s@-P`j@ʢ+P0F.0 P05/PP Ѝp@w#㶣 p0@#C )㬣 H0@)9 dP,05/Ѝp@nAA`@Ac d @-//s@-P`kjP@ 10: S)Q00zw@ 0P|+ 0@00D00<@H00L00P0x0P |{0|0Ѝp00!00NK0 HP,Ѝp@@kdLg Ae f f lf AA@-rP@-lo@- 00* R | SlQ@ i H000* R S_@kd` A@-@{0@-C9!: ^SpP3 @4T004 0040606L00L000 @cc0l4/@-@, H$0 0Z?wЍlg !AG-P0 VPU0p`w@T qp YXU!Q0S@p h@P \cHH@= @忙@Tmd1AKAiAA-` f`V@lPp8@T 0Q`H0 @ᘙ aTmdG-`0000p@ 0  PU x0(60\ (0S Z00P, @\@ Ѝ"TmdP/0@-M@P 0 P @  0p@Ѝ00@-M@P 0 P @  0p@Ѝ0@-P0$M000@R<` p000S0 P@ 80 0`0p@ 0 0gP0@0$ЍbtTmde0@-M@P 0 TP@  0p@~Ѝ0@-@0 ?P @  p@jЍ P@- R ??Tmd0/Tmdp@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !pTmd@cdddp@-HP0PSp P@ `6/q0  0p@/Tmdp@-x`0SplPP@00C00SP  0 `6/T 000pp@!PpTmdcG-pP`P@ P" P PV `FPEⴜ@P P #P`嫜T00Y0S<4垜 `@噜AAAA/@-0,\ @T 4/ЍTmd00S/ R//Tmd00S/ R//Tmdp@-@P. l.0p@80/lmd 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/cA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 c s s 0  )?)/ 0  )?)/^/@-@q dQ0P0Cq 8 q (q AAAAA@-H M@?8ڞ W000 0R ЍAt 0@- 0@ ,MPr           0 040$0QP 000 U,Ѝ00cs /0/!//A-pQ`.0  P@ x0E2P Hpp`@tT:80*0 G'J Dc@p>@-A@-A///1/8#81/1/  R/ R/  0s S40@o//0@3S0/@c/Ap@-@0P\3/>p`S0Dp@/81 0$$# 0p@  /AAX> AAQ0 Q Q // AAA+BO-P`M 0 3/Ѝ03/@pyQ   0RP$ D 3/0 0Sp0 0 "R 3/ 0A0CS003/ 00u0d0Q 03/$.!3/(!0AYS000(c0C S#0x   0P3/ 0@3/@ 003/W  03/0 3/W0A CRS 000 0R3/07 t1p 2/0 30 r#0`3/ $>$(0". : S0 3/$&0$0$3/0 0 &6z R'zppF0$0l3/d60S T6T&0S H&ZD0<3/0,3/ Z0q03/$rO8pOS p $03/50S 5Z 2/5  0tt3/ZG 0D3/0T3/0zp! [  +S 03/ K R 03/ 0W03/0\3/ + $0`$0 $V0Q$80 0C2/$01?3 ?3!?#;00 2/@q0s00$* "0 : 0#$90"? :$#: `0PL#0$"@0007S0  S003/ 03/ 03/ 03/000}0x$3 0$2 t0$0d, R$PP03/$03/!t03/0|3/0p3/WF 00$03/$($0p 7/00t3/200pd$($0 7/$8$&$p00 0`AX>b>*A A6AA=AW>X>A(iAYB}A:AX>8A>AASAAKA/QA[BA|FBWBVA@^AhAnAxAzApA|Ahc>AAc>c>AAAAA|AAZBASA!AA7Ac>c>AAABAAAAAA Fc>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O⫘- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P Q!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S 7}p@4@c ,00,0/0 R,00,0/@cp@-(0c0@ TPUp@cp@-2@02 P<0#0P20C22S Upp@Q p@-\0!C !2 Q02(0$! Ø (0$!p@@cR/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/@c -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R DPP 0=S0@V20V 0  SR0T=Sp'p ]P@ ]  Z]P  . P Ѝc>7@- 0@P P0P R Sw @- Ѝ0@-@0 }P )] XPoЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0PN@ @0 4/@TP @> 4/@G8H@c1 !0R$04$0/|uc/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ chmdlmdp@-AQ+ 0S R[ xh_0_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0!$00pB@廐lmdAi!iL c4A1?/ //0 ?1@o/ c//0/////?  22//-P/6 c N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N c c c c1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  +(00(0/O- R\bY I* b$\" win_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0@cH00S/@-@0  "!$0p03/0 !!(ndlmd03 /0@-$@4 ]< 4 @ 8 L < @ 0 < /p@-P$@4 \40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0.p<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@-H0` o\1017800;` !.pW J0000 0 00 `L<`划0@0 0S101ߍ@c@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X 101101 0\! 6 SSO-0`@p0M 46CSЍO/t G000 0$0L0 0C0C004pNЍt!pppV 0  Z 0cQ  [ J<!PP)1\Z 0  3PP P08  0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C @cc02/P $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S 0@-0ZCU lPC^   LL& &0/0@cpP 0@- @ |M l Q \\ QQSH0t SF0  !0 @Q|Ѝ0@c0!R 10/Xndp@-@P rPp Xnd0 S   q0@-4 0S$ @ Xnd cO-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#  弋 t E0  !0 P}|ЍV@@ 0 ;/P t E0 !0 P$@|ЍO[V@ccXndA^ H d `"O-`P|T&nd0mdDc@vcc/@- 00@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00P 0S#020 0zP 0S"020 0mP 0S"010 0`P 0S|"010 0S Pd 0Sh d0I Pf 0Sj @0? Ph 0Sl 05 Pj 0SnЍ0*Ppr!000m0 Pn0Phj`!0@00e0 Pfh0!000c\0Pdf!0:0a00Pbd 000_0P 0800Pp 0800P@ 0700P 070&AFeAAzAAA&Ae'An'AA|AA+AAA=AAAA"A%A(A2A@-H00S<00Sz0 00000{ЍTldXld00/G-Sp@` A S5 S11P0 @D`Fp@03/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0 nd$ndlmdO- 0@4`lTD r0P\qX pY  R: R:[ Ѝ PN Y  L\!TWX D p(p W*Y )  p 0S p    0@pWr P@@- ^ 0P \0 BQ0&d>5AA-Pp4`@kP 0Pp 0<0`@P00 (@0 0,0 @yc4kG-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0:P  `FP@VU0,00,0000,000000/O-0p `0 W W W Ѝ@04"0 S )4S 0"4PS| V1d0 ЍO/ @D P T*P0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!*0 0 A3A3C?o20 0c @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0: @ `FJ  )  %p>c>lmdd>RAoAG-@Pp @ЍTJЍb2"0S@SM0j0O-@M<`N@N;@5TpP3:T#3p0 ?oZ20S 0 PH 801P;0; 0 X0TЍ`@ 0 SPT帄0 0 0Q0 R0S 000 R!>S>0 jJDV:V: 0 Dcp>Ap@-PN@N@% 0  p@0p>Dc@-0 PS@0S 0#G-p`@00hTЍ PZe 0 1UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 Ѝ@ycO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0 H`P0``>0 BB6*a"*UbY &<0 0  0 P PE 0H0 H B @ycO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T XHP%@; P @[H0@@ ;:S P%0:0PD0@S $H Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R N (0+0  VPV0P00 0 σЍ R N *0VPV0P00  0 | ᴃ$ R N (0+0 VPV0P0 0 00d>AAA//@-M`@>KPT#Ld,'@`0'4\UF/$ 2?0Rr ``p`@Q``` PPP T@%PP `1l p! 000T0  @Ѝ@ЍOA\AiAndndndndndndndvAAAA-HCM`PJTxЍAƂRh  !pŸ *Q   0"D3SD0P 0Sl DX!\1L L ]< <, Ղ 幁΂WT3:WDT3ĂT3@T3  庂市1!0S 1*B0S. 1F@T/+0pW0x! h1 \T ⑂ G R88T3 ,,$$!1@TT 0 0 0 0  ~W P01GT Ѝ `AcA0d>EAA A%>B=AFASAAAAAAAAXV%Apd>LArAAAAWAeA`A`Amd,ndAA A7AC-pIPI@P03/bTD03/0L30HP3,G?07@sI62C 000X2  00"Xd2  00XH2  00X,2  00 X2  00X1  00W1  00W1  00W1J 00W1N 00Wh1R 00WL1V 00W01Z 00W1^ 00W0b 00W0f 00W0  00W0j 00W04T ЍCd΀` ЍCglmd@ceArAAAAAA A* AJ A^ Ar A A A A A A A A!A%!A P-`@P p!c pЗ!P  R $LpL 4D膱 4/!`@S`!W , ,`! !oDЍ@cReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! m!oDЍN  0O   ! "`"Рo(A%(A )A(A(A(A(A)A)A%)A8)AE)AB(AM(Au(AC- @`p(P  0S 00PAP 00(0S|p(Q 00(0L0 Ѝ@0?  0 L0 00S 0 it 8  p$`Q)As@-@ \ TP`t ~8 00 `$PЍp@-1@``QP R& $ z? 0    !F|0t0@|$0`0:|40(L04|0880L00,|Ѝp@cm)A)A)A)A*AO-; T S3 RLDLOoB@ 0 u P 4(S$ [009t{ 0S00&R ! R &R l!l R `A@\1T@@@(0 0 P0( 0S O R [ (0L0Ѝ0 2{t C70 Z0o Z ZA``PzO@0 n0 X{ 0(0^ 0Y ( Xlmd@co>/*AhmdDc\*A*A*AO-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 ) P/ t 60 [0 0a`Pzo`0 n0 z 0 0 0t 60 0 0$  00@4@<0  P0 @TL@0* R @@Ѝ@chmd*AO-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ~?oT20S00 ?oT20S00  |lmd@cdddp>*A00P (031000Co//,c@c!:!P/ 0 00S/@0. 04S/Q0 /0,c @-5C.@-5G-08M@pl00 00,(p$@ @@ @`P0,0L0 0D000000(p$@@ @`8ЍBodj,A0*4S/0S0 0 /000/lmd*4S/@-0@03/0BN0lmdQ(QT0\0 )Q/R0 S,0@0D0//S/0H0lmdQ@-@ (4S80BNX03/00)4S0<03/0)4lmdp@-@0Do A("(RP p$$Ph$! ,$" \%R 8A\u00CS0p0 p@ Qu,codqd@-@|0T0S$D 0SX 0S@@I<0QD$   D$ @@DD,ccod0 04Ē Q884/0H4S/i,codT H$R i@-@@8P 084 $ 00e4od,cDc@A-P @`pTQ 0 "A2P 0`PR  V`p@V0A31003@c0P/- R   B B  P^^ $ B$ , Q R!! B B!!,cP/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  ,c0S@0S//0O-P` @P\Q pQ00ЁU00SE R㴑; Ѝ ^^p1Q@` Wp0U0 WU0 `` 0!&Q0 !SL   0E&  @T00 ЍO/QᤠT ``  U [  R`` `!& 1!L0L  o@,clmdodG-1pS@0!R00R0P  \  \ 1!aV0`0ó?0`QP 0  ^ ` 0S 0PR" S 6YY 0S 0h0hS 1S 0h  PU0S0`000p>,cp@-0PPdL4S N@l $60L0V L0?4`003/03/+-3pod,clmdp@-`P>A@<@2t=[TP_X[_P`\003/`003/03/`\T4PX4P__pcodlmdp@-D@[PX_0``003/03/`X4P_podlmdO-Ph4dpQLP4Q9 @䀟䠟fU*%*1Qh \ : 0010?0@03/@0Phx%!1PLP L0^뚟@03/@Zodlmd r,A/O-p64M@00[6PH4S 0 @ 0` T`k0 01000X0000N6T =0P0 +60$00$ 0(01,0(010Sp P p g@pV, 0S0PS0 4pp0V :߸W @:kp&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% >P <00W  T匸[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sk0(4S   0y X4Ѝ,c@csdcO-@p@P` $>PP`<`   *60Q000  ԰ @03/00 3/03/  0P4 0?PUP'S 0h<0LOT00  S  S80d5 ,0L42 S0`5,clmdod`0@-0@D0PSM,PЍ00 0/P -40 U0*0/4e@O-@pjT:奷003/O$ZZVUP!N`$5ᔠ?`U0 0C0=P @0  <@0H$ 00?@03/003/J`,clmdodA-p@`PU$$4$*$00SZ<(DF0@00V@U($<01S  2# R=$605X 0S(H$HJ$J@L W000 ,c00 p@- 0$@0P000Sp`H4S d0)$4$&CH P4th5hE000D40@@DDpod,c,AO-`MlP@ា0I 0000 T : 0 S:0SM˶ЍO$jjf V `!vP@ p$5?pT*. , 0 < ᚯ8뚯R0 <,[0    d卶0  R!* Jp +4S 0,03/0+4ЍclmdO-^PPE@p+댐匠ZT:Ob `fV`!P@ $5?0CT*0 GQ!803/@ZlmdO-@p$M`!+'<01S 01 0  000Y' ^'v00100PqW X [  G E<P D͵ <XP 0 P$Ѝ @00@0 00 00皿  x뚿$,$$0 !R3 0?  PX;P 儵 <P 0 @00@0 00 0尵0皏   9뚏P R0lœ\l% 0S 00 HRq0 <  0pJq 0 Eqcod-A3-A[-A0 #!R/080/@clmds@-@PU$ %60Q;`P 80 00<LJЍp@*cO-q3Sa100@-4S[0,4T倁勰U !0 PU ,$$#2$$0 SQ8 0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$  2/03/00  !!000T(4xDT U0-40-4|D Ѝ|03/VBn@c,c clmdhmd10 P0  044-4/@c@- 4@S 0 4cP $0T W0(4 0@0/,clmd@-$a  hl @] 0 4$(4]@T R0D4 p000 00S 000D40P0D4僴$TPp,tq0000'0$4$0!*10 ,$020 0 Ѝodchmd@-@L0 49p@-@Pp 4S v0 4!\IP Pp 1T 0(4ps!1q*2h$T 0S0Q D$,$ ,$ B  B R @@TQD$h0 0T X0x$R x$p@ 4kDPD$,chmdcodsd@cud@-@P@HG-`x妳PdG@@@ @pW0S   ʳYQ @T0,03/03/YP`P 屳p᭳Vjp0t0壳U4 (0C4 040C4 0 @ዳec,clmdsd@-@.P'q@}-AO-0P 0UM0 0@p0 0 0   P@᫳Pk[WPUЍ0    0* 0 100R `0A  S + + 1 L4` 0 0 V'! B!! ! R 0Y0 0 皟  +0뚟  0  0 6  B    S 00 #cod,cp@-P),奲@@@ <e@۲pcp@-P(,唲@@@ <T@ʲpcp@-@p@崲p@pp>cG-0X`TL4 :0?003/03/@`p.P 0` S@03/@@@00?003/odlmd0' 70/odO-xBMgV<*dZʀ 0! $@"08"0"   !&j aw0W:Q<03/,03/03/G 0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0od@cdddclmd,c(wdp@-PPP@}$F@0T0?@003/0p@/hmd,clmd@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-$4$T$D,M w|T0 0=$41 - ) `г~ !Q1 $ *P$   o)  PVxo㖠 `    ἐ ^ $3P$ l Y 'P lb<03/03/03/ 0 72|唗ЋP  )5? T唇\딇0PDn(5? `X唇"0S70977'3C?6C0C#:%. "&0#2>0#6!' 7印D h@t1q $4!*$010w,$020 0@01 0(1C0 0@@ @@@gf1 0000 @@_0 0000@@ @@@Nf+000@0@0 @@@@f ;<0,ЍO/@c,codcc-A-A-A2.Almdxdt.Andcsdhmd .Audhc.Asd .Aqd!.Aod@c@-Z560@ P56 @Gtd0H4xdodO-$M,h($g 1@`5PQP`!P(PESܐ(Vᖨ(:$Ѝ0 y@Pm0 0000009  2Ppp@W T:`&& 00JpodqdEcTldDc.AXld.A@0!S@0d4 S00h4 S$0;00;010?/odxdp@-0`S0@LT!* Sp0PT S`0dUP0SHP,jm$EOM0?pod.A/A-!01; 00? 000$,cO-~0PP04 ?mp~R@p R R1!ěd`V Ѝt!l1d弋L\!T1h帋PV[#0$ ! \ /FVfF<R0 R  lP $%/("(VR#  U뚿HXhF /JZjFO/Axdodp>t/A/A !:!/ ),cA- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?pxdod !iD!!G-`@0匀pB00>0>0PT0?0?0000?$:[P(0p00 I06SP1ADi 0 A0:0 0 0 0p>g0APAI0AAU0Av0A0As@-0P `R0  @P1 00 @Ѝpx0d03/00 `40P0  @P4000400040@@p>lmdc/0 9G-p `P /9~M0@:0$@P $8U 00<0 0@0$000 0 00@D@ //C-H0M00p0dj00LP@0` 0%&x00@`@UЍ x0 00 Z0A3e cp>A- t+j0P0>0\ @X0`@Dp@ o00 L0000L00Ap> cO-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJdgЍp>lmd0A0/c0/ᰆd0/ᰆdT0@-@0 @RS ,0 Ѝ0000갆dcl0P/0 S/@- ^@LS:0 0CS(0 S谆dl0P/0 S/@- ^@LS:0 0CS(0 S谆d @-W/k0 0耼c0p@-`!P  O@P$P`I00@p@聫ꀼcA-餀`@;0PU |ip R0P R 0Li j [0$A Nꀼc1A0A7@-Pkd000@T $kT 0PE0%VE$ @ Ѝ00S 0ES:@ꀼc0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/A-(P`p@P @ 0 60PT`\00XpD0 0L0$0h0009 0@0⹪00S/cM1Ap@-@P0Ppp@0/cp@-@P0 Rpp@0/c@-B@P 000T0X0\0`0d0h0l0p00Pt|x03  _Y1A@-@_@<O-P@M800Y*Ѝ0 S+ 0R'`<3 p<P 13 ` <P &3  <P 0p` S @0P#/////|/x/t/p/l/h/d/`/\/X/@-PgL/H/q>wqAe1Am1Aw1A|1A1A1A1A1A1A1A1A1A1A2A2A aB`1A0 8< 0/P0  T0S0CT0/ 0S/0C 0/M 0@ 0S*0 0S*Ѝ/A-\0S"`0PSp`?X@ 0cA @TX 0♩@0VD0W @@0@-\@M0SP P 8 00  Xz]Ѝ0@ Ѝ0踆d=2A0@-@MP0 | 00 0H0 S 0 0@00p00@,0ܕP L hfЍ0 Ap!D2Aw2Ap@-@P0t00t0h_p0S0p@3~^p@-`D @@?YP0! 0PQS0  @ Pp@00S   0 /0T0RG-p@`00¨PY0 S<80  Z7   3<80S.8倀+00W00ި<YPP+   0W@@8`<000⊨00x0W 0P0x000⼨W P8008000]W00hX00C0 80<80W00☨00 03/0XTddA2A2Ap@-P @@ 0R8` 0x0 0  G Z00C0 80<800S80 080^80 080p@^00Sp/Pp0p@0/dp@-@P4`V0x0Vxpp@0<L00L0/L0CQL/80/[^8 @0 |Q 0d0#/@- | R |080H^|   @\H@^ RQ @p@-@P00⬧L00Lp@0p@-@P00❧0p@0ԧp@-P@`0⎧0Sp@0Ƨ800800 ]p@-P@0`03/0Sp800800\p@-@@nc0P20C0S0 0@acUpAHq>2AA-@`@00S>l00%S P= S< SC S? 00 03/l<?c6Sn0m o484c 2czpS qS00 03/n$c6Solnp2p Ww03/pP 8008080@Q P80 PP8 <203/P00 03/21b6Sb1pG Wdp\ `0R0C?o20S0`0W P8008080@x :RP P  80  x %Ry R P Px0)Sy0SP80080808  PD0S0CPD0Pb D0S bP0 bs0SLbodrp\{bs`pGs 0R<rb73AM3AA2A$q>cHq> A2q>2A2A3A3A.3A2A40: -$M00  (  0 0$Ѝ/'C-$M`P@p V00$0 pJ0 0@ P0 S <8P J0 00@u$Ѝ'q>@-4@$MJPp` !0040 000`0 @@pU$Ѝp@- M@P` 00@0< 0  ` 00@7 Ѝp`'@-@ M , (* 4  0   @ ЍA-(M@p @`PZ00&4#0D0 :00 0L00H0`00p$`(Ѝ-$M(000 ,0 $Ѝ@-,MPp` @U00$4#0@0 :00 0H00D0@00p$@,Ѝ@-@PP j0P0O-4,MD(,00C#  ; _D1P100@00a0q$00 09 0 0`P@PU9,ЍPvP P0U  RTP  E P!0  ` P  SpP Wp0PE\q@ `A-@p0`P0P0tPP P0t0p0`t07[0A-P@4`pVd0⽤T# T) T@t`@H P 0 S08 @TVA0֤00S 3/|@T Z\0Td0Sp!@8 0  S   8 d  @@@ P 0Sdp`0WQ Q QG-@@P(M`0Kd0Sl0Si8 00 03/XA`>0t`0\SA(4`$40X3/p(Ѝ0`@ 80 ;808ppp2 0/xz 0p l0  f80Pp;80夐 Pd P0 d00 03/<_0d080p 0d0S p0T0d  R 003/p&00 03/_d0S60(S3@00D0 00 R0B0CS$000 03/,_0$0 p0⠣w_0d00<00<0H00H0P#pQ0ɣ`D0Sp 0CD00‣80P0 0d! \00I0⯣|pPL0$0L0!0pD @P D0S0CD0pp00 03/N_00 03/dE_d0S >0t0 0S 3/0+80 h3A3Ac3A3A3AEc4APk!4A,4AO-q@`P\ d0P0C?o2?3\0S0v`` V)`0S&0 U03d0SpP P 0! VP0ڢp W|0Pt0Pl0Pd0P\0PT0`/0@ 1`/0000q QHq>P P P P P >/0( 1d/0000Hq>P@- P P P P (<00 01d0000ꀖHq>00/00/G-@0cx0S G0⛢|PU @p 0R,L0S)80k&  80! P(P  0| 06P80 @00 03/.^Px00x0t00t0X R00 8080;80 @P0S  RT0`F6T00bV0 0 03/ H]`0000- }c0?o `cR4A{4Ap@-@P4`V0١x0VCxp0x0Spp@`p@-@P|00P 0p@It  t Xp@0p@-@@`P0⣡<0 0ܡKP0 0T000 0T0@ 00C08080;80  @0 1T"T <08 0<0d0 0S00L 0L0d0S0S80@;8080 p@0⡡S 0@0Wd0S0②p@0000@@G-L @p@R` P0S P1LSRL0003/<0\ 0<00` d008 80@   ! 880   080p R   080PP6 0U0 0!3/#l(788080 ! R"  R R 00 03/8 \^ 3/\#0h0Ϡ 0 _0ƠY U 00 03/t\@00>V<0 0Vp Z 0⢠[&4A4A4A5A5AA-0@S 3/`0␠P00P0Pt0US0Vp 0t003/ 0t00Ⱡ t0 00!/@!b040[p 0t00⒠ U R00 0₠ppV0yqEcgfff95AA-@Pp@@ @`0SЍ U`P@ 00 0X q- ^ /$0/p@-`P>5P@ $@T @P  pp@-@i A5PPp$0Spa p@p@-8@Pߟ@Tp0U @갇dp@-M@P[ $0HS 00 03/[$00$PU !R00 03/[0^0 @P` 066 99000000PЍp@h6AT6A6A 借갇dA-P@`h0C10 @B1d0S10\0` 0C 18000k0A0⣟ lA!+0C1plAq +Cq00 03/@S[00000 03/d E[q>6A6AO-MZ ЍMA6Ap@-P`t@TpQ.ZPd`x@6AC-`p䑟`0S Ѝ B@PX  008  @P 0SM$0SJ(0 0S0@S $(8> P? D,] 0B F $?dP 9_(0e] 0  ] 0B  $B 0PQ PU !0_Ae\\ 0  \\p0P0$D00@0L L\D\<\QA 7A%7A.7A77AMb?7AX7Ac7AA6A8BN7Ap@-P`@`0Sp 0P 80 @   R @R 8   \@u7AA-@p`00Sd0SA 3/p@ l0!#B@ T_ Q@+P\ `Q ` T\@|Q@tQ< D0SD 0C\QD01TQ8008080@0 0Q @80 ( @Q00 03/!Y8008080&8 # P D0S P0CD0@PUT @@|PlPLP@00 03/lL@U @q>o5A7A7A7AA5AX5A5A˼A5A7Ab5A5A7A@-@`pP4P #P#@0 0L0 X ЍMA7A@000  00T0/@-0@0#0L 01@ @<00 2$0S8$0,@-`@0P p 0# 000 |Xw2PB210 @X0 $X Ѝ@21 Ѝc7A8A48AA-@P0<`  pc&8 O 0 000L0 P C#0 ,UX0d08Ѝy^8AA-@0!< `Pᒃ(p 80C 0 #$000 -X10S  Z 00 0 b p'$P0$0H1L R 0#3!0 #31P"0 Xn80d0Ѝ0 `8 0 8  `\ Q  C40l0@0d 40 0 d0Q 0 XW0 l d@W98!cv8Ac8AMbEc8A!8A9Ap@-PX7@"8p@l\0O-$M h0 0$ `0̴@< pP  0" 00 W700S u"00P00 W@gY 0 0S70d0%t0S 3/ 0 $ _020 \:/Y L0  0 pY `7$Ѝ4"000P00 BW0d07x0S 3/}? 0 ,03/ ,0 3/<〓 ,03/0   C$   0W2 Zi 00P` \W @T04/80 00 0a7~0 V0I Q(0 V 儀 0 8/(X0 000 0C00 ` :/H0 pV0I Q(0 TV 0 `6/(Q0 V0`0[, 00S 0 d$^ ,03/ ,0,3/ W V  0B$ dl  \~V604cS9Al9A9A9A9Aq>!:A/:A>:A|:A:A:A:A:Ap@-RP@ ` R R0 <XV8;Xd /p@0d0/4;A^;Ap@-`@ 08P]P Up] z 0< P 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-p0@P!W@0`@0Lp0 0 U P0 0$/@P0d0A80帀 00 0 00 0X00\0 P040h00$0P 0*/Act;Aq>O-M0` L 01 2=AT! 0R://p@-P@`P0k P-p@0✗A-`Ppp@l0S 05PPቜALLL4,P050 Ec=Ap@-P(@ P@ Lp踇d =A@-`@10P KPV`@U`0!S\tQ l,VP08 X0 S` ``Ō P0000  P Ѝp@U0  R, 0 0p00l00P\0vP L LЍp@UЍpA)=AA!A5=AY=A`=Ag=Ac!dm=A=AL!=A8@- ( @0000hcX@- H @P 0 0mP000hcG-Q@M U0a@DrP 0!0T` 0Ap 0T T0Q0 HPD 0P   (P00cUЍ A=A=A=AA=AO-p`MTPPP3p@0Dh0lJ 40@ -0 s 0S 03S 50 * 0ES$ PPl0 , &R8  8 n  H  R 0@SP0,0S[l0 P0m0P3T0t0X0|0\00`0n0L@dh0000H PPR8s0 0000 00  00@ 000000000R 0 0SS ST 000900000:000000000 00040 P 00P4P 000 L0$%RPPP%* kH0S 4@o 0000000L @ ЍP3/Pf ],0SdY0000000:00"L^TKr>,r>\5Ș!@9B00S 0L0Sp //O-qMp P\00C(0w!0`p$0pG3 3100 0P0(0UЍQP\0S(W`0S$pd0S @ 0`@@D@H@3`@P0D@h0$ 40L0P0uN00SH0㴒 y8_0 (@0*8G0 4"<42@00`0 0 @@B@F@0P0a0 8< 0 4 Z*" S0!@L81@C00C80@,0001000 0 @R3 4,40 8<  ,4 (0` $nP04, 000, Q>00  1V 80S` @ $@+ $4"49#9V0@0$0 S00W0S  T 7  P)  P @W00!@cU r>'$>Ad!@-@#@A-`@P0P  :S0 0 pP0V zIt* \ R00 H IJ40l >AEcD>AddćdA-@aP |0 R p T T X0T 1 00AA0A hcUU UP/p@-Q@P R0S L RpJHAXHAR/0@o/A-pP`0x\0S @P 0S `1A0⠓p@-P`t @0=PPᑘIHHH4(P0=p 00s @ S /Q@-@ P]R@08^@00 0 0 LRЍ A=A=AnHAA-@P'@P`0d00`0Q\1R4:(P 0p|HyHvHpp0 P\QP\p@PWA803/@AHAY=A`=Ag=AAQ @-Q/HAA-`(M0Pp 00 P40 040@ 0 0|0 0@P 00 D0 @(Ѝ{UQQ<>t!!@9B0 8< 0///O-P`L1@ 0"PP3 !pH1 !)0   0 pWW{j0AL0{""i>n Ѝ0!P>|>0@-,MP@ > 508 00  L  @ 00r,Ѝ00up@-%LA0PH1 8 !i.80080`p@-,M@p` P G00@0P "0D0  #0H0 $000 00Lp `!P0,Ѝ0u0@-,M@P  K08 00  0 00 L$P,Ѝ00up@-(MP@`  [008D#L:8 00   0 0`B(ЍpA-P`P@000S3 S  ph !i! Wl0LQ0000P 0X00080 080OPP0 ᑖPA,EPH0 SH10H1긁>BA>Ap@-@@0PYhQpP`0U0$00p@$ip@-@JP@0mDip@0'>iA-l0@P~0pSSn0@0SLx0SIypWF|`PX1 0n00Sx0Sy0S|`hP>0 0n00Sx0Sy0S|@MP#00( 0EcPk!@-@`Pp<<0$M((0 00WhЍ(cA-@p F`0@PlP L18 \9@L VS(0 0`0 lЍ(c@-T0( P@"6 0<H1 (0$ 4cR$0L1@(cp@-T@P0`S 0S 000 0000S 0S000 0000XP0Sp Rp00  Q0S0$00Dp@ @- 00 0 Ѝ>0@-P$0M 0 0 yЍ0X!!@-(0 0600jЍX!!G-P @P  P0 bbH0$ H08<06000000 0(0T000$0@İ!A-(M@Pp `DB00@00>00 0<0T000 @0L@p"`$(Ѝ0uA-(M@P @p`C00'4#0D0pT%0:00 000 000L0@"$p(Ѝ0us@- 0@P La@0P40   H0b",4b4#04!400 S0S000Ѝpp@-M@w0La Px0K?4X0 X 8  !0 X0<0 00 0  0ߍpIA0@-LM4 $Pd@ 00 @0LiЍ0 @@00@0LD N@-S\ 0000L Ѝ0 0L d NC-P0,M p` @P 0 P 0S! Ġ"Č  Ƞ,ȠH p `  P ,Ѝp@-0P(M ``P @P 0` }P 0S $!$("( P   (Ѝp0@-,M@P S00$ Q>4PT6 1bQ0 P00P"0pԀ(80 pH00PN0S A0$0(<@ D0 pl0<PtcP@0cS400Ѝ QL;00u RIAG-(M`Lq@0 P?`aL0V SH1H 0㩜H1  PP P PU Vq(Ѝ-PP80L;L  0PIPX 0 S 000P ~P0S $!$ ("(R  $(  R%I0 0!$+PX!T1808 080 T1 0P1$ (0d0,0000H1 0H180080    ^P;L  0P 0 r2JAjJAO-$MPuLA0X 0R80 080C#@0∍$Ѝ@ $PJ4@pd#dD0[h0030#P00S&h+8 4 )  ``&  0  0R0pJ@P0 W0 0" 0+&*(0'4a `0p0 T0D040PT`Xp\L0hP@  Ecԭ!0uO-$ `p@<<4!44Md@H 4  `d0@d$P2 MF0ZL00 T0P `40LPp#4"48#8S ᙂ P [h5 50Z00 ^00pX`pPN0 4d#d5h&hV`` hFh` &4_0X0``P30F c `$0 ,($0S*/o\" RL\  LRࠑ (0L岠RR 3 ##@000 0000 `0P Ѝ R R pRoXQ 'Q(0RRR 0<0㑓#K0RA#ᰐ 0 S` S ,0A(Y X, Q   $0 0C$0Q X<0RR!K0R0C1#0S  P Y C0X00 ^0 0pX`p@P0 $4"4P"8#R#hB#< _0 0X``*P0 0 p 0 ᰠ`FV 岠 RpC; 00 00 p0l 0*Y Y 0 \Zp@pG\ \ 0`F7N &j4"48#8 S㴸͑ f040 g04i 00000"20 00 0@0k 03 0Q<<< 50lp tx| 0uRCs@-0@ CR 00  P0`P0S L140  Ѝp0 h0C1Q   L!4  l(,"$l$" A0C 4"40O-MPO30 F0@pᰣR)@K0R0La8@@ @\?W Z2C7CW"0CWX?WE 0 0 0pdP@B0 0 0p?c|GrGWpp>W >W >W0d` @00@PL140 0$#$  @h>W :@oT<>34ߍ$>W >W Y?C0CWT ?=W =W@P`PU V 0 @0d0@Pf g0@0C10 0d0@Pgf0UVJ@ύP?3Q#QQPPL@=W^@D`80 @P4 0 @PN0dp0 0@P80S  "L !$ $l("(          ;W ;C?CWG 0W ߍO;W@PM@ 4"4e xE0d0& c@pd c@d@!cpdcc ccccdҀ>c(c c<d>@ P> C>>F>JA0uJA N eR0 d00D H D k0j0  d@Dpm0 0 0@P40-p|`P  eR0d00 d@k01#n 6:00 00p000 0L@P+[ | dpE R0D00K0?0M0:00 01D@00 00@P6$#$("( 0BS 3y,rU|`Ps  exR0d00d@pk0h26:00 0L2 000L0@P 04$#$("( R@  $@%|,px H DF0,0:02 @ 00004w@P0 $4"48#8RS#00Nӑ;@$ 00@P$0 ,0F0,00 30:03 0000 @DPi 0 S0 <   0@<0;0 9Q080"0$h8@@0  d0@P 0S  {$  G $:$ F 0L 0  D@P:   B# D# F@K@#0 @ 0 L@P #   B# {@P T*04#!A 0 (Q(0(Q)  +!Q0Y    +!Q"00;000 @@ 0000;;>0>0@0@00 >J?000 0<< S0 00)S@}7 0EC0D00J0:D@0  (0LB@Pe+ *00C8#833##Yfkm 00 10000h0n43i0g 43oj0# b 4303000 p2000@ }0| 8< ~ ,4 (0 $"000 000 0(0000ߍOp0GS W Q )0GS0*QQA9!31  ߍOCQAQ@RQ +QQ 0AS8 \@0AH 8#8# 8d: W 5/QQ AQ B0ASRQ <@ dO00:0@  d0k@Po0W?00o000:0<0d @P W  WߍOg+QQ QQAA;!31 A AQ A eX0 d0d@4"46: ,00  0 0 [H u0S<0 8< 0/O-P` L0@ PP5BYp 1 !)0   0p W}Z0y 0Ⳃ dZtᤇ Ѝ!>>p@-La(MH0S4@LH1P@0H1 k500<0\ 000P0 @@(Ѝp꠆p@-P LQ0`H1  @PH1`0 XAH1@0H180 . 80080"p%KA@-( H1  @PH1`0 @H1@0H1%KA@- 0Fep@-@0@P H1h@`0H1QpP`0U0$00p@Yp@-@P@0Yp@0ҁYH1 L1800S (0$ 4cR$0L1@^c@-`MtPn p@T 10'*"*0*00(00,00 $0$00Ѝ蔂>p@-|0( x@"6 0dLa80 80000$00p@hPP p@XcO-PL,MxQPH1p0H1 `fv@PP`D  1 1%H0j `S7d1 00 0`0 PP)`0 hl0Pd0\ ` 0X 0x10T P`$4"49#9003H10H1;v,Ѝ p=%0 07X0P00`0 0 Ppm`P`TQP N@-LP4 D@  \\ @@ @00L02Ѝp@@ @ 00L0 pC-`@pLMP0 00 000Y0 (0 0P XLЍ0S!04"408#80S 0?0S 0Č 4,48#800SQ\Q00 $>4"48#80@- 00 0X Ѝ>C-@P@@0$M,c 0`WЍcX p@-`P0 & P<@P \P  0p@.XpcA-P`p%0Mx@PЍ;P L180 0040 00000p:Xc0@-P$0M 0 0 uЍ0!!@-(0 0600fЍ!!p@-@Pj `14L180X00X0pO-,DTM$ F0@ px|;)0@4RLaP83W 0CWg37W@ B27WE  0 XP@  0 z\3\0S00@TЍ QTЍO 0S0`2X0 \0@ w@P80 TЍOH0S0  00@0 l@P0S(0$00# p" ppS40xx0  r 00H000 IP0S(0$00 t|pZ H0S=0  `Q00000 (@P\( $ 0000S0q 0&?00\0L     0 @[   0 d-@P H1 0S H1@P@0H1@`0H1@<@:@8 @6cvd>pO-4"48#80C-1@SP\Mo< 0|0p`\Ѝ4 00000L(0P P00/ $4"48#8 0 L P< 0@00 005:5 020,30(40$10VWSQ! p`7 0p` #$+4"8  > C"X!\1, P!(00 T!4 x!2L0^?0n/ P0 0p`| 0# 0(0,0002 00 L(0$ OP`_ Pr+0So 000SV Si ,0p`b 201 483 00LP<0'6#$+4" H1 0`;P0 ("00 00 0( P0S"+0, 4"40 8#8S0 48L1 80 P-  {P&wP#   3/P pKA N#LAA- M`p@P ⨁n X409400000Su S  R! R   0LQ0100P 0X00080 0809d940 PP ^P9U< U< \hln!<# ! \10X10P1T!9x1S \x9Q s9q9po9U\ l0lmP\"9 ЍH0 SH10H140t>A>A?LA}LALA+B$!x!ALALAG-P+Lap0@P<?PQ$0U S @ @L @PP@  P@@ T 880P P800Y .P.PP 080P0@-3@PdM *QL7dЍ0  00R( 0 "  07LA>LAp@-P!@0PS ?!600#Q0SP(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P14 X3P@-|X3@  T1P03/X3;X3O-Mp؃@g13`Ѝ?0P X3` t0P ` 0 p$1$@ WJX0P0/ s@  ) B$ H$  ))`, 0徲4 #(08 <#T! P2/P!] < "`P!CV0p@@0u>A-P1P`h0Q C\PP4VH4@@@pV4 !04@TA4>LALAA}A=AgBO-(`pT@_[00P1P*0/P1P1 p 4 d$t"<402X#  p3`S002ձ02ű@202(0@P<4T103/Dl0Q0Xu4Ts4 HD@k4,J600lc>MAA MA4MAFMAOMA@-h@SP@aPG-pPW`@(  8 W@D (,$D00PT`H00#AD m (,W00 02X3  D[(0p, 0 Q0000P0S202l4S P10  W0 202 0< 0m4S P10  0S2<2X3@20202X3 0<2X30 0 2022<20RoSp40p4xT1P03/GwG-p@RowP1P"hP1p$0 S 0!R* Pd0P_PO P08 w#PCwEc$"p@-R_@wx#Rp@wd0x3T-p@-R_@pw#Rp@wd03T@-@`Pp<<0$M((0 00NЍcC-@ Fp0@`MPP =P `3d#0 X3A> S9@A WT00 00pRЍcp@-L(0H@P#04jX3 @t3$0S$@p@yc@-`MtPp@T 10'*"*0*00(00,00 $0$00Ѝ(>p@-PP@200$000P1 0P$P L2`0P1 V`p@09SYS! 0C023 0tQqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`nmMAMA11@@p@-l0( h@"6 0TX300$00p@P!P p@{NcG-@!`2PY P1ЍGY D0T`0"R0L0Sl ru0 00000z R!11Y 0S<00L0S,3d00!C=ЍGvlq 0 P1 ,P *0E P1$$qP R  qqqx3 d00xC0u00 2@0S *"*20S 0S$00P1 }up40Cp4ubMЍGMlc>MAHA NAA"@-@8  t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@p@-T1@0P3/PPX3VP <]3T1PP03/pX30;X3zNAO-MpPn`@ HQIt 0pdT10VP1 P1% P1  xcc8=522d3 PE 3 p`Kx%8KOj 2P1  V ,5,EyP2 PF~D00,(P$  `̾0P 0$2Ѝc moH0Q Q P\ H HD t34tQL1S /0T t$.t 2L1 20P!00P16 2?0W X3<X3n?0 X3@0X3X3lq |12 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ t  #Y?ⰰX3岠@0  ?70t# dt 2W tPy2V  08s24q2o2t#T0"0"AOAOA A{A`>NANANANAOATOAOAOA+BOAANA2OACOAPAPAOPA\PAC-@P@@0$M,c 0`KЍcX p@-`P0 & P<@P P  0p@YKpc0@-P$0M 0 0 sЍ0""@-(0 0600sЍ""O-hhS@ 0M`L8<X3 03Z p 1CZ 1Z  0 L`~2Z] 2Z0 0 0 BPq /0pS   Sz*0Sw <0 00000 00,0 :601 00:60 0Js0X0P0S`  ͙` BQ ,@+ X00X0 `@帔0YP P!!0S`ЍJ80 ,,ĠჁ ~R`0ЍO~ЍOЍO 0000100000` 080,041 P0`` `cvdndQ""A-`0MX@p `P\ $0HP 40 000p0`0fJЍlccR/00S  00s  @o///p@-P`G/P10@,0`02X0!40T10P3/P1  HP1p@iPA@@0u>O-p@ 0 A`P[xpP1 !)0  u 0 PoURVI pT1߿P 03/   =   鿄    qT_R $OHtTU k0t4uF p0P!0P!0 Ѝ "(>>@-T1@0P3/P WT1P03/p@-PT1@0P3/P00>pY0   " ""   00H00D000h0>p@-2RP0@`2 R R0L00QP0 <0L 6#p@ /0L00P0 4,.4;A^;Ap@-P@` Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@`DMX(h000 P<0 $0T YH 0 \0p 0+ p t0S 3/0 $ _02\ 0:/ N3@ QP8 7P  =3@  T7P80!0d R2  R00p + "3\ h0" 0/@-@ 08 0(0!3R@- /@c@-@<P80080<0A-`PDP@p80S6 0Aop0 0AT./P <00Q@Q<00P P "(!A-80@SP <0SxpC`<0S<` :0(S8P<  @< 00A-P@h003/P` P P=A!h003/pW h003/O-0P`04@T p p 4! ЍO  0S0 00! 0S     0R <0X2)QA    Q!PX <<(jP 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    PP X 0R{ R\ ` $ @` 8>SAaꀈdp@-@P` 0B 04@0 0!p@0`0S 3/ 0 pp@'ꀈdp@-@P 0<X00X 0@0 00S` p@(00X0S0X  0@ 0 0 04 0 0 00 R0S 0=@Sp@A-`P@0pSaP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 < AA-@p`p0<00P P yh0 03/o<0P0 ` fA-@`帀SA@-@o0 0Sk80S0,8A- @$pC1`00 1T05 0T6 0PT 2C7CT,<0,W7<0 R 4S @t T``@dpV<04#P@P -Hcξ3A 2A4Ap@-P` @`0T@ 0 <0S 3/@P 00C 04pC-M`@P`''@P40S  pᴀPl_h00pphCx0 0 ``0U P P7'0D DxmP4ЍC+'ЍAc@"pd AS"SAXN"\@"AT@- D@P 0P000Hcp@-@ 0P CS <0S 3/p@C-@P 1MSX03/<g4`0S  z*hW< R% 08 Q pJ0 00 00PT P! ЍC& \0.Tg R00 < ,g j ЍCЍpdpdSAxd<^"SAG-@p`0Ÿ8 R4䁟ܑ 00S 0SA  0` 0  0; 0o P\ 0, 0S< 0 <  0  80S 0: 0<05#0  0*P 0  P)3 0R S  P 0BS@@ %S,0%PAQMTP>TA*TA4@- $e@000HcO-@Px80S Ѝ<p0S P `0 00 002%0%P;TAA0S]*@-@@0@Q00. >0,! ,1Q 0 @㓥EcMb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  AG-`@PP@  1 ,p0S S8 @$ @ D1. 尓 ,/ 408p<003/3 3@ 0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0ꀈd NEFXPi'TDG-p`P@PP 0,00202?Sb40003/S3 PP>耈dO-M MP0` @0MpP00S:0007/<,rPw )000&0度`bS00T2Z< :  R+00d [fd R  PWW #ad R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ą@p 0p0p00S ۍ ЍO##p[*Wۍ Ѝ#t` t#p0pGWpX{#8`LHD@WAmTAD`AA[TATATA0>TATATATAO-0@4MPepAe80S<0:l=S#08Q D R< #" R*T03/80 S%d0S 3/ `l80SGʆPd R00 @ 6(e Q0<` `00SQ  00  `00 00 00< `V ]<0 0`@ <0 0Q Q<0` 0 pdTApd8>"UAp@-P@`rd PUdp0S \P0 P/ 0 /p@-@PYd@dpp@-@`PLd0 @Tdp0S \@ Pp@-P1 P#UDP30 P0 0 00(005@$ ,00$4<pUAUAUA"UA@-@4<@D@-@ c,A0S)UAp@-@P 00P`cdcAp@fA- a@TpUʀ 0! $ 0    !A 0  @ 0! T0t l   ! 00 0h0 03/@T \p P @cdddcc/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp P=,K0帢,<zpsL!DH1003/}#-  Ѝ_?0Q R 0hY 100100100 0C -/@@@/UA]UAG-@p`Nzh1VA@-6o@-Pd0`@ P0@@d0@0 000`MP Ѝp@Ѝp̣@ A|"VAp@-@PL`` 0S 000 P0H0P0@@H@9p@ aA-@`LpP` 0S Q H 0 0 00@`U `PX0S U `U `("aP @`G-`PLp@`0P 0@0S7`eOP,(0 ᰆᘆ(0 Pu x \tY`W`U`~oP PU @-[$0\@[A-@tp9`0 03/`$PYo`V 0ACEc0   Q @-0 03/P0S/A-P(MsU@P@(Ѝ0`P0$0(0 `0 03/$0 (0 q?00008 0P; p 0 `p*08/0S)0=0 888/P< 8!P r? 8 ׅP (<03/ 403/ʅUVAp@-P@$0 (0 庅ͅ(<03/400 43/婅p@U #-d}P0.X X%,à1 0")!0 <"#1o\Q "9MbEcCcVA@-XM@X  s 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X N701H0T@9C>H0 @H0P  0( 0 0 XЍp@-XM@X  +< H0XЍ0@-P(@\M hW\Ѝ0X $0 010408020H0P$020VA2p@-(0PXM 2`XЍp00@S SQ 0R0@`X  0T1008020 H0iTP`  P0@#WAMWA@-(@00 3/ 40S 3/00 3/00 2/p@-$0@ `8P8P08<0,4p P  `PU$09$0P@-@t`M`^0 03/$0PPy99$0^U W$09$00<0S 3/ P0p03/7/PPh 0 4pW  7/PP 8(0 m03/(0 2PP(0 $0 28PUPP(0$0$0 S(0 $0 P $$0 P PU8P0S pp 0 0S $0p p00 00 P9 PU$09$0]$0 9$0Ѝ@]W Ѝ@ЍjWAWAWAWAWAWAWA7A@l"A-@`,L]PpDPU  0R0H0 0 XP]03/x]X 0S$0 P  ]c]P@P]JA-@PT   @ `840D 4p P `84O-`0.40$M 0F3*@@R  $Ѝ![y [ [ 0  3"[ [ 0 S,  P P8 0 40 0 0@R TP  P)TP@  0RT@>4  n k h2!1@ \1 Tp04  0UPP 0DEG?0 0F0P[ = :P @P /P@  )P[@pl[ 0 | r` PT   0@40  0400P~ 4 0 0P 0  0Pg 0P 0B ! YSWD kSoWAYAXAXAYAAXAiXA>XAXA=YAXAWYAqYAYAA-0@P`*0) J0S V hZ``VP2"8 $AYAYA}A AAYA ZA$ X0R/0p@-)00+P@*0,,尵JoNOPVPp(!>C-OopPd`【\MBX  0 1HjP 0?40`V<?oU20S 00\ЍC'O-`lMp0pV Q ;T.;P"PP@X 5020t!(ST0TpU`10W ,PLPpX0G S<<000 0``P7 R00,`0 啁0@0`P0 ቁᅁV U00p0 0 plЍ4 80 Pf`2rA>jBZAA-`MpP`5@P*U@x 0PN0X TBP$402|0PSd020P0$P@P(00 <T 8 U400`0 0 D`Ѝ2@A>jBHZA@-$00$00 00  0@PQ P P$00$0Ѝp P$00$0%>0S,0 0TP P0 3/ `PP, PP ꠆kZAZAA-@00PP 0004P<0P0<00 03/pP` Hig`0p`0<0<,0SZAZA@-000 00<Ѝ@-1 0 /ЍA-@04pP0 3/$`Q\@    0 03/P t`P X00014  1\1\1 Q004`V 6/P`  3@T :00  03/tyPp`PZAZAP [A"[AMb0[A>[A0S/pp@-0@4PQ 0# WPL`0S 04A0P30PU*<p rEcXB0S/p@-0@4P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ@P@@@0 P0`HC-Pp`"Q P 1  0w Ѝ\@P@@@0 kP0`HC-@P`pQ P 3  0Q Ѝ6@P@0 DP0 P ` GC-@P`#pQ P !3  0) Ѝ@P@0 P0 P ` G@-0000  0Ѝp@-0@4P; 0# p@@p@-0@4P, 0# p@1G-p0(0S PqN@P jNP`N@ `?P bX0S40(0 3/0000@00Xp@-P0(0Sp@`DX 0R000 Q0 (03/4pX@Np@=N@-A0(0Sx@@p@-@`XPUXX0 p@,0/0 3/Pp@-0@Q4Pp ` 2/P D$ @p 0`( "4`#/0S 0\/-48 \$ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0( MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00}@P8p0 }X (0 Xd000p0(00(h`X0l`射@P(0 00 0} HMP@P (0 } <03/ 403/ЍLM rZp@- P@@@4?`;QpC-@(0\MPp`x( X  6< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2"P \Ѝ@ 0b0?o0cS2   ( (0` 1011SX  010 80t0H0rP X   01(0 080H``P 0  rr2 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000|P3 0|0 FZ!0 00||t` 00 0|0 $Z | Ѝ0 0 0~| G-@(0XMPp`x@ ?0 S㣤030#$ 0 X  <011 H0P-X  -< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2"P XЍ@ 0b0?o0cS2   ( (0` 1011SX  01|0 H0lP X   01(0 080H`ZP 0  2222 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000{P7 0{0 0Z%0 00{{t` 00 0{0  Z y{ Ѝ0 0 0s{21BP31 a1/G-0M01S`P`1 @o (0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0{@P;p@0 '{X (0od0@0h0l0040(0D00p0(00X0@P(0 00 @0{@ %@JP@P (0 z@ <03/ 403/TlЍJ rG-`0( M@p0c   0P*5/PP@008P< 5/PPB,1P 0L\Ac\A\Ay\A\A\A\A\AO-頠\1@Z!0P4` MV 6/Pp @R 03/(0L ` 000 ``00*8/PD00`80 8/PF9p 00wP8`0 wX p00000X90308(0p 00AP(0 00 0w f]GPP (0 w <03/ 0403/X @pߍ[Gx|SPp`< !4 4tp00P  'P " (1pS  PXp(0o1S\1Q0Z0 S 04pW 7/Pp2 7夐8# 000( 0   0p*@7/pP008p@0 7/pP6p 0@0vpP@0 wX 0 0@000$60 01(000tpP(0 00 @0v@ 0 (pX 012000 0PpP00 3/pP0 0p  Dn-`1 k 00PpP VW a ^ 06$0(0 Q N  003pP 0 A pP$08$0(0         Ho48#0婒\1Y0 3/(p\@FPUpP (0t Nv@ <03/ 403/W l0 \0 n0 c0 0 0 R0Z2 0ؤӑ[p0 [00 !0+ 0s1  z  Y x X h 0S T [ H  W8 42W0, ( pP /E (1S 0 Pt000ḡ S<#0 0 R XX :1S+ 1S( 0!`Pt161`!A?<`V)       '. !R尰R , [0 " !(   尀 000 [A r\A>]A!]AX]A<]A]A]A]A]A]A]A]A]A\AyA\A]AA ^A]A"^AR^AC^AA-P`@v $0 DS P9 PJ0 0(0 `L rPaH TXX p[1qp P0!?A1c L\1`06 SQ 6 `'``La H` P  r{ 6Hv `'q`` HLaiP`d T_XX[ p[V<0qp P0( ?A1c\1L!4L1>gfffi^A^Ap@-$`P`@0  p7 `l2 Xp-Pt)Hu%@v!8w`0xya |  pH!R0BS2l$ p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yza^AC-lM@d p(X 02XxP*00$0`80 ` 0 0 `h0&hS `Pb (0P 0 (0 p8P0`UlЍ40S04P0<0P(0PR`>:p@6_A!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-$O-P@P)m_J01naV!no1SKJU~o p\`↬VnpJv~A#$pԬP ᓬpPW J$00MJ[ ῬPu1 pPC-MPpEpQ@101Uo0|1 0p!]?lL  0t$0p1l!!0 v]|!0 ~T\!0 K mI4ns010ȁ1ԁ @٫01$ F40 00\` V10㨁 t1[AA-PL@B`m>IP0n`AsIs@- 1`QPpB@p>000#@0RЍpm_IHP 82<"0820 <"0II0P0t0L`000 01no1010s 10CS1nZvvd@cP"p@-pP@moHP P2""N0 0 IpPP0P0 P1"p@-p@PmoHP#@ @@(0 @0 @1Hp"A-@`$0@PA E KPmHU 101HUPAC101A-pp@`PoL!?R01 AA-p@`@D0L!mϠQ  p @00$PPIHHЍA0 $0+ PP 0S0 0000l+ 00 0 H1S$0P0<0$8 0!ЍAMHOb`A@MA`AEcT"p@-@0P$ mo G$1S1p@1H 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd (0 R 0 0040/|ddO-P(pP`@\p!RWㅡ& W5 O@ P`p1S0 0@0 A\'0S0S  @ T  t R 0 00qT 0 TG 0S 0S0S 0Sp`A|d`A`AaA@-0@S f0l S 01 0000S>@  Q Q  0|dPA-S@`p0 100PU0S0 8/00PQU0S0 8/P`A|dPp@-P`0@0 P`00 R @p 4@0@ 1Sp R  R ,      0`A|ddIaA@-@ R 040 @h|d-^ 0/$0a(!"$a$"  b"!4b4#0/0@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Q0/o"0#?S R000,c Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 PdchcaA/@- @q <Q 0(Aq aAaAaA0@-4M@P000(00 0 0    , 0 0P 000 4Ѝ0"O-4M`@2`2020 00 P0 5/0P  P 5/P <rZ pp 0< `9/PT0 ! U0}>0 4 9/0 4 ;/Y  Ul 40 3/[  Uc^ 0 !0 < 8/ခ PE(_CSe(/C#b?0ELPGr81  P,!, #0P00 P(01! 010 000aP 000 P (00 000>00NPy  0 00 0(4Ѝ>^괉dcpcaA0AaA bA@-bAMbSbAh$AaApbAbA"@bAbA@bA"/O-`0A3vᣁᣒᣣLP \[ \  P @P@ PD  \ # ZK0/ᴉd@-D 0S 40@/0S 8贉dcA@- D0Q d@/Q 0봉dAcA0/ᴉdA- @0PS ` p 403/0dU00 A/ R 0Q000봉dgcAN  0O   ! "`"Рo@-QcA@-McAp@-@PؗPpH0. `@@@Dދ$0Î p@0忖p>Dc00! $0 /@cd 0(0S 0@o/d@0 !!/@-0 !@@-0 !@p@-Px@x(P= $0dP$0 ,0KO R0(,04S00!pdcA"@cp@-@6p  PPPDUT ʀ0 ! 0$ 040pcAd0$/dG-`0p$0PUG|U !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pf10, TP2/@cd @- 0 ! 0^ Q    D $ 10@S@@@d@cL@-0DPO@cp@-$0D0P !;3p@cG-@`po  P00TS\70 !HP10,p1,a(0 ℑ41 0 , dAd@c@-@{o  Pl ,00DQSQ @0@!,1!,0,q@d1dA" $0 0!0 00 /@cddd,0P 0 Q>0//pd@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S pdXdAP0@-  d@/  R 0pd{dA@-P`@`0000  p 07/PPXG0Lq 2/y/,✹ 0 4 8 < @ D H L Pn  P   O R0 P P@ Ѝ@00,0 0@ Ѝ@qdAdApd`"dAdA0@- !" 0 !0@- ! 0 !`QO-RrpxPGx`q<@U@Tp  G210@ 010Dn  P `U pT X Ѝ@U   0 @[X ≐@0 4P0ڬ 2/p[ eA@cp@-P @@@@n  P`@p0/pdA-`1@P0_SL b0 _SL0_S Ip0 _S I0_SO 021   0 0Q000S$ SNApd-eA`eAA-|0 `pR_V0@00C{ 0@@_V=Pp @pdG-1xPPxp@ \W 0GSD ,0S 0 0 @0p,0Y`0,0 B0  W30# W _YOO@A$ 5Y0 ` _YOpq _YN @pdeAeAeAfA""G-0`@i0 p R, * 0 R& _TC _TP@PQP$B@  A0P% _T Fpd0@-@, _S= Bpd( 0 _S!Cpd( 0 _S! FpdA-PH0_PB`@@@Ap0S  Apd( 0 _S!OpdO-00Y @b_[pLpq0 CX_[ `I`aPPp0Z 0 @Z V O  @  pd@cԆ>PfAp@-@@0SpP"0 PpA-`P8` `p00p D1@ ׈0P   8/P Ѝ0t | x0Q  6CQ@ 6Aos0, N 0AoXczfAp@P%`A@-P 0|!SF &BS &SG `ЍpH!S0Sk  P(A 0SkA1  P@`p2 0@0  o0P` ` 6/P@0 \` 6/ |0` 3/0Sk\@\0 0SkD@D0 0@  p@`AcccXccccc/!/!`!//` `! /!8b!@b!Hb!Sb![b1/c 8!0/c#c4 4#1/!Yb!ab!ib!rb!zb@-`P@$P0@00 p0 7/0P P d`6/0d` 6/ Ѝ@ AcfAfA@-o 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-Qp@ 0d`6/0 `P0d 8/0 48/V00V*U03S 0`4P 5/ P0d 8/ PGV`!U0#02cEcA-0p@ 0dP5/`P Pd08/0 48/V00V*U03S w0`4P 5/ P0d 8/MPuV`!U0#02cp@-D00@ !0 4P5/0 , !pcp@-T0@.04P 5/0 00dp@/c@0A-\!\Q\a0@0j  PD p8  $p `0 00`0 00`0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/0`0ЍADFecFeP1EcfA<"T"7@-0Â"6 @FC$0S0 XPV0@T :@@Dd0 0S B @DT Ѝ0cQY'A-pP@`0!0 48/0dp0 7/0 dp7/0 !!c@Bp@-8 0403/8 0d`6/pA-0` Pdp@403/ ;7/0 4P5/P0@ `dp403/ ;A/-8/48/-8/-8/-8/-8/-8/-8/A-@`iO-00 0B ( 00Cp 0 00S 0F0  0G V0 S] 0J$00 3,000  0 C 0壐 000 000p4$00S0@0@0000$0@A QIP QFJPPBEQRH P<Ѝ@03/d03/400 SP4 L0 0R0@ 0R0?ZaPT (Q <0 3/ R 40(3/\0$ 0gAc$tclmdxc܆>fAp>A-PM@0 00 ". `6/`P # 001! 0@0P $ 0 dp7/T1 R `   P ,HЍ@(0@8p<0$0:0 080 S@   1H0D 0S0009Qd   {000040I> 0 0000 8/0 @00 Y,PgAA5gApc#YgAxdgA 0A 0S/@-@ 0S/@-@ @0S 0CS/A-@M`pP T1 00000 ؄@P@܍  P: h0R1ʖQ001  d $0` pX@z000040@ 0Q Sp@-@P  Pp/C-MP  p`P): @0 0( 80<  S@ ʜS0H|0D 8  Kz40 00T 5/00 @00Ѝp@-0PS @  00C0 0S0 0PV;(Q $ <03/ R 403/p@gA$p@-@R 0 0R 0R pR 0Rp/00   ,000 0H00 4P5/ @o_W@@W@AW@EW@- o ϜDH R< o    @03/Ѝtc-0 4 0/-0d /40P 0S/0S<0//ᄋd0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LT \\LXp` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPLITP,Z`N `Y  \ pXp B`\  ::0:0 & SC-M`p@p0000+ 00 P0 5/PP \ЍCpH2傏@   p@W%d  P ("( 0 00 00$ (0,0 0S3 ծUn"0" n2U]"L" ]2L2PUP*00 PPp008/P  1 000:88/P t)>0:! \P!: \P<: R? p@ P 0j=0:* 00 ЍgAdAdgAhA*hAVhA#O-0`SP@ Z-0S* cp   P00Z0000 ЍpQ3# 0kc  P  0 p@SHG-paPP@::S0YL M"L"8 R PBc  P  d0(S  D  "O-@ P4 pჟ0  Q ` !PU h0pW㋰   Ѝb  P  '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0oP t1 R8 8  01PjyhA 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddhh@- 0(0C*s` Ѝ1pP0d0 @0 L~`P 0SQ Q0 ,Xm`P,pWQ Q0<00D00 87 H0R/ R0 0SH01H0WH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 hX2H02,00@008000@@0 0S%40040ꄋdA-@2PVD`q@pWA40@00S 80S0p 0sBPh 80S80S808   YpDKXDD< :RD01 "0D20LML q @50@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0 ꄋdhAp@-h2@4Pld 5/`Ph”l0d`d 06/@Kh2ld 4`6/h”0ldd p@/'p@-P`@zPP@P jX| fp"R h2l`6/0p2pA-P`᛺p@0h20prx$0` h?0  0 8/ P ЍAW0hp2(Pl5/ +h2d 4Pl5/4Rh”d 0dpl07/h2d 4pl7/h”0d dpl7/h2d 4Pl5/1h”d 0dPl05/h2d 4Pl5/PGh2d 4pl7/h”h1d dp0l7/h2d 4pl7/h”0d dpl7/h=dph l7/h2H 4pl7/h1 dpl7/0 P h2p"lP5/0p2gָ0P  PX4 IЍAA',&hA iAt#p@-P@`  PPp00pp/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/uqs@->0`@ P  B` 0ŒQΌ Q @C0T00 P05/P  0 Ѝp*iAp@-0P L+00T0@4`X 6/TX0d` 6/p@FiAO-,M?x @ d0SS0 p(а d0S ,ЍS CS 0C$0PΤ(0``03/P 0PP0  (0`P  piiA,#oiAp@-@$0 03/$003/` $00) 3/ $003/P$0 03/ HxF$0 03/\>XP$003/Pp}4PUp3/$0 0 N'p@-0P`@ ᬩ0 0T @ ` BT0 0p@/0@-@ ᑩ T A-0@兤@q`PU P Pfp0 !o R00 C1o$003/P00P$003/0P RR 00`(d0 U T0X 4P5/T0 dPX5/PEciAiA/O-@,M d1!Q d0S TX00 P0 5/pP X,ЍOd0T 0C?odP2X5/x d0SS0pd0S ԣ,ЍS CS 0C0(P` 0pPP3/0 0 0 $8a h p@0 pq h00!AAiAiAiAc)#xA(#(#p@- R 0@P5/00 _p Zp@-@9dP8 5/0dP 5/p@ D@-@@s@-@00 P0 5/PP \L00Ѝp000(` 6/ 0000iAG-`0 p9d":/d0":/0"d:/`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z 8Z 3pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z mZ hpWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/,`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < <000( 0"( ,>iA jAp@-@' dP05/pp@-@0 4P5/0 0p@-P` @`0000 p 0 7/P ϱ Ѝ@$ `0p<SH8008080(040,0 Ѝ@ 0 00$0&jA9jAUjAH#hI#TF# F#@-@P 0SW  P0<00 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-@ေ`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-PU 0 3&*?=0 `p?x0@xp᎛ x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X0@0/-0d$ /{jA Q/0jAD0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PEhU AEcjAjA 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-P@`U$ V  P0UP0p U /0S  \*@t x0dP 5/0dP 5/@p&jAp@-@`TP TcV  P @ph@@p@-@P0d` 6/0d` 6/( d`\06/T00T0app@-@Pt`\00\0dP( 5/p@N@-@$X H00H00X0@gep@-@`UP\00\0d`( 6/p@/Q G-@P?10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPUDpPp᷑Q  l0L0GPb0 d:/ 0dp 7/ dp17/< P000QH 00@00  00004040gP  L40L0H00H00X0( $00040(0U  P,`T0XP0T0@`0dp 7/ d`x06/0d` 6/E`pX 0V0R0SX0S<0(@0P0T `. 0 ff`FkA?kANkAEcskAO-0@4P, 5/0P( 4`6/P fPX0S   P0_ X0@0S X0<0X0H0@(\ X0L U  X`H0p8 ē0p 0< 4:/04< ;/ 0 'X0L00 4p7/pH0p  p<0 1 / T  P+H0 0S'0L0@ 0< 48/04< 9/04< :/2$p 4 < (p,pLpL0S@0SP0<0T  P H0@(W P %b@P :PX0Sk  `  X0L P0 X0<0X0H0@(2V\P \PJV "P` XpP X` `0HP0H0@% V P0S+`P + Y'0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@NkAC-4MPŭ@P0,; v0P 0 P05/pP  dp4Ѝ0"*P r0P P5/kS  PNh2h2ltp0S  P<;PP`d0hP`O( 2P0sPE 0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`10P,0IPt(? @(0d!`(0P(0(0  (0  (0 (0, `(0,P(00P(04 (0 ` )0@00 000l00p0 0P00$0IS  PP0$00$00 oPZ|P0P (P ykAAA=jAR#kA N,LkA@AkAJ#DAkAhJ#`ATckAp0\ ?R"0/A-P` VP@P 00S lp%P U@ X0@0X0@%`VX00 @@cdp@-lP VP`@l`P%UX0 U0 X00\0`0%p0X0cA-L@`ǙlpPf%A@ \0S"@%訴cA-@L尙PU `80lpph0I%"%訴cX>p@-@p`lP8%"p@q%X0 @-\0@S ` 0\00s00`R`0(0C#p@   t "X /舋dd0S/p@-`d`@Psu멊h0 0!T0$LH @   !p@ꈋd@cddd\ P/0 !8 00 (  , !/@cdddp@-P@dPo\0 0T ?S5#c@0b2 03/Ppp@EclAd P0 P!ڠ 0@ S0/P P t `Sp/h/d/`/\/X/T/P/L/$/@/</8/@>lA)mA6lAIlAalAlAlAlAlAlAmAjmAImA[mA-@-@4biY Ѝ@ Ѝ/mALA@-pS@ 04MS 2 03/Dc2 0 3/00 P `V 0 0d0S e00 00004Ѝ 0B S020S' 0S P000  00 0203/0 000820S 0SP0002 03/203/ 0S P0000 000 0S2 0 3/} d0Sq n 00 0$0Sf2 03/2 0  R05"105%R0 0f d0 `Sb pdp:t0 0l ?0a. 203/PJ cFꈋdK>mAcX>mAmAEcmAp@-@@`lP_##ἔ 0 aEcmAA-p`套lP@D#1W 1W 0W$ @v#d1W# 1C7CW2 03/P0 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0000000 @ꨴcA @A A(@mAcdQ @-/mA0( o( /ላdp@-@8MQ2!8#8 S^ S_ QSQ  d R S `TQP$ ,`(`$0S2 03/203/2 0 3/P 20S 3/`P ln"d` 0 !h\0  00p0+P 20S 3/LJ8ЍpA7AcdmAmA Ad#nAp@-@PXP " " " #p@r@-aop@-P@Pf'pC-4M`p8K?0S,0APT( 0S 0s S$Q0 0$1 0(1@0008 0$Ѝv$@T4Ѝ\5m#p@-@`PLwD@00000 81'Ppp@AAp@-P@01Sᵨ8 p@ R $ R $ p0wnA@-,0D ,@ 04/01/@-,D@0\ 0@/A-pᱨP0AT <1S 0,03/000XT0D 1 01_Ѝ}AA=AnAp@- 0PQ@ `M ` 8NU < 0 C܍p AnAG-p`@ V@0s5 S20s/ PPE_oRP! Q P P Q PP Q PP Q PPY U @`FPY P 9/P@-@ӧ0@00/X0 @-(/nA@-§<1 S@-(0 `MS$A@(0X001T PЍX L D ARF:@ PA,,00@@D  BD H0H0L {M wN sO oL0P  Bi(0  c _(000Q?0@  Q T RC G NX00X00S 0,p P 5/PP H 0 D  pP 05/PP 0  2/$¦,KoA|oAp@-(0 `SX@ 01S 0S P X00X001S 0H  2/ 0,  2/p@X  D  BQ:@ Q0KoAA-pX0@`P  h0 p 07/P  0L0Q0CL  QL P R*P0ЍoAp@-X0@ P d00p@/oA@-pX0@P` \ST0S L3  0p p07/PT$*T ЍoApA4pAp@-X0@P 81T0S( 0 $ 2/0T0pPpApAO-p`@M 0SP㸐 0S5 0  P 5/PP,7P UPU0E U0#3S\ P  00;/PP$  0S@XЍ 0 @ 2/$p0S 0 S @X 0  @ 2/, 0  2/$ppAA-@`(Pp 0S `p0S 0 ` 2/,p 0 ` 2/$pG-`p(@ 0SPp㸀0S%  0   P 05/PP,p 0!PP$p 0S$4@WЍ0S$4 0S ,0G'T 0,@  2/A-@P$(`4p 0SP,p0S 0  2/PPp@-@P`Up6/PP Q(Pp@s@-@@N@-@h0 01 0!0!!01(!10!0(1A-@PUP@`PPqO-0p"SMSS ЍD/0C@ S00S0S00001I0S000S 0 0,P5/1 0 0,P5/P`1 0 00,9/P V 1BP0 !0011P0`!BP001UV0S 0 0,P5/ 0P 0,`6/1TQ 0 0,P5/ 0P 0,`6/1TQk0Sh 1S& 0s01! 0 0,P5/1T 0 0a,P5/1SG 0SD0SA0S S<P: 0 0,P5/PPP 0pRP3U_&W\p"P  0 0,P5/\ 0 00,9/P0S 0 0,P5/` Q0`PP S:1S 1 0 0,8/11 0 00,9/! 0V1 01 0 000,9/!0U100C/ኔ    0 0,P5/aPV@? 0 Sb CFC/`Შ011B/X0`1 aP 0 0,P5/P000@000 000000 0 00,8/00000P 0,   ,03/P:8   ,03/PX0C/OX [0S 0 00,8/0S0PPSPPP0S2 0S 0 00,8/0 000@0 00 8 000 ,8/00S 0Y0P00 0 RU 0S3 0S 0 00,8/0=@0@000 0<0 0 00,9/ 0 00,8/ᴚP0`0  R S @S7 0 00,8/00S0_1>  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/P긇>  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( 8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0U P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0p`X d,0B"3/P @ԡ@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 00ԇ>pA@-@M.  010K/0  $!(! 111 1014!, p1>  ލP{#A-Pϝ  Q'R R@依`0S峝(1$!0aVKO0S奝 AlhhմV XP`V叝 ,$#0 S(0  @T`\0SrX0 j0S S||bt_ 0SP0S XWp0S\Q 4M0K0 F0 A0 <0 70 20  -0@ (0 #0  0  0  0  p AwXp 0S<Q 0(A$pQ 0AQ ,ppApApAYAAYA%sAqAqA}A A ZA> P;P8 Q5 P2W10S bv R(qpW hV @h ¡0041@041CG C/峡0Bp Y `W ,F$pBW>cLsAA}A A 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q 2`P 1S P'P(㕀 0St>p@-@ 0P` P@HTppA-`PX4S@ @TtV@Pp@-0@@ ThPPP T[PP PT0P4p蠂%@-@TPTu0P4C-@Q4MT4P 0p`  8/P 4ЍT4  0   p  09/@PE |lPT4 0  2/0 , 9/@ TT4 0  2/sAsAA-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-MpL@\p PT P <ЍO 0(0  RC> 0800P 5/P  @ 8$D0<4>`P2嬢42 4HVG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4-}0Py P\0 PR0X4ЍA#sAsAT#|%#tA%%%%%h%%%%%X%%(%%,%М%%2tAQtA 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0괡>A-`p!BT PR@P=p@-b@0 P PpPP  0 22D 0(1S5Q  "P%LwAb@-@ 0 2p@-`Pә@P  P p@ 0t(0 PP p@0T1x0p0p0L1l0P1凙`VZP0P PP@z0T102p@p#sA #D# A%<%%A 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`&|4S@ PF@Ptp@- 0 R\0S 0 000P00 Ѝ>p@-P00S PpU@t 0  twPP xQ t0x4< 0pPxxQ txTPle%O-M`pʘ@C` tP  P ЍO 0A(P0000h0 00S0404РE>L00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 ̪#EcwA#QtAwA 0R R ?R//p@-Z1S @pPp$Q p0@-01 0P ЍP>p@-@T=X PS0@  ``\6/0  OT-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 NT=X \S`PA0@  5/p@0  NxAO-@M`V 0 SV0 SV0 S  PV Z @00 0 0R5Ѝ0S0`pX d0`\h0Pl0UtT=S3: 8t #8;/T=X \S< x 0`;/X=p`T=S00> 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPpזU@a 0L#^P$  RPP $x0$=1S 0"P( P0 "NT-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PUKS  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0Bߍ{PU$Q $]Ts%z?xA#ExA>G-`@Phc@ X P G@ 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}单 0\ R`l0P x G P %01hA#sA\#SAxAA/ 0P/Q/c@-@v R`0S0`Qd\0@-@bT0$0-p@-@PH2Sp$0SpH20$w(\003/$2@-@$-003/$@eݱA-`P4@` p00%00pG:W0$01` E``2S`0$03/H0S <⍵A,܀*zA1zAAl?;zAMzA#^zAc̻##A-@P0S}8$  0H"$L܀$ b@a}fcd(cUtUUĈc#|#@-@#  @\ ddH0 60S @-@, (0 x@L 0@/cdcp@-@X & R@@P A@ 000S R @ * pdcdp@-@TT0 60SP<0p@8h0 ,P   ppp?ddp@-\@ RPP Q.5S0(0(0n00C0ppccp@-@MP+] /0PP0 00cS0`0e@QN@P@,  x000S JtDL ЍpcddA-P`ሒ0@S"%0S 00@0$@-0@0$0 00@0$@-@@p@-@P0P03/0p@0 Ip@-@P0P03/0p@0 < P00/000/P0S00/00/P0S 0S8020////-0 $ B^\\^\^p 0 /G-P@0弑4p X0IbS 0 $0SP0$0W$0\0S000 0 0  1P" P"0,0$0S 0R*10$0P003/0S PZ kP  /(0S V0@@0$(0$ 3/V 00$@`D oob` W 000$0 0S0SGBXX0S pp@-@DP$qP 00$0S0$0003/l$p@A-p 000 ,`lPPP0 @$2100 P 00 $0(P.X0  0  Ѝ@-2>  0 Ѝ@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ@-8 "  Ѝ@- <  0 Ѝ@-<  0 Ѝ@-MpP`J@P   ,0 ` P00 0 Ѝ! @-`P1@P  00 00 00 000~Ѝp@-`P@P  n (0P00 0 fЍp! A-`pP@P  T80 p `00 00 0(00IЍ! A-`pP@P  780 p `00 00 0(00,Ѝ@-  ! Ѝ"7@-P@P Ѝ00  $0CQ RR!Q Q @-pP`@P@ Ѝ0P @ 0P ݥ0 @P ԥ00A-`PL,( p0@0 `OT Ѝ< @-,00@ b@P@Ec{A{A@@-@@0 4@- CRS 44ڽ0SR ?|A|A8|A@-@P 000@-@PP0S0S @-@0P 0S @7@-P @ P 0St 0S Ѝ0s@-PSЍp@` @ P P 0S St 0SЍp0  R0 0S00/ SA-`p P 0 @P @@@-0@0$:0 !0@0$qO-@KI0HDpF`B0 80E0PtG0@AdIl R \ Al  $0Q \/ 3l /l +l *l #l "l lt R l lx R Xlp R D ЍOl Ѝ]|AY|Ae|Aq|An|ABw|A}|A|A|A|A|A00S/bc|AQ @-@( /|A|A|AO-P0tMp@ `]0PW E0DF IG0T@H$H0L 刱4PP0<`!`@hPlp `E W ;tЍd !R8 "!00SA X00X0\0000`0000d0000D00  r @R( Sr$ (nx0 00 $0000< 0,v P  0 0QdP!hh0W|A\5d#@-@\MDT0E0DFČG0I`H0p4@000@8 HA00LB4 <P r  "xd00\0\ 4$00p(ЍzvPP 㯣dP`phps\Ѝ\5|A#@-BP 00000 000A-`P`p)@P   03/@10 c}AG-hP`p@P @P L@0 4/@@0 ϻc}AP0 /@- ?A4d@-@Jt -Kx )Lp @$G-@P` $(P0Q0p0& 0 JP 0 KP0SD0E $}0SGEF0D 4$GtQ YxQ  Y@-00B4 g Ѝ}AG-`P @-0p 0 G0F $ E D040 0DU@ A0` 0@09@?0>HHI0t .P H/0@@0H @0H( 00ЍG螢$}A<}AJ}AQ}Ap@-`Q@ Pp ㎢P $ ᄢ pA|Ap@-P` u@ pn0I"RP Q 00#1-, $ ,# n=cEcMb[}A A-p 0` P0 >@P 2 @P0 0X@Ѝ @#@-@0P 40`CV^^p`W ^^PU\@p@-P04@Pp0S0 p0SSQ QS Up DQp@-@00$!srPP00$Gpp@-@00$0 0P 0P!00$2p@-0@0$0 !0@0$"p@-@00$0 rsP P0 0 00$ p@-@00$0 0S00  0@$O-p8@PU`P. Z P cPP 0$0 \=BP 00P@P R 呹U @R^ R^[ 0 R   R,    00@^(4@  ^ "$ D?b}A}A}A}AO-MP,MUPPqPU FP7@sP0`x',ЍO'8A8rP3U8۠P0֠TP 0Ϡ080P0T0 007 PPZ Ṡ`p 0 pPP b`V0  7ᥠVP 0ᝠT0S0!4R P` 00CS`( PQU|`0 `P %[l`0S0!4R T`0 PRY 0L剃 0 P8  嗸 P0P#30 0PP[)  7Pp80弇 08P 2 0tB 08* P 08pU Hx8 080Pd8h8R[[,Ѝ}A}A@-`QPp@MЍ@ 5P 0S Ѝ@M0Sp@-`0P$@0s S@@T00 @0$Npp@-P@0$00C00p@$?G-$ p`PPP-0婟000@0PP4P8`p $ $ @04A04B04 04 0S004 04``V5 bP0`V3\0S  0N΅ P P R'4ЍcpQ  1YSd0P J. pf R 0೤``0X*V`$\ @!< R 1 0$    AQ     A-@P 80SP0P`2PP 0TP 0`Q d0`0tP ۜxP ֜pP ќA͜8$8rPU8ᾜC- @PMT p``0S`00$ 0 1  0$$LЍd0Y   R GoP  4дQ $˴ȴ``0S~A|A~AA-pXPQ0P` AT \Q ` R `PU0 X  AT  R- 0 \ 0$ 0 4D\\\\\\ \? @-^PPG 7<0 3/40 3/ ᾛ,㻛+P Q$' P$P!: P:  PQ(0(0(0$X00C080@  o00 0PЍ@t80X@  o00 0$cP PH< 9Tpp@0,0Spp@/AG-@MpD` P:PB3S?0EUS;U%  P  U RP&SU# 0P0200 Ѝ 0P0 S*40$03/ 2A(#$HAA-PD@pt3S AP 0U(`0C 0  U U wU0S0A/i=}P  ᜰUmAp@-@D\"P <0Sp@8PU PpA-pP`7z@P0 0A/A-pP`#z@~P0 0A/A-P?㲖0`D20@2bRT ?0D0ЍVe@-PxU-`D@(h`003pccpc Ѝ00S0  S/8cO-`x\0SnP U\0 E2#<@T `0S0 Pd Qh 0 Bh `QhpWddp`pꞀAp@-qxP@V0/0pG-pax0\`V3 @ P0Z/|  DP 0S0EH 0\ $P (۔ P (֔P (є⟦ 0S P O-\0$MP 0.0S 0`S 000/@/0+T$$00 dP A { v@\0 D2#<Q 0 @ 0 0S@p0 \D⚃#88 $ !R!  0㚃#<P \0S 03/ 00#"0 0)Pu03 2pt 1 0  0@ 070S  p0㚃#7 R7+ e 0  p  0  p@     [0㚃#< 0㚃#<0S  @  6  K P#  @ 0 0S_ 0( ,0R PN $x|( -hYL-0SC$Ѝ0㚃#0p1 pW20    0<    p ppWp0GS  Q 0 @00 P  P( 0㓊(7<0b0-0̀AA A+AAAjARp@-@p@ ZRPp`( U:,PU 0 ,0$|( gp@ 0000PC-\Mp`v@PNb`P00p嫮 0S 0 CRS%5%5奮 pP 0S Nub]( 0rg 0S_ 00CS[l5$ $p07pp 0 0&pS  W   !R00.0700{%0' 2p103 *0"60#X02pSJ $4Q0$W040 rWB&$P (Ò P (徒P (幒X 0GHⱒ0\040 0 8 0/o20"S R 01 0"000 #0X !! R0R!0GH⁒d3\0@0 00CS R  BȬ. 0" 0C&0$C4'0( `P$ YP0S$YP 倭$P 00S tss(5(2 (- $g ( $f0,0001 0(0$00@0 0$P00S  0 CRS0 <@P6 78Qd}A^DQAD W0\0  P } 0W00S x0.0-00 8Pl\ЍALAAAA!AAA*:1B!BفAA)d.$A/A@AUApAAA3$AÂAAp@-@tP0 $\00$p@t`V 0p@-P`t@gPPP uP$P  0m0$0 #,3(pQ@-@ ά Q ɬAA 0S$0]S(0S/GS(0S 0SS@-t  /O-M`Pt@`0D<啬 (Y(,0@0D048< p 0 ᅬ 0 z P/ 5R0CS =&0i0 0 00 S 0s!0 z0PЍO P R0 R \ 4R0S S0CS  4  @CS \$S p  @4  00(t0 0S$0]S(0Sغ??cmLAD$|I$G$J$H$DJ$4K$\5;$y?vA@-@ P  0T T LOЍp H`R @ 0R0C 0`\埧 $04$00 0 Y 0 0S Hc0 3/ꛃARRG-`@P P(pu0@00X\40X0\0,ס 0G/000/000/A-`@ MP(pN0P PPXP<0S0<00S,Px Ѝ80S ̠PP 0001380<0S P0<0080剡UWΎ0H 0P1 00@ L0 PGq: P00PP#T @ PPP`0( 0 1000000P0TP T0SPPP 70P0LP XL/0L0H刎0H0<0PFTTPP@cC$ `p@-P@(`000P0S @0S D0P 0,D0 p@A-`@(P0D R P0,D0<0S0C,p<0 8X0< 3R800B<08ݠ000 h00 0AT0S PTTPP 0P0LP L0L0HH?@cC-p @R`00@ ЍP0 0v  0r@э@-00  ЍG-@ P0SP- (`P,0'4pWDy ፟P Pl03400@0% 000 PTP@4pCЍP@cO-@PP0MS: (p0-4`V,Dx)0400 @0<0X0@0\0008008#80T 0TPP UЍ8傧4`@X`\`,PPPlD$A0/@-p@p@-@PpP  $     p@L$@-0PQ@M 0Q 680Q 0Q 000P  uЍ `P`P <0 0 p,07/"pUDiU@nUc#|#$0 0!0 00 /@cdddʀ0$R/ -0^ "G P Q H0Q -1CQ0 /@-:10/ W@ WQ@-@ :04Sh=  LPh=0h=h=9h=0h=DZ$G- M`p P@&u 01 0SđS: 018#(!#( 0 R R0SS 0: 0@ T Ѝ@-o0 $2@-@oT0 04-A-@`oPz1DT" l=S kot h0 $P ^Gm@J8J0  kh= AHd@-:! Q \ \ !R0100  ЍO-Mp@oPp0@000000 0 0h]04嬦0 KP@P  d]d`سծ{P|T]PFme, 0 #P8`G0#` 0 X#P 0 8#P h=0h=h=0h= 0!  Ph= 0h=h=;"Ql0l=02$@Z00 0I2`1081 aaAaI|.@2 b04"0 ("!I0"^0$14Ѝ8 h0"Q+ P(Ssl0 h=0h=p:txl0Q`4P\p! Q \A僦 LЍO>S IU 0C#pTtXx\0T,P;@Q @t0 S 0t0x0 @d=S @p00t0 0x0`=t0d=l=Sd < \AA?Hd?Q$EcMbV$X,&AAApAQA8A@-@ 0 4PЍ: Q/@-<0DT 0 !0  !@c0@- ! 0 !7@-P@ uU H :(000U J(00C0 Ѝ0HdG-P@0pS` 0S团00h=0h=,2S h=0h=,2S0P #.P0C ,2 20q 00PX0PGHdA0/C-h=@`M 8! P(!14  "R. S>4h-<0.p XS ,h-PP Q 4rU h=`   0r,Rߍ ,h-: p $`  5UߍC=(?G-@P` ^pTT-0GR8`-!d=Q?:h= F %h=P<h= < h= h=0S/:!P 1r0 0@a0 GGP T< 030p 0S 030G?8?Ƚ?EcQ[$p@-@Z1Qp+ 0 /Hd0 -  /00Q/-0 /@-l 0 @-@lT00-A-P@`pP Vx`@P V@P @UA-PpZl,`@?00zwpP W0S   PP [10PSS U SG@-MpPl`@,P哣. 4` -:00000 0`P 000010040 0800S 3/00S 10S$0'0CS 0c4`8`(0S S0 ЍS PS0000010000C0S&611 0 B Rhh&!$ `V 0S 3/P<a`p0S 0R S 0Q+Qeo0000PЍ@^ 0 SR 00SRR`Q:4007<%0 0 %0  `P 0FS/k@ ? Ѝ@"0S80 080 0P  Ѝ@00 0P H00S 0P  x0 p W00`Su 0CS|000 0P  0P  0P  0P   0P   0P  P000 0P~  Pv00Sw 0CS|00Sp 0CSL2n1 (0RjRjlrP`i M000 t0PC  l0P;|  d0P3  \0P+  T0P#   L0P   D0P  <P 000 30P p #$!|\0R2 0 HPNPA˼Aؽ?? aBA1ADAAaA}AAAڅA?2AAAA@-@P p 0S$00CS (0SSPS@-M$@\ ( Ƞ,Ƞ 0)PЍ7@-0PS @ P P2 " 0  P   Ѝ0@ Ѝ0!@-`@V Pp1;T0P 00$0%`b0 P   Ѝ@ Ѝ@-@\ (8#800 mPЍO-P4`0U@DHp@B 0  ЍO/@N  0IJ <00D`@0000I?o2K3H0n00|0帐弰`PȀpP 0 0<P  ЍOa ЍcUSBCR@-@  0S   Ѝ@P x0BS00U  Ѝ@=000S 000 vP ЍS  In00 00S 0 $U U0Q 0 Ѝ@,0S &nU h H3`R@sp 0(帝0 0CS000000[00U R0 04  \[04]8^<SU0[025S0^0 B0A@ 840_ C <#$` #(#p@-0@0P@e10SZU - U p00 00P00p000p@- MPd0`@00@00 00`PV,00$ 0@`xT Ѝp$>$B !@-@威00p@- MPp0`<0h0@@00`08 000 PU000( 0@`KT Ѝpx$?=AT!P/p@-Ph@ƈ1 01  hp@ψp@-P@T0SpPT0`pp@s@-@P`TЍp@00S000 DЍpp@-0@( AR P0(00(0C40(pp00@-M@P0P Ѝ000  00  P0P0@-M@PP Ѝ000  00  P0P@-p0@ R 0 0>0LaP Ѝ ,0RP 0S ?!@-P`@0P  0 00,     `0Ѝp@A-p@`iP %(@ pc@P ({ pW< &("(A-`@pAPDP 0  00@@ 0 % (`-@P (E`V<Ѝ@&s@-P@` * |D0  R= 080#80C?o2S  cD03  Y R@0 D0  R= 080#80S0S @P @0  0L0 0nЍp@ p@-@ PPp PUct,@0~$  & ~@0  { p@啟A'G-`ဂMpc@`P匚T'1 <* 700H000(00 ,0L0d0TH` P@ $ P0P 5 ᾚЍ PP0 0>0]H0@00S 00S 10S 20S4ᛚ0P   0 SR0 R2R1PM`P l #h#Yeb\y!8X@9`0 $ ?A˼AA!AgABAyAA-pP`@P00P `0VP  #H    @- @ @G-@`v0P00f0SH L2H0L2? ЍGBT pTL2H@0L2'v  P @TЍ mP0 #  Q0"Z-.R0W30B00@p P/O-peMPa@;֙` ٙ0(00,00 0$02P @001 00 0P0@0@``  $0 PX,,0P P 0 S,010,0`00SP `  Y00S  `P eߍO1c0S 00S! 10S 10STP@ 0 Q0S0  S`S1  m 0$PA*080寍 9af`=0 |>U+eߍ P 8jPA˼A`?AAAÉAAAA7A@-@@0`A( @0CR@Pp0@?@0 ( (0f Ѝ@-1@00  4P  0S$@oЍ?@-Pp@@0` T@D T h善0 0 0 h Ѝ@蟄000  Ѝ @-8@0,00Q #^  P/0@-M@PP Ѝ000  00  P0Pp@-0P( 0CR@00(0 0(0 C40pp@-000 [P  Ѝ?@-@ P@0  0 P ` {Ѝ@Ap@-Ph`ho@P 0 0 0 i 0$ k0/ 0$  0$ m0/ 0$  0$ 0/ 0$ hp@@-p@P6T` 0$ R00@DR0S h΃0 0 0 h Ѝ@׃00 Ѝ@-0  f Ѝ@@@-P`_P@0˗p xΗ HP H Ѝ@u8100(00,00 0$0< P`@00 .PP  Ѝ@\p0Se8  P G_[0  Ѝ@0P `  0 SR0 R2R1PA˼AA?!AcAOAs@-`@P P (0  0` P Ѝp@@-@ `@p@-Pg`@ "P00P `FaVTP  ` $ # " pO-KP?@2GpP0 HL2H0L2 00Y HO SHbVL2H0L2p9!H00H0 YjP*!H0[0H0 00 `V@P/s@-P`^@\P W00X0008809{0\0Ѝp@Os@-(0P@ ?@@R@3: 0`0000( 0V  DvOЍp@-0#00 P  Ѝ8?@-00Q@00  0 Ѝ@-@0  0 Ѝ@-@P@0`0 c0 0 05 @ ЍpG-` MP ^@嘕3 =` |6C0(00`,002 00 IP ~]@ 001 00 5P j]@   k &P V]Xj   P0P q  0 SR0 R2R1`~C00H000 `P K8bW0 0X00y0\ T ЍGhA˼A?AA!AgAAъADA?A?AAOA]AO-`Mkpq@[5P005TPP HL2H0L2.%  % ЍO505HXWP    ((R  hP\  (bZ   PXL2H0L25 0500\008 #8`%@-@M`pT DP00000R !X0<BP h圀0 0 0 hЍ@襀000ЍP/@-000 P  Ѝ?p@-P0( R@0(;Pp0< `tM<pp@-@hY0 0 0 h@cs@-@P`TЍp@ D0 4  000TЍpC-(p@`PP W 8M ЍW@000000  @0PP0P0W0S@  M@- @0@PЍ@-0@ 0 0@PЍp@-PQ`00R@ R 0@BT@ l0R [0T TƐP00p Q?7 ?ABF@-0 0 0tЍ@-  0jЍ@-0 0 0`Ѝp@-@PpXL _Pp$y PUp@.'G-`r Mv[P@剓 ጓ 000(00 ,0<` P@ $ 00P l' Ѝ PP D 0 00004GV0@0{pS2P0S 00S 10S 20Si0P    R 0S0 ĵ1 ĥPR 0S2 ĵc0.080 P00$* ?A˼AAAgAċAgAA-Pn@pDP00P `1VTL (   &/.p@-PQ@T T |0@DT@ T0T Z0< <呏PpQ?7`?ABFG-p0@00PKzPHgPL2 0HL2P ЍGbV0L2V H XP  eP L2HP0L2s? 1  Y!  00 `Ѝ&*P/@-0$00 EP  Ѝ?G-@00`P@(p 0h 0&hPS@+<Oo0XB%XA  BWpS  `P&d%T`P 0 ( VT 0    @-( PO: ]0]Ec@-P@`p-P  0@0@DF  0p`@d Ѝs@-P`@P0@ D0FI T  "@@ @ AOCO R= 080#8S S S 0D P 4Ѝp@ɏ @LЍpAA-p`@4X@@P0 P@0 @00`0  @VЍ! C-p@MP`4Y@@0 @j0 0 0c0 h@\Y Tp@Ѝ`Foo0b0@  R`V00 A@- 40$a S00@60 PS!PZ `0P% Q40 PPS 00 D 0P0 pS4  0P0 @S Ѝ@"Ec"@-"P@5@-@h|0 0 0 h@|O-M@ pP` @` ( RЍO 0@ BD0P40#0 @R03`1:0D00`B @0VPЍj& R000Ƞ40# 0^ @@R::P ,ˠ 0 0 Q0  Q0`B @D@0C-`M0@000P   T_PP HsЍ0H00mPL2 0L2HI000 0 AbVp0L2pV H4U000000 * cP L2H0L200K00Q - 2W0A00`Pp AO-`K,MpWP L   000 (00` P,0 $ YP `ሏ,Ѝ0 0$0D0 @0 DP~@0p< 0 0S;9@00C2@0S<qK000 P^L0?SSK0?SP4@0@p pd0 p0 L00P010 $p봡9Z3 9 p X000P    0B?o 2 00S0@^00S 10S1R00S2R5pD @0pB0 S- g 10p20 S W 0p"0 S@  G10p dpp0 p \0 *)@ 2Zpl$0 0 )@ " 0 p0 p)@p0 p H0 p 0 lp  0p <8000 PI hER00셟 p0 pS괅 0p0 S p l<00 Sy 00p~0 S@i <0pZRp Ԕ 0p嶡e0 SP 0  0pT 0 00S> x D0pC0 S@. h  0p30 S X XA40 |0 4w40 14 0l0 4g&B 0 Dp( 140pS+0   %0 p< H0 p 0 p(0p  00 0 l  H0pp  40 2 p0Sq0  0p1 0S|0 Pp1:040 4P P3011pW0H#40H40 0p@0 0 040J0@0 0 2@0 0  @0 <00ZwH  xIP lk?A˼AA!A A  ?OAEcVUUU"`MA`6A U0nA@-PpS@UPi@`800`Y0 H0 ` I0 `J0 E`"@0 !nt40 0 0 < <  K"40 0 0 < < @0 00 !;@00 ?  ?f?P P Ѝ0 4J T@0*@ 1L  >;5@0:@005@0:a.*aUP/@-000 ~P  Ѝ?0@-MP@PX0 00 A1P  P0 偊Ѝ0?AG-P` @P 0   ypW@-@h x0 0 0 h@xG-P`@UpPxx T0l!l@ЍG0 $0( ?( 0$!(@007c *0J8#8 S 0  0S90Q"' Q/o"3 QRA000@ P0@  0*   L0 0S8#8@TPЍRB0 0??AAόA@-@P @A-Pp0(`0CV ,@  @00Ve0!Ѝ1V04@00T@3 S0!H00 00$#$S  0!S S A/o,0"<,& R!0%0P 00 0($(̠ ((   $($L @0 0 0%R5 9 P  0 0@ņņ3@ @?Ap@-MP@`iPP0 00 `A1P PI0 8Ѝp@&?AC-p@``PIPE$     0 PP   0 P D HP Ѝ,UX (4?A A@-@@  `p0PP 0S SL0  Ѝ@ ЍO-@p@pP "p&fI1 @6P` 嫈<`@0  NV Ѝ!@F; 0@1`P $DXE? AA@-@@@ @Ѝ0 P@oO-0` 0?   `P `3Y 0 p ` pW 0 0S  S  +    0?   `BP 0S  8@0 {'@0z q+BjB @0``_!@0``T!@0 bPF!?!*@0 LP0&u)@088"8 #80$ 8ᝈ@0% /P8`J0 PY P 80 9 0: 0; 0< 0= 0 P GF`&8 $& & 08`  0 0! }0 20Z&0 P809 0: 0; 0< 0= 0 809 0: 0; 0< 0= 0 A˼AX?:A[AAA? AÍAAA2A*AލAAC-@4`Y @P0 @pP  @ Ѝx0#-5  0 @P , 4<@ I\("(? AAA-4X@ p0 Pj`P | |Ѝ I\0#-5  {0 `NP  ą<? AAp@-@APA ^A@< ?( AQAA p@I?p@-@@0P``` 1 ++U **p@ 0@-00Q 6 0Q ui p@-@PPp@00SD0  R= 080#8S0!23 ^mPp@0# 0 0SD0  R= 080#80C?o2S+ *+D0V ` [P R@  . 0 0S0  S(  p@CH@p@-@%0 00 P4 T8 G, FQ.pO-@PUM`pPPFB/H?@ ?@0㰀`1_HsPP1 \L20L2\H|TH`@0  ^ Zp  U W0!0$0%PS !囄 BUߍ` 041H0 0b[V4 8!0H PH$ $ p` ,0  (0!0$0P pW? AAP/@-0$00 P  Ѝ?p@-Ph@q1 01  hp@qs@-`P@0   Č \@D\0 Ѝp@ L(00"(Ѝpp@-0@( ARP0( ;R< b>< B4 0ppp@-P@Pp@0pD0  R= 080#8Spp@A-@`pPP 0  0PpP@P  P>ЍG-P r M>M`@嶄Q[ T a000(00 ,0<P `@ $ 00P f t Ѝ ⵿`P ZL  000$G000@0C0p3200S 00S 10S 20SĄ00P    R 0S0 ĵ1 ĥ`R 0S2 ĵ0208 0b P<@000$ ?A˼AAAgAċAgA07@-@P0 P Ѝ00 >Ps@-`@P P  =  0` P 3Ѝpp@-@PPp   _Pp PUp@܈'@-@P`pP 0P0 ЍU  @    0  00@-@pP`P =  0p`ѿ Ѝs@-`@w 0P iQ0 a qZ0  iLP% N ]F U> M6 FU ?PЍp(  PP @-@P`p+T@  @ $0  p     ЍC-@PPs@0     ЍCP HuL2H0L2 0 009H_b pV L2H0L2 0  *= > SY  C 00 `V  VP L2H0L2j   Ѝ$0 0!0 00 /@cddd-0 ,0/-0\ /@-00l@ 4/Ѝ@-0 4@4/-0d /A-Pp@`T d08/< S   S Co    / 0 /c0~  0~  $@- ? 7Ⱥcp@-t0P#0\?70@ 0 0$1(10  000 pp@Ⱥchp@- T?P@7T1S `mJP 0 p@0/pȺchp@- T?P@7T1S `OJP 0 p@ 0/pȺchp@- T?P@7T1S `1JP 0 p@40/pȺcA-(0P#0?q7T1S@JP0/`6PhE`F $a0tp000-191910919!03/0 Q$1UP!`0 !6/$10C$1 10 1A#Ⱥc@-@ @ȍe@-@ P`  I8 4U,00VH0xЍpA!AA0110   @-<0DT 0 !v0  !@c0@- !g 0 !G-H1@pT`(A- $0S)h0L3/# h03/h0P03/00S "YZ 0 00++R4S0000 1 PtPh0L\3/ PUl0  83/00 (P05/ЍGcTdcXmdIA-@p`h P4:0000p`h0$0Pl00L p0AkND$h$$p?p@-@P0d %S 050pp@-@`P0d &S 0U60pU 0h00l00p0p $$$EA B/o P" RA-@pP* @& %3"3P_P`P 0 9?9?00??C S0cVS@@@-@l0D 3/ l003/h0D3/Ph003/8-|M 0V|Ѝp@-D1@S@00tP919!03/03/D1SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p091D1S91P0 0CS910919!03/610616!0p@/A-P`H0pH@@ CP1S T!R 3/0T10@ 0 0 0L`GP 0\E'0WEP׶SP P < "0 4"~pTdXmd? 60D31Q0@   D91/p@-@x`tP03/D1 0CSp03/ 0 3/p@d`V 03/Pp@-@tPD!0R@  3/D1S 03/0 03/=!03/0  03/=!0 3/D1Se;11S/6!Q0061210/-!R $!$10(!21//0| 00Q  Q  BQ6!0 210/-!R $!$10(!21/6! 6!6!061 ltG-@ |?p(,3PP` T1S`ЍcFP  0$` 06/p` 0  6p`ܑ TE 1TV 1T0CT 1 C T 1?A3c0Ⱥc\t]t@{t [e`?1@Xt@1(@jt@mt1(Mb?1S/,!t       000 l0/p@-@P,10,1@1  ``0d 0 `0d 0D!@0 0910BRS91091R91@09109!t3/P1Sp3/0T1pp@- ?`2P0@ @003/T1S [EP 0@0SpȺcG-`0p#0?2T1S@9EP D(pZ  SPP⨏ZȀ F0P * 61p061 Y ( A6p61P061 $0( S S00@ 0990`1S@1Sp8@-80OτB 003A1+ \R? 6!@  6! i R6!@ =!@!051( `1RgS61>!0gD!0ETPR;1v011,1 ,10,1,1 ,10,1D!0R3003/08v/!Rs /1?oR6!=!@ 6!6!6!  S61>!061$0 0!1B8ȺccO-0 pLM?1@P`LЍ0  1S $DP P0 `pP 0oP0 n0`@0Sp̠L1S 3/P o{`<0T1x`0d 0h0S  В0 ` dQShP0 h00&091@1 91091D1S91P0 0CS91091t9! 03/0 3/3崼V? 4 !0@=K,!D0t0 D0@00$ )$ $ ($ $06$00`1C|1810<1l1D1p1 1181 01,10,1 `P0  03/`P3 0@00S-*eSw Rh00SZ=9 R = ?A3c2#d S 0"#!0 "#1R 3~?4 # MȺccAMb[eTd+cEcr@p@-0 P"6 0?x0T1Sp@CP ?1S WU,1 ,10 Tp ,10,1S,1 ,10,10Ⱥcp@-@P )@pȍeO-T!R BP 1!PR 1! A(0q 01pBR0  R<" 0"  @V`0@S @DWb A!  BR!V:,!K ,! ,!9! 9!D!R:9! 9!90@`FSAV    R<1! 0 03/p,! ,! ,!0@`S @D` BR9!@t4/,! ,! ,! 0!R p 0q3a 4A4qA!@ 0 2/@!  /! /!.!R .! $   h0A ЍO ЍcEcX$0S/&O-T1S @BP tPG03/0`S C ЍD1 SPf03/c8!03/03/`D1 S 0S @0V 3/1q0 R 03/ Q  $ P\ˠˠ \ Q  D!R0 ,!Le `V03/03/`j0Sf0S`Vgy3/0A  3/8!0 3/;!03/6he#::d`h>0 % < $00v0[* PX>00000$00  P Jv00L1S0T10H Q   4cЍ010xd00@010`d00z010Hd00s010 0003/dg010 0003/c[,!Pt0 4`x6/ !`R016/cA0 006/lc9@010 : 0003/ < @010;0a>03/ 0p3/ 03/03/P0,,0 3/03/0P 01 03/1S a Sa0 3/1@S` 03/ru QA܏AAATdXmdA'c? %WA2AFAc%%$0$P$?0A<%WAcAsA}AAA*AAAA+AAAFAA AOALA%0@-@PM0  0 00 Ѝ0p@-HP0S p`@P 0ST00pTd@-<0 0 t3/p@-<@tP 03/03/p@-<@[G-p@ `APCQR zU010! A-P@` 0$ pE\:q X0 A\ ^G- P$`(p,00 N\:q AY Y@0 G V @ AT/C-@P@@0$M,)c 0`ԍЍhcP p@-PH0 & @4) P t1  0p@phc@-@xPt`$0M\p|)P t1 0040 000p`00$ЍhcG-p0P 6 0`0W)x0@U  Z40 0 0迎Ѝ0 00:/p hcvd@-@( $0$$"6 0+)@6hc@-@`Pp<<0$M()(0 00XЍhc@-@dP`p$0MH`(P t1 (0 00Ѝhc0@-P$0M 0 0 Ѝ0 % %@-(0 0600ֵЍ % %@-@; 1R0@-80( 4@"6 0 ($p@߶hcA-pP`@e;^ T 0pA/@-S;@s@-P`L;AT 0( `4/@P qЍpvdwA@-o/@-p@-);@R_t1qPEcAAA-M`pЀ:1S@ @P !?P0P P+001 $P3/@P @ ЍA-pP:T!t1Q<S qS#P@RoᓳT!t1Q< S 13/PPT10T1S q#Pṳ꿐AA-@pQ (MR`gSht1 ! R0ót1 pӊX"qC1]S8Ì1\1S `1S X1SEB9p0 # *6p0 #**6p0@ #*5p0 3 #?0\!#b`1?+p1#X5X1%  /0#!0$+4l1t1h!@040LC /0#!  0M E!1 0`10\10X1?rQ 1Q ,rQ 'r%r#r8  + EP"1(0`1!,0\100X1401L01P0QE 0X0X X PHq@p(ЍA%(ЍܐA?TOAOALA+BA!% "%`"%Ax!%p@-P@RoᵲQpp@-tA@ P0 B@Pp "%t1/G-R@ᗲ`PST1S :hP nIJ1'>>>`e9P1QY 0 6`0 6VPBBL䚷gGSEcA$?P?p@-@R_<MT1!0CST1ShႲp@Xp@{0S$000S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0 P mDЍ0A A?!AA-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 tp9<l=D=S?u  80 ,m9l=hml]衆FAcAO-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P D6pT-X=\R6 l 0;/ 0P4xVA@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+tXT-X=\R0P  5/x0PX0 `o<T=X \S4 h `08/ 0 o蠆AБA000 ͓0\SЦ㯦Ip@-Ph@[1 01  hp@[G-@}`Jᤰ1吀011S #S3P11011S (fPP 10CS1fP@cp@-@mPv 10CS11fp@詰=  -0=X T=\`S4 0h /D A-@P`}X= 0\8/  D=SspW.o<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/Ap@-]p@1-P Xn= S-<<l=0=*0>03p A? A 0!< 04 0 (   !/@cdddO-`@P0ȠY p3 ⓼ Lk ՖP U '0 0 @ T0 Ѝ;A\ P/0 !8 00 (  , !/@cdddp@-@P T[9S 9S 404 0@a 0 (p@/%EcgfffD4%D=S/p@-@=P0C==0CS=>3;3p@hBA-=PS`p @PVD=S@ 0r &=@S蠆A-@p !P`P  0P Q- 0T  \nЍ0A S  ,m 0  pAA@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  ^0d 9S 0Q Q   Ѝ0  D?G-0Q@pP0MQ }0ЍQ u 4=3/|7S (h70?0?h70?|7S 0 0@a 0 (;|7S H/ox"᲍"0 \%  R # y:0/^q p:B˒AEcgfffD4%A@-`M MP@P#EP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q X€P2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp 90SSp E /  ("( E s@=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 009H0QN0 pN0N0%*:iFA-όp` 0P@rP 0 `jP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S) S S@@S@@n R 3 0hhh \@Ѝp@ S S@ S@S@@@Ѝp?AO-@lM@=S D=Sd?`< ,0$=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 06 p 0 P 4 0 03/039Sb.030@]  4aP303TsW ?9SBP~U ;PU 0S000000C0lo Z0(P 0 S30 03/?pPW2 0 > t ěPP\"(0傿) 0Rd-! "D\ʔG  0 D9Sㆍ P0S ` P 0!:> *00! 420a08/ᠾ(0"0D100 0$00KC195 S) 10170< :0V(0 501=0,0P(  0\!Xrj0d=  P 0 H0 0YXZ Z!0  b 0   0 PoD10=   =0C== S-)0j>0>pe?Ap@-0=@S 3/`D]U'n PP `V|jpT=X \S2 d 0``6/T=X \S4 h ``(06/ P N7AC-CdMpL 3` <3#`0 dЍP۪ RU`@ =0D?o2P0S Pᙄ  %7V00P`@UHPDH3@<30G-MMpG@ l$zPPnW`T$A0Vk  V7* V  V @-R ~u$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  60 S0 ۍЍ \ R\P@-R 6  -~6 P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!s0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0SP Pl P9S9  09b pPP [@ VF x9i*F%?- S/@-@pP`,M ! @5"0 D,ЍC-3@@DM > H=S  CR})9 K L)"" CPP> <PP@ R![0 l U C5@PU0@0 `P3@ > Ud=;d=DЍSP-1R  >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#<@$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> >P=0 .:^^XW3XR=3 ,=3/@]GO-@P@MX,=3/`P0@= N/bd>?oH-2R0S 9l&89d=0d=9S00`P  ?8< ?2989H-R%9" ;Sږo"#}> p ;CV("( ;t0} 0d40 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332 T=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  - 3@Q SUH=S 0 `Ѝ  H=S ?  00C0S0020ӕ Q1ڮ۾=-  P  Pe `DeT-X \R0 ` 003/ aj1Ye<`T-X \R" D 003/T=X \S4 0h `9/= [0=PS 0CS>02tobp@>S 0CS>02p@TH=S >S ꄓAC-PpMG-P@ `@P KЍ1Y0CYD1Ye 1Y 9 - 09 |94P@4 =#@=S M\1Y7 1Y. 2@P#@= S7 9S    @u S 4 r4P@3@ @V0 @0 0X@P4P@3@ UH=S@2iii9iO-@=@SdM ,P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0FP 0D+Ded  T-X=`R" D 0p\7/=-0C==0=1 i& T-X R$ H 00\3/00` (0 P㖯) 0\*T)d= 0.^3 ;3@& T-X R$ H 00\3/<0 0` 0 P▯= 0)d= 0.53 ;3 T-X=\R  0P5/` 0p`10)S { S  BS T=X \S=4 8h `P#85/= j3  d=0S "P !0=00 S0#( 0=T=X S2 0d ` 2 9S8t(8W9Sp02"'`P' W0 .00< p0pQp(p320@@00` P! (Xǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК 6P 3 "*8S00C89 ᪋J 0ecX,,-`@7_ 8P 0/Ţ)` V0%a ~ pQp  70H(མ=[)08%Xb= -JZ%(b=0= 0F&>=~)0 S$bᨾPp bW _ _ _ T⼄ተ _Vp_l_ )W n`` pQ 0 /pp0G'བྷ=[)0#yb~= -JZl#lb=0= ᐊ0H(>=nf S0 0 012P#_0CSy0d=0d=9S9Sm `43/_cd=0d=_H=S >Sl"PS 0>P9SMd=09`S 4Q`PEUP#L뎄 U >^pP>P"N 0$ 0 0$ p-N&00 02` S08#82́ 000H-Q0R RH RI a  0> hGP``:g>  L0>YP 1>#F&V   01  ?& '/22?2 ?"LP0C.>2>2?5?# R #./D2 ?A(?3?e?AAΓAAc8dAA'AHA\AAA?AO- @$M;P( ^ $Ѝ] nc)WT=`X S2 d `P0\5/T=X \S4 h `Pl85/0D=,P0D=T_}0 0TP 4PXA  .?^0p 00 pp)0^H}0wQ R)%^0SH=10S"t^0H=0 000X0 0d1!42# 0L= ^( 0(=w p]0H=0dp0 0 1!ᬆ2# 0H-P=R0&SS+ 000  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=(H=S% S% ]H=帥帕S L}d d :9"a0@gt]Pd   :9ȏ"a@h 00{]b( - )+5),|04p@04\r0404043099!= 0 YP `:0㠠 0I10S S2 ԊO베YH0D 8PG0  SBQQ Q"< 1?0:H=S0 d=  0 P0 d0מ0d= d-H-R' R RB d-P#Qb?d= p#Qژ0d=`3)Q8<9 9<9< (S:S_/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0` 0 ~Pe 0SbڴyX ->2 t= 2(x=6=⾀ᰀᩤO/44=4!8=141:1:141=1=1=1 =ER@p1X 0>9/  >pX1a  8v>p0T8%)%)%*%\O%e0NƕA<=S. A-pD}@PT`CMᯠ]`CPqTVqW "d۟hU( (}aU/@-@&T⅞-@=S> p@-@&P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002 ˛`4pI$: f0@000w%u%4%xv% w% y%܉%`%A@-@4S@/G-3PA@,p0 <300 U SH&bVH^3<3㋪> - 2X>00`V  /P 3<300 UHG;O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S !?%%@%d%{%AA%,%%(%p@-@P):pp@-}@4P P]p@-DA-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0T03 \P05/2 ,P5/2P,` 6/ `P P@U! P P03\` &N6/0 ԫ`xp0 `VAHP$P@ 4P0P,P#PŘAAAt%ht%? AA# AO-P \h ( ` ,@,4/ R@ WdW0 0 ,P5/0D(0@0O-p\h@R`C$x102c000 0Z PPP Ѝ00$10P t0S 3/0 \$8/ W ,0,3/" t0S 3/0 \$9/ W ,0,3/U d0@ -PU PEc)A\0O- 0Q0l5ph`  p@^ |0 3/}NW0 ,p7/p +40\p87/   hpP l0 [ $0\ 8/0 ,P,5/t0S  3/0 \p$7/ W0 ,p,7/t0pS  3/0 $\;/ V ,0,3/I YʠWWppPPpgP t0S  3/0\p $7/0\p 7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/0P ,p 7/P P t0S  3/0\p $7/0\p 7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/P0\p  7/0 ,p7/0P ,p 7/P Yp ЍW;6 t0S  3/_0 2$\ 0 %t!@-@40Q !@\0@00A-`#P@0S P 0q@P rP"Pp@-P@#p@p@-0`@hPP 0 \00 ,@,4/pt*P 0 0 0 0h0 03/P 00 0pp@-@P.+p@0,D%G-P 10!Up0 0$C! $C1`(,+T 0 S0 (ЍG0 PЍ"PP  0 P  0$LPUPEcMbAO-@MphP*l"`P ߍO*~P% \0W%p00,$,0"Z:@<0 R80S@p<0$Rt*Q80SOʅߍI"80S<0Qt0S 3/0 \p$7/ Q ,0,3/p<00St0S 3/0 \$9/ Q ,0,3/<0 R@ 8 R4S@0" '0r0SI*<00  D*<0S( 0 B'P 3*0"&.* < /'P  *<00 Rp    *`mt0S 3/_02 \$0:/ QX0\ :/0\ :/0 ,:/XP<000 ,:/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 0D3<3$Ѝ 4à@  P ^8pP pP#8 NMbEcȲ%A-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`a' 00 0&PP 0S  0  0` $q08 #U P 0,T! p@ 1A\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#10/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@@$0PL py Ѝ?@-P`p@s@$0PL pϋ Ѝ?p@-@P0 \`6/M 0 \`6/MU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&x 0!d!0    !0G@cdddEc7@-@ &^E0202020 DR2|0@4S0000 2S " " Ѝ0@?%%%%ht%t%@-@ &@蜉@-&Pp@-@P&*2020p@-@4@SS& 0@Ec@-@&@)/@-00   Ѝ?@-@8Đ<0\ @/@-84< ,@4/@-00 僊 Ѝ?G-p@d尐PV㬀ʀ 0! $ 0    !&ⷉ 0!d!0    !0GW@cdddEc7@-@&^ 0202x02p0p DR2h0X0000 A2S " c" Ѝ0@胠%%$% %ht%t%@-@' &@@-&DPp@-@P&n2020p@-@&3 0@Ec@-@&@q/p@-@DP0`,0Sp$]>//p@-@Q P`00T0 0 00DPSʁ@p0C0Q/ P /P  /C-.04@5 01D`00pP$M P/0. $4"4H#8#8SA # SS $#0CS0S1 #S- CS" BS(  S @$@R$Ѝ S @q"S ʤ"S ST00 S x"S(T(@#h 4T90{@TT D" 8C8Sm  SF  BSb  S  S0ST@#  S  S+  S0S T @# T@#0 Sʤt!T 1 #S@0ST@#d b0 00S*T*@#4 >@I2,pS$'0 $09/I2PS$ۇ@0,@?>UiPh  T 0@0T00Ņ0{@0YP8tY9ƕqJ$?  ?f??0?B?T????A8A@-0 0`( "4`#/0s@-@Ph0p2(`l 6/h2 4l0Ѝp@/0P/0?0/ D00H(/0-#20$A?0R  $$D 0 QH$ /0/0 0H00S00:A-0TP@0 `p 0 +(T0Q 0000A @-#@R 2S00H0\ @ A-@P` p 0  0 0 0 0 P(8S_0 A0 O-`$MHpS00H@ H̏(8SZ@2W<7 0SPX 000 S0 Z0%ZZeZ P0PE000C0儏 00((0R0 0(8S0Y   (8S00R2(`Z 0 p @0W   P @(8S W0000  Q0 L0  0p0Pp0 p,p(`L0P$ЍG-D0p唨Z b@` 0X0T0X?  4XP @0  `( `( 0Q 000( 0Q 000(8Sf  0 `202P0 0 (8SO0( Q0000 ͎$Ѝ0s@-@_҅ 4h @0 400(`p2l6/h@0d` l6/Ѝp@A-@0MxWe` PČ T $"d% P ʿ/BPA  BP@0Ѝ %P3 @ %P *BP PQ% @ PU $8UQP 40 8 0Q l$\`$0ЍAU0$8U84PLQ\ 0h0p2(` l6/0hd` l6/0h0p2(` l6/h0d`0h0p2(` l6/h?0T8P y8:  -?  &?0h0 (`p2l6/h0d` l6/@( 0h0 (`p2l6/h0d` l6/ 40 4 000S  RR9U|OAkA~Ap@-@  40 4> 4p_Ђep@ ~~G-D0P唨Z w@p 0X0T0X?  X` 0  p(友`( 0Q 000( 0Q 000(8S  02`020kX0 ` 0 c(8S0( Q0000 O0h0p2(`l 6/hlP0 d`6/$P~Ѝ0yO-D0MP.008S .04005 XpX00p 00X`@ 04T 07 00000 %(8Sw 0`0000 H(0P 000(ȕ \Ġ0 000 ܊\0 `0.\H0 ϊ("2Q0 0(8Sv40(8S-0(8S$"0 ,0(@C`p0 ⡊0((<RCQA$X0Q<<(A-@D0pPo0X S<( <80 <R 0<8QA$ !R 0<(G-S@>0A@@-S>  pBFP`p$@0Sq@Pᧀ0T*01S݀V$ <(@ <80A0(P徒1 0p@-0DT 000?P  @-D00000 T ?P A-D0`p<0P@@BT0A#6T@1@$@V:YPOV  00(P异1 0`0`F>@80@xG-0T` 0 \p@` 0P ( Q0000 (8SvsP /V0P 0S0 0 0  0  R X0<( <8T08( 880s00aR1 AG-@ស HhP<V P $P10CSp!p1W000$0yL0@  GP 1 21PEc%D H(R/ $ yO-M0P唨Z @ 80@ S 0S S@33P0@Ѝ`P@  YT`yP@&0X 00S :"; p&pP 0Xp 0 0  B/o"   $(8S00(8PS0(8S 0 0Y Y Y 2\@ 0@0$eP@O$82TP080s0S ;@W <80$ذ", (88S000 4,48#8? \0 0R0  0$ S$ $0 ` S$ $0 X $0S`PuAO-D0,MPQ `RT 0H00S00{\0s 0 s((2R\0X@0X00 @0 0H00B:~#:0<0p 00`@pQq0X 0r0 000(00;\0J (8S0(8Sp0p(8S0(8S0 020(`#20&a?0R  1$F$00 \0 @ 0\0`00`00 00$0 0(8S_0( Q0000 ݃,Ѝ 008$ 0cP ᲃ:#:K 0嫃 0PW\$ fZ WQJ 0$00\1 00J (8S0(8Sp0p 0(8S0(8S0 0(`0020#20&a?0R  1$F $00q\0$ @ 0\00~p0 (Q ! Z0G-D0.TP@`P pP 000`pX 00 0 0 sP O9z<80a.0 PSP.PS  (X^/9`00 `PP P,0D-h) L90p0L 0P'"8XW (800 ,Ѝ 0 ,0p$P⌂2,2 [0 4P/ ( Q0000 nP ( Q0000 [P ( PQ0000 oFPPQ)nV 025( P 0U000E00140(8S 0 0 P ?UV⯄0(8Ss2 Q,0l4<P0fH$b X P81S0h0 (Pp2l5/h1dP l5/H0Pdh0 (p2l8/h dl08/5z/Y\ Uh (p2l9/h1d l9/U$7h (p2l8/h dP0l5/dzPhP (p2l8/h d0l8/dyhP (Pp2l5/h0dP l5/ <P Y \7! VP   `h` (p2l9/h2dl2 0 0  9/h` (pp2l7/h4 dp0l7/h` (pp2l7/h4( dp0l7/h` (pp2l7/h dp2l7/{0hp` (plp29/h d0l9/$04yc'yN@ @8h ` p2l (:/h 04 dl:/h` (`p2l6/!qhdP1@ l5/,8 04<:0PhP (`p2l6/h0H d`l:6/hP (`p2l6/h8P d`l6/yhP (Pp2l5/h0H dPl5/0 P$8xHPU$#0 0d000hP(L(0(Pp2l5/h 4 dP1l5/0t2A%%A-AA6APA?kAA@?s@-ut2S P@hP (`p2l6/h d`P0l6/hP (Pp2l5/h0dP l5/Ѝp@A-LP@hP (`p2l6/h2d`pl 06/hP (`p2l6/h4 d`0l6/hP (`p2l6/h4( d`0l6/P8S hP (Pp2l5/hP(0dPl0 5/LXUMPphpp2(`l 6/h@0 d`l6/`;xhpp2(pl 7/hP0 dpl7/2(x0P8L8Ѝs@-@L8PS0L8P0h0p2(`l 6/h d`l06/2wЍpA-@P$ ovXUP M2S 0h0 (pp2l7/h2 pdPl 05/@vЍ@P/ 0\R/@-@ 0^   \R@-@0U. V?  3 Ѝ@1ꛛAЛAA-PQ+ t@pT'ZP UP `0d L2\0 @P 0t000 >2Ѝ@AAA@ A 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0T?@-  Ѝ@-  ЍO-M@p0 (P $   `0 S p  .(A =ߍ      0 (p @0p@-@MP `  @ @@ @@ K }zw t.   ܍p@- z Ѝ@-@ mЍO-MHR@`L @5 B?<00p (008 <040,0$0? @L 9!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@6 2ߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00 X ( S 0 N 0 p$008,0040< V @L P8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@ x  . p  l܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lx @@!H!P!X !,0( $ OZ`@ h$(,.` @ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.` @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPu\0 P0o0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@09V@0 00``V 0  @0# 4= i0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

0  >2  >2  >2     Eߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/c00 0/cG-@`pP0@M 0a800,($@ @@ @X008 <0a,($@ @@ @IT00L0000 03/ 0(9/ P !0 ٹ0 Թ@P 0((8/ PP < 0 幹0 8?cEAxA6|AcpAG-@`pP0@M 0a800,($@ @@ @埯008 <0a,($@ @@ @启T00L00000S !&.8PP &> 0S !&> ☲&>ş 0S " &> ≲P0p0 59/5 0S !x%`TP \5 0S !<5(( bş 5 0S " 5 SP0p0 49/4 0S !$P 4 0S !h4PP ,8ğL4 0S " ,4 P0p0 39/3 0S !#P 3 0S !3xx `ßx3 0S " X3D< P0p0 $3?9/?0 0S !? P ?0 0S !?0 ?0 0S " ?0tl ⳱P0`B0&.088/&.P &>0 ❱&>/☱P&.00!08/!hP 1 1!zP&.00l!0p8/T!8JP <1@$ a(1 ! \P&.00 08/ ,P 0 C0 >P&.00? 0@4/? HP ?0P4 %?0 $ Pߍ?\?סA6|A?_A? 0@-ALM0 P0`5/(@ @P @0 @ 0P00 (p7/@ 8P @0 @0xP0 (P0 p7/8 PP 0@, аPLЍ??A6?A?Ap@-`@pMP͸ й ̹`a R Ĺ@Th pЍp07@-7P|@~ Q@00#47 b0 P Q0~ Ѝ0r00#4p@-@P`\08M 00 00 P  [8Ѝp@-t @S0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-`p0MMPStX@pP `0 (`(07 ` ``^ N 7 (v`VIM0bP 7 (? G_ 7 (h `ӷ0 `0Ը7 `и` p 0b"!4b4# 0(0 7  (p0h 0p0` Mߍ⣷7 (⦸ ( `F O-M0@, ? R$0(@0 0$0 0p t 07 0001  E0Pppn0ERt  7`EPS0婠@k0C?o200U 00 Q @7 t0 4 t# t0P  U0Q00pp0 Q@0  7 t0@ 4 t0@7 P@@R tRY@0Z_0S0}$Ѝ?@[@@p@-l@P / r ',ap0@-,M@P!4\0 %   000Z?F,Ѝ0DJdA 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddG-pP`4Al!T 孒, LaT@! PU,QP N  0 0  0< 005  ,QЍG$c@-$M4!`||p0 q@P D0!4a000lr  $ЍDJd$c0@- $N@ L&$c&@- Ѝ@- { Ѝ@- Q@05/cw^ 0o`000S P0> p /베p W`0S1001^n80 Sd001c00N8fKP0S00d0Q00@Sg/1!p11H4H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 S 01 1S  0310@0wN.1S(01ЍGaeAD@, c0 cd!AD&0.R  "-" R   wP/P/////|0R 0\ 4\ !8/P x7S0S/4@D@O-`@0弐u_0Pw>0S4 0! pㄠ儰0Sx @TP Ѝ P <0<  0W$  p4 c3AEA0AAABAp@-`@PPp@$!$.00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;P@MA;@O-@0`pTM 0<^0 #f qw>0S9+ 3 a0 Afp7  0 9fp7  0 1fp7  0 (fp7 0  fY YpPP0S] (RD0fX 2 0PT TЍ\I0X0 S0   0P 0p ep7  0 ep7  0 ep7  0 ep7 0 e0 0RʻP 70A  `P( 0 S0 `` ep7  0 ep7  0 ep7  0 ep7 0 epmh@@B00 S   P 01@/D@G-P@PT"Tm-\8 Q2 +Q  Q/ QwⴀXa` 0 S&100SP6 P Q$u?0XPpQ0Q Q 00 P PWP2q?0^ PP00p |p  ppWQX" 0S YP48S|74XS l0|w7h78 WI>J4`Vh78h7@MAJ0000 000/s@-@d ^1 R S00#0 0S0:1D!0CR 0 D10D1! 0!0 0 0 00 0%00n\0D1S 0S00 000 R 0D10CD1! 0  R0Ѝp0!0 0  ̃AA΀\Q: / AA!  ////p@-@8 MQ 1P 00#!" 0 0000 `0V :3/P 1 0h p 10 18003/@ @08003/000<0 ЍpA@A!A<@G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::<@؍d0&&&&0S 00, QQ {/1@IA؍dwA0S 88n4!RR   c!/K@IA؍dwAP0P//؍dQG-@p ڐ1 0" $10$1Ѝd`PXQ1I(10(1,"1h1 0O ,X  p7岠`71 0! `W p71 ! `80S0S$ `03/P1 0(!@ 베,10,1W1 11h0 00 8003/ 0`R ᤚ0 9/P 120!S 0! 0X  W㲠`0`4!S 4!n 0 Ht h0000g@A؍d@§AANAA>AAAݨAp@-@P:3/:3/p@-@:3/:@/G-8p(MWW 1@P` ᴐᲠ4X0 0#!"!0 03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/AA@6AmAC-`@ 1RP~P1US^1 W0 0p1p 000P Ѝ08 R<< 0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S* y@P  # 0 3/P x@<@@A@©AC-Pp(0`S!R# _ 0@ u0 0R@@@N@80S*xPU 00 0@ Ѝ (0 S*!R $ $ $03/P@ԩA<@/A-`P@HM p&40%V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p *P`Ѝ@©A@-0<S !  4 0 h Ѝ0.A@<!@-@ P0@00 @/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` %ЍpG-R@P<M0 % ` 1 01(ppG0G  0o AP 80R  $Ѝ>o$"P//O-@<`IMP 101p     000 S0 0>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  P0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍʫA @A-@` 1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  1P0 %IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #ʫA @p@-pK00000h' 00.[  㠅  P 1 4MX> H>!000d $P$[ 1 =  0 =   0SG Q1S=X 00 0 0S8x 0 $0P 0 P 1 $ 4L0P HL< <P0[0Z0S  P   9%PPn 0p000Z|7S0D00S0S !R 0 <0ppW9p090!% 05"# #^#PQ\ Rʐ 0  0 ;+pm000101p%0S4 SH 1S 0 08; 0Sp10p180080|7S00S2S1<+ :0,+;D10D10 q7/00` 00(0 0pP mP 0`00 0/ |70*`S*0X 1 0:0*]000 03  0   P1 909C0000`X0@0+ h71 H9098),$00$0101Xx8S1 80,9)000 00 0 2S1 808(0 a6/ 2" 0 S!-0002021 HsK!= 0S!-00C02021  H]K!= 0kPQ1S} 3/z1  HGKP1 LV HQ 0SH1L1 P10CP1S0 900S000000 0P0101B 0t 0S0t0`0S*l`P0`  H0S0S0S0S0SXGhI0 0Sp S SLX R00 4(04$0$04S9l `Y (0 0C4!<0V0` 20 %S ! (  0%400010100`00$00 붡0 ,0$0 00SG Xk0=0倀0>X ! Z oP   iP 00#@ k,0S 101k000^h(`i(0 0(00嶡$0S =`|V0`+j080 R ,003/P 1 30#(39101P00 0@00 G&h2L X.Gr0L?!L00L0S 40040Ѝ, T0d0252 5 X$YX0Zp0S1 $>.Gr0>!D00D00J S*1 =-Gr08>!L00L00SS  2St *Sp 0S ! 0D=D-P00P0SPk xl00phQ1 <,Gr04=!L00L0~x7S 0450!0P0C2X00Z0Q1 8<8,Gr0<!nL00L0\x7S0X0Q1 ;+Gr0P<!WL00L0E0`0H5Q0[0 1 ;+fH00H0Q  04 8 <4,S0S SP |0S! *0Gr:!H00H0l0S1 :*Gr0;!D00D0 R1 P*Grd:!H00H0X VY1  )Gr:!T00T0YQ xQ 1  )Gr9!X00X0A=P:1  \)Grx9!d10d1xU !/  W101<00<0101|7hWSPm2Sj U   Pd d7![0R 1  @F[ 71p w. h7R7!66h7[071?%0#  1  @E ?w>0S)  45?|Q 2  P5`0S ;!0:1h7 0 000T0"08U l7 +l78l70 000T0~"5   P! T P 0`P00 0P  6x8Xh'* 13/?S PT0 d|wW 7S 40040  0 RY-1 $6X%05 D00D0BP*1 5%05 L00L0P 2P P00S ! $0T5 H00H0uZ1 (5T$04 vD00D0d0 S ! $04 eH00H0SS x RP 1 3  `00`0 p0L 4P 8P <S 0C?o020\3bqE0p01L.b |>儞!|0>T h W1.M >p._00Z 1.>= 0A@0P !1 ,?,/b0 G  00 Q 0  1l ?D<08 8 <0 HXB i pG p 1/? 0?  C !0pp$W%1 9 p0L 4P 8P <S 0C?o020\3bqE0p0 14) 09((00cWF01 441(  Tp?0 40Q0F00D0 0C00A00@0080n,P (0,0,01S  TJ? ,0HP0<808S 0( a6/x00x000 T/Ph7 1S  T? 7P0(0( a6/c|00|0b000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 50P /(0004P (($04020|7S7S 400400LS1 6 &Gr06!L00L0꺁xXX 1  T>0W5 0x8U<10<1h00h0 ሕ 0\Q:1 `5D%Gr045!D00D0LP*1 4$Gr04!L00L02P  P P0Z   P0S! P$0GrX4!H00H00ḡἑZ 1  T*>0W 306x8 U<10<1|00|013/oX㺯ᴒM  pG 202-wh7Q / > 67Qh7 !, h7R7!66h71  T=h2Ÿ    0Ÿ0W 20  13/20276h7'0R40040 0CS 1 1!00 1L00L00q001 01P400401  T=0 |7S S 40040 1 3/x8U 0q00101 _P400401  TX=0 g|7S S 40040 1 3/x8U ѴAAA*A AAAZAA%Ax c AArAAP=AFAԵAA,AAAA2AXA -0@-@PM0 0x P= 0Ѝ0@Ѝ/ᕶAA-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0z!GR # rD1"022222220 " 8,c" ZN_292S988-#87 0C2c70r0Q   G0   04Q   <0PP0C03254D@A-P L0R8pL `@ܧ|'R"(R# #0 83/G?G/ @0?@D00Q0000L00 00 R  001H0O-`qF尡MT9 0 Yd (  咧00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0崻!GR # 嬻0S/S10C1ߍ(0 ✻ 0" R 0Q   ␻0   0" R 4Q   ₻ WP0pG@D@@-1CMS@CߍP` U@P p  6`P 0,0Q    R,Q!0R 1ŁV@p@-2@SP 0aS 0 6/p@03A0AS@-@e '/C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍCWV7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@RUPPa4VA  gPP` 8. 0000000Q<<0 0 0000 P00' i 0R `000U @ UPDVOxc nJ   xW#_o`/R χ166S1 000P U0!01S 1UP#TЍCTЍC"1S zTPP  `P !ZR !ā BUP2괁X \TPP  `P 2 01 SP0} pl 0DP1UP0UQ S# `(30PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/@a@8>'@1'@0|7S2S/004 S00R  0 u0000/A- MPp"%@S`Pl0$`S9 BS` BS!? S* SU  S `Y$02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C V/@`U0"0t"]0h7=$`B000i;0d 0 L 000X @*@.@*-OZe<3'G-p M@`!'PgR`P0'XHS^ + BS*? S* S  S !`@'?;CS00$'S?  Sj BSX0Sj p7 h70h7s&Sc 5, BS  BS&?;C0CS0&SDX @0SC00P0S Q>⪎0pⲐWC嶠C B ᆷ@0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0   (G03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R<   ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  x7 ?op2X  0RQ ÑVP P6P   Q A0 S -p@%@EO@O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO8 ?Q_0 00 0p0;PPM.x0@FS00>Q >Q F0Q0 0CSz14PP/|>Q7S|'R h7   U0>Q $ QL >Q>|ЍOh>W0.|ЍO@=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8jOPPH<0 SPo;XK=0S|7S=xhɽ >/PYp:3/0= 8"PP <0S0#0$" 0#0 {< X⿴V > PP 3S>ñ:3/V c4U< ' > z `PPXqs`~!Rj8OPP8Q|7SxHo 9պP 91P|Ѝ 9 O @P f+QCs!*R;8NPP80SS*0|7S-9 iR B0<PP" [P>0CS|7S <  @P 80S& < |'R R0<zP  < @P 81#3/ @8  |7S PpP P !tNPP x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> MPP 8x7 ?o2x`QQ 6P  x@Q @A0 S |Q  x0@`P|V` x01@0S S2 Q_P|Xe 8&03A0AS7SP U|7S cP 13/P]!R8zvMPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4vPP 03/P Z0U 03/!R8+MPP  8 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(Riii@i9ii:ii8i8i(7io?.@R@) 6'a@@hAW@\@* *@D@cA@cddid! 8aLPPj8` V#=0 ᛝ h9ޱx! 8⒝7S (#8 9ϱ! 8XMPHx 8  0BS !R r39S0S0 p Q ARQz0W8@ Y  R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0Sv@pX0 0CR00h'4PS4400Rh7KPP 0 0HN-HsP h7~N#2000@000S@@T`' 0PP0T0 TLPP  > 0S p7  h7 ; h7h7 ; h7N50000> 0  Mh7P:: x1($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S||ЍO^?0 00 0p0PP- |ЍOHL!"P   03/P"|ЍO]ꔥ唅唵Yʀ 0! $%0    ! @aRa/#L6PPWa/$ 0!4&0 !    !0C-DM,00 `p\(00 00a00$  P<0@nP0(0`0$  0T00<0 a ,nP<  DЍ訶AiB˶AAA@@-  0H2$,p(`0/0,2  0408 .lPv 0 00졟!18 $ 0,p(`40lP`0 00!18 $ 0,p(`40lPL 0!X18 $ 0,p(` 40kP9> 0 00!18 $ 0,p(`40kP$w> 00$ 0,p(`408 kP0N@$ 0,p(` @408 kP  <<TЍ7Ae'DBP cAd'=AGASA^AiAuAA@c/n@-@Pp@-@`PUp0S00`00C0  `N-@-0 0 Ѝ Ѝ/Ap@-PP UlyU`J@P K0000 (g vL@P@p脷AADA-1P@`p x(0Qᔀ4- 0(x8 S ḬVed0 KZ#Ѝ ᩬV0 lg020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍA<@AD@<@ ) @0) 8408008,08089!= 01/w'v'' G" !@ Br 00# B1  㛄@0p p@*GG?0@ Q  Ѝ7SD10A@ A+A0 R0S P@xHvjA-|7`SSp@ h7] P i^P0S TAT10 R0S P@xHF0S i V1Sp1 &0D D0 0P+AЍ#@AA-pymP|7 `S 0 xHT |7SS @P L@1 ~&0 r000@AC-P@@@`pAT ݐ  AP01SЮP1 T&0, , 0F Ѝ@ @˻AG-`X  pR 0S R@OoB@XPU@ P 0R01 S  R 0S RP0 P0T@`C-p`@P$ ӫP@TX Ѝ0S «PT1 %0t t 0    AT  ⧫P0S ➫P @.@4@˻AA-P@U+ pP ЍA0S0S i V1S1 %0D @ 0!HP ЍAЍR@A@-@xP 0x8i <P 0<8HP0H8p@-|7@SP yn089,8xxXP 0 022220000990w>018+|'R 13/pAA-1@` !y^H|7S118889,8{  PPp ᔤ(# ⍤x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGQ .ASf@A;AA@-@xQ `P ⅪP P 1  <10<1Ѝp+1 $h\ \0   D@  ,mh70SU? #~Q A1 |!0 `p0Sp7  |7S 1 $!$`Q2+~Q A1 U!0 I0S1  ?h76h7p7  1 l |2h767h7V @ZAAl@AԽAAA@DAjAAAӾAO-P`|7MSS00 09ppps1 p0")0W  (ЍO]Z @T S00Ѝ0W p|7S2  0S 4"|0 0P B00x8S| 0 0C8C80Q Rn P1S: 00! 0 0 00HP 0SH1L100P10CP1AH1S 0 R B0 Y 1  0 1P 0Q113/0Sʐ1  0 8 2S 0 ᬑ9/000a)Sʐ1\  T0T Ȩ NS@]@AAEc A'AgAGA AC-2@SP`M !Ⰰ8#8X 0 q7/ЍCa< p 92<2<! !000w>0SA p!$20S  hǔ   1WQ01S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 0 GP202~0001 0 7S 1  h76h7? 1 T h776h7tps@A,AAAArA:AAĿA @AAA-|W`U U) U@w xP 83/@ ? 83/P@pWU!3@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, , PQ00Ap@#@rAp@-PiN@ @P`#xh~VxHp 0^ 022220000990?p@;~As@-!]0!@S001 Ł<>HP1 00!1 yG 07H180$8<1m`Ug,884X P10X 00 0in  F  0(' 0' 8' j^6D'@7<7Vsx8 p  p'    P ( D ) x8 r Ѝp>@;AAX'Alx' A-pʀjPzQ` 0ES  B2U U U ,U UPPH$H@҂Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ 㯝s000 0t u"    @v w 0  " @x 0S @@pt@A-0 0S@P p `*|7S00 0w  s o003213030 0`  \   T  P X@t0/C-@`M*;PP000l~ Ѝp0 `ݐ0=0 H02 |7S0000(001011 ` X0P   D r00L7SPP7HWLW0P7ABA-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1 0S "N)Rt@O-0LM S< P@ 8⑜h7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8>0 060000H  0C FR{:@P000 Vڸ h4:0Y000040  B    004@]4@Th `:U 0      $D"$  (00 #RH L0S0P  =@P000> 40H   CW0C00000 (0`0(00 0|7S000 0ⷛ > ⳛ 8⯛0 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8h 81081 8 P > Lx 0 08B  > >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: P$`Y  :P`PPe8 I90 0 0 010 1 00 0 0 I0, 08, 00(0080$0`0000 S0 000((0C(90 8000000C001!0110/1!LЍP`t<Y0 S  04[<P 4a<@^<@[80[ 0 00徠SX ,A<@@AA`@*AbAsALAO-PW9  W W W 1S 0 000@x0WW W1t W 0 .PP 0尀00(0202shpkPP000 @ ăx8?0 00|7h'S000  0 ;0xG  x'00R_000嘧    M? 0#40坹 00#300ᓹ 00P#3@0  6! |7S   0 0X w>0S h'0 n  0h000   J0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0\PP0 = S  岀崠 45 0,DY 1 4 0:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00v0  , R :01 i3 ]0@001 PW|'R  U3Grq竸 0 |1 0100L7SPP7HWX0P7080LW2x@$Ѝ -0 !PP 0ᰀ00(0101m}8S>HHPP |7h'S000 (  0/  p' ; W00  . x xG ozh'0  4 R  R0Q  Y0 00 0C0(0&3RPP5 h'00  0  ;X00  岀0  " 101G(3h'0  4 R 0C0(0p 101#RH L0S0P  7PP곓A4@0d!!p740!h  i j9k9 0 g901!\0g|7S!=0S* 9'w>0 01 9i9 00\0 L|7S 93/1  |7X `S499Ѝ@9x829009h72h7Ѝ@\ c@A4AKAp7/p@-@f_Qqp@p7/A-`Pp㠁Mw>@WAL WP WPx10@|'RL 5) 6) 7) 8)099!  089 079!069059000N9 O)PQ R   00 pWPx8S  19ЍAh 0: 0@T P 0590690790890Ѝ c@N@rAA@l@@@-h7"1 @ |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@A˼AO-pM`0`  P0@0 00P 000 0_o`@ZIRPPU!R:"R :"R:0ЍC-MP 0`p` @幎0 0 00  00P 0 0@"I?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`LPJ<1$ 0<0  A,p(LP91$ 0<0  A,p(LP)0'00弐$00 00A,p( < LP0$00 0l0 0`0A00,p0(0< LP  ,,ѽ@ЍiBAdA'A !c'mA!Ag@G-SP Lo `0@4p8à St# 00000SW q0` 01`P1 0j`0 d`叽Ѝ@0@T@AJ0^0P0᳐0Y:0 !cwA@-  0 @!  Q3  4夋000 P1#9P00T0jX耖C@BC-P`尀p0@ A0 0S HP `0` 000 Ѝ !cdAO-P@0MP00p1W;*0S`0 S00qp0少  A$0 H[! P p 0PQ`1P  0 jPP0p 0 0\Ѝ[ <P 1 0CЍOм !c(!cdAAO-@0pM00P@`hPy 0SP S P S0P0܁ R@*00Q:0S  pP 0 ≐00)  0i 0  D儼 A ቐ 0R 0 ්0S0 EP 0Pi0S" 7P P* P GW@JPG_P!0RdF X@Ѝ` `ki벰 0(6 !cd3A(!c,AVAmAAuA@-@ @@- 4,4 8 #8D ЍAp@-@0M SЍp@P` 00 0+ЍpA-$M840, (  0  $Ѝ䄾c@-`plM&*@P@ !0 0  ( 0  P0000C0 p0!0F0 0C0000 0d@S2 001 00@0g'嬪H0L 0 H0L 巪lЍȑeTdc0O-@DM 081 0,0@@PhPpl0 0000,P(p$@ @@ @`BJ0 00@40P,P(p$@ @@ @1J040l0 0d0000080P,P(p$@ @ @`J 0ADЍA@ccAA'^BO-\F,MPp 90 0 0 D0d#dh&hV *'0 0 0 2,ЍO5-0 0S 0S*T-PP  0 0 0 ,ЍO00C0FEP 0 0 0 00C0000`P' 0S S S/٩ 0$ 0 0$ 3"0ZT$S ũ(0, 0 (0, Щ,< P 夯P  n0,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S 72㭈 @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S ~"@ z @00?004 0 004 J30 R S +80< 0 80< d 0S  P`0 0'c Pc 00 @0D 0 @0D 0S 0CSQ00N0 0S0߽004 0 004 3 70 R S ڨ80< 0 80<   0SfP`0 0 Խ 1P 00幨@0D 0 @0D Ĩ0SSSꄾc@c@c@0p@-00@4S 3P1 00'R0 0S0StyP 000 01S0H00``)2㟇@ap p@c@c  BR/ $R/ #/0 0S/c@-P@1S `p= 0 @1 @T p Ѝ0S 0CS0@q 0S0 0S:00 Y @@ce@-l 801S@i R  R 0@c@-@V D0Q  0TS   厯@I @c03!"/@c03" /@c0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/p@-@P t!>000pp@-@`ᘼPF@P ᳼pP/p@-@PP #p@-@P #@-@ 0Bp@-@P#o#p@qQeO-$M`@Pu >pP u0$ЍT@ @ ` X0@00S @T ; [00S 000S00 0T 00?0P` ` @Z 0 [0 T?0P0T ?0P ` 0 0`0/G-pP@0`P "T 4 06 S H0S 4 R30 ⇎PP@P8 0x00PPH0"]Zv 05 06 06"`SH0Y 0S 0C @ Q*  " ^(A,0/@- 0MP3p0ppw`hP@ᓻ 03  !*,0 , @ 0  Ѝ@* 0#000S2 0,0-jp~i 03  !),00,0 03  )P,00,0,0 0 0*GЍR dP'0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@A|`pP1hSl l0p 6AD20P1p00`0101S0@@^hq d@-60!0 0 0[ Ѝ@-@Td$,d,lH,l $.` O-@`DRD2DM `00 @@0A10A _o>  W EF? M`pP!1 00a0,P($@ @@ @ME000D1 0<1 00a4,P($@ @ @:E1  00a40@,P($@ @@ @)E0'40张0  00a80@,P($@@ @PE040p0 00a80@,P($@ @ @PDDЍ dAA(AcA,!cAA@-@ 0 0S 4P@\0X0S@+!P d0`0S ,!c dp@-P@0 0DS P@ 00S \0X0S@pDP 00Sd0`0S D,!c0S 00P0#///0  S /0C\ B /p@-鐹 @dPPRL0$!p@觹 0S  Q@D0R0 1 dp@-P@ q0!S <S21p@-@dY@4d@-@Z> 004d@-@N 0G@(0@s3p@-3@ P1D ]d@PLp00S0U 0U>ph0U 0S d0S `0U X0U D=/,!c80S/@-3`A0ASM=pDP P@Ѝ@00S%0 00P0 R0020 0003/PDЍp@-M@`᰸DPP@̸Ѝp@00SῸ0S 3/0000k2닸PD@-@$1@ Qvp@-@P 4市001Pp0S 0Sp d@ p@- @P8j@P@p@P@@dA-pHQU`P000E@PЍ0 p 000!>00H `P ȪP` Z1S0 d R1@0H` JA0, D(10(1] d1i@d0@-@MPPEUP xЍ0@I!>00 T ( Pp0@PS   (10C(12rЍ0@d2i dC-0PSM 3/4 0`C @ 1P 00ЍCꢷpPXTᶷT T&Y  0#   Q @STX4d dp@-@,0P `0,0EmQt x0Rx0t 1x0 0S  0 00. 000p@ d4dO-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y LP 30Sڸ0003Zʀ !  , ! p !P3L3 H3@300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0St24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0` 0# 2 Y0VP0PPt P.ᑶ 03 8 %pP,00,0/ W.,P0S  ` 0S0S  S 7% 000 0S$ ",0 Tp53S0S|00`fYU 0R WPN 03/JFc@cddd d4dO-<PQtM p!< R$ 35Q X@ 0M@XlWP<W26 @<@,0 S00$<Q 3C5CQX U D ;W +W !BW-`S R R   `E  @ TW" |;W 0 @m 0 @ 0S P !>d60 0 `0i0 0  00R 0`xDP@ ᔵ1`tЍ|:W 0 00 RV  00 S D:|`W| ⶁ  寁 0Q` R0`1 0`Y Vm0 @Qm 0━| @␁3 P 剁P 允 <0 0 XZ 0  tЍOI00000 !6@PJ 6060X`\00` E``Z`8W 6C 0CW 80Sl8W1CWi 080 S`@8W0ST 0?˴  80P@ 7'WW00W0S* T1`@ 0S0Z 0W0S00}0SZ|00SXzTꀠ0Z0SX6&WW| T600 Z`0 0 `0p6PeTwT@P7`o 0| 000?893 !>8 ~000000S(500 0 0 P3TBw% SJ00\50SBt%S?00X|  `3 8 3   00  03 P `P )T Y 0Oj,0  n" i"3 PYh0 r`Y SO]E0t01x0@t010S ؀SS P0؀ a4`V PP0Yd0'0 P2`0`V `000d0尳 !0S` 0S ` ` Y00 0 `3 !0S P 0ST  ZkR0001 P `@Y> `h0S 0S000PS 0 `PsZ V`[ 1 /``` W003 P R0``0@Q 0Si ii io@ iAiii@%iߖo?i@'i d,Aoi@@!i#i"i4dYd08 P R/ !  / d !  d@d@d@dO- MP@Dp `0@0#@@P1|P@U ᘲT100#Ѝ!>00  0 0`P H03WHDP@$ rT 0Y00C?o20S7 0S4 ;OP"@ XT 10@0L0S D\X 03 PLt@P 0  /80S 3/@P 8 d0Q)@- 0@R0S b$",0S R  `P 03 0Q / dp@-`㌕P w0@0L0`0D00@0 0<0(080,040D00040,000@p(((X((('(((@-@@b0O-,M,00S@(`@P 0 0 0T1"T00XS%X@P  00 ")a! 1 00 $a$" 1040  0fpP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80b0$0$0Y C *,ЍY 0 !PP  !0P0J0@pECV @>`Pp#V`[P 0p0(0 4p*4 0Ằ 07p0x p 0c8##4 Ib4#00 1 00 y7 0 p0 0`p@`A-`p(@P P PU@0 1PTC-0@SPP @A0S`Დ;pp0 p0 @4"40 0 17W  0  0 @ 0C70 P00 R0("( ,00#,0 Ѝ 0p 0x7@-0P 4!4 8A#81C 6 P,000000! R ݑ0  0O Ѝ0 0`( "4`#/03" /@c@-@pMl0l`0@@ @0 てDPD0 0@@ @0tЍ7AEcLd@A@-T@CzL0010P @PЍ0S 00(d 0!< 04 0 (   !/@cddd\ P/0 !8 0 0 (  , !/@cdddA-P`@0p Pl 0f0  `?;$2020S A;4!c1(0p@-S/@@`ၯP0SP y0P )0Pd0 1@ᓯp0@ 0R/!&   ~g 0R/!&   pgO-0PXQ p`H($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 @-P@T Ѝ0S(F8P`(`00p000W  8`pV (0@@-pDMW,8`P@P& 4  f<00004 0000S'40   000 PUDЍ0S/8p@-P@Tp0S 8`0P H R@O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `X6%XpD%DH$H00!1P0%@@1!P\\ Q \\\ P0S 0S0 Ld0SjA- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Aypv&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QP@P 000S  d0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Sp7pLd0&cG-(p0@0SP,``M く ROd0" 0 0  0 P" P c  =iP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0p喞P  0 P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PShM;0S/70S] 0` R@( RS Xr   R R S"0 0 0S0C00匀(XG2#212(0 00p08^pP P1hЍs000S 0CS # 00000ЪP d0   1 က 60 0,P.L0+0SQ 0006l0S (000L00 00!1ZP\ 'P /0 d@cA-p(`@pPD0S   !R, 00! {hP 8p0SP Zj屵*0S0 {A0ILde0S/@-40@0006(01@Ld@-0SЍ䳑S !>00 000080Ѝ88@- <0b",4b4#  #$  #(  #< 9ЍIAp@-@0M SЍp@P` 4"48 #800ЍpUAQ<%cbxQ 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # Bp|PpEp@-40 R@  000 * o 1Ѝ@-40@ R  000  X ЍX0 0&-$M840, (  0b $ЍXdC-M 0P`` @uxp0 P 00 00 0 0@/0?o2P0S B~Q Ѝ!cC-PMp@9 0` u`0 P  00 000 0@0?o2P0SP @TP@P T@P0KЍT _c!cO-@`Pp3DM ,@0 00p(`$  P33ဃ ,@0 04p0P(`$  P3 0 0 0'!(3 ,@0@ 0 8p4P0P(`$ 30 400!2 02 ,@0@ 0 8p0P(`$ |30 0 0!2 ,@0@ 0 8p4`0P(`$ f30400 0 0!$2 ,@0@ 0 8p0P(`$ O30 0 0!1 014,@ 0@ 0 8p0P(`$ 730 400!|1 0t1 00,@0 08p0P(`$ 30400 0 0!1 ,@0@ 0 8p0P(`$ 3 0400 0 0!0 ,@0 0  8p0P(`$ 2 | tk`J1T@T2DЍAeA!cjAL(sAAAhM(A`L(^BAAcXd8Z(c*cp@-P 㞋@lh 0S Q 0P @@@040p@P p@ ㄋ0c!c!c0 '3XdO-PM@0010pC 6#21 2 P 0S `5 V#2!12 5Ѝ 00剧` q5010ZРJm៧Z  T@[PZ  R` 30 a2 0 0S DCZK zZ| YXj !>000 ( h40800 `$`02,0 00 P230 0 0 )0 0$#$ (0"(DRD iPP DP0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00 ! 0 S0!0 X ȌX0\ 0 X0\ ӌU, 1Ό@ @ 게H L0 [H L ` d d` 崌U` 0 `ꩌU 7X (X 0P H0@` 傌0 @0 0 匌@cc"c@-!>@tPM `0@@fp0  0PoЍL000g ecO-=Mm= @P=ЍOs`X 8 1$!0 1$!CHT=@@0D0D0S S # 1$!0 1$!.@3 0 0 0 "@0 <   e@P0 0 0 0S8P@0@S 0 0 0 @ATߋ 0$ 0 0$ 0TPP@ 0Sɋ0 0 0 ;`( "$`$"",R a(!"4a4##<S3 @1, @000@S S奋0 0 0 3 ;0S V'P 4"48#8T劋(0, 0 (0, e@(S}0 0 0 X Q0(0 C! @ @0;00 0000P(0@P 0@0Y1!0 1!40SP@G 00001S0`0 RP0@0U 00400S @0 @p0,P0$800010C 0 0STz 90S@s 0tPPm  t0@0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z vW0t00u080S| $0S @E 0S [@@D 0x0尟<t`0P0<0̟Z.@0 tG0尊0 0 0 廊궟 0R*+Z 4 0P $0k$0J* 0$0@K@ xkZjt0P00$0  k ၟ$0Sx00000@@@T@xLP Lk @ vdW0t00u0,0Sx 0SJ Zz 0R: xk)t0PJ0   k A0000,0= 9xLP@i L ukYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ vW0t00u00 0S 80x0՞Ӟ0P 0S H @Hi000t0 k Ԟ000 vV0t00u00 0S  xk뙞tI0P0  ꋞS@T 30S@0@A@@$0ph201P0P0S 0CS# 2X0X0SD0CO ሞ00SK PmlX0\ 0 X0\ G W T  X (  (  N #K0T0T0  R  Q W9 h W6 ` W3 X W0 R- H0\0\0S D0CS@p#@10S (0@S 0 0iX0\ 0 X0\ `004 S 000S @o P@0S 000010p0t 0 p0t ,0 @0<01# 0@3/ec dȑe<"c"c(dXd@O- LM {@P`pp8 h8 (p000`,P$@ @@ @y(' 8 (p0@04`0@,P$@ @@ @g(4 0 07(p008`0@,P$@@ @PR( 0 07 (p008`4P0@,P$@@ @P>(0 0@7 4(p008`0@,P$@@ @P)(0 064 06(p008`0@,P$@ @P(0400 06 (p008`0@,P$@@ @P'0400 0L6 (p008`0@,P$@@ @P' 040 0 05 (p008`0@,P$@@ @P' 0405 05(p008`0@,P$@ @P' 040h5\ 0\5(p008`0@,P$@ @P' 0405 05(p008`0@,P$@ @P'44 04 (p008`0@,P$@ @P}'040|4X 0p4(p008`0@,P$@ @Pg'040 0 04(p008`0@,P$@@ @PQ'0@ 040$0 03 (p008`0@,P$@@ @P6'040p3 0h3(p008`0@,P$@@ @P!'040$303 0<(p008`0@,P$@ @ @ '0402 02(p008`0@,P$@@ @P& (p||24  0pD08`0@,P$@ @@ @&,2($0 200pD ,` @ @&p1$01D 00,`(p @ @&1010D 0,`(p$@ @ @& \!\\0@S50@ T08!0@T ?, 1d@R㒇70LЍ RPP CB! ,0dm(cAcA"cAA&A8h(*A4AGARAH!c)ZA4!cfAhg(rAD!cA@!cAAA<"cAg(^BcAA)A)A`)AXd@.L!cpdc@-@e @e A-p @PP0S PP 0 0100a10 `0 0 0pf0 0V *0HHQ0C00 @-@0SZ 00pd 0 /pd@-P(0dp`LM @ i@ 0 6$P@  0 ,$P@PP"   0 (02,0(0$P@ `"0  ````( 0 (($LЍp@-0P@҅1 01  p@ۅc03!"/@c03" /@cp@-@`រPL@P Ṛpd00S @-[ P3<8 #8!R "00 /8"cpdP/0P7@- Ѝ0P @R R00P0S0@-`Q00pPg8'#TgT%%< a@P@ ЍVPldh00100S 0CS W @#RP 000(dA-@M`p  XP@P%0 R@ 00S,UP' ( +R!>00 0@@APPPP 00*@ЍHP P@ߙUP1@P P00A-@ PRp   0P 0SR`P͙1VP 00Ù0\ Q f0 0!0;0Q 0!A-PS@` pPl0 A/4@刄8!< 8!<哄chP/A-p`0PPQPEU `f @ T T@ @T@  e0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴS40 0 0 ?D(,Ѝ0000 000000#![< 0C 0((04"<00 00000@ ,0@0,0VP *0C SUR0 0 0 0 0 0 7PUPP(Rу0 0 0 ܃V7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0P 0( 000@ *xPd0 0 0 o000:, ,0@ 0,0 00800`Pd@cȑeO-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00 x0| 0 x0| +0S( !P00!>,00000408000S 0 0S 0 0R 0$ @Pn@Pi,PP,0 0b m0 p0 0 `(0S004 3SH0L RP0/P 0 0C000000<@0 @d(0P 0(0c000$#$ 8$#, kH0 00@V0g0 00b0010k0R ` `P[x0 p0 0 傂3P 0LAP [pc0 0 0 n@0000 0PTp @z0qS>q(0[     Y Z70 0 0 B0 sR 0 W [U PR LP dZ`0 p0 0 #@0`0S0` sR 0PP3 P 0PT@P H0S Yp0 0 0 AP@0D 0@040 D 0  PW0p/T@PY`ā0 0 0 ΁p`0H4PS0@0D L`0@00 @000D 0ppW 0OP0X    J0  #RV  3Q 0S# tPP X偁014!0 014!匁1P80S t80,3/PP t0 0t  P* [ 0S% (PP 00SPP ,0 ,00,0000 , '0S 3 V+0 0 0 6(;PW `+ 0R7X L$KЍ 0S80S W `r80,3/`Pr `p0 0 00S U0 0 0 hU6 3 lU܀@1D!0 @1D!Y0  8Uπ@1D!0 @1D!ڀ P @4"4D 8#8Q ( %0%<#*T嵀@1D!0 @1D!(P( 0<00 (0(DQ ,   40#0 @0A_V Wp 0 ("50 @000PP(0Scu1 !0 1 !倀`J`0<  )0 !><0 0 ` @0DPHPQ`P/ 0P+0S( 0#p# 30S  t33"1`00t0Ȓ30 0 0 >WpMpp3 20S ( ,0@0,0 (4"4 8,P#8S G04X 0R0  0 0 0 H1P00,0 @ (,0@0,0 3  10S 10S d(,00,00 ,0 0 0  P%3  10S 00S A( ,00,0  (VPP((Q Ut0 0 0 tU (0   0, Ppcȑecc@c@A<"c%c(%cC-`!.p0MP00  @S00000sLTЍ0S  Sp BS0S 0 00000 000B00SQ QR `0 SP R 000*A-PpU@(M \mwPP7@2 000$30P0# 0CS0 @P0S@ `0P #R1@0S  2R`V\mw`(Ѝ200S0@0 J@ 0 00S"00 0 P@* Q& 3S#`0VV;@ IaP 0007@00 0 K ^ R `1@ 0@ 0S 0 DP@`0  V1@ 1 e0 `aR0C000 0 S S Q ` -@V\@s@-0@ SP& S) S- T 0S000 Ѝp0S`(P 0P0@000*P00P 0  0Td0O-,M00P`Sd@ %S 4RN *P PG0$0CS00hP y0h0[5 ApP7,Ѝ  J [ 0Z'`V&[$ZZV0_ `F` ,R0 _`hpd@(V ^`0p%P0`#0CS000000 CR0ŕ0S@@0S@@0S@@0S@@0SKKF0 00+0 0p0"P0SJJP0SJJ  Pn$0S 00 .`$BPL1_P 00Bp PQ}PK0SS @ģrS @n {P;gO0P CR hPX 0 eP$ !0CS0DD R R D0$00  0p 00$ b@@@@p@-@PP`p0Sp@\6uPp@-@0x`S   !00C000C0PUp@ R0 0  婉xdG- PIpȀ`H@Tp@W< 00C@S@p0S00C0S0 ]|@0D 0 @0D h| @1!  ꄐdxdcxdO-<@`pP DM  0 0a0,@($   <  0 0a40,@($    4 \ _ 0 '.  a 80,@($ P @EDЍxdAcA"Ap@-@`M0P0@@ @0 CdP  <@@T 0200 R00C1 2"Ѝp@1AEcxdEc@- IPBA@ꀒdA-@70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PAxdEc@"cdO-Mp 4"4 $,$8("( H#8! CQD0Gl{0 0 0 FCSC 00 Z V`K "(?AT0&H{0 4化 0 4R{ .`PE7{0 0 0 B{8` Ѝ R:F${0 0 0 /{P R\ \ @ 嘕0`R {0 0 0 {h, Q 0 p" 0 崡10T01A0000W2SS}$@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !Rz0 0 0 z0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  !( !! B! RA10C100C0Tz80< 0 80< _z} h ^9!AQ ڴ! Q Ƞ,Ƞ B! REQ  p B! B!  B WZe 0R ` ``d1S <0 0}1`p[ |0R  B   B $ `  X0- 嶀 q0(t"|p   0 ! 0 1C00S,00V(`8 y0 0 0 y-00  φ 1   0cxddxd-//-/-/@-@-@-p00d0@ ` P 3d0 (00  0 Q(0 0S(~ Ѝ1M  @-5:A@-1DAp@-@P0S 0S 0Pp0Pp*_P p茒d!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`GP 0 ], 0  02# |0R0@l@ +xh0l 0 h0p0l t 0Sp0 t xꌒdXd@̹(c-/ 0!< 04 0 (   !/@cdddT0M000S ~S 0S/0S001Ѝ/e\ P/0 !8 0 0 (  , !/@cdddp@-@P<`]0wpedp@-P`@pp@-P`@pp@-P@zpp@-@`P000lpTdA-@pP`y@PZ0@-S@ @p0`000S ~S 0S/@P0P d0  0S 1@2 Ѝ00@0eO-@`p\!DM 0 ( a0,$  @P0 00( 0 a4,$  @P 4 p 0 h (d  00 0 a8,$ Pl DЍOAXBtc)OAdG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 /@h8(d@-p`( PSQMp $ @ND0P POUd (0F0S* 10H   CR30C0000Tr 0(00(0 0 () $   R  h 00` 08 PЍ#RH L0S0P   @SASC 0 #RH L R    0@P+ 0( R($!, $!$ 0S(0DS 00 0 0`P0 0v0 0 0 v7P(P PPȑecG-@pP`1W0 S8@ @P   04W@ P`S9@000Tds@-aPU0@ QPd B% / P  P d0R0;;d0ЍpU   Ѝp@5P P\ P d0R00\d       0`( "4`#/@- 4"4!04"41@- ^W Ѝ 0<P   /  ,<%cd%c a)0M/ X 1M/ p@-P`8P@Pp0Sp@ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0:0@@-@0 :0@@-0 00   00yЍWAdp@-Ph{@p踒dp@-P@ |p@긒dO- MQ( P '    @TS   RK 00 0G 0R010 0! R010A0;S@T 1 R00 1`@ R00 0`R010 00C 0 01 0 !i Ѝ HR@T  R1 ` p @0V 000 R / 00 000 R00 0R010 Wp 00C 0 V 00 000s RJ C\`C^L&\@Ct! ! !$ !$t  W `^K\CQ B C*0 00000 SD0 000h R00 0R010 Wp 00C 0 1 a0R*Dt1 !0 1 !Ot T  70 0H  00L0CS@`1@0 pWpP 202t8!< 8!@!<D @![D (!, (!0!,4 0!40t0T0 @0S0ppp@ 0@0 00S0ppp 0HdD"cG- @`$p嶈P0P= Y YH Ј,  Q. Q Q 3 ,10S  0.PR00@ 0@ @,(#(0 4 <8#80#Q0P @ᕈs0 0 0 s,0 Q Q 0@ 00S  0g(%cdO-@PDMpp4UXDЍ`0V V X `XV0CS0V  0 ;S0000 4"40HPV 0 ;S0@000Sg1h0 0#2S S . ,!. g!0Ȅg. r V0 0OT HT 0 ;S0<00h1h00l1V 0 ;S<00S0 <00 X@aAkAd@%c@-00SJ@ R  a``  B BR00C0@0CT傅AA-8AP`r80< 0 80< rPqW: AAdpT1WpT@dCAD@T@0PqTA0S 00S 00S01S *08PX!AQ1DAT@1T0@#H1;@0rAPqTAd$c$c %c$cEcO-CM0O0 0Ar0 0 0 Lr XE?0 <D0< 0`0SP% 0%* h0P h0 QP%*8PU r1!0 1!!rCߍ fPP 0P 0#2S S0 00S00 P0d#d 0h&h`F0P0000040 0#21VS(000%q1!0 1!q0S 0S0S0S 0S 0(``F 0P0000(0( R`F 00 RP 0 ( 0 P 0(  QxPPUy (00CD0080D0 S  0Sw<P  0@0X0m\j8@`(0  0  00`0P@0@@s00 S000P 00 pP0Tq1!0 1!_q  pP0p 0h0e0$0e0 p00 h00mpPpp(q1!0 1!3q0 D opP0q1!0 1!q;0S 0 SZhp%  $ p4"4$!$8("( #8 㫂x:xx P| 0080f L @000$000000 00mpPdpp`p1!0 1!p0 DopPO0Kp1!0 1!pT90S 0 SZhp . qp.$ mp p4"4$!$8("( #8 . H. D0@ 0 @HX3 001HS00C8@ă#8"@ē1V0:8SxSp!@ ! !$ !$Wpp0`F001X00C @ģ1V/ w4pX1\!0 X1\!?p_ 000 0 jS  0Rk(wp(!, (!0!,4 0!4pp0 0HX,voH1L!0 H1L!pop 0 0CS0S5 0R1o`1d!`h0 `1d!o p @  0Ro6 W'9000 00 00000`5 xP000`00x0P0p 4  000 3S0H L0SP0\ 0X0<   0CS00S0 00040 PAp0060J R0 w Su 0 hPm xi p@Tg $ d13$0(40D1;S3`1B&80S X00 00D 080  0" 70P00SJ S0703 oP2T"0P22 T"o@ 0!0CS103/XQ, ` R 2000Cp!0C,0, 2R , ^0 SQ h!\00CS !0$< Co\P  P0 PQ t0CS,20l1\0h1V0CP C\|4!$Rx:+Ru, R0C HQ L!0CSڤ10C(q0``Fn1x!0| x!!| 1!n1!0CS0X1C 10C10    BR901! Va0 BR1011v 01Ro%h0S dA ДddA0%c\"cdaAAA,%cH"cd8&cEcD"cH?8%cx"c4%c|"c,c`@dn@d00SH00S$0p'P1N w\P 0 %$@! 0R00S 0@oP @n1!0 1! n Uo$4RX00D0 080 0 0hP `Am1!0 1!m@` 000dmX2\"0 X2\"8%Pc20$ZPy0Sv0 0Sq* Pm0B @S0Vg<0`r !$!01m1!0 10! 00 0 00/ m0S `0S !  @ k 2 ?000  1Rd<k(!,x< (!0!,4 0!4k030H0B0 !L010T0T L0pCpWG<jH1L!0H1 = L!j =VYjP1T!0P1D=/T!j ; S 0 !0CSF@c1Sq 1Rm0m00j`1d!0 `1d!j ggT0L `CX0S  t1BQ 0C  0C0CST>0l1\0h1)  1R ;.0CS 0jP1T!0P1>/T!6040^;}j0 0 0 jo=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ So9jh1l!0 h1l!Dj!P 0Q/ 0;`80  BR0!0CSlxj0 0 0 $jx]0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS ڶip1t!0 p1t!iU0404 (0pCix!| x!!| !i,0SC H!R 0L0CS86A 01R8 1 03/ W91X0C1?0 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS908 P(50O !10CS0X110C11W0#4 500( 50C01 0S 1  Q 40?0&  0; % 0S 0;841  0S 31 V!0R1$ S *sh1!0 1!h$0$ 10101\1S$05\150 0 !$10BS$!% <x 5S <q0 W0P00J  0S0 B; S1 00S220 0S010;0 0;D821(211 ?PFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S hW0 h0 0w0 04 S0 0P0000  h-5 )500S!>6 l 9&00090 S   hOdD"cdv@Ec%c%c,%cH"cd@-0  0'S(.P L@g1!0 1!g$0 sLd 0`( "4`#/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0:0@p@-P!T1PB1AP \`zX1+8T@1D01@ xSx0 S 0; S0Ҳ;p*A@EcO-0M@S 0 S/p`V 0S?(<(PP p( !R `0d  Sp3p# RppWO^hPPC 0S0S0S ᳍ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4>F00P4%41584F00P8%8150<01@00D00S^ P0Sd P.P%p0'T00Sf 0 0C1!4!R4!480P00L00T000(00 :0Px  10S00(|! (  0B00  00!0CS41a-V`!;p0\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 GP0;00UA(0SP kUP!gE0PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSP'P8#P90&pwHp30 @P&QR P0S0S0S0s  `F1S`pPpV1S\PE80P H0Q8S80P H0 8(@0D S8D!00C S:08P0 R<P 8P0STP 41R1'!0!0S01Q441r0\?0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP1800;V PF03 PE UV"0k80_P Pp0H00(000S4 LP08HP, Z( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 00 5`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#EЍ1 @a0 40K0 `0  X `4000:80U040D3 d00S0U0S- 0 0 0 3dDpP 4 00S<N07bc024"0 024"c p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PHv0QAQQ0 3SH L0SP0\ 00<  0CU4 00 0000 Z 0 S 0 0$00 ($ QdXLDv0 Pe"cd"c{@x"c4%c|"c@%cd%c a);AOAȑe@_A8%cdEc%cdp@Fc0 0 0 0 80McvpP> x4 00S$0B P/ 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RLLu8 OD Q pQ   AQ U 0 BRU RZ ȡbX"\ X"\b ( @0% 00   V  ` D & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1Pb004 0 004 [b`P 0R 0!S S{ 8P K0;t40840` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S>l   '8<P0S 040Q: Q6 @ Q1J0 A\-Pap B B0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRpp%c%cp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R j1M  0MX @p@-PUp@`D0P 4 U80Pp`d  H Q1Q44!<010p@x"cp@-PUp@`[0P 4 \W[0Pp`d  H Q1Q44![010p@x"c@-0 D4DJdd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0  :0p@-T0@00SDP@q T$3Sp0p@c[ȑeđevAx"c.)@- @7)A-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S 00PP   ( + 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8SpZ0pP(P0 00 00 + Ve1 R30 3R0(4"<0 00P0 0 0Z0(0   0b*0 $   L3 Ჰ0V 00 0S8 @N,Ѝ0 ""R R2 Bp ,    ""!R!3 Q@ 0Q #@@Z0 ; 0P0 0 0 0 up( -@P 1  Q 6 1C0 00 0 0p0(P 0( IQ Vᴰ 0S`00000S ZX0 00V U0S R Z `0X0T`P0,ЍOF}1`0S05T`P,ЍO/ȑe0"c<&cX&cp@-A3???H2S L2P"0S0R201T2!211C1S03S0#00"0P0S$2$p00S(2(`0`\0P0`1PP1P!UP3,b0Rn;P!<0824px"cEcT%cX%c\%c`%c0@-0PMX"@Y0 0`0 80@0@y` v&\(& Ѝ0x"cdAG-`P<a@P1 /(N=0 0  1! p`1!1尠 (p( WpV V 8`h]c@`0@00T0P01H0,1@0Cp1_@0Pd"c@0"c4"cdXdp@-P@T @p R00 0R010  G-`0! 1(pP0C 82BJ@k0:0NiP 000B:000([[(0, a0 (0, (e[@pv(@JW@mB|bO@P 00S X@ 0<1P0 PY 0 00T0 PY 0 8P 0 0x0| 0?P0 0y* .:P03 ( 00j 0 0? 0 bded =zA-0(pW ;@SP`0;g(Z0 0 0 (Z<U>0SPT0(Z 0$ 0 0$ d 00!/dA-p`嚯PUAӯ@T P P (Z0 0 0 (Z~0:0aPed@-@01S001d0SfC-0`S,M(P@%Pt!0@ S 0\q\1 00 DLS<10S UA 0 Sp< ( 0R*T ,Ѝ O' 0T0!  00VP@ 00dSP`00S H00@ C3SR p0/@!@<*Дd)%@)d0S,4! x!/@-@0M '<01,0 00 0R0Ѝ,!)!@Дd@-( (0 帿*NЍt )ДdP Q Q@\ \2SQ Q @00P1Q0 Q(000S@080P1/x"cDdG-P0S`(eA``"0R^ !QOd2S01q1O@T@!A0S(VXA``2SN ̐ H"AP<dBT@pp0;PA`uV pt00KT *0D80 T1PG#h"R l2S0Pp2S<0h2S lBT@GPpBT<@x"cEc<"@,cp@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 %X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS U~    ~ 8z2tЍTx"c!)d@-0S6& ЍS6&kA0b? S /A-@P(p[T0`8@ TL3K@D0S@D0S@DV x0|  0T@ D7X0 P1XpVL 0   @T8A%815A8x"c,c0S0 S(00 b/ R /0SA-0`S0MUPSPQ 2q0@S0@?oR20S@Z P0@S PaQL |L0 000 0HP  0 00TP! Q U0`0@S010@Sʲ0TT#T1X%XS !0P90D0Ѝ  10CSa0Tw00000090P4 W R0( @Q+ Q 0p00 0dP00S @0G3WS "$!>20 2 0 $0 80  兽W 0/@Дd)dh8(p@-0P@(W1 01  (p@WdA-8pP(`@W1!01@@(AWd 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B r=0C=d@-@P 0q;@0:P@P@ 0 \3\#  0@Ec$G)O-m0@SM S( /Y`P@$00#.0#A0@.H>@$00#|[4 0 00 PU `0S l<P  <PPd%@-0@ 0@00 00@@aY$$00S@ ЍAdd%O-4b@=PSPPm0S S8 > t00#.0#8.> p00#`3 p\V 1  xQ6T1!0 1!T 6 T00;c1S 0 0A0 0g!P00@0@00=0=T1!0 1!T ЍO-0R:{T1 01T 0SH 0 A SS0!\ 0 d%H%cddA-P`ATAAp@O-5$❽P0`0000 Q ""g! `0 f! ""d! 0 e!;0=0h0p1P`7`M@`/S2"0 2"S R0`0063hYh0S h 0R 0  ) 4 0& 0 d0d  99d07i0Sf006S 40SG Py0r` 1 111101000 1,10;1(!U CS0 0 0 NS; 10S0;0; 10S080;;;S;10SP |10SAPX+ 0S01S0!41010$101 100010 X0 S,!0 CR,10t0R1!0 1!Rn@PP000` 0 0X 00岧d@vcEc@%c8%cx"c4%c|"ce@-Pp`B@ ZPP Ѝ@0 0CS4`&R! !R:d@-@p`P 5@P Ѝ@0S; +R0;8`jR1!0 1!uR dO-MP ` pPTX ! R@ BPQ # 0R    ,`" 0 \"Pߍ0S  PP* `CR2 "0 2 "'RX P 븀1 d0#PR0 0 00 00 RW@hTX w  l13 -3[Ḁ000Sf Sm `20;0 ǪPm1 [XX0100Ch01d00= S;0;0`0`S0012010#R0* S 0  L10S;0; 0?S,10S;0;0 0UPP${Q0 0 00 00 Qz6000 j000 `NQ2"0 2"O$cddd,c@%c8%c@-@R$M,0  $Ѝ@dpP  % Q" 10SJ 0CS1) wO00 00A 00 0( 18$Ѝ0a1;08C8 S; 0;PH0L 0 H0L P>Q<PP0T 0 P0T PPT1X! 1C1S01S01S0# 01S ;SP0 0 0 P01;SP!T11T10P1000110H1;S0;0103/._e"ct )Дdd@Ecp@-@Q}0  p@趥8P ;` S0 D1 B00R *PT11XC1S014cR :gPx0| 0 x0| rP<~YPX0\ 0 X0\ dP0000eddP%c@-@aM20  Ѝ@j`pP HQ/P`0d 0 `0d :P;S6S00 (  1( 1S D  B0R#*Ph0l 0 h0l P00  B !  )x01T01Op0t 0 p0t O<eddEcp@-@Pʤ0  p@`P 01; S !R D0D00CR:001$edEc@-T@圤aKH 04004 000Τ@0e$cdEcdx0 R   R-  R   R   R-  R/  / b /P%cEcgfff@-V@0 e갤d_)p@-@TPO0==09#9S p@脤P 000e@-@[8Y`W@T0S-//A-P@apa.1`P1!`75; C("(R1S00 111; SQ0A?0 EcC-MP00`0p0 0` @A0 P  0`  00 000 0@?o2P0S R0 ЍO-M0l4@3`rXVP 0 S0  J@DT0V0 00p020@3啣@`T0V2|p3ȣ+0 S0 00(0 0000GVP -(0@D00S Se [030#X0S -(QP 3団 ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U(!  (@0 ( !( 0 `d (t0T0l Sh pq xy!&^? 0|10  @J30 0( 0,(0 8( 0%(0 @ D  H d L 1P0 0T00S0+0X \00U(,  (@0 ( !( d0 x ` ( t00 lqh  p &'T0S^0yx1&^? 0|10P0  @J0 0( 0(0 8( 00 K =00Hs }@ @ce-$M840, (  0L$Ѝd7@-PQ@ PP ]R R #gP Ѝ000@-MBc0 嗴0P (P W PU 00 00!0 0U@P5xЍ Ѝ@@ДdO-GMp!Z`@D1LR @Gߍ RP@ S @  R!JoQ 婒[ PR 00 0@H ,`(p 008P40$@@ @  0!>4 ,`(p 008P0$@@ @d> 00!T> 0L>4p,`(p008P0$@ @> 00!> ,`(p008P40$@@ @"040= 00!= ,`(p008P0$@@ @x= 00!d= 4,`(p008P0$@@ @(= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @o 040< 00!t< ,`(p008P0$@@ @Y 0!0< 0<4 ,`(p0@08P0$@ @@ @A 0!;0< ,`(p0L08P40$@ @@ @*; 00!x;0<0L 0,P($@@ @ 0 !(;B0 ;L$ 00,P( @ @ 040: 00l!: ,`(p008P0$@ @: 00 !:4 ,`(p008P0$@ @040@: 00!0: ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @040P9 00D!@9 ,`(p008P0$@ @y0409 00!8 ,`(p008P0$@ @b0408 00!8 ,`(p008P0$@ @K0 400!L8 0 <,`(p008P0$@ @@ @40408 00!7 ,`(p008P0$@@ @0407 00!7 ,`(p008P0$@@ @040`7 00!P7 ,`(p008P0$@@ @0407 00x!6 ,`(p008P0$@ @0 40D0!6 ,`(p$p008P0 @ @040`6 00!P6 ,`(p008P0$@@ @6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @~p5 00!`5 ,`(p008P40$@@ @i$5 00!5 ,`(p008P40$@@ @T4 00!4 ,`(p008P40$@@ @?4 00!|4 ,`(p008P40$@@ @*@4 00!04 ,`(p008P40$@@ @3 00!3 ,`(p008P40$@@ @ 0!300T 0a,P($@ @4 040 010 f1 SRBA^E0 0 0 iE0;0`1\ 0@ ɮ@P a "A@P T0Sӯ7@S=0f1,cdEcG-PU@ p@`R000S S @ Ꮾ@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; Q@P p@-@T P0`SDpS=pp@-@T P0`S0S\=ppA-0`SP@p0S9@@+0S ;2XR* 0R 001000@0oljx7@A-`@pP8000S S/@X>2D@>4Aϟ 塪@[PeДd0S p@-P_@5:@p/0S) A-@P`pLT0S1@ 0 `1 &!#00a!0 `10#`11<1/A-@0S `pTP 0S @X;^@0S p@-@`1P Mp/A-@`00p0S 0S 1;10;0PPPQ011PPQ7PH0PP [0 1Sx01Дdh%cG-p0M0@`0S6@ЍZP V V @|  @@  h`Y`r Yt3HX@P 0R000@P0S@+S; @P@T 2i TA @P@T t2S TA r@P@T (2@ TA _@P@T 1- TA1HXg00 0S;   ; 0= S00 000`0`S0e00d10200q0 000=KD1 P@@1T#3=P012|=T0814X0!\!1 l0 1pp|00t00 p x0200002020-1111*@ @Ec@Ec@-;@SS8#8S TS0 T @0;@0;;S0(P ; S Q 00?0; S0P 0PD00  P $00  P Ec%c%c;S{p@-0@(P0 Qp@@P p0S p@-P-@p/0S/p@-P@p@p@-0S@ `@Pi@P ]@pO-QM⸀ 0S S4 Ѝd1p`1`\1@X1P 0` "0 0 00  00P 00 0 0b0?o2P0S0S*  BR 0p0`0@0S`` S`V WpS0 0SPP/CjRP#US@@Ӗ/CjR@#TH!c4!cD!c@!c @%c%c%c%c@- @ 긂BAAAp@-@\41P!l P301108480pp@-@\41P!V 00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0 $%c %c;S/0H @-0@0@Tw (0S w @ؤdp%cEAA-;@S0;)`! AR80;p4Q H0  CPPP 00!0C,2#41000&ЍA0404Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m Y0!aq?A3c 2#!0C01' Aat14X6' $A$A! T@T(#3#  p0p [(1!20  0  [@ @0`FB`%d1 #<S01R4!41$Ѝ 0  0   0 0$ЍOMb̫gfffA-p@`{P  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   hdxd@dddO-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 D!P- 4!P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   hdxd@dddO-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000hdd@ddȦdxdO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:hd@\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /hdp@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>0`0"#0 0 /0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` 幌@|pG M @I(PU@T D0D 0?8cތЍ 0@0$@edEcgfffԧd%cДdO- S@Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0S' pW* '078!800$0#1S<0P%1P%PDЍ00a@p@-@P!t `0D0034 0 0 %0 0%0phdp@-@Pt `080034 0 n0 f%0 0%0phdp@-@`?PPpP 0V 0 10 V& Zp0% 8 4 &#&#(    % ( %    % (0 @10(0D`04`06% 36 3(00000%0(0% 0 000%0e 00#2%0(0@10(0RO-@PlM3 $00 8%P !  ( %qp P$ 0`@  KPP 8<% 0 ! ! % 0 0`48(0@$00$0lЍX   %`0!&bPP` 8<DT0 4D0%0 010102%000(0C-MP 0`p` @y0 0 00  00P 0 0@?o2P0S00D DSS  S00 Ѝ%c%c@-@ 4101H00H0101p00p0101000 20 2000800 u$00 ohdp)%c%c40!( ( "P @@ /-//-/-/@-$0$ ݚH{6 0(%cd-$M840, (  0( 㒫$Ѝd@-bHA@-^HA@-@ᔸᒸ-託1M/ A-P0p`0帻@P& d0 0  0 4 0vPP@ca(E5004 0 004 (P5Ѝd@-@(0((0M @XL@-@0S 0S <kP0 0  0 4P d0"c%c-/ 0!< 04 0 (   !/@cdddQA A-P,p@`10 00S S S ,00S @$!,0( "(0P x@(40 0 0 (4ṍ3 40 0S 0 2P/d%c\ P/0 !8 0 0 (  , !/@cdddA-@pP` 6@PoA-@`pP @`p@-@P<`R0l̚凉Kpedp@-P`@ə=pp@-P`@˙1pp@-P@'pp@-@`P101Ξ 000ڛpTd1S/0%c) 0O-@P`DM!2 0 0 0`,@(P$   0p!t2 0 0 4`0p,@(P$  40 0 00'!2 0 08`0p,@(P$ @0 0 0!1 0 08`4@0p,@(P$ @~0400 0 0!l1 0 08`0p,@(P$ @g 0!$1  0 08`4P0p,@(P$ @Q0400 00!0 00 0 08`0p,@(P$ 8 0!x0 0p0 0 08`40p,@(P$ "DЍO9AA%cAAAAdtc)OA4)^B\ 0 \ /JKxG-DhM (`030 0 0 (:3 0Sp * 00⌸P  00 Qp%p *TEW (30 0 0 (3hЍ  ^P p 0S 4"4 8T"T#8X%XU (20 0 0 (2 S A0  PP !> 12! P0 P $00S"(P,PHpWh P 0Xp  L0P L0 Qp%p :W 00USx 28 Ⰳ&0 N3T⼄&04` 0L 0vp 0(P\j y2(0, 0 (0, r$P2!0$0劙PP4(_280< 0 80< (j2"$T͙PP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX 2 0$ 0 0$ (2 0 PR PdA@-0S0SP0!0@SP R \`0  0 0 00wЍ 0宗0@)dh8(A-0`0P@Xp X/@0S  N0S  ᠳ@ЍV0dS*@P)@P0S S @d0ፂ@P>p@-40 R@  000  嗨/ Ѝ@-40@ R  000 Ӭ 倨 ڧЍX0 0&C-PMp@;~ 0`  `0 P 00 000 0@?o2P0SP QPX@P QP,M~Ѝ譨Q bꀿc&c%c-$M840, (  0 $Ѝ d1M/ G-PQp`{ PW@50 0U00 p` * P@ P  #RH LQP\ Vx!` V U  TS#3V\C  .QP V P pX.XLppPI>Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B Ze@-`P@M 8p.-( .h`(( .$( `p0d9ЍA0@-ASS!0CS0Sf )(B +1Q (A 0 0 0 B(A 0 0 0"(A 0 0 0 0(A 0$ 0 0'A (0, 0 (0, 'A 004 00 00 Q Q'B 0 0 0 'B 0 0 0 @'Q Q Q'B 'B 'B 'B d @ @O-M @0(`PP∁pPQ 860S ,60S 0F00V < P 1  Qm:YE' 8$(0 8$('Pߍ0P0@`0 h PhP 0S!00S 50S  .8'$090S 40S  .''00$09DP<'C 0$ 0 0$ F'h40P2 0 R 0S 40S 0  #08 ͤ P! 30S  .&0  |#08\30S 0  <#0L ᡤ@0S 30S 0  ~"0|00@` S1 Ko0nP [ 20S{  00 _x"0]0 ((C]TlTP<20S 0  H"08^8P< R 50 00Sၡ  10SG  .d&0  5&J!09840+000 0VP[?hhZ{*X10SS<{t fe a  \0086lBύdp0‐0 0  P t]{D0Bύ1v`&c&cA dP'c @AHAAA*AlAAAA%cc(&c)O-PM'U@|50S p50h5h%h0(0007 U(UL p0( \(E⛥0/S0&@PE ( p3((0K0:00p\(`)1P440P,0( HDP PPPH0 p,'PHץU 440S .p%$$Pp0c70/S0@PЍ/PPL 0`00:00pPW |1000p:P( :0,PR 0 <0X30 P0#1 P,FP0: S |!  |!  V )V `F|!V.`2xtPp0P*:p{PP 0P` A:UcP200S F  R("`F|1V,`  [ w|1 000n 000f 000^ 000V 000N 000F 000>1!0 1!60!  ! . 000& 000 000 000 000P'cA @RAA%c @X&c @O-(PWM@PEe~P |1 00U0~$ 8$(0 8$($|1 0 00  0'S(㨧@P`$ 8$(0 8$(k$|1 0 00 @00000 0S0% %` * D0⬩P D0 Q`%` *7@V   刧@P 0 0`0: 0P,0 ,>0S 0P. `#,00-0P5$(8,(0 (8,(#0夝B?! !$X10HS$`=0S 0p. #0J. #200-50SN,0H S00,H|1X1800S 000 R0  0P 0 Qi:Y X<0mdPPj  000;[3 00/Upx# 8$(0 8$(#ሦ|1 000  0040004 0$0[ 0$A [A K#8(0 8(V# (0,0[(0, |1 80<0[80<|PPP @ 0 R 0 3SH0L0S 0 z`P0@`%P@0 R0  H0mP H 0Q:00S U  "88<(0 88 4<($$0 4 $$"T#|1 @0D0@0D[ U%|1X0p t p tP Khx | x |K|1 000U"084(0 084(WT80S U8 UP 0P0S0%0 * L0P L0 QH: 000S 70PX7`yP*0S00S# o7D0S[ ᕡPP 0  3S H0L RPp\0p0pG4pGWϢK700 0 4"4 (0)Y0C$0pC0IS `p<00SW 00S S4 ` 0 SW`` W  0{ tP  ;c0S 7  P` 0 S 0IS50 %0IS00|5PP 0S `Jz 0S  0R`%` *  P03`P P0 Q``V 0W0 V P XW$00C (0R0 RQ0H000p \ ?^R$00CSᤤ\HX R(\0P8 40 P8 40 0p( CR G0 Rʅ0pG00SpH3```-Pxp`bp8`ᇠPPk >X((  (Y0 Y Y )02s0 (0Ddb'!88<(0 88x4<(|$0x4 |$,!( ^000<(0 0 ?o2R0S (Pp'`5100T0TpW^ 0 00~G940W06p P2X00PX$0XDHX$0S: J}0508 X`p00S(0S `p$0P0$0`6aP P P 0  0 40S PH0\0\X DH0 0  00 01`0`pW ~G pp<`J0M dAP'c !@AA @ @ @%c @eZeZed"@ped)024 80C)0 280`0yP 0S(0 0(008 )0 (  00E0 #R HL R\0P  0800B00V0080$00 ^ '5V4810d0dY~I0(0 00980Y 2h0hpW DpGWV1p0pY~I(0 0#R00 S( ,00S 0(0 S  0S 0 0H0l0lpS`000h`P P P0  0 80S 0S2<244Jx,0800u0 0 0 000 < H00< P0000?00CP10 $ $0 0`9a$00$000C0,00,0ppEp[3( 0Wp ( 0 4'04pp(p2U|1 H0L0H0L0S|1 P0T0[P0T0US ḥP 0Y Y|1 X0\0[X0\U៥P =V;V|1 `0d0[`0dUᇥP QQs|1 h0l0[h0l'UwoPXV\[Ug00`0S0% % *0 t0lP t 00Q:00S 8$(0 8$( OWߍPp00,W0{ AWC +W_ 0V`0 0 0<P 00 Q:``V ,0P0K 帰0 0  _P0 _0SU 3(3W <W R00  x0P x 0QO:00S  3W Q  Qp R00  |0ܣPx | 0Q1:00So  [00  0ţPa 0Q:00SX ,Ro PT30@`:0000000P쐍Sp00,P9 T92#0Sp  3/kx9`V"U d 90S(00  0 y-彝(0 ,0S(hY0S80:S50S0S0S0S  P#0S0S0S0S  yP R 0!0# U pPP`d ;0S(00  0 -^(0 ͸0S(Ḡ嶠00K嬠P0T 0S P0T [ 6\ 0O-@P`DM! 7 ,@0 0 0`(P$  4 0:p!6 ,@0 04`0p(P$   0!6 06 004,@0 0 8`0p(P$ D6 00'!,6 ,@0 08`40p(P$ 0405 00!5 05 ,@0 08`0p(P$ ټ0405 00!5 ,@0 08`0p(P$ ¼0 4004!05 ,@ 0 08`0p(P$ 嫼 0400 0 0!4 ,@0 08`0p(P$ 唼 0400 0 0!|4 ,@0 08`0p(P$ }0400 0 0!$4 ,@0 08`0p(P$ f3 4@,@ 0 08`0p(P$ P 0403 00!|3 ,@0 08`0p(P$ 9 04083 00!(3 ,@0 08`0p(P$ "0402 00!2 ,@0 08`0p(P$  0㔢40 0 00!|2 ,@0 08`0p(P$ 040 0 0 0!$2 ,@0 08`0p(P$ ܻ0401 00!1 ,@0 08`0p(P$ Ż0400 0 0!x1 00 ,@0 08`0p(P$ 孻0400 0 0!1 00 ,@0 08`0p(P$ 啻7D pp0@ P0 p}DЍA(Ap)^B&cA&c`)A'c.A'c8ABAPA^AmAX'cyA%cA&cA%cAAP'cAAAc&c dH *p@-P 1@luph 0S Q0P@@@040p@pPpp@ 0ꀿc%c%cG-S@`p[0 0 0 f0  K0 0 0 V[X 'R 3SH0L0S(u@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0mP 0 Q% *D-Q  8$(0 8$(Ѝ0 #0C?o231 姊P (MQMa⃚  #RH L0S0P  0@0 0 0 o0H   C/R00C00000T 10S q?!_,0( 0 (  /R 3SH0L0S0͝@P  \ \(`)p0, 0q`1 01  z(Y{ dA&c%c(dP'c!@AO-0p'S(,`(㔝@P  P [ P |[P  0 ЍO@ЍOLЍ@-0  冺 dC-0@4M02`PPQ7P(Rro֙V 00SS*4ЍC8o6o 1`1 dP +[0S  .4Ѝ.⣗@P 400   0 MP ᓗn@T;oP XX ၗ@n ᅙnXT 40 X`0d 0S S :H0$U0*`B 004 0 004 `Pd03/@%cc) dO-p,00,0,0 0  hЍ8d>*p@-@,0 `0,0)OjQU 0S   jC@djPTsj1S! 1! 01>jj01ip@npP70S . 0(0000%&i1尷S 0 qZiǟhp`Lp DdxH\MUPD ɑ0P   0P 0 ὑ4  X0007`  ఍1kP ~H U  0! 0HPទ0 >0PH60Sh  .0000H&H0 0h! 0R 1hZ s5% 0 3 P 0 L>PBx50S  .|0000x%x0V% N0L00 M0[0TP >P  "P! 44 X0004`  ఍1P Uh1xS 0 hH0U  ፐHP 0 =Pl 9h1S 0 ohCP 3(0,0<,0\rP/ dp p,0) 81# <=40$0 00}~~0PT`P X#X$=V P=<3`U F6pKY @h ~;P $0S(P[ 0SX0S `P H0S 0S P}pPԀ pMH0S 0S  PkP H)0S  0ZP (h0s0 0000s0 000d0 8Q00 00 qP 10S000d0 00[ Z 0Xz W fUgK'D `Pg'XX H0W40$&cP'c@!@ARAA577Q 70S&6 32 -$6U 6U 6US#6U W 6U 6U037U d60SW 0 m460S5[ 1U0  5U7 0 U5ꌥ UE5U946`0U 77CQ0CU,03@5E04C@T 0S@  R7 HOP @$5@U/ 046U0UZ %7CQ0CUU 4D04U @4U0CU+0CU 40S40SO|4[t U* d4U1U '0CU0CU:TR1d$4U 4U 0U 4U3U3#0S00T !3R/@ Uq 3U] d0.h@l 0 @Th@lp@t 0 @Tp@t.0@0 0X Ra 3噀\U 3 @X@N `  |1+:`.|1. 1!Q 1!)x 00/h00l p0/0t x00|06b 1 H/b00TU `@TK 00TF 0s SP@@P0A @PA @t 0P T A @P0A @PAUiikiii miHsi iViWiHMi >ojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi (!@ixYdO-pMD-P@`UT D" P5TX@@0S0 00SDPsM PT v ` Z` `$4R@@00S0 800S DT@ 4Q@8&c80S/A-3`A0ASHMp!DP@$T!HЍ00S1a!0 000S)kP% 00000S .` n  0L0 00?d0Ei!PaD@09@&cP'c!@DAEc@-@9@A-HM`RpG!DP\@T b!L|1S  00 0HЍ00S!daO!E00S .`  P P00000!PLaD+@P'c!@]A@-@|1@ uQCp@-@P P oppp@-`VPVVu9QL t0@0L0`0D00@0 0<0(080,040D00040,000t@pA*DA*@*@*C*?*P?*?*p@-P@t0@`0`9`VV #Lp@Ve0008C00 0/p@- @P!>00000pp@-@P 00000000p@-@ M Ѝp@-@YVPqVPp@-@0Q$MG 'R`l P'RX9("($( 0t0  0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@XPAQ R000CS1uAAA-`pP@200SD0CS+ XP 40GSFV`#0F0H PB  P< V? /030#S00 D to`( o\Q\ X ^ QPQ `P H000S D0CS #S S Ѝ%S000 00 00 00 00 00000V0S  0000%c%cQRI p@-`@M 0 C^.^ P?R1  000 C0PU'X gX X XX V`0 0<000 qKP`ЍpA ER PPC/C-40@SOM  S|1 0 0 0|1 00 0Oߍ R@D  Q *40S $0OߍCS S #3R x40S l$p0|1 0 0; LT, >`P2 p Y4Bύa`a`001411 0``1P x30S 0x#xp|10 0(0 SX#2q12L PP ` 2P<2034P09P 20S 0";XT pPO\20S 0l"p(020S 000<"D000000 00000000 JP1B110 0141P /P h10S 0!"3"p'qr `10$0$PU ~_EU%X `!` 1 `  !> 000S0 XZP,d0)1PU  PP 0@0Ѝ R S 0S0S0S d0.ZP 00\'c0!@0SE0@-@8P<$MP 0S$ 0R ᖃჃPzP0S0S0s!.0  ↃP $Ѝ0 PS0S ,0 @@H/8IO-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  mP0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 7l0` x0(0t 00` 0kdP 0S10 0 P_04 @4帐3V &WQx EDZ0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +]i 00000S P0`( "4`4# :000[ vZ! PU1P iP P1P0P\'c@c<&cO-p((T"\P ,w\M0 0X " %X " app@T W% Pa@TFЍ R0S d  &R&R W d   PD @ 1(E a0@1T  R0S d  &R &Rd   P @ R0S d  &R &R W d   PP @T R R @@"@0S/ 0@-S0S   Q Q> (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 0j!0.Ѝ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50A>@p@-@08M S8Ѝp@uP`.p 4"48 #8008ЍpA 0 /%c>@- @(㖠6)C-C&<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00@dG-@Q M`@pI YF 0S BP)`0d 0 `0d 4/@P Ѝ  0sPP 4@@ W  /PA0 0 0 A@ H-PH0S |1 X0\0X0\0S1 0S.0s+ 7 0 5PP-TA  0S# UQ H0Q SppW |1 X0\0X0\~00AR@T dO-7M#2p嬠1 20Z@0000<SP000[d0# 0S P SX@P@ @d0< 6PPd`VH0BX40@P= 3PAP<s~0\00C?o20S +X@PP Z@[V `VS 0S0S0S 0SG  fI6lpT6dTP(:1PL0 T QPWL0 @Z M?PP ZVL5 #2!12ЍPP`Z@W 0S0S0S 0S PT ( ?PP(0p040p800`8P0 0UA_EUV: 4 @>PA40 R=`0d3l 00p0S/ 0 d>P), d>P#0 ,0R030S `0 @$04P```0s 0@0P1<0(   w PJ$0 0 0 /|1 0 00 0M9)0 9)R @ =02F?! !2S28(0 8(8(0 8(0'S( w0 `R 0 0 0 |1 0 00 1 R  RQ Q$Q Q  \| R\ |0 0 0 |1 0$0 0$ vy0'S(vP _ p (~00! !0(  ~vP j<,0 <,u 0` 4P X0 0 0 4 P 4 P}40P0:>0 00S1|1 000P4:pWP p#0 0 0 @0D 0 @0D (|1 80<080< s99LD00H00 \0 $0DVs$0pSB pph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ T0 0 0 x $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,.P CP0 0 0 [@` 8#(#Q@;( <s.P $0R (0R(0, 0(080 , 0< 800 < a ((@004 0 004 'PlP "0 00(00YsP p0 3SH0L RP0H0 0AaT +pP (@(@@42P@TL000S;  U+ . LP. 00;#0P0m|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  4l 4 P" $P|;<3x0S00C0xP唀R P|P; .H:@P XA@H0 |Ѝ0 d0# 0# 0# 0# 0# 0#$ 0#01q5 %0 5 %W5%h0 50%$%0 0$%3P 7 P $P0S p   |ЍONnPP20'S 0 3SH0L0S()kPP 00# 0# 0# 0# 0# 0#$ 0# 1q0000W 2P2j dP $^P0Sp0( mP2j P2PLpH0082`p dR lR5 2j 2 =  0010p8#8Wp WpdW  lW0 H pp'h5l%0 h5l%, 0 @00a5%0 % 5Z 0@$0 x00 a000310吀00 0P0 pS  R 00D%0 00D%"25j 0p0d&cH&cϺA Add&cxd?AO-B0`00 0 0 (ppGW 0 0 0 j"0W0PP 0RPP 0HlP 0 PRPP0 0 0  ЍU 0  R 0 0 0 0S00 g>P 0 0 0  [A 0$ 0 0$  0R*`./W0 0 0 y(0, 0 (0, 00`S 0S 00 k@Tz f0<< Ì0LQ@  "dA&cxdP%@03" /@cA-p`Pbe@P7Ue0f P@A-0@(S`p]ePP4i7f($f( 0(0C00(00@ ^@@A-0@0t0Pt00`0x0x0|0|00S 0PO 000S 0PA  180S ppq0P82  8"<0S ppq0P<#  <p0S ppq0Pp  p@0Sppq0P@  @P 0P 08P 0<P 0pP 0@P70-l 0/G- @XPp i`P @f<,0 <,qvh|10 0 mh2`3 0  Gd7@-0@ Q)R*SP S |P0sS  Ѝ0 :R0S00:S{@- @"00t0x0|0qp@-``.Q00S@P P 000/U00S00=U00S0t00U00S  eP /001U00S 8P /080#U00S <P /0<03U00S @P /0H@0d2U`VppP /0p0pA-`P0 ,0@p4(ЍR GR*S # GR$1R # GR V R  R R  R  R R.c\00S 0S0S0S 0S0S D`X=Pb_P0/PQ  SV0  R0V0t0V0  R0 000 0 00PxV0 Vr0So R/lSi0S 0S0S0S] 0SZ 1$PU0.P 7I0 000 0 00P>V1q V8 00V41.P 80 000 0 00PVR V 00VჁ#W<`p`.P kV39V0 SRx03V\0 R000&V0 R|0l%@%@\'c@-@0PS`pMf.P7 a,0 00000(000Ѝp@-P`M.@P J [P `.@p@-@PF@U.G-hMP pሠz@P0S( 0$0 @@@0 0P @ P =P@9hЍRsZ p0S @( @0 ,0" r!.$  ,00( $@-cP@@c`P H0 <@c@cZ 0(<$0G- pMS@P  )S *@B pGWP P @9p}d@4pcP P*0+`0G<S000 000 0 00g@P,z@P9WgWl;pGWp0  R0@pЍ d0R88d0_ A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R55+0 @@0 0@P d0R55 Py@P A0:Py@P A0 ,P9 y@P -m A 0h@`@`T ,@P 8@`0`0000( 0CS0 PTyP`PP  :P 0'3Sб100S@7 0R;0S8@T5,@1P/yPP0  R00sh700 yP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s pDb PU:  `V 3S100 $"PpW0 $ P 0S 0 000V $P p4 xPr408 0<0spafD\ :P` P  K"PRpWO V 0S P p 5XpTP04P h!P`5X00 *-0Ejx@PN0S S Sd04M d044Hd044DSx@P7WW > 40SKW$w#0GS##pc`V S19@ 38`8p40 00@=0 0 pG=g' !4gt# q޿ @(0`0(000 @0R] TQ V0# 3SH L0SP0\ 0p<[ ]P ]0 taX`0d 0 `0d cu< 0CS00S  00 呿Qa 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T `0d 0 `0d P ` @0S 0S0S0 000 `0 0 -P@`p+0S `0 0 0 X0\ 0 X0\ <0S 00(  堪< X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0PP`0D0H0)70Sx1S800X 0Sx1S 7P D`@V<`]PP -`0d 0 `0d 8m0P?o20T00S |1 P0T0P0TD0S`dp H =PxؖPm H0Ritp H $P_ܐpPU H0RQ3{Uyh d00l 0p 0q  ٩>ⰐJύd0]3P^ Ԑ[  Jύt0M3oᩒYL 50S .d D53X%X1`00>X\u`0d 0 `0d V |1 X0\0X0\Y1P@ DL P@ Dg `F0P Tn`0d 0 `0d Px&9QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P08\P T`PH00U@P  Up3\3:$R*PX&D0S *\ U0X x0S 0SX x0S\ 0S L0(0@ 1P>LPpm0 @@NP@0S~R p<,0 <,U@ T0<<0 |1 0003S$R0 0 0 T |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN @1 0R00S  @ P @^D<[<0P[k4[ f40%UߍT@PUPe\c X ( ,0 <#  W lPX0 0 0 c(P@clAT&cP'c&@Ad'c%c(%cȑed$" 0@/D0Q0*$ PP<P0<1 0.WYW=0S RG 0P0P @ $(  $@ 1,PP0 3  10S (10S n@ ,000,0D0 00 p^lS Q0 0 0 P U*Q0 0 0 Ts |1 h0l0h0lj00S p0(0 0l 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0YP@#s7T`0d 0 `0d _0@0 p_]@PWT=p0t 0 p0t H0 0048900(0@0(0l4 000$0( 0S0 s_P 0X    @P 80YP  80  00J04!< 8Q#8<000,0 pA00 0400(4"<$ 00 3_Pu @0 0S @  ( 0x0| 0 x0| T |1 p0t0p0t,WPpmP @0$ ( 00/ 0$ D000@ p@PE\V0 0 0 V |1 X0\0X0\APP/80< S001R  ! @0pS001P0/03" /@cQ/C-@M 0(pP g`Po T0P4`原@0!Q8P=A` A0P4`8@5ЍEc@B(0s/@-@$lU@@ U0(0cO-2+1ip@-@P(Q(P p@Qcp@-@P(Q@ QTpc@-@<~QP @T00 W@QckQcQcP@- P $mRVRPYRcA-p` P: @P700 0 CPJ @@-@08Q00P &Q8 c 0O-p`\+Ad9+AP P0S  (R0\0 /|10 /|10/|10/0)  eA- a M)0 0峋0P00@Tp~OD+) Ѝ|10S 0>CS0 Y10P0G0%U?0T000o Pq-10@T ~ODTeEcK+ee 'c@-4 R0R 0 01= Ѝ,&c$M+0S%p@-PX0\ @06S P `CP6S000c0#06BP00C0p/@-0@0,M`S6S 6Q0C?o20S B,Ѝ@mP@0 P pt0\ 00 00P p$pKcTPOO|1U=`&cp@-0PM@\`P ^(0(S00 V 000 |0 00@X0<8@400 `4 L@cPЍp0  @`Z"@C-1嬁嬑1!$M0婊(#2a12t1P00@TAOD43"`&ab($Ѝ10p WAG(0s! x0@0P Pi(F'P (˽(@STP  (@T(0s x0@0P000b0 0 'ce@cEcK+8e8dG-|1P`p M0K S200S D0CS#@7T3  p  0  0 0 3 @T p Ѝ  R   ` Ra R H0 0 0@ 00 03 S Đ#212 00 020@T D@DT 3"(00S ' P 000 'H00@A@c0@-MC N喉哉00000 0|0c00;@P  ``qXP0P $卉0@ Ѝ0@膉'c@ce8ẹ@O+A e&@AEcK+K+p@-P@0@0d00%0?00:<0?00 0400S 40S3 !0 0p0u%c0p@-P P@YU0 @@@D@H @Pp@0Sl G-@`qQ@ R HQD0PP 9DY1`Q#C 0 0 0 -P &01 0S@0@H0C Q+Q! D R   0L S H0`S@A 0 0 0 D0S L PD R ( 0H0S /&@ 'c d&@AzAAAQ|Q/P/:p@-@P %p@` H*0@-@PP0$M @M|1 03/PM$Ѝ0p@-0 M @`DOPM|1 0@4/@MU 3OT06 Ѝpp@-0@SP M 00S:P  P0@o Ѝp5`+(P 0UPL P MN0P 4   H RNN0P/@- Hk@A@-|1@PH2`PM 0CPi 0Po 7C0CPVP 0P00PЍ1PC '7C 0CPB 0P0  $PP  4`PP 6(06 06$0Xp\00p mvp,p$M<1P 0P,0S0pW 0W pz0'u?0040 0S0$t8 ⾝0-00,0000 0 0$0000000 000S0`V 0V `I0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$PLV_Lx00Cx0,Ѝ PP 0 `O- X@ 0 S [ 000CS00S6 0U$00p 4$_U 0U  0 0 #LU |1<ЍOWX 0U 06&@O-|10@00 A0B} p4(4( :00r᰿000Y0ppH V |1 000|1 000AP4T$0 P4T$HKzl1p 04 0 0$00 $0 P HKMf14p0,00 0 H0,D$P 00S  .p p0y ×jP 5p(0  pp0(00 00@⯗0q@0Ap 5 Boȑe dP'c0'@AA-0 p003A0AS@`姈PE%DP@ 0  P` Ѝ@-P'@AEcMbt+AO-@M`H( P̠5p&I@P T pp0@ppW.I0gJЍ0 00S0V<002101@0` 0(00pp00 0  $0 (0 204 $ (0 P)@T240,0,HDI P0 0  H0,PP 10S .pb!Pp0?HIL002 0SP ZSP0SU  5(0  0(00 00@f0ɑ@0A5 B⤪P 4*4( :0 0,R׽0 00PPV |1 000|1 000p@#X4\$0 X4\$.H>IA0S50 R0PPȑeP'cL'@A dO-OM 0`00p7`00"PP  0R@@  0UNP 0 Q@@TF 8$(0 8$(`Oߍ@0  p `P[H 60S @. `. 00 0P<&<f@(f0S . z0&X0S .0 n0%L0S .@ b%0@e|C 0 0 0 T"0( 0, 0 X5R40S80S<0S% 50S % 5`0 0aP40S .00$0@0Sl40S `$ HP040S  $D@tD`< /KH쀝0XS 0S0S 0X?o20S 30ST #00@pt 0l@P"l3@0@EpP 40` 000S.t @P( 0`00ET 0pP0X 50 00 S 20S @ .I500T"0k JP 20S .w!,0Uu 0$(0,0 QjX 40" N  ZQ- 00C?ot20"0( p0, /l1@ P0ppSp00 p'0S03 2@ O) Q 004 m0S 000 0  00``S`0 `&0S032 @0@ `&cA dP'cZ'@AAAAA#AMAAlAAA!@he  `eG-0P8M ` . 0 08Ѝ` R008ЍGU 03 X,xq@ `P T X8ЍGNT .`  00 }P:0`` 00``0@0@0S `p.` `y0 pVY 0h |1 00T 0H @a}<0 $ A@&c`eLAP'cg'@AEcMbt+hep@-@D_ <PPp@ p@heO-@Mp`,# PP- 0S # Rp @` .pp0.   0"\X XD P20S ", 3I0 00$ 0( 0  0R p0tKP p0 QP FMA 8$(0 8$(,Ѝ0S00S |10S .@\!l@0\aX!XT10    0R  0$KP 0 QP F Tz R 50 00Sa  l00S .@ppXl005 `FLX, @0U`0 00)^P'cu'@AAA dApAAA-/1 -$01019/0!@/-/-/-$M840, (  0N;$Ѝle@-@XHVH-@-p0`0d 0@0S P(00   0D(0 D`0S(`@p_.H,H(0, 0 (0,  Ѝ1M  &_le@-Ľ@-ӽu@-80@0SP 㕽00@P/'c@-_-/p@-@4P(垾᮲ؾpepe@-@k_@-0SP0`000S1P Ѝ~S 0@S0VPP0S 0S0s 0pS 0S 0S 0S@!0P 0 1Pe\'c-/ 0!< 04 0 (   !/@cddd0O-TM$0`1`0(0(0SP ~SN 0PS/@?0S@;00100@P0#212$0,p<∀0 p 80@P $0P0 Q S R` ^ $#2!12TЍ @P @1@e\'c@c 0O-@p`\DM!h! 0  0,p(`$  @Pc 0!! 0  40,p(`$  @Pc 04 00! 0  80,p(`$ c 0!| 0 t  84@0,p(`$ oc  H8u$0DЍAApetc)OAD+^BleO-PcP4M0 0 0  30,QpP0@ 0M F4Ѝ0SD0S S?0S0S0S0S  P-0S0S0S0S  P0s. 80 0 0 C (0Q)0 0 0 4@TW P 0 0CCP ⢷PWpXIP 0 0 0 0 0   0$ 0 0$ ;Y E@P0T 0S P0T g`@PTp |1" 0"0 Uled0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0RP Q AoZ `0 0 0H iЍ@0(p0p/)%@pe<*!@O-M0(000406#@21,2`000S ( 0 P  PP0016 pPPp00:S0P 00S hE@P7@0P0 0 i0H   C'Rk(0C00(00T 0p(0(0(00$080(00 0<0040000 80JPS4Q [H$0000`00040&<404000:S80 Rx BRu:(p03 80 E@P ( 0K 80D@P#RH L0S0P  (D@ $P D/0s08 80 `  ( J00:S80S |U-U#BPn101x0S PRwD4<K2, 2 "12ЍdŸE|Q E Q<E|1Q- R|1000000000000000000000101}0  u000m000e000]000U000M4@0040004N@c\'c d'@'@lep@-`1@P M R8@ 0 0 3P@R9@ 0S/@0S@ C Ѝp7@-Q@T0 QP   *W Ѝ0P WP0S)T   Ѝ0@s@iTdTT Ѝ0@k@DT\ Ѝ0@U\ Ѝ0@{ A-Pp^ 00 00000@P& dVʀ0! 0     !0 0,]@PhQ(@P Ѝ0Pp0 㞸 @cddd &c&cpes@-@P` 0R0%0 * 0DEP  0Q0%0 *S @ſ0 0 0 пx R ! Ѝp@`孿0 0 0 帿 0PD PP 10SЍU8 0 Sp* ( 0R*T 0;T 1!00̸ P١100!L< c<  (6 U,0S|0 0P<0帀3ቚ Y6ST(0l00LtlP,8!l⇼P,< 4@P0S 0S0S0S90L 6P☰0(p ! #RH L0S0P  <` sd0  $96P☰0pY0H   CR:0C0C00000V70 0(00(000X  & 0 0#(141"<1 81#81Y0ᶠ 0p00`0000p h8(R#h 0\ R 0      0SK00S 0l"lR0 8<0000000 #(R0,B B 0,0000OH0L 0 H0L Z0@0  8 , 0S  0R& K;,EߍR  RS00SX(0#n*  *0 08(#804"< 8 #80 $0a$0 1(0 PYS0 P0 00(4"<0=xp@0D 0P0 @0D p0 008 4\'c@(@A@c0!@Ae$dA-p@`# 0P 00@Ѝp@-0P@嵷1 01  p@辷ep@-@` PQ@@@@Tpp@-@pPp@BdPh?pPA-@P4S% |$St40CS0!1t0 |$,0h Θl0d 0l00d0h004t4,0004080<0@0D0H0L0P0 `0FS 0SV:0ă`F V: 003\( 0##0S0 P P Pß ARx  04(B(0 $0(0< <@ 0 $R0x4x$\`0 h0R0 40|404h0x Q03x45t:t4S0t t4 R00h ,0 G0d0l dhx4t4!",0l 004080<0@0D0H0L0P0j T0X0\ 0X0h )0,0004080<0@0D0H0L0P0t4S0\0X0h 0CX0 0 Q/8 0K I G E C 0A$0?d0=(00l09h07hC`h p`.p`V+ lph ߗhlp3!c Q' \ 0t$,0R!tt0  \x$ 000\ 04080<0@0D0H0L006(3(@(@A A(@A(@(A7AC-lM@P` `pP`p@DBlЍYP0SX@\0UPt$G-hM∠p P吐m` @PpU@P0 ST  0SXU 0X\`Y UhЍP/00@-  !!B^P 31Ñ0PA4@-@T  0DP010# T0S@A-hM p@P `P0S H R `V  PP PSV RhЍS`` /0/ 0/0/-/-/0/p@-@p d~0S S pP@0`ph0\ H p0h0c|@@@p@-Q@Pp` F @0U/(0,  } "R0pp@-@p`P2 Hp@k dA- T@p~P `A@ @0S`HyR cA-LM` 8P᠀p`~(3@Ve 213E=C(0CV} ?30V K=(0V|0 ^n 0 pЍA/2Vq E=&0V p0SW  q`0F RD ` =T2V@ >C0CV a?V0|0.2Vh 1CVQ^ Q^ Q00`0V0 SBp (V@  ӔT  0S p0S1 d Ѝp0L @ p0S1 0     R+#  ҕ0S  0R0S7 P-xvxw 0$0Q Q Q0 S0 P 0$000zc}fUcvtUp@- @} ` ?o2R0S@ P(_@P|0(S  P@p 0cC-M pp[}x0P00 @0@T@0S7@ ` oP (@Ѝ`@0S@X  #@0S  @ d@P ,@ R0STQ S0#S@1@! ( @Pcs@- |@P& P0S `  H ldp` Q(;(`,_({000000x0ЍpccPp@- @|@P P`00ȾpcA-d X|@PP `G0SPU ~PЍpP0x0p,r 'p2 PPp(P#pp_ PP  HxpppP Q(ǫ(p'0000x000: Pcc+@-@P`p, (S$Hep000S ,pP [8 Ѝ@c7@-@H  ;P 00 0  { t0$|`@"T @+0  P Ѝ0AIAlAAp@-@ DMP`t0   zHp@@//C-M@ P{0P@h !T@d  Rd*  Pa Q^` V P RW R Q RP  0  @F V  `.@P5pW 0p  .@P x 0p0 00 0@  T@  Q 0 .@W 忪V  庪Ѝ@cI@- @00C0-eXp@- HA{P@@Up000pcep@- PR@0 0S   Tpp@t@00 A-`čPp@T 0V `000A00 @0@-$M@P ~00 0 0Px$Ѝ0(+ 0Q @-/A@-^ L0\ 0 S4044  @(ЍaAA+BLAtAAs@-P`@P0 @Ѝpp@-P`@P @pp@-P@P_ p @-0eP@- P H0S <寭0@0S =:h'c+ep@-@PQ000p@0S p@-@`PQ0P00p@0S G-@ၩp⼠P0`V S0PP@p R 0 pWppU V0 0!`G-(MP`ᤌ@妌pP1堌ބpPHq  }0 0 00sV  S1!11%*X!:Qax|0SxZZ PU  wP<]K곘D1 P 04 1;(ЍlpP xpP WxPxPpxPpw0 ㌀P  7/P \0{ P #0!AA+yaraAAA8+b8B+ A+0@-@$MP Q: |$Ѝ0 P 0 0000L000@ 00Ѝ00R{ P =A\5+A-HMpPً@ `hNdP0p0P p: 0  P!吋pṋ`ᴋ nP V0 0 0|0V,0,0010`$@ị100 00⸋P0 0 RMTHЍAᑊp<`P 0 nP 4 oP4<08  o0P80<0$0 oP00Q  @⢐40#S80S R$$0S ᨊ0@00D0,-HЍAjAuAA~AA(+AAk\Bj`BAAA@-@&@-  zPZPZ   zp@-@`PP "Pd00 PpPpp(00S0000S01/cc0   (0S"" /P/@-@0 { 00@-@ >oBA-Pp`@P@  0S 3/@P @- @R 2/@O-LMppt0P|0 0W0 2`@xQ [Z 00Z 0!) Z7 Z< $0Ə0# $$00 } QH00$C0#t p0$0 "0 aQ$%00$00 @p0 ;/ LЍ[ 0 |LЍO/W5  03/P 03/ (03/P Xo `100@r[ `[0@X" Z V@ $0I3/PZ0A@ 03/P  03/P Z00S (0Y3/ 03/P @-0 0  00 0 00%Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/@-Q@ Vq Q2A 0,01 0 N<?<3Q#3?P [@P # [P0  R= 080#80C?o2S>^F0 7/,0@ 3 #R(0\\Lp60 0,00 <0F_EcA+A-@( 0  R    RA| ` p  P ,]@[  [Li0 8/,0@ (0LP0 5/(0LP0 A/hA@$A7@-@(0HPӃ 05/0<0(0LPȃ0 5/040 Ѝ07@-( $ 0# 0@ Q 0HP孃 05/(0HP奃0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LP} 05/}_(0H`t0 6/0SPU 0S , P(0L`_0 ;6/Ѝpp@-,0@y  06/(0H`6y 06/0  D0 6 60 60D0@6  600y 06/ D0@006A-Pp,y@`!堰  8pp<0 00(`0h00$00,0$003/(00Hx0 8/3 03'A\E@AAs@-,0@!;90(0LPx 05/]_(0H`x0 6/0S}OPU 0S , P(0L`x0 ;6/Ѝps@-@XP B 0R= S8  0"S4 ЍpS  0"S (0HPx 05/(0LP{x0 ;5/$03 (0H`mx 06/0V>00(0L`ax 06/6S  0"SpXE@@-bP E@A-Pp^x@`Sү  jpp<0 00(`0h0<0$00,0,$003/(00Hx0 8/3 03YAE@AAs@-,0@!;90(0LPw 05/}㏴dP(0H`w0 6/0SぴPU 0S , P(0L`w0 ;6/ЍpA- 0pP(@@pD0(0 `Hw 08/(0Hw 08/(0Hpw 07/0@00@0(0Hpw0 7/0  D00D00@0Ѝ D #D   D0 0 00D06 D0D0D07@-@P B 0R  0"S.. 0"S (0HPbw 05/(0LPZw0 ;5/ Ѝ0$03 ' 0"SpE@@-ZP E@A- 0pP(@@pD0(0 `H)w 08/(0H!w 08/0@00@0(0Hpw0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H`v 06/(0H`v 06/ D0 R60 R R6 0R R6060D06A-Ppv@`d  pp<0 00(`0h00$00,0$003/(00Hv0 8/3 03A~E@AAp@-@ (0LPv0p@ /7@-@P B 0R  0"S99 0"S (0HPmv 05/(0LPev0 ;5/ Ѝ0$03 2 0"SpE@@-eP E@A-Ppav@`Vխ  mp<0p 000 0C2?000(`00h0H0$00,0$$003/(00H v0 8/3 03QAE@AAA- 0pP(@@pD0(0 `Hu 08/(0Hu 08/0@00@0(0Hpu0 7/0  D00D00@0Ѝ D #D  $ 0 D00 (0H`u 06/ D00Q0066D0 D00D007@-@P B 0R  0"SPP 0"S (0HPu 05/(0LP|u0 ;5/ Ѝ0$03 I 0"Sp E@@-|P PF@A- 0pP(@@pD0(0 `HKu 08/0@00@0(0Hp>u0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H` u 06/ D0  0  0D066D00D0A-Pp)u@`坬  5pp<0 00(`0h0$0$00,0$003/(00Ht0 8/3 03$APF@AA7@-@P B 0R  0"S 0"S (0HPt 05/(0LPt0 ;5/ Ѝ0$03 x 0"Sp8LF@A-Ppt@`(ìp<0 00(`00$00,0< R Atsp0,0}$003/(00Hft0 8/3 03A=AAF@:Ap@-@(0LPNt1r#@S0$0|0x$0é`$003/(00Hnq0 8/3 03AE(G@AAdG@XG@A7@-@P B 0R  0"S   0"S (0HP>q 05/(0LP6q0 ;5/ Ѝ0$03  0"Sap$G@7@-@ 0S ,0 (0HP q0 5/0  Ѝ00坭(0LPp0 ;5/咭금@-P tG@A-Pp q@`偨  pp<0 00(`0h0`0$00,0$003/(00Hp0 8/3 03AtG@AAA- 0pP(@@pD0(0 `Hp 08/(0Hp 08/0@00@0(0Hpp0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`vp 06/D0 Q6  60D0 D00D0 6 0 6007@-@P B 0R  0"S 0"S (0HP7p 05/(0LP/p0 ;5/ Ѝ0$03  0"SZppG@@-/PG@A- 0`@(P@`D0(0 pHo 08/(0Ho 08/0@00@0(0H`o0 6/0  D00D00@0Ѝ D03D00D0A-Ppo@`i  pp<0 00(`0l00$00<,0$003/(00Ho0 8/3 03AG@AA7@-@P B 0R  0"SJJ 0"S (0HP~o 05/(0LPvo0 ;5/ Ѝ0$03 C 0"SpG@/G-PMPxo@뺐 Ir?p`0D wP D 0SA 0  wئ<0` 000 0C2?000(000$000,0,$003/(00Hpo0 7/3 0 3 P(02H`o0 6/NPЍ 0 6AA H@FA7@-@P B 0R  0"S 0"S (0HPn 05/(0LPn0 ;5/ Ѝ0$03  0"SpZH@p@-P0@ P@T0 0pep@-@X0S LNP0@` P$P(P,00PP00@@p@)cpS,ep@-$0S 4w@,P R00 p@qAeeA-@ 0S p`rP@UT P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$0}ee@-@D60 000(S   0$00C$0@dep@-PPL @T  0R 00 0 RTp03/e 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-4@P0 P0   peU,p@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ %AA-@pP R00 0`0C 0 0p0 0 00 00S PPt0p 0@@@ tAZ 0 e%e@- 0 8 00 00 D ᵜ 0 ЍAeA-p0S `P =@P D U^X U %PP Z@ 0@P4 0`e@- 0@ @,0@ Ce@-04 00 ( $  y0 0Ѝ`cAeA-hp0S@ @`PP @ s@P ጘ0@0 @Pe@- 0S ǣ@@wAep@-P`@U@p 0RpP PE @-N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝe(00S @- 3//e)cp@-LP@0 S   R 2/$0Sp p@/eA-P`P 0003/Dq@p 0 R @Tg0@DJ9g 00 @$ ЍeXH@Xmds@-@`SgP@g0 0000 'Ѝpp@-P@D`0SpeTP@2gP p(cQ @-@/AC-@ 0P`p0 6(000 9/HPH`0S,0,0S  R 2/0`0 ЍeXmd)cC-@ 0P`p0  (000 9/HPH`0S,0,0S  R 2/0`0 ЍeXmd)c0 , /eXmds@-@Pf40 000`0 6/ЍpG-PMpPt `p0P@ 04/p@x2VX %'17V. 7C0CV7 0% 0 & 000@PЍ2V 0tp 0PЍG/1Vk 0CV1V 70V@ 0S R  0CPS0 0 0@4!04/S@00S P 0 % @P0L00(0( 3/@P0 R  2/0 $ R 2/ 0 Y? 0 Y?   |8PЍG@vPWLW`WXW (0Q40S0000//TW@A-pD2 M`QP8' @ $2Q{ 0Q 0CQ= @ Ѝ1Q: Y177Q o37QPl 08 0 ЍA/pW 0  @P pP  0 @P0 @P  ЍA`00S P 0 z @P 0@000T00@0O p$.@P 00b$p0 03/@0s0S@NW aWMW(*BO-Pc @!rRCe\ 0U40S0000 Ѝ\0 0p ЍOA AT Z0  4p0` ЍOj0p $0 ;/p0  pp (cTW@0@-MP@dx0S  8P@\P  奚Ѝ0A@-P 00 0  / ЍW P/ 0/A-pW0@(`$$0PV`T6/>868s@-@d40S PU T0(0Ѝp@/0 R ` 6/@TЍp0@D( 02/A-P`pdu@ UE01SC  40S 00Su0 00P4P00 0000S  R h R  A@@ 04/#P  eg,@-@@d4QT T@0 R@ /P/p@-0@SP` 0P`4 R   p03/P p0S 0004 R   //?o2\0S//Q1S ///40S0/qA-p6@P400S0T0S0 %@QQ`V 40S@ 0@ 0 000@S@   @6A@-@c40ST   @@>,A- @!PP`c0S8O S 0AT 0S 0S p`003/0S 03/0 R   2/8000S 0  2/ 00 0(cep@-8P@0S0T0pMP00e0 0$/)ce0 0 0$0/)cep@-P(cPf[`Pp^P@0P^ p@#p]A 0     R [$X(\,Y0]4Z< @ 8D 0/0 0 /  $ p@-p0`P@ P p@fP000PU P@T fPt*c,0 0S/ R  B /0t*c@-@0, @0 0 S0  0 0t*c*cX0 0S/ R P  R   00/0/t*c8- 0000 08ep@-@PH P`C 0H0 00P0000000p8eG-`p0 @P05/ᘑpW 0 0ЍG/0 CR/ I0S0C 0 P0PEPE0cUP!00:/000P 05/0S0C0 P 5/0 0S0:00 0 0CR 2 5: P 5/0  P0A5/H@ P/8e; S 0 0//8eQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/H@5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`PpH@@-0@000\P 0\0`P 0`0P 00P 00P 00P 00P |000T@t\e\Q@- /6Q@-B/%Q& 4A0&S0&Q  @-/0 .0!/  /H@9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 SX0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V s0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 03/JЍI@H@gA0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 O0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPlOYp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000%\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hl O p'00(Ap,Ap ppI@hI@@-PP@ p`E(0 0 000@($080 \ P`dP      Ѝ\e@-0 @04 80\0`0d000000 Ѝ\ep@-Q@<0 Q Q!R0 ,R0Q *Q !R0 ,R0!R0 ,R0<0p!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@U`1P3p1:PEU`p0T 08/`0S T Xa0T D08/`P T0 P-N`0S  0S 0d00 00CR00d0A-X`@VP1p1:`FVPp0T 08/`0S T a0 `TD06/`0S T M`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00M R 0PD05/`P  M0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?S+@0C4S00*SS *S *SU  SW $Ѝ*S 8$ЍC>*S ! BS;  SPh`h0S! lPL*S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S `8 0PiQ D\PQ R(90 )P ̐  8 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/^0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRD0B0d0?X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍCplQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0t Qp\0Cl0S fll0 S0C BR 0\l0S SW \$ЍC}K\ 0M0HPLPphQ@0 0` ` 09/P6 `` 0` `  0` 00 ``009/P0@0 0l 1R1R aRYRPRB0dBPP\pB APR40@0D0HPLPpPPPPPPPPPB R p\&P A Rt 0$P(pB R p\P A RtpR  p \0 AR00Ѥ pl0S0H!0 0 Ў  8l0S S S< 0T 0C 0 S S x p t q nl0 p S03S0!R 0CQccPX< T0X00I@J?u&p$c>Al?p$?A*`BAAAAAfJ@AAAAAAp@-PUpU- @\\J0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0 AA-@P` 0!0`3/V0p4`e%n 0!0p3/ WJ@p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@K@L@; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000peN@/AM@AAAA"A&A*AM@M@.A4A:A?ADAIANASAXA]AbAfAjAnArAvAzA~Ap 0S S"0A(0,D R  Á(,//0A-@M(00 00p@P A<00,p$  `< 0PL  D    p A ,(p$00 0< @Ѝ&A*c.A<0S/@-@00@cSA-@ S  pp剎lP`pP   03/@NT@ @AUN@>Ac 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@p`Pp@@0S/p@-P @ 00 R PD  s@ 0P4p*c,@0S/@-@w@s0@04@O-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ 9ZV`@0  @0@0000@Y 0S@ T`` 0@+`@[ L#@080 03@P >UAA-@PpOA@` 0 R@)A-PU 80p`h0@6pN@ @-@80S 080<0S4@A-P0 @R <"p0CS3 :  `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@1VT00@-*V0041p@- MP@l T`XP 0 R V ,TI ЍpRV RW SW lp@- \`P=C0S@0 00P00CS0p pc@p@- 0@PCPP  p@pc8@- (@ CPP @c0 000/G-P`UP0@x000000sU0Sp 0pW屍0S1h0$lh00h뜐 i0 \0h0  @0l0 0p000000t0h0#P Ah0|0000(00,000000S 0$@Ԍo TP (UfnjbW<S P h0\ YPL ?P8G*cbAte`,jA*c}AAAA,AAA-`MpP0UH4@V =84V ,4V $4V 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQ`3V] 0T3V $H3V X 0 p}`P  A Yh X2Vp 0V`P2VA 2Vr 2V |@000000000 0 0 000`1v l00| 0pЍA/i 0     0 0 000l000Af0 0000 0`PlA ЍA @000000000@00000HA0 0000 0`P@ 0S0 ЍA0+h0 00P0`P3 PЍA ``W W @W@W @W W@W @W@WWW W W W WW*c*c@-@p`S0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0  ЍP R 0 0q`@ @T@@~fvtA-@aP( @0 pAc40( R/$ R R/  /te-4( \0^/teT0Sp@- @RP 0y.l0p0p@//@- @ P@A- `@PP@ @T@`V X0S PpW@0`P`p@P PpcD@- 4l@P@T  P c 0!< 04 0 (   !/@cddd RP RP }//C-QP `M 0q<0 0V@p# 䀖XW Ѝ0 8/P 0S 00p Wp04&08#8 S$=;G"0C S04W00G?o  2%`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  )t0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZN@01 N@$'*N@s@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 te*cA-PPx0UTPS@UTp W `W` 0 `U`RT0 0+l00p3/`PTPTpU@ P  P AA\ P/0 !8 00 (  , !/@cdddp@-@0Sp@z0PS 0p Sd :!+T0S` 0Sh0T0`!EcMb@-MPjPX0@S `+T+x0S 0$ P`V% 00S" 0p0CS00 00P < p00` P  PH<T@P0 MЍteEcAAN@Q @-1/Ap@-`P0@ O  `P0(0pte,l,,p@-P@PPP(Ppte@-Mp`PO0@S 00*A0S$  hPP: TP0S4 S P0 0!! !1Ѝ@*h0Uh0TPP @ R 00`SPU0P00 P {O UЍEcMb Ap@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ PA9)Ap@-0@SP S`d `A < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 Tx0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02"OAyAp@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pMPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@,p,0c@-  001P(,0c@-  001Pk,0c40 60 0 1Pn/,0c/@-P`x@fp0lpp000 P$.0@@0 P0tp0 ЍA00cp@-PP@0S ``0Pp0p,0cAs@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HL3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RoL0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0} 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00K\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcW@cddd$ 0,0cp@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` P/K ᛂPlpWXPV K@ K <~00S 3/PP\pAA@-@.KTT0 TQ S S @Q @-1/Ap@-@PX:PpJP J8P X0SP0Sp@ pA 0`( "4`#/R/`0  B-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P Q   @-:#:^:,\:( 0 /\P@A-Pp`@@0@Dp@0@L$<#@`W "N0pG`@A-PlL0pLALA$ `@`W N0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0`!pW:X  QY Q  N 0P\P@S/G-` p P#"Y@PX M0S  N00H@PR/G-PQ0Fh pY@p`V8h N0S h |N@pG-Pl @R`T  Vp P匀`#801U "0S  XN0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  'N00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  +eP p A #e Q0000000PL0cQO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@cdddO-`h)@4pS0ʀ0!8)00)()   !@WpVP`P 400 $0d0@04 00$00 , 0 4 00CSG ЍTd40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ JvGJ v lAJp1ʡhPL|00 10000000 P 0 Tp ` 0h`Waf`` J`Fd 00C0c& 0R0 0C (0`10` 0RS0C2x05A45t454545454544 Wp%00d%W$4. W  @T R><@GSA S S  @<Π` P BP RY 0 S< b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ嬂01 `@380!A!Q Q ^: 0 0S  z Rb`@|l( 6g`0pHlpGW04 TP    ̈́I 000404040404PTP!  ̈́I 00|04x04`04\04d0@cdddQ@Ax,x,,,, ,L,,t,AA ,T,,,,,,\,O-Pp`( 4M:60S:0,0 T0$WpVP` D@ J Im/0@@ @@ P,TT|004ЍT0     ,l,8 P,0D0@@0 20P00#0CS04<0@s倃倣000X [0R bQ" B3Y 3R b\Q" B0Z 0R b] BP"YY !1"0202 &&Y0XZ0cY0[\ ]0`kX 0T2$ ÆahFh`bV`a& "A 0Qc2 &0A$ Q0SW ASL 0CS>T0H90 P UC|0 S00`10006P!P1P@@T.T0 [,!,1P@@T#ZZZ0X00X00X0 S 0@00 pYD8#  T0,88 < T0 T@2AKAcAATP@eQ@ 98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-I/Q@O-PP L0!p!`W1 p` Q02 !X800#0Q00p0` P b C22  A X80z  " Sy  " 0S  H0p0`   T@d@$e@S/O-`4MP@XA P^!1 00 Z P0̹p c02Aq4Ѝ W Ġ   ! Ġ ! ,  ,Ġ 1!Ġ !  ̠̌  1!̠̌!!!P P h i P D\R@TqZp0pp PN0@000ȷ@T0 @BpGBS0(01 0 0d$000Cs0v 0S0 "<<"$0,04#$(#$0,0 S "<<"$0,0$ 32# $ (#$,0 0"00#0  0ERa0SP 0G0S@0#Ġ #4 <0!<Ġ< ! 00 Q Ġ    `1! Ġ ! 0##4<0 48,0(4(, L<\0? 00#00#0B0S (0 !YG00pP^<T! 4 8!004#  #4<  48 0 0$30##4<"q 0i3##4<44, 1 00A1@00Z@@P0S0$0 00 0C 000Cs0~ 0S N 0#,,#4 < 0#"<<"$0, 0  R ̠̌   `1!̠̌!0# # 480.̠t.4̌ x<^0[ 00#€t 00#0R Bp0(0 0b,0(0S^0S2 4 8 0 02##4<00 S0 b##4<032#$(#4 < l!0!  0S $0 !ZF00@PW 0i3 ##4< 0 1 00R! 4 8!002#  #4< 48 0 0,30##4<00pT@d@$e@O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? 1!pW:Y  ! !QZ ! !Q  E `AT@d@$e@O-$R@4M@ R^v C^r*P`! !!X V`"( !X P",!P Z S $p0~' 0p RhʠS: 0 02 (,0Y4:04!48#8400p0R2##48 0S0`0P 0" 00#0 R00`0PY*X0 0t 0c PRx `R 4Ѝ衯0 :00 B0c 0! 00#0Qa0 !    R h@P  "S ] 0qY4*X0 0t xp0c PR`00W 0PE0s00 #  "0  S r  !  " 0S 0 `FDpG0s00 #  "0  S r  !  " 0S  D0`0P0p0 cR2 ,00 (0 1$0Y:0 $4"4 8#8$04  p r  000!Q"  "$,   P r0  00>  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ D0`0PAT@$e@d@00 04040404/ -h-,x -O-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  C0 `0P[:004!48#804pQ 0S  }C0 `0Pό\00PE0 S 0S 0 `FbCpGO-Q@,M@Q\ C\*P`!!P pV" ! P` P S"! P) 0 $0 剐<*4,2,2  )00XR:0 E 0=R0S  C0`0PX<:0 Q0$ Q0! 0 a`0X0@0cP[0$00k0僱 Y0K0c[3\;$;b!Z A bQ"]100 0 S0S  B0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `FBHeQ@T00  ,0X00500\04/-D-O-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  GB0P00 $4"4 8#8$04  ` R0S  )B0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PEApGO-4S@P,M@0S ^0L^*0p%!P0`P#80!)V` P \"P !)ᇀ ("( - $0⒎($⊠""00 0000 000 0YR:0E 0=R0S  A0`0PY<:0  R0$ R0! 0ba0X0A0cQ[0$00k0僲 Y0K0c[3\;$; `ZB$aR!]18#80 0 S0S  _A0`0PP0 0t x0c PpR`X,Ѝ0PE0 R 0S 0`F :AHeQ@X0S  0R   Y  Z0X0[ 50 0\04/ --,00S/  R 0 eA-`P㔪V0@P0# (㋪( @0`0p $@0$p=tP`= Q0`000  @@ e"/p@-P$0@Tp5/@ e\0P/ L  \/-  , "   eP0cA-p`^@P P@@@ @S PU$R : ^V WQ I?P@^T0 N^@D@D\'LD@D BR@D@D\ @ N!N'O-Pp``08@TV#2 Ѝ 0 U`P@ ep@-P` 0@Tp 5/@ e@-P0P0P`@P , 0< 0 00 20Ѝp eO-PcTHHCUDsP 01` Dp0>P 8Ѝp<  P0M  An@R  Q 0 R  $\?   //PBcO-`pP0 W UQ 0 .Rq ;RG @&Y@?0S< $2!0BS*R R# R@ `pGU 0 0P;S>T# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@PBcn@O-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0PPBc//O-00a040,($@@ @x<ЍAPBcA@- 6 Ѝ@-0 R  @ @b `@ 6ЍЀp@-P@,000 080/0 0 !""##$$10/0 pG-@ MP 6`ЁR[@ h"P $(` 00 c2s~ C1|8Q \:fFp Ѝ4, RX\X! 0C#000 ?pP \f0, 0 0 0S \  0 fcH _L0 0P0001@00th0SA 0;  R8 0p 0A a320! r0  P T Q 8 #61S0SS$ 0S 0;`0H @R000@0@v00 WSX000L000))~0L z; eAAAA eo@ȵ@ e eP P /;TBc!)p@- Ph&@P`0S ~D&S 9^@Nr000:0pp@-` MR@@P50  `$!1/@P 08SMF@ Ѝp7@-P 0 fO@PR@P M00 Ѝ0s@-P@<`F` 0ЍpC-0000`C-p@00CSʺ0 V0  =# C!b0 R6P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 40000 P4000S 0 ,00/ 0 S _R Qrg4P e> 0X&  ( , P B R   ,0b,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, 0`60A00h"AT0T \/@- 1"\0?0A@P4Ccx@0@-PQ0USL0R @@T00APES Q T03=?00QS^T ?6?0000-A\\^CS0Q Ӂ0ѳ 0ҁQ/0C-P0M`00@V5p x 0R  (: {>C 0C"4T0 0  ?d @;c U l0<#l \0B#o,Ek,@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ w@Pod4,0PЍ耖0@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP000s@ G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP X+)0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[s@C-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁--  )-  $-Y@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP ,  , ,`TF`% @P TT@@ YV@@@$T P 0!1RX 0SRRs@C-P@?00CSLM`LЍ@0 `p0R , , , 0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ B4+ ],\ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 0@-@|P|0M P0x0d @@NTPP0P 00 @@N('' Ѝ0@k`cA eAv@/@-R0@R@_ e@-Q|L EЍC-@$M` +0pS rBL S?xx>P@x T !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \Q$ЍP @P+0 H0 0I0 0J0 0L0 0M02/,)&#X/+0\0800sX JL000 CX0@0000H0H @0P0`h< 00@0@Z e!! ev@A 0Q0A-` @ P80 rGLppF\P:j\pd@ E 02p `0S7:0 00 P 0 \-Ѝ\` 0\Px00 00H0 C2 000\0 >0>00C00B0\ ,0ЍAAO-@L8`p0,MP 0s @$ )Z,Ѝ0 0\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B 0$ - -\P 0!;P> r 00 0Pd0;0hl0 Q! 0LP  AH B"     \P0 00S\P00#SdAp@-@PU P NB0 0`g儝`Pp e@-P`u&%@P⭝mN@h0 000 001 0!X%00喝Ѝp e e@-PNL$@P4冝Ѝ %~O e e ep@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@<$P$?FЍ0 08 e e@-0Pp0 0d$@TH$Ѝp 0S (C%`b%vO@ e e eG-P@|xp 'X `D2 H.W L R ! V x&x 0 e-   11 1`00C`0`0  0`0 11 1/@- ( Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P Y l0d H BT02000V`pd000 0SNX\0S*(P o $&$00,0  0[ $ ,0(R:P V(P O0(l ,0 B$"P 00s000p0pD 0S (VpP #pGhplg e h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0aPpp`0 00z'0 {0'0 0808Y<r0"\!o0C00ID0l `$0 B"0$0~$ 00'0 n0P  PP!Wp.0S&p\ P WЍv@,AHAO-R4MXP0v\0@Sq: ;% 00$0 0(l $p0 B$"`P5( 0 z/C 0 0! $1Q- q5 :CQ0 8 8 #8#40 (+0(00t0(P 64ЍZ  R 80 #8R#4P00 0RP ,,P&`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`p$0l ,0000000 B"$0P0!YQ00(@% q, *BQ000]   (0"(\"$ @@(@(0[Y 0E0 8ᴣ#8#400000+0" 4  4&@O-`Q@p$M ?R H0p00?(0Ce\ 9# P 0[* 0R3:U& H0Z 0 0p Aq  o B X0 H0p00 $ЍUP11 Aq  o B  X0H0 0p0UP1 1 mNA0C-P@q崁,M00T\0S*Q]. _#00 0 B` V n0S. s8 S 0@Q s0l 000 0 B"0$0P ,Ѝ00 Z00:0 2#4@000 I0@020000 5 2@$ $0%% 50C-@$M0\ S :0P(a`0\0pS*W?5 0 "x"WQ 0p0w#PW p 0 p l0  0Cp  $#0lP $ЍW O-X M@Rp@8`L0P1 R hhhq Rh0p0l0t0WP l  l  0PP ЍX0 Ql00qPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#08P$ 0XP eM!Ѝ/O-0lM P00L0 `圠  8@0 L@P )0,    CR@lЍ     P 0@OoB@\OP@M@0  . 0.S+R R'0.S$0pbD0 Sr L0R, R' v0  kL@PX 0'rRppW @<0@0\P PD PJ@  0p$00, ` 0'p0S  0R4 (`0`0\0<`S H00 (D0P P$ P40Sx 40Su  L@Po[0`[ 0Gb0G@,`00d  >0p0p$0l0TP C)CL@H)0c"$<3P<0 L`H0Sx(00(000    QQ[0`Q'e0[ 0S0 00 0 0 00 8P $0S  \h)P 000 d^)P 08 ,`SR0p00pG0p 0BB00 p0p04 B8LQ0R S`bD0L00D R` 'Q  R 0 v  \K@PX 0'rRppW@ 0D@X 'rRppW ";0000 E 0D@P O-8@LM00 \0pR`:,p Ad01000 0P\ 0  LЍd00 \d800000@ P00lSh0 A)A )0aD@48"03$P4 h0@0P 0 PA"H0 0I0 0J0 0L0 0M0 0L0< 0\0<0"800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S 0S{ L0 X0r00L S000 S<0 0P0<0 00^h m04S4 zd8000@ 9PP,l@ A)A)0aD48"03$HPP4 h00P 0P80 0($ 00 0 I00DP 00PP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PEJPPi h/04S& d0@ 7Pl@ A)A)0aD8"03$P 40h 00 0 pG  P  0CO-`p8$M000 L@P @DOoB$Ѝl A)A)0a"03$P0P [ pQ Q @ 84'P $.'P   PbAnAA-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$HPV 0h 00P00Ѝ@- 0$ 8 ЍO-8@0800S 0s \ S00\ (0$000 0QPP30$010,000t010(0@1 110  00 10:0000l0$0d0 08cLЍx#|e00P@8P ]T P ݃ۃ00AAw@A@-0Ms0P@  @PT m20 00 |00 0t@x@`@T  Ѝ@T b    @c4_e`AA$FeC-PRM@Ѝ R `  R@ @@ptx| 2|000x00000S0x3 p R0 -@    @P 0S0 $6= 00` 0&000?@DT0100S 1 @P0S 1@0n0S1@0HML60 @`0&00 0x?@PDT 1g0'pp6 A@=DT0 @P@P Glr6 A"Dp1$ 0R 5@00 0 06@+@c@G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0P08< rqHL rq0 000 JX@ 0[?P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 .X,0@(?P L000L00000| r 0 0 X,0@ ?P~| L00 0L0000ЍG?0Sk iC-0M@p0S   RP- 0U0P S 80 \p`H@X!V0 =P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$PP p00 0CS0! 0@@T0PSTTPnO-`$M0S S@ dH 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 09@PV 0 \ \ >0>00S H0A0|0000 0H0  C200000 (@P[; 0S0\ K0T [ a000D 0 0 >0 .0 0SB@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP (p000 #8 *(80( 0BP @ [B$ЍOo@<@:AM!Ѝ/A-0 @p0`SP , PW..G-` P@U.@P pp, @P 0I -00@ >g.B@s@-@0P000CSG#SR`88 d0l 0C S c10PQ0,`P 0##sr$ 000#sr  Ѝp@A8l A)A0<)a21 #JЍpA@-0P@"XlE0@8 4#, #$0`E^EЍAOAA00\ <0X 0C S0 0 ! /+ 0 0 0U8w@G-0 S*S* P 8pL  PS  P <0S2  I00 > `!jS 0 <S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!0~0`S0040 0#240~ 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, `000SF:  PF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$10PD0\ T00CS0H08 S  8 \8 000X :0 L0TRQQ 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  l#0 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0  P+ \P,0@ 000 000< 0C( 00\ @TpTp0S [   0u}0P0Po} |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D Z"A"AA-@Mp0@P`00 R@@T00V T0L0 0L0800"0 VT=@`00R 0 W@T+@M00N0P w000Ѝ@-0`P pMX0S, \0R@#0*x P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, v@P  0 000 Ѝ80 000 m7@-@P匆(P ʄņ Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S {P3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  Ѝ@- `P@u P 0   0L 0 0<03100; 0P Ѝpvd@cG-0p` M8P0X0S, \0R@#* 0@P~x Z0PP(0(wl0dT A@! 0C#p00$?{@ p 0?@ 0 00!e  XpLP:!0.e2-8640q."@* X #@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |@P (Dw@ 0`( "4`#/p@-@(0Sp0PSP 0 R@TpO- DMhR/@lp0-`p0P00`$,`@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P _@P|,z$bDЍ$ @P P0`Ꭾ< 0P0 8 U\$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R Bᩮ(0W0 ,000,0`A8Cc-C-萟M8P Qo<01 @`p000o, 0 < 00 0 0 )P0SP7 000ʱЍ蠆A-PPP Up`ŭU@ 0(@P0 A-0Sp@ı@P 0`PP`P0 P 00`p@-@㇭004P0 pp@-0`S@㋱@P P0S00  |pG-0`@ `Ppf@lT Ѝ 4 `P0 00@0`P@`J@EcO-M@Z0`@P %1 1PP0Z00008p+08p0 xP8ȂW(8p ([( (( (  (P%u<00<0%#0 3!0{LVP0@8003!0I@T#%X;>0 SC&P02#@ 05:#0P0 @ 0000000$000 pϦ@ 0 SS$ 0$R00S0} @徦0刔pC 0Sj @#!P$$(00D 0(0#00$ 0A@P$p00ʿW0!P"Т3" R 0P03Py 30p 0Tg@P 0! 0K"@0 l0  0U80(, <00PQb0 1 000$00 100@ଦp0@$0  0@ 0 0T8<$p 0004$0/0 0 !P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S ;!@0C`T!@@0 RS P0R 0" 0pe! 0  41T 8@@8081T#\  (#0S ȥ 0SI0p~!I!~ ᱥ0\ R 0  8@@808-e@cwA\.e1uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0 YQ Q Q :0S S 1H0C200<00 0P  0 P0*&00000$0 0;00@Pap| 060QP ]T0 ;cS10! 0p$00:0 @P 060 %.P  ! 7X- 0 0$00 "$Z 8S  0RP a$0 (000J ( RY#QQY*  R, ( RNڸ \RD  00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* l 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 G% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AL000  0  0   gX0(0\0,0pi8B(00,0 040S W X0SZ%Q@c-eACcO-P $@p @@DM $c T<✐0娰 ` IP  0 DЍ`&W`V ``P  0 0$3 0壴  !o c9P+X 0S68T080TSJTQ0S 0-| 0 R #1 TX T: 0V  01 Cr T 0!{!X!?|P0 ! !0Bq  H@o/@-M@P`  0 0P @P 7Ѝp0@  4/@P2V@002d0  4/@P Hl7 tV 000( (0ʹADciAiAEcA.C-p` 0TM P pϻ@P D7TЍ. "S !>V4D`Y2!>3`04\@ 0$p 4/@P 8#7 +(00 0ADci@8AEcNA0.p@- P0@@`2<04 @ 04/@P 6 坻AiDcA@- 0 0000 0Ѝ @-0 000 00 0Ѝ@-!>0004!4 0ЍO-@Pp`LM$@WplR6X ᧫P0 7 |8/P $_ LЍ ``  4:/P .6 $I $`F88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 S x0S $0x 00$0A A 0x.p@-@P$ Bp@ 0`( "4`#/O-P@P004m@P@Pf #P Pz R R 00U>000 C3H)10S@0   @U. p)3000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@X0#T00S 0 #T T0S0S0@2T@0 OoB0CB001 tbݤ00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @姤0 00 S00  P  呤t60Q &(10(1ThYvd6@Ty 0S0Y @0 00000H60S: 8, 5,6P:# 80  <0L P0C1001008 ؕ 0`000d0嘚*0<00L 0  ! X 000h5 000 s 00bR0d`0Y e  P:dd0 00 0`0542(8p  ,?$<'Xy,XX0Bsa0HS^@2 00?GV;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :8?=0 0 0* <=M0S<Ѝ8< 08    08 08  0`H̋@`.e@ȵ@d.e0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8<厙0 00 * eЍ0@<Ѝ0S} O-@$MTP`L Hp RQGPP0UPPӔ0U  QS 0Q P:`0S00S XQ0R@3 Er1 10!W?Q00 00U0P00H0 00000`00X0,.181q_r$ЍP0PP\0001 1pWÏ`0Wr1 <U.1818r/AAQAAC-DMP` p g <  0$ 00 0@ "4X00 00 0 (0|0 0 P0 S  g P gDЍL\ 0 \0? 0 0 900 0 0g 0@-8@ h0l P 0nP3<P<#/G-@$q`0d 00000`P`0d P Z000Pp"SR \ R3#. ; 1; 8   088  H@-e 0`( "4`#/O-$@ q&0q00q0a@S 0F  `MqF` q0 S  0 `@@qpPU- 007qHpo?0尡Z | Q ! |! BR!L'q Vp0S 1S10C1q0S q pp0S hp 0XS  0 pp=&p$h]4&A$ e( ep&xp00C0 rpЍ$ e0,0000 q删!!  *P!X& f! ,++:10 0 W4 ;P !*!0l 0 F4 *( 40  ++!îEcAAG- MP  p@` ?@T Ѝ Z@ ʟZ R00 00@@}eTP0T00PP $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X l0 T0 0C S 00   @P _Z? 0 埿0P0? P!KpC!0 SH080@   004005000@@?60 S0 ?-0 ?%@?-Q P@ 0P 00T 0,Ѝ@0S   R00   S  @P ~LCcp@-@Pn0 BEp@nG-1MsnQa0S 00%nЍ@T0S_@n[  PD 00 0n0  $P4! #%" S R- Z03H0 $0X\ RP(0` R  X000 R 000Gn 040 0$@0HL RP0P R 00 !/ #@c0 eDCc8 eEcQp@-@ @QD\0@$0@0$0ppPn$@MnTp\0$00$0$@p@-Q@pP @QD@pmd 0$ 0S (0, 0@@'nd 0$ 0S (00, @@p@-p`Pm@T 0S4` 00S0C04L#0S00  0S00@np@m9#@DCc0 e@- m@0'#0 eA@-T@0S m00#,#0Sm m@#0 e8 eA-pM0S S\1 @#P1P!PCh0 4a4&!v"$bm R100 0Z@P mЍ̀`V@0@0P `X0 h00|400"0@00S`000pP4#cm@T@@@@c0 eA7.DCcA8 e- $\/p@-@PP 0SH0D)Up@$83Ah@A-@P`pW;0 A0Kp0@-@P0M 0 @0P@5h0 `0 @0P@+0D 0@0<@@`<P (*Ѝ0`cAH eA8eD>.A(eB@-@  @<H eA-P`p@ @V@0L00唀@0 0L 0h,hud`dPTP63A3= 0&HL 0 H eh.e8e@cx@7@-P0@P @T00  Ѝ0@-@p0PS` H`HV 00|03 70 2008o<080S 0S  V 0 ; Ѝ@cH ep@-P@{#0S  0S x 0 @QL\PP P 0S0k6p,e8eH e 0`( "4`#/7@-@00Pk000U  Ѝ0@ Ѝ0kA-$PU0@$0N1  k` pv1SkA責 " "'!@-P 0`S4 R13U  @Ѝp $`V@ 0@ 堙@ !00 0C?o2 104A04/@P U 7T0S 0@0 0 0 0U>0( T 0(T@0 0 07T0S  H( DR2320   (T @@cB/BO-@Mpi84@P0S0u0@0\5`4IW00 Q, 3Q00 3`0 0 00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  tZ @H[ @ R20 030000 3SH0L RP \0 Δ0@`00_ P ,00 B R  R@0 00 Z `!H0GS5040v400 3SH L0SP0\ 0 ㌔0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0 Z0`@0 <  0CS00S0W00  4̑e,e,e,e-eБe,e,e,e@@-8@qP(0, 0(00 , @0e-e@-@ Hi `9 X00PL07 D00(000 ,00p0)Ѝ0e\.A" @ 0֨@P }s0  000000) 0ˬ@P Et2h"1ᷨ@P 00 X9@  ϲ1 $R00S 4 `P 101>@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ @P1@010@00@1<:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S &  000000t @0 R003tp@ሀ@M@Ec@vc-eZBO-P`1 @pᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,Uh0S2h 0! d0    !tT# 000 굸@P8?P 0 R (@- 0@Ec-e@vc@cddd0eehBG-0@@p` !4#Q!PP00Ѝ 0`( "4`#/d0SI /-//s@-`P80Q30 : @0@j(LfЍpG-w@ Z1812[ ` PPWGPVP PP KW Z181[1p 010PPf54ZB @o>v<zi0  ~EcBp@-@0` PxV@PP XpC-MHoP'`p㨂 hM@P2Ѝ6P 9 ``PP.O- 1`DЍP 0 0<TPPV 04 (P0 00C/S00(0 , 0 pPP,P t0 PS!t tPXXt p0 PS!pPppQ00 S Qppx0 PS!?0x0S Y ?0Spxp 0 Iqp n P0r05q5Q0ao0a 101V-eBO-6LM$3@ 0080 0p圀0 |W 1 0 %W000 D ,0' WP@ 8Q```# #RLH LQ\P AQL0S0P0\ 0  0CSb`VC, BVTL ,@`P0080000<0  0 `P aWq 0<0 D0000CS000W 4  uPP4 N 8` LЍ@0000@,00,000,0000Fa aF1(L4Q #RH L0SP0\ 0 @ 0   @, <  0CS00S0 ,  0 ,0wP 0 0DPPV 80S 0S H8居< W00 0 4 0CR0000 4 PP400'R 0<W0N 0;P8?;;0P4;T0P,p )_[[PpT[tPp?;;0 4;PUĠt (P,pP  0 0$P4P0 P$ 0$8C2 |2' 0<0:t0p0x00008|0l 0 0X 00CPk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 05PK0 TPxK!` 0  0Sp _ ^ ]\[Z0 qzoK P0S00000 \0 Pp0p { A  P { @|4U  o v zQ(@Cc~BBBB-eEcPCcBG-PR M 0GS p`0 V Q 40p |@P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@p VS  7<$(, 0 00@SD@J {@P6ZJY `0 Ề@P)Z `ZJY 0D嫀@PZ `000靤@P 000 s@ JJ J@@@cA-1Ms1YP@<P0< !0 0BPT@P BЍ0( ,@(0$!    {~@P1  0p0X0 0(0"@P( s(8 2?l+X`p0@`^`!(& p W 4V@c4_e*`B 0S& p@-`0 CSR!0@P P  0 P  0 0# =Pp 0&p p@cG-p0M0`0@8 ;8$PPi "\D00D0 D 0a U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSR}U3Q, BUDL (PP00$ 0 0 0 013PP Q 00 0,,PPK ]0Ѝ(0000(000000#000EQ QE1(L~Q #RH L0SP0\ 0 9}( 0   ( <  0CS00S0   0 0,00S00  R,0 U-eB@cO-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C Sy|ZH AZkL ,<K@P ᬀP<0000<,00, 00 0,0r000J! !B1(L<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS p|T<0000<,00,000,00DA AD*00010(LTP QH L0SP0\ 0 A|< 0   <, <  0CS00S0 ,  L 0 ,0W<0 D #RHL RP \ ;|< 0   <, 8, BTL ,<@PDY2P?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<E@P@004000080 0 &@P AU 080 X0000CS000( (  PP(  4z@P, B[ ,@  0,0?0 0K1 1C! 2P 0 0 XxPPX0 080 P000CS (  `P(  4:@000(2 0R$78 00 00CS000 (   t`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  ;`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X HP 4~P0%'TZ-eB,eO-0pdM00 ,0`0S4PdЍlV$HH&圀t00t0 $0   ' V@8u 8QPPP# #RuHL R \P   BUL0S0\ P00  0CSP`zU`, BUBL $8PP C~`800008$00$000$0 000EQ QE1(Le0SI#~`?P V8080 0o,00S0U0SPqQ #RH L0SP0\ 0 z8 0   8$ <  0CS00S0 $  0 $08 ? PHLPP\ 6 $8aPP~,00(004 00 023APP mQV 4( `000CS0(0&  @P  0}PP  @Q0$P000$0]000A A1 2 0R44 (0 00CS0(0   @P 3P T.X+'' SR0 000HS# SR80Co4( B@-@8 0 ,@P-BG-8`08MP0 0C, S0, 0 @8Ѝ 0R@ #p000D (08 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CS]sT, BTOL ($a@P w$0000$(00(000(0000DA AD1(L T2, 3   !  %@P A , 4000CS0,0 0  PP0  |w@hNP 0 04PPT  , 000CS0,0 0  PP0 00CS0! 0  0 0C?o20 0R 1 0 c># C,0!0 0 0H03!O@P  08ЍG_TG0@-eB@c;@,e0 XN7@-P@0LP! "0S, ,00 13/ Ѝ0>B @teA@-@0S )@C-`M @P- 00 0SS S p0 S2 I00>00 P 0   0@ЍO-p0PDM,sr`l90V0< 4%P00P0H $028 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CSnrTHh%Ø0 P@ X@ @ T@ T0S@DЍR 0, BTQL $8@P2 1v TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L=80 3SH L0SP0\ 0 q800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013C@P A4( <000CS0(0 ,  `P,  0u@fRSiP 0 0<`P<T 0uTN0K 00G 0S S@A4( 000CS0(0 ,  `P, 4 @DЍOsS@ 굗 0@0T -eB@cp@-`P@M8  ;8qP00 -  08 H@   0 013/Ѝp茷@e@-p`@M8 % (   8P00  0H X@  0 013/Ѝ茷@tep@-@ `(MP0x 0 0$00 000 PS@P A t(ЍpO-dM000/H0p0H0 <D ` $0J X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSMpU:, BU?L $4PP ftX400004$00$000$0.000EQ QE1(L4$^0q  R[ 3SH L0SP0\ 0R@p400004$0PQ #RH L0SP0\ 0 'p4 0   4$ <  0CS00S0 $  L 0 $0=40 3SH L0SP0\ 0o400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05o400004$03R 3SH L0SP0\ 0 o400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 M40q u R> 3SH L0SP0\ 05io400004$03R 3SH L0SP0\ 0 Ro400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05 o400004$03R 3SH L0SP0\ 0 n400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,(8n4 0   4$ `\ #RHL RP \ &n4 0   4$ , BR  R $  0$04040 3SH L0SP0\ 0 m400004$0 <  0CS00S0$ 000$000, B R  R $  0$040HP40k 3SH L0SP0\ 0bm400004$0`\ #RHL RP \ m4 0   4$ , BR  R $  0$04040 3SH L0SP0\ 0 qm400004$0 <  0CS00S0$ 000$000<  0CS00S0$ 000$01000(00,00 0 PP QX 0( 圀000CS0(0] 8  l@P8 T , qPdЍ<  0CS00S 0$ 00 0$0p0 0R01 p0 p0 ( 8@p \0B`HP0s0 ( ?@c-eB-e-e@Mb,e 0 0Rp40 (0 00CS0(0 8   @P8spPTp nXk@@Dpf'SR0SH#SR8ppGor0( <`000CS0(0 8  @P8 W=P 0 0 0<@PJ<0X` [W P00`X00P @P ,P0%'0 0 0PP`]@P $UG-@|0s-P pr`0s 8<0sqHL0sq0s 00~(,圠p|^ 0>0 ^0P3l:0S#S$Pe PPe% "؀(,x1 3̾PP!  0 E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 PPЍP@cO-00$`pT0DM|0T0 D $0" WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_[kT@ڔ, BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  qPP, L 0o@DЍ800008$00$000$0000DA AD1(L2Q #RH L0SP0\ 0 j8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0n4( 000CS0(0 ,  @P, w P 0n?@R 0 @P@T4( 000CS0(0 ,  @P, M P 0pnH@\WAT!-eB@cO-0 0p0/PTM:0`<010SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSNjU , BU@L 4HPP! m <TЍH0000H400400040000EQ QE1(LH0A 3SH L0SP0\ 08iH0000H403Q #RH L0SP0\ 0 iH 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0W0PS5 QN0!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @GmPM,P< P 0 0D0LY@PLU@4D8 000CS080 < 8 Du@P< D8 000CS080 < 8 D]@P< p0@P@lHP0 0D0L@PLP 80DP @l P@l 0K0 00S Oo0BS@T@$0TPU-eB@cO-M<00`D  T yP0 @0/P:0 <(000r>00(0`SX040H00L0r0$`40 P 0S`Vڨ+tPH\00\0 0SP1<0,PS    T0(0 pSd 0Q8```$ #RHL R P \  BRH L0S0P0\ 0  0CShPhV/ژ , BVZ TdL `P: 2l 4w<0S >00C00S{ʐ:>=D0$ V 00Ѝd0000dT00T000T00Fa aF00010(L6d0\ 3SH L0SP0\ 0Sgd0000dT0QQ #RH L0SP0\ 0 gd 0   dT <  0CS00S0 T  0T00 Ld0 3SH L0SP0\ 0gd0000dT0<  0CS00S0T00 0T0^[XD0`S` <0S~ `|g HL D`P   T\P$ A# d X`P0 0C0000 00C00 0 0&=000`=  d B"00X0 0`00\000 00`63`P a(0Sp `X p000CS0X0- h X `pP$ \k `<  0CS00Sb0T000T0 } T0d`P h L5 0RK` X0 0 0CS0X0 h X `1Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh YP0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP VV` X0 00CS0X0 h X `pP \Cj`P0%'hUP\3j`U0PE 000,0C0 0000 0S/0 000$0pS SPpp ;Q> 0PCQ <$p[ P0hH0\iV 0, X0C 040040_ 0 LP0$0, ?oU20SS 0 E000 0C0000000 0S 0 59$0 0QP  0$0SYQ0X 0`(0‐PP \i`wꀐ( |`VbbBzB-eB.@c,eO-dM000&@`p0圐l0p0$ H pp  $0 8@#VP4n 8P  " QHLP\P@@ @D[L0S0P0\00C SJ]e[ A[<L $4@P @i`400004$00$ 00 0$0000K! !B1(LbZD!i`?@ V8080800S0T0S@dЍP QH L0SP0\ 0 e4 0   4$ <  0CS00S0 $  0 $04p0i 3SH L0S0\P00 0CW_L0S0P0\ 0  0CS dWe400004$00$000 $0000Gq qG 1800,000(00  0 @P KAV 0( `000CS0(0  PP  ,qh@. < 0CW 0 $4@P 2 0R p50 (0 00CS0(0   PP pP TpXP@Dp 'SR0000HS#SR8ppGor0( <000CS0(0  iPP `P 0 0<(PP<YP 0SW P00PX0?o2P @MP ,gP0%'Wv[-eB,e0@-00 : ЍO-p0@0lM$ `H  x00x0000000 00 @@  ,0T[P<{ 8P  # QHLPP@\@@DZHL0S0P0\00C SVcZ D AZHL ,<@P pg `<0000<,00, 00 0,06000J! !B1(LWOOg `?@ [808 8080V0@00S0T0S@lЍP QH L0SP0\ 0 (c< 0   <, <  0CS00S0 ,  0 ,00<@0 3SgH L0S0P0\ 0  0CT}H L0S0P0\ 0  0CS bTW<0000<,00,000,0000DA AD $1< [ P8@@@N QHLQP\ATDHL0S0P0\00CS bT <0000<,00,000,00DA ADV00010(L < 0CT0$ ,<@P ATL ,<@P0S 0<@0 3SH L0S0\P00 0CSL0S0P0\ 0  0CS 9bT<0000<,00,000,0000DA AD 1Q@0000 08004000 00咾@P A[g 80 p000CS000G ( 0 8FPP( > `4e@P QHL0SP0\0 a<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<H@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(c`X\` ^`[L`HPVP'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( l,P 00 08DrPP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8~PP(  4e@`P0%'0000 R p58 00 00CS000 ( 0 8UPP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8PP( `P 00 08DPPDZP 0SW P00PX0?o2X HP 4dMP0%' `TT1T Z-eB,e@-4 0Ü   Ѝ@cO-p0\M0 0@ 0 00圐$<S0  D0 00,0*0 00, <00 `SPu 8QPPP+ #RH LQ\P AU!L0S0P0\ 0  0CSP7`U  0 x0?R*`b, BU:L <PPP dP0000P<00<000<0000EQ QE1(L5P0[ 3SH L0SP0\ 0R_P0000P<0PQ #RH L0SP0\ 0 _P 0   P< <  0CS00S0 <  L 0 <0P0o 3SH L0SP0\ 0f_P0000P<0d<  0CS00S <0    <                0@xH00L00H0000  06 3PP Q0SZ L@ 00$0CST0@0" D  L`P HAcP\Ѝ<  0CS00S0<000<0D P 0 0LTD`PT0$0UHL@ 000CS0@0 D @ L_`PD 0000L@ 000CS0@0 D @ LF`PD `PFPL@ 000CS0@0 D @ L'PD  Z#3PHb[0k 嬬0 08#800C0 0C00 00 0 0C0V` !8888YL @0 0 0CR S 0@0 D @ L`P?DXU(R0@S`HtbHP1S0@0 D @ L`P D9(,kX04 G04 0000C000000C0  A0XN0 [p(00`Ḁ 00 L 0C00 00 0 0C0 @0SP Hb PH`0 H 0 0C0000 00C0L @0 0 0CR. S 0@0 D @ LLP HaPL @0 0 0C R@@L`P`DV$ 01  S0@0 D @ LPDV  000S U-eB@cO-0M0@00`p$ h,00+000\ 0068 PPDP+ #RH LQ\P AU!L0S0P0\ 0  0CSYr]U" )0 x0?R*, BUCL 0DPP$ Ma,P Y ЍD0000D000000000 000EQ QE1(LgD0 3SH L0SP0\ 0 #]D0000D00 <  0CS00S00 00!0000 400 0 0@000 000000 00x0p00<00$0 08 3aPP Q@4 L000CS040 8  P <`Pi8 P 0 0LҿPLU<W@4 000C S 040 8  P8 0000bPGP@ 40 00CS040 8 4 @P8D [#3P<d` 0Sc0 O0 08#800C0 0C00 00 0 0C0X !8888@4 000C S 040 8 4 @Pm8 0 00@S<`HP0,cX0 0 0000C000000C0  A000XV0 ` 0 000 S0Ḁ00  0C00@ 00 0 0C0 40P <_ P0 H H ᾩ0 0C0000 00C0 0000@4 000C S 040 8 4 @P <_ PR@ 40 0 0C R0404@P8 X 01 00CV@ 4P0 00C SST040 8 4T @P8T ⡽@4 000CS040 8 4 @P8 %PQ @4 000CS040 8 4 @P8 0@?S@ 40 0 0C R 4  8@4wPG88 S> LP8 ,Hp0 ,⹼X H0,P0 11x C60 0hd,P YM 0,0@ 40 00CS040 8 4 @8P78M<0 H0TPH0T0,0S040 8 4 @P8 P@4 0 00CR4ղ4@P -+[UI-eB@c@O-00p L0DM✠0L0<$ H 00$0 P (0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS9`ZTڜ, BT+L $8@P C^800008$00$000$0 000DA AD1(LfW4%^?@Pl0SQ #RH L0SP0\ 0 Z8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS YTv800008$00$000$0000DA AD 1p00(40  h0p 1@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  0] < 0CT0 $8 @P )E0@?S`0g]H@Pl00S=T 0l 08 U6 3 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0 0 Ln`p 0 +@P  0#]DЍ 0@QL 0 L  LP 0h`L0 0 0?  0J-@lЍ, BT3L 0@@P <\@0000@000000000000DA AD1(L_0S;\?@` V8080Q #RH L0SP0\ 0  X@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@i@P@V0  R- 3SH L0SP0\ 0$W@0000@00"  @Q00@00000y0A A1 չ<  0CS00S00K000 00;Z@0q E R 3SH L0SP0\ 0 vW@0000@00 <  0CS00S0000000:00'@0> 3SH L0SP0\ 05GW@0000@003R 3SH L0SP0\ 0 0W@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 V@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 V@0000@00 <  0CS00S00 00000008<@tz |TZ@0  \ #RHL RP \ V@ 0   @0 , B R  R 0  000408C@@HL@tz |TZ@0  \ #R HL RP\ A Q PV@ 0 @ 00  00040H P 00CS@0 3SH L0SP0\ 0&V@0000@00\ #RHL RP \ V@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 U@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ U@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 U@0000@00 <  0CS00S00 00000001<  0CS00S900000002 '0#0 <00480 00 0|2 3ı@P `AV <4 000CS040Y ,  <w@P, P 8R 3SH L0SP0\ 0 U@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  < @P, 0@?SP8XH@-eB-e-e@@@Mb@c,eP < 40 0 0C R 4  ,< @P,e00 H0@P]H0VT6 <4 000CS040 ,  <@P,  8]X`Y> ;*[PP <4 000CSST 4 T <b@P[UPP% 0 0<XXW@PXV <4 `000CS040 ,  <sPP,  8X@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < APP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  <PP, `P" 0 0<DǶPPDp[P 0S 0S P00PX0 P?o2X HP 8WT# $0 [P0%'T+p@- P`0 PP@0 归p0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSSST0$00, BT@L L`@P V`0000`L00L000L0000DA AD1(L0SHV?@80VT00S $0S S V@0S 8T0 Q #RH L0SP0\ 0 R` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$YR`0000`L0"  @Q0L@000L00A A1 l<  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 R`0000`L0 <  0CS00S0L@000L000P0 0\00X000 0:3i@P A 0S \P 000CS0P0f T P \@PT ] X$`0q E R 3SH L0SP0\ 0 Q`0000`L0 <  0CS00S0L000L0T900``0? 3SH L0SP0\ 06Q`0000`L04R 3SH L0SP0\ 0 iQ`0000`L0 <  0CS00S0L 000L0,800<  0CS00S0L 000L0700`0 3SH L0SP0\ 0 )Q`0000`L0 <  0CS00S0L 000L0,700`0 3SH L0SP0\ 0 P`0000`L0 <  0CS00S0L 000L0|6008p<@tw wTW`0 S \ #RHL RP \ P` 0   `L , B R  R L  0L0408x@uHpL@tw vTW`0  \l #RHL RP \ cP` 0   `L `\ #RHL RP \ sP` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 FP`0000`L0 <  0CS00S0L 000L000, B R  R L  0L040HP\ #RHL RP \ P` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 O`0000`L0 <  0CS00S0L 000L000R 3SH L0SP0\ 0 O`0000`L0 <  0CS00S0L 00 0L0 81R01Z 10000 08Q@p ,C`HHEP0s0{ ,?@c;t7\P PP000C S0P0 T P \@PT 0@?Sp`PX>SH@z-eB-e@-eMb,e@cp `P\ P0 0 0C R P  T\Px@PT[00 h0☸@PSh0T00 0S+ \P 000CS0P0 T P \U@PT 8WPP \P 000CSST P T P\@P!WUPP* 0P \x00x0@Px00 0S \P `000CS0P0 T P \PPT  XR@pW@H00,2300 @PH0T0d2 0R04\ P0 0 0CS0P0 T P \PPTXx|p RPNlh0Ipx |00\R  4 RI0 4 QSD80I?o200(0S> &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\dSPPsdY`40SZ00S P00`X00(pp?o2x hqPp ( <0R0(0XRTA80$ R00S x@u#sr8$srH(5 3 )@P/09 ,0 @0 # 808(0S0ЍP0%' TO-@ 0lM/00p0@@P0\@h00h0宬   U (0 L0  <  (08 U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CYrMY@), B RL (<@P UQP`!<0000<(00( 00 0(0000I I 1(Lv00SKP2Q`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0 M< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< n@PyU <K0q ` R/ 3SH L0SP0\ 0&L<0000<(0$  @Q0(@000(00A Aw010 Ԯ<  0CS00S0(000(0:00Y<0> 3SH L0SP0\ 05yL<0000<(03R 3SH L0SP0\ 0 bL<0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 $L<0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0 K<0000<(0 <  0CS00S0( 000(0008<@ty rTY<0 S \ #RHL RP \ K< 0   <( , B R  R (  0(0408u@rHL@ty qTY<0  \l #RHL RP \ cK< 0   <( `\ #RHL RP \ pK< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 CK<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<≾@PU<0 3SH L0SP0\ 0{J<0000<(0y\ #RHL RP \ J< 0   <( , BR (  0(040<0 3SH L0SP0\ 0 J<0000<(0 <  0CS00S0( 000(000v AR( ( F0 0 0C11C!0 埬t<  0CS00Sz0(" 00 0(00$1000 08@p 1B`HP0s0 !?@c@004000,8 0 0D13婦@Pp UAn T`8, 000CS0,0 0  [@P0  4M`"PPK 8, 000CS0,0 0  >@P0 0@?Sp 4M`H@P-eB-e@-eMb,e@c8 ,0 0 0C R ,  0 @P0``H0 4@PH0T` 4M`8, 000CS0,0 0  @P0 jU P-@8, P000CS0,0* 0  ԻpP0 ! 4uM@P 8, 000CSST , T  ᆼ@P 0 0XX`@PX` 1 0R88 ,0 00CS0,0 0   㘻pP0X\ ` LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  ZpP0 PP 0 0DpPy 0DSp $0SX P00pX0?o2X H=P 4LP0%'@ 0  '0X0X00,4 3 00 0@PX0T`00@`T 2U`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00 " U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;\HZh, BZ-L 0H޻@P ?LPp H0000H0000 00 000000J J 1(L`0S3PLp?@`]Q #RH L0SP0\ 0 HH 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS GXtH0000H000000000000H H10 HU0 | KqU R$ 3SH L0SP0\ 0GH0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00>H0> 3SH L0SP0\ 05^GH0000H003R 3SH L0SP0\ 0 GGH0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0  GH0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 FH0000H00 <  0CS00S00 00000008<@tx lTXH0 P \K #R HL RP\ A Q FH 0 H 00  000408`@]HL@tx) lTXH0  \o #RHL RP \ fsFH 0   H0 c \ #RHL RP \ XFH 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 +FH0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043j@P AU( D4 000CS040 8  @P8  @I`pP U8080<00S0T0SpV ,,003 3 00 0@P,0T`0K?o 2R0S@  00@`\ #RHL RP \ {EH 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 NEH0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 $EH0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  !@P8  @H0@?Sp`@HH@-eB-e@c@-eMb,ep `D 40 0 0C R 4  8 @P8 @H00 P0 @PP0UT`2 D4 000CS040 8  ̶@P8  @mHp`>WP D4 000CSST 4 T  v@PWX 0 0```m@P``@U D4 P000CS040 8  ሶP8  @)H@jp`02 0R $4D 40 00CS040 8   dP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 D.P8 PP 04 0DLPLZ㜀 $0SY P00X0?o2` PP @GP0%'T V [ 'tЍ 7XZLO-p M0`0 00SI$@hA/3 1 H`P寥 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0EVPP PU 003 00 0H@Ѝ000zS0Pƽ$ṼB@cB>@G-P `MpOPL0S@ EP 0b003 P@( 0U&2ЍH0S0 RP@=P @ P0SH0S300 10 CS 8:8HB@cG-`@0 S_Tp  SXPڜ0H0S0S 0 P@1 3 00000 00 0 P UU0S 00   ρT 0S 0ŁTT  Ѝ0 Pؼ@cO-0pdMA@YdЍU%`000D $0׳8 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CSBT, BTzL $8╵@P E800008$00$000$0000DA AD1(L80V 3S HL0SP \0  B R A800 80$ $ 00 0 $0 0(0400 00 00.@P ]A4( 地000CS0(0 ,  PP,  0E@B0,2 0R `54 (0 00CS0(0 ,   㾳PP,7`P T`2X/P@D`*'SR0000HS#VU8``Foob4( 40)l"0<  'Px0q Ye\%<3R=SPe0#S\$0( 嵏0 $0 (嶌 RP$0 00 S21 00S  0IB˱ Q!mP  mP P@@ 00,, PE000   cP_oQeP?$00P40S 00 堌4000P0x RH0x0yT3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#32024P u0u0$0<Ѝ(0 (0 08u0P t4P tTU Tʐ@'BRB@-003!z?` 0 Ѝ@cvB0@-qPM:Ѝ0@@80@ 3P@z?00`0 Ѝ0@cnBC-M8`0@XP:@DŔ  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`ЍBBBO-,M 0%!@ 0|PP`` d\%1R=Sd \1R\0 嵟 dp1>0S100! 0 $y=$SW 01000W 00p50 00Tp]4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOuTU Bڐ@.BO-P0A 0V 0S ?ʄL#" R: Ϡ!800L#" R*080O-@pP4M ů 0ᬄ`\Ŕ5$!\X    0 T0 L)L,)l"300^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP Di(b  $  jH000$ H0H0 , H0 00S  00S  V00R<0D@$0C!d 0 a$ 40`R0A00S x 9006@4X"N,0S HhBB@?B/TU T~BCcBBBO-p`0P4M 0 ?&0@00 !0\%0$01R 00@ ``&!! X0 00<P@? j4*!, ZS QS:lP ,l 00\ Ó\ h4Ѝ $0 R  X   !,iT(@U O-P0@Ḡ $M0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@PkP l 00Q Q +h $ЍH  0 0 PhT9@(BU O-PḰ@ 0$M\0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X:@ 0@P? GkP l 00Q Q g $ЍH  0 0 PAhTF@(BU C-`PḀ@p 0M~ 0\Žß0.S\! 00 Q    ` a 00Tl40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P }g40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00jP0d0(T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Ap0$0101 0 "p `@ H0PP0805@U50P%P0L05P000Tr40 `001 0 0p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0cP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0*PP <0 B2 b061")(!Ŗ''0001S 1' f X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(hcc8U@e8 L0PP`P`U1S 00P000T\% 0 R qq p0@01 0 0@-p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000TV0 p001 0 0p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0El0000 0(*P(l00Cl00 01 0g00T1 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPd)ePP0 0ap0T000400`0  0 F Ϭ 0f2fcd000 00 00  0OPd0+ wcpG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( $Pdbb< 0(bd0000000%FeP pԿH0p`d10 `.c040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( H0p !0001S P 1 b X0P 0 PB2 b50>" pPG Q0 :1S1 !< _8U@e8 L0PP`P`U00T \%0 R qq(0@01 0 0@Gp0$01 01 01 0` 0Pp@:P0p Q0@558 50P%P0L05P000T0 (001 0 0p00101 0 0PbP1S 01Pp 0 0T0 C)C)ct00<21 ( 0l0000 0(u'Pl00Cl00 01Sb00T1 P  0 p001 P@000 0 0 HPPx0d000 000p`0T0x` C)C)ct02160" *(PPdaPP0 0a0T00|0400`8P<0d000000(0!RdPPd00L0L 0ql0< R 0P00 `x0PT40@HҟP d`80slpJx`40V:[ h04Ch000T$1P Pl0R 0 L0P 00 0 0L@H@0H 00 (0 0?@Hp001 P 000 0@00H00 0PPp4ph0400 0000T0 C)C)ct0201<" ("PP4 d``4ph4aPP480< s0L <001d a<04p80P0`X`10JH`Pu00TL0 010l02H0 0 0p001 01 0000 0 PPV4 ppt0p!R  !  0  T B)B1) b072  0(PP400407l0 2H0L qz`_1S !00h  0 0(QcPP  0T0() C C")0c7#10 0 ad 000"00  ( QPHd0p ἐ?00T0 `C0)0c VQQ? Qw/" \5 S 0?!>0  0 F Ϭ 0f2fI`d000 00 00  0 Pd0) 5`pG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( PdL_H_8 0(bd0000000%FbPd0H 00d_|040n 000?N00cTO-@P᷇p(,`PT: [0 S0S (PZ@V 0000000@@000@ @O-需TMpP0S@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0v$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0_o@RTP$_U000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUPPPP;8%P@5PL0P@vc@ycAO-p|M00-P `븰[ 000P|Ѝ0 00\@000S/ :0 80QP0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P ]U =P n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ `PU@7 u]0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @H`( LP@% 0@D TTw 0,0 X PU@m,]V 0080\0000!Pi@yc0   R  R*4 R'@-hB000S -/0   R Q   -//@-P`00S-@! < 墬@P@P 0@0 0 P]@ 0S R |@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 T@P 0ST 0S@Pu@PL !0pI@p p G pp B뼰0@0 0  Cp 00 @W  A K+@K0P L" l1. Q*  S0 S 0 S00@$Ѝ 0p@ 0 ʄ pƄ    s  ɀ@P   z  s弰帀  @-@@A-P@00S= 00CS9< 奫PP0Sk@p?oV20#S 00W: 0R R 0000@0` R f@@-A-P`00SE 00SC 00A0 Y@P 0S 0S@Ѝx@Pp V뼀 0@0 0 Wp ]@ @ A H=Hp ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$r8H\0`0P00 00 P (0 P6\0 44#T20T20$ ;60 0Rڼpt ?0:# 4080$0H0(#00\GY@P\@P \ZdЍ\0000S00$00?@D0@0S@@T @ 0\00 0奆800t RY\[0 @0S 00004L0?tPP0(0`E 0/#\00000,< 1P(080< SH007D0 R00S 00S`0 1`0 0 400$0C0 0q T0 C)Cba)0c9c00, `Pg  R !00 R(  ) 080S03 S300S P" 00 00m00S01 0( A0L 0 0P 0 ,0 0,000 000<0`V0<0(00C(0~S 0 00T0C00 T0 C)C) c0<;2 , 00PPT 0U0T0S 0S P0 &_o$0R_P@0S \ZUS@cB@-`Pp!0MV @ p`0 W p0 P  $0 Q D 0  0V `0 P ( ,0 Q @ @0D 0 @0D 0  U P0 P 0 40 Q$ H 0, 00:00Ѝ    O-`0Mpp@P0 s00Su 0@ 00@`p\%1R,5S0 0 0 p0 o."\哞T1`Z 0 ?  Ϡ ,2 0 `x 0p`0 C c00T0 ` C)Cba0)0c"03\P0000x 0`0[p\0\%R ,քW YЍ0 wY TTO-]M 0 0$0@ C0CSR ]ߍ0S1  ;100P`S00|hp 0\5pSB\\?@5D0L 04; pW SØ,.1  0 Su0R: pSWk00S(p$p 0)PY 0000 0 Df8(\$Q?00 \09\&/ 01\& 0 0 0 0Pr  P$P$8ŕ0 @L (Q`Y!0800<00PS 0)R 0V:0 0 $00 01 $0加S 0 0kP0$ c2# S,P!Q  RQIp S1Q\Q\3PR= $08u< p 0 H0pß $0YW/  0k10$0  W 00 $ 0Q P 10$ 0X <#H0P$ p  ~p. ?. 0;0 S100 0! P 0u0S ]0 000 0R    000 0/SP0 c0 SRQR3000Z,00004000 ZP t0T RX  R?&4D00\h p BW, W pq0S*0p ,Y ! !X4@X Y   !0 C 0[00 0 0pQt1(( R@ 0pPi1XXϠ R$0 0 0p0 0R$       0 0000Gz0P0[0 S0&t 0( 0Sp0 0St0Sx0|\% 0R  P ! P01@ # 0@0H  p 0T0 C)C )0c8Ì"h0 30P(0@0S" 00 0 00 0S(0 01H0DL0H0LpW* p,0S40 0,04 rs \%5R,00 0!!0 ,0 S400 P00 L ᜐ pl̠: S?:0p000000S00000 00,0 S400 P00 A1ᜐ a8:<P0%:00S-q8%$"6600Q 00Si 0_P 0 b R320 QP1Q SQ ☐ pBᜠ b<  YS:0 B z'z b~3p2z0W p11$0 吓S 0  0H0$p5 5C20000 0G00)=0 p 0~pY 0&X%0'00 0 P 0 S100 0P 8@ŕ L     1ptpt1p@0S(0#S [ 0(0$ 0dž$0(80 0<080 H0<00 0R8   < < L   0 Rh  Bh    R  000c\%P0R !0 !08 P L@ l0 ^85@50%00L508Q Q0(090 0S 0 01H0L0H0LpW8up@5pL0p85@00L0TBBpGWm8Q Q0(0 TS1 p?H0L0H0LQ 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"7@P 000 P9S5U@ЍRG-p0 `$PS@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000孁RPV@-`00pdPU@ 0 Vp@ T  ЍT80< @31)` Q0R 0008<Ĕ?,gP0 C c00 0 ⥜P `9 0#0X  0 h 0S000 0`,``000剦008 1$01B0I> 0008<Ĕ?fP0 C c0 ,$0cP `V0L"֬0 0 40h00,000R@c)BMBxBBB$0G-p0`@ PU 000W Gh+ R 00 0h Rh9S000k$0O-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPt p$`W0@: ,0W0:F,Ѝ\0Q.0 ` 08T @)@)`"30LPd 00\ Ó\ HxH0哸+0[0: 0 TU p0Sp/0@-@0M 0@0@ @@@I|P|0 0@0@ @@@;L0 00@@ @@@ . Ѝ0@Cc Bl.e B# B8 p00CSp0/@- @ 壟塟@螟Ccl.e@-0 R  @ @0b ` 0sЍЀ-M [{ProЍ, BO-0,M G P0070 kpW PPW@?n /h+p+ 0 $+4UKP   0s % ! % G\%0R004\5 P   ,Ѝtl4RR  h0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3os  Ċ000k0P0<(%0 0R@0@0 0T`0$S> ) %> 1S 0DD@30Vj0P4T$0X4S E>0X4 #40`A'XL V$5S0P=$Rct $zc`P ‹PdP/ g80HL0S40pH0pՓT0 C)C)0c"03JPO  0r  G80`$%!0, R0 j0PPl \E^ἠ_<#| YP  0 ?<#Ή p 0Px 0)^`0 C c00T0P C)CRQ 0)0c03"*JPP يP$b"  FɊe-@D B8 TT5 BO BAp B0O-PRp@0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 SE0400P008T0<P C)C44)0c03"2I0P440$ R:E4 5Ҡ  0 Z00C?o200004圀AzV$%,0R00ĈL0Yh$5S0Pœ, H]4lS944S@040T3 0P1wc110 1<(%0 0R@0@00P :>0 $  * MPg 0L0凈0T h0倈04P FEUp P o$j00c000,20V.0700080 H0S0L0 C40œ T0 C)C4)0c03"}H0P4 0,0p,04 E,04080f$%0 , Rg 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P0夹Z 0 <Ѝ\4S  5  0t |000V`0 0\* _@db8@8 TT 8T2 B5 BO BA{ B@-0S0jP@  a@0T Ɉ Ѝ 070@T 9`_070&d`0u/Pp\0Y Vg>C^;`%l@c4_e`A2 B$FeA-P00`SP p`@P `@PHy0  ٙ`$@Ѝ̋cC-@p3$M/P++  h0$+4`P6T0h 0o0 51 50@0\%R=S04, 030304040 50o0" " 200(0\5WD`$ЍBT8 O-,M@40ATp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"036P$ 0to0$000SVD8 PAG-pMR R`@A ZP   hPV!P4 p^PP0 RPq0JnP V 0S 0 0R\嚇V 0\P 0]k0 P@0&00 0<PU:040000 0+jPP,V,`P``F HPU0€ g0PUp`{ ' :י&K$p`=S0 Po04=S:0 0S0SNP(0 aPPP 0 0S 50ó 5y=S  0  PP Ѝ0 5< 0L!L000V81 000C?o20000\4S Pu/V{: 5 0 5=S# UTP=S 0 H2C>00|0SUT͝010PVPT@c@5 B{ BA B BA-@`L1pPP 000' pPB=TSEP 0 <=0S ֶ<= SL%$%0,RL1*h'P "aV000:0@cO-P@`=$MS =S  2]T㠡T00p@0 ^P9]T 0/0T RdXdX T ي 9Pp僘T=S+ 00y1CnCP$Ѝ ᶊ P ṅT 0Pᘅ p 0   h@ B 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  0q80 V 0(00 0 0P40S #H0 .`np`` ? ൗ0:P00S P0S 0)L 0p0`085< `F V`!V"40S #H08<Ř  Ÿ   . ?yxD HLW  < W Q  #&&  "00`0,00,000"R0 0 00TXqTQQ80@ 0(00 ?P;H0 C2 00000 0&",R0 0 00p[@0Sh0'C( 0C8RP]  000 #8 '(80(0PK $00(0 +\Ѝ90( 0 8 @  1/7[!p@- @P Pp0p@0@-@Pp.9S ʰ;S  0"!`PQ 0 SL0L0ΖȨ0P0 0  Ѝt.ex.ep.eO-pLMP4  P3s:Pp R00`5M:eP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@;BP80' @DXT $@0,0 $rcY8 >080[ 0 0 0 \$  0 $ R0 8P > 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@ 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  M) R 0P0 1R H0C200 00 0A% P ЍO-需,0 0/\*0 ,\0 0 ) o,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` Fb@P 4=" 0 @P4<Ѝ8e@5``L0`(04S 2>oobT`V 00 0S;=@-P`c@P0 0@P   0 00P姍0 mЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?T p p 0 00000.0>000 ㈔@P9 W000 04@P, m0S) 0 b@@T0S3 00S00a@P  0  0@3 100\Ѝ2 :pP 0   0,0n:+@᳑Td@cvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-I Bp@-0@P XP X  0p@0 1/p Bd@ep@-`Pd@00`L`F`OV X╏$} 0p@0 1/.e@e@-@80$ 00 P@:p@-P@0S ʗ<|P P 0S80$ 00/f00:t #!SpP00S 0 8底0 'X B@cle B.e@-`pP X@P|0@@3 ;]@P XP Hs$00  Ѝ.e@c Bp@- 0P pX*\Œ\\p0QpVQp8LP8840=40 0@pDc BT0cqB.eHc- P0 SQO- 4 R 40  #H/" R @RP `@ p`f9gpTpTP^@!`n``p R  ^N  ``QRV^ 40S40p ЍHp@D `4`j PUiQNo @`j `>i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000c0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(0:;PP 0 =$05L0 C c#3800 9!600< 0p2#T20T26P $O8 Ѝ`(0$ ~64D40SU ;87800 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000@cTd@-0S    P (000 00 0 <ЍD0 p@-0@00P`06/ 000`06/P {00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0mzPEP0W(0,0ů _t1 000040 0 0刎pP $KzLЍ0x 0 | P ( 01/Pܠ0@ 0 p 01/wH4QrOpUp(6*C/Q @ ?QD   00ã 0WPMMM\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0! dd0`ʑLP嬓 hQ Ѝ!|@ B B@-0,@00V@"4/Ѝ6 6^ B0@-@0@000@@PD @DPPP0 0 P: 08S00P0000 B B B B Bp@-@`P(0P0  a P bqM000@09#60pO-P@p0KM 0`@`0U0:KߍP1 00P0 0 >0!Q \0:V&0'0S(.^S(,0S ^ P\)0.SP PO-P10DMp @0! 0x 01 0x 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 8@P0 h 40R 0 h`F ` l 0Qx NxDЍDcO- p`0MP$00$ 00@0000D000 t0pP @"D0900 00 0KS@$00|00000 :P |0S080$0@OoB@ЍPM@`00 0`0|0S0800`0007X000C?o270L00000L0000[00CT0T R ?R5:0X80@040X0  <00 @0C0?d00?\00\0K0H00,008#8@0 0h0X0H S80S0X0T0 H00(80TX =0t@P t XT0 P X40X t00?@Pq0 00(0t0(P0000ഐYg & R   0 P 0\  R Rj 4 R      IRLXP^P`z( ( (L R  A, T R? 4 R  R8 l0(fPl014 RB  R?\0XH800,0tP 3`0Sw [08S 0$00 U;d$X 0h0@0 C 0)X @<  X 0S (<  ,  8 R\0=04 XR@@)@@@@R0*#f @圐 0R@ @000P3X0[00SW 0 cX00T0 0 儀0"XQwx`$0x000 :{00S6 9S3 D0  ۇP@0S 0d \0J0L@X;H@Pi᱇[0 @<0@J,0,@0X[Q@T[=00S X0  <  C 0L 儀0"XQkwx` xp儇@P9  0 0Პ 0`p噅P @6w! x0x@Px0$ 0@X0[00Sf D0  ]P@ 0 儀0"XQ@  x0}x@Px0$ 09 x0ox@PH00SRDc B B@A-Mp@ `0- 0?PP$ 0 T 9 0C8C890000t0TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP$0  @@  9 0C8C890000*0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?}@Pm@00$0@T  R@@@@@`ᴰK [00S S% dP[ᴀǑ"$$A @ `@ T@ 0P@@@@@B ]0[ᴀǑ@Ƒ`0S 4"40 ] 哅0@P00 R ?R *  1/,Ѝ艛@ B BO- ,M@RP0Sp0 P刐`0I $$ߎ0  ?1/P6 0 00P 00000)b@ 4"400 00C0 0   &]*@X0 00`06/T,Ѝ ,ЍOꘛ@ B-DMLH ,  0{DЍ䤛@@-0"EP Ѝ@-0 \ 0 00\ϘЍA- MP8@<`P^0yᨀPPP)0P p@`Ƙ Ѝ 0 @-)@0 Ѝ@- @ 0  0)0 Ѝs@-`@0 04KPPPP L0 00 ЍpO- ʠ,ʠ`@*0  @R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#0 0 p~@PX0|0#880'00 Rd0X00$00|0 *P\PS4Ѝ z0s8 0@@z 0 { g@*0 p~@P 嬰0 Rt 娠0 Rp000*P\P4"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 +@@ 0 p;~@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *ᖖ00)0 p}@P# 9  :(090*P\Pl3-@@@@@A-`p0S t 0d0 0 0P0 Lc@P90VNoЍ@3oO-` 0M04tPR@X1)RP##G*D1 0PA@0 0}PPP79 08C890 000000p07/P Dp 0 L- b[ P ) B(B()    ᗁU A Ѝ.eC-` @PpTLp T, T4000S-@ Ѝ贀 @00@ \V   bB 00 0P @  070 @‡.e BO-30P @0 00 0U *Y0 SiIPS,@ 0 DsMP000 00S U0 20 0 0 kk0 0 0\00#0300S00 0 0  000,0$0 S:00( RT ( ,0A  @ 0000000S  1!  0@0PPkꫪ@- 0 RR@ @Th R( L@ @p  R0  0@/@-0`0CSx倅8<)Q\8 PP P^(Ѝp#sr$ 0?P<0SM(P`PP0V0 "2 0S`ᰜ`V <P 4003/P $ 40 <#1/P &&PP$ 40 P0<#5/PP =0:0w BTd@-`0P@ "6000 "40"()`$) P*0S< <00 13/(Ѝp, BT Bk B @teA0   000 0 01/@e0   0:0 0 01/4@ep@-P@;iPڈ000`0 6/ 0p@0 1/ጷ@e0 0000 001/@te0 0:00 001/4@tep@-P@iPڈ000`0 6/ 0p@0 1/ጷ@te0x 0CS0 0\ / 0, 0 0* 0+ 0 0/@0)H7@-@`P9#61S0S(0, 0C00000T @00D0@ЍpS  0 R( '0њȵ@O-M@P D`pI R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !@UP `0 R0: 00/S/0A-(M @  0P$HpLP`!Ѝ\JT T h徃000@0 4/0V0/oS" R(Ѝ000@ BC- 0" M0p0L @P- NP`0 R&0 S (pQ ` 0Q` ` )sW0   00|T @jЍ@@ 0 0 0 000 0 @@@-@0d(0$S, , ,0( @c@-@ P k0800F,0$ @R(( ,,0{c.eS/S  !!0/G-``pP  #}@P= qP KP T Sh000 Qpq0$0 PhP hP hP hh (}X 012@/ec?e@-! @P  !<- $MD0< 0 4 40 , 00 0@ z$Ѝc00/e Bp@-@ PQihfh ch$0@s]hp@ |/eA- HP0D`p0C ##R@`V( 01S P `0D1X  Q R 1P `0Sp@-P@P p@0! 000CS00SrP0U:00p@G-HPMp0SЍG0 0 0S1 0S- `` :;C@P0T@0P `` 0e<`P  t=00C0 0 Ax;G;; 0D0 0p0000C0 B Bp@-P@ gP$0$0p 00 $0Cp@A-@P`"v$0S000000A(G-0P@Sp`P0p0S(W !R 0 !V R"*0PE  1  BS !!  100C000CS0O-p@$PM 0`TT00 !1R 00B0 00TЍ1X0 0HS G 0 $ 0I  0@!1Rp0p  BZ F 0  0G p  00 S[ 0  0[ ^ @G-H`傊p  V@ P B5^:0\P`R  \ #RP  V 0S*0S  "  0 D@PH00000  #P0S .v PPH0800S000000"00C0GD  !! !R  !1   0 S  B!:00CS0000$00Cs0 D0HPD0cA-P$0@S`p000$00Cs0 AO-P`H@,MDh0 P0 0C#& #6&& 0! `0p $0s  }0  BwU  R!$00Cs0,Ѝ 0 ` 0 pB`FW 0K0D$00Cs0  0SH$U0@ s 0R0 B{ $0H sF q  -M0 $ 0$  M `F!9  M0S 000D 101P+XÕe 10$00Csp  vep  re  ne  je0 RS00P0S W \e0S Ve0S PeZ  Ke Y0 U0B$00 0V  !M0U0 00Z  ! M$0!9U V  !M0W$0j UP  !M$0!n9 0$pR0 B 0H 0 P 0Q d dd0Is d0 `C0 R ! B!0 0!0 yM  0 !0 0 !jM0 C 0$p 0 0H0`F0D`Y0$0U A-`MP `p1@0%T00S`Ѝ,0(@0P,0(0,0(0SX , X00(P\0cP<1 <(0SX@ @S , , , P0X0S\ , \ 0P0SP0! 0 R00R0S"000P0000SH(0X@S, , , 0X0S\ , \ 0UPc.e B 0 !6/ ! !Lp@-PS`@!V 01P 0  0ap0 1 Q000 !  !AR !  B /A-p@P`.0 00A0p@-@P`0S00p@S000 p@0{ /-@ $M0 4  *( 0 0 00u$Ѝh0 B1e @-wP001eA-P@T* 0S' 0pѿ 0S g`P@ 0 L 0S 0 ; 000C0 B p@-@6 P pP MPp} PP `O0 09667V pp B@-@ PO0 0p@-@PT+ 0S Q 0`a00C000噿 000Ap@ Lzw 0 0 0p@6 0S,1e3ep@-P@ 0 0 0<6Pp@c 0s/ gT0( $ A\ @-4 00A A"1S@ ^\01,0//O-(0`9p"AR0,0Paq04`0AAbATW" o@P 1@ S0@A 6PQW`p V000 YZ @`W``fV00C00S0S   Mq@cO-tMp0圀P@`@, ` B80 S6 ?8P ;80 `oᩒ tЍ(P,0PU0%VZZ28 00`0 < 08 V80J0 0N8P "SR 0 !^5T70S N8 0J0 00p7 `$6:00@ 000R  0  0 0m6Py:Y% 7p  LNY PN5ZV 6 !67h0S7 0Jp@0 00`v B B|1G-p VZ`'v& TA0$pp P(00@0?o20/ $ AP0# pB"   40xW0X (00(0XHaa$p@p P(p@Va,V0h )t/Y L@/DP ≽@18@AS8 80< <@@⾽3eH3e@@cc@/0@-`0ML@T LPL   @A_0 0,0 0X0@@lЍ03e@c B @-VP@jMO-plM $@6 `@ lЍn @`  t!@N@ S * 0L0)y$ @$F 6 J0 0 07PPk6"R0   46 6Z(`,  [ttz ZT44`4j 0SS (0,#6~_4BFB,@NB A-?Pp M     6  %:&p` @T @0 ЍP4434 0D0 06O-$MH L $P!AYpZ `4!C20(2>B"  YV[ pf$ЍO;*0 AT  QPP SPUR QP  RQ  R R  0Rn0@P 0 TL000 A`P X0P`@ď T0,0P:L`@$Ѝ3e@c 0s/p@-@`M) aQP1)< 800`S< < # ? 5 0`5PP50  RG $0AQ0%4 0U-H_`Ѝp5K 0 P 2y5(0,#6iJ3,v_@c]BC-Ap ᲻@QU` Ѝ<0@8PU {ܻ"AR0@4 R`001S B XWP Q00P `ZV U T,0!X00W0S `"V0P `PU@c@cO-@M ` @VsC f %  ! . R  F3  +0SI!4s    BR - 00> $!*:pU  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO40 @ <P 72 2 C2X    0 ,  4 @, P3ep>G- P@ U `D`(00@0$V0:Pp$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0peBmBP3eO-4MX傉 8d娉0:hR 0Pi?)v%t(0$ 0AT,0@T3 0B!"P0U QY (@ 0`0DC3f0S   $04D#0* 0e $0(0S, , " 80S< < # 0P 02( $ (( P( ,A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$09`09 0 *"*0 # 30 #6: ,00$0 0! 0 0*h0 d!1l!0 \    ,  d . 01/pP6 4Ѝ 0`0DC3fd0 R  R Z  ,d2x6d0$0 6 0/0 rp,0W  0h 0 0,00P3eEc}Bp>O- 00S #6:(00"  $ (01/#P1 0B!0S@(06` 0 0T:0fK<Ѝ0@s 0,  l0J0S Y5 )P0,,10F+f50$0S2P,/$0   0 :,0,/,/,'0, Z 00 0 0P3eEcB0@-,A,Q0  Mv*K\P & C\0,0,  P0 00 0@7@-@P2 0S0C 0 Ѝ0@ 0 00w0h P(0S, , " 0  (Da(0 Ѝ0@ZcB 0 3ecRp@-@P HU DTp p@O-pM00`$` H @" \BP 0HPЍ P(0,HpPJP'rpp'0V P0(0 H@0V00S#1s D0 0 0Ep 0 40& P 0 P0 HZ`PO-8pC`BP@ Ѝ$0!SS 80  ut U0S10 0Ep JPXddM@TP凶0Y0< P@ ($= 0S4R0(0 p$`( P,0,'"SR(@0 00000 00X 00 0ol0  000DDQP(0$<'0Y063ecX@B@-@P  07   0R  07,0 3100S/ $Q 5/@cp@-@PpPU  p@ p@hRp@-P@ T p@p@-@ 0S 0 0P`P   07p 07pO-M00pQ`@HPrPP U @T00@P" 000U## 0@ -P U&0W 0 DL 0D0 00@ @ E4P 0%_7 Ѝ&Z7810*}0.BO-PM8@0pH.0`0 0+0VŒ 0  `P Y ~,q,0,, G3P ` 1`Ѝ0S e,K,q, 0  .(0, #60] !6P H,,T,BO-p00@`0PH)+0 2 00 0E`P ',,3, 3P ` H1` Ѝ0S ,+,.  V6P ++,Bp@-`$0S 0$0P@fP   06p 06pO-`P 0Mv62 p3RL"H"  L"H"U =0@T 0S o@dT; 00  0R6 Q, w 0P"A+> R /[i WQ P'D0 0  ; Y HW;p9@!Pa 0U 00  @@`J,@P  6 0&62PK <0 ( 05  Dpg+Y  3Ѝ 0 9++*C+ 0D0 0-YU  0DABV  0 5SpMp p@cBB$BO-`pAM$ P@\+0h0i0j00$0Xp>0S .82<082$1<0S$10|$1Q}: R$ R l 7<K<@D0H@T0 @HP Q P<< 05P@0T  BRT 50 H $@ H@L   P000 <8 /H$ | XY p X 0h0h R 2˟`A&f, 0V`!0CFA#60CS  00`00\@d`h0YpD 00|0|P0 D=PP0V200C?o20S6 Y 1S Z 0 ) ) * VX P x(0,p0 06?  0 1/Y Q0F\@0C0`00d0 pP0H0(00d`WMZ <0!P0rH@a <#PP |p P0 @0S k0Sl00l0 0SP0XHp0 <P P@q < d< .0`@\`0d`0_X0bcX0P0x0g(0S [00p0W0 `V 0S  <0 P3P0SS)F)_) 0#3<0;(l0[ 0ÃQ 0  U MP uY i7 0/ O0 X<0Pe Gk0S* 0S'0P 8`t0H 0X<P6 03p00 80<p) P P680  B  X<P 030 Sl0 0Ãl00$PU XZ yB 0@ P 0<5/ PPW0P <;xe 0"m30P@800 " 0 R002` 81/80S1O E q Gr  Y R; 6(0<0MP3*PZ2P0S(v((0 $"3l0Z0P 0   0 ,0R< 0 0(0[' ,0( { 0 SZ <0bk0ASTt0CP0@`X Hp,`F( 2<`0 0 P ^ < 3!#L20L2 020 800 8  4  @ 04@1/PPN #UIX3 X0/ 0@t03#H20H2t0S0 2P000v l00l00S k0Sl00l0 P0X<Hp0 P `Pf <& 02x-0@ X<0P000#10yuP<jW``V@ |Z40x PU4'4'4'40 0  V P@ 0DAP@ <t@4 0 0 0'4M'4'T4@T  0'/24' 1 R"P{'/'' 0@0 0P0X<Hp0 uPp00 80<bp PZ8`t 0 10 [0u1XSjFe@c5e/Bt@EBEc;BPBZBdB@C- @ pP)m0 P RSPP P F3P  P 0@0S z5`P '&'JT03P5:P " ЍoBp@-@P`i  p@+QG-@ 0S`pPU@# * 0 @P U  ZX 0 DcX 0DcA-@p@`@P) ΄0 H@Dc@- .    Ѝ0.   Rp@-P@ 000@p@i00i@- 80000  0 ;  je0ЍDcB3e 0 f3e 0 f3e 0 g3e / /A-D0Dp0Pc00S@I0000A@c@yc @-,0@ ,0,0t ,0 1,*,*\%& 00S:R%0@ 6, P0T|c|c@-\0C0h0H0aXZ1(@^+K0 `@c̣@EcB0 0@c@-@0S#3003e@-@0SZlP  &+0  1$3PQ;!( 8u`0V'B5eB6e*B6e@?e%7#7\B :ePA-, N0RǠȠ̌' @N@  0 `p0PP ||k000dUPP(0 <00 0 P jЍ蘜@/BZBG-p`0P00@ @@ A0 ' T0@XhG 0 $pP 0 d #$P$jW I$J`5eDcp>3eBO-DM@p xT:DЍ!Z`VU3#:E- V@P`2$p>@-. .   Ѝp@-N@N@`P@ | p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 0$`0S #+P (0  r$0P 0S  $0`,Ѝ zI q"@0 j5eDcp>BO-N@N$M@0`SxPP$p`AfX0e000  1$0PV ly(`0 P  x$Ѝ H +"@0 zp>BDcp@-P`N40@N@ 0* p@{xDcp>p@-8PPpz@z0P3#pDc@-@P  0- o  0R 2 0-A-p`V@0y 0SP%PU! 0B0 0S0S 0  B;  0ᠫ0S 0S0S"U `FPP0 BA-Pp`VX+ @$A0S0S"000e""`0 0@} X @$Tp@-0Pdp0 5"@k"0S 7"t"B"Rp@-@P LU HTp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXl@$0 SV 0 RP0`PX000 00Cd Sd05$0000 S0X00\0d080D0<0H0S  0` 68 4000 R 0F 0H0S LX/9Sl `0< I pPe 0@ P 0  Q 0S `0L$ Hs@lЍ000pD`0 HL P r #RM4 0/x "[p 404 J,00,0f@0S `0LHE$0 S@ $ 0CA0S!000_!!@ 0S x`} `0R $@Hp0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #Ph2 d0/ vL(WX D0 @D0 0 &X `P 0DA6P LD 0 !D D!D 00 0Y D 0  !<Y 0 |D;PsD00^0 B H@1x 0 pP0 pp0p 0!pP 0D00 0  y  0K0@O000剩l0\0 LID%LP T ; H'EcBZB$=eBO-4M$0X0 P\!=!@lX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X% T \n4Ѝ,X @Y , ! !  !0 / @EcB/;@-$0 @@c@$=e@-`@ 0 ```` PP " 0@0 0 00 0 0S6!ЍpC-`M 0 ````p @P 4 P!m"W' 0`0C0@ 0; 0! 0WD0 0|tW1 0S1  T 000^Ѝ 0; 0p^@cc 0S:0P//0 R:P3#//rp@- P@00w^p@G 2`@=e0 @0 0p@- ` H0@SP`B   DD00 $p@2=p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`<Ѝ$1v3BDcS1BG-M 0p` @`3P0 P 00 0 0 `@a?o2P0S0S 00S00Ѝ R 0000 0YP DcP @-[_P010@=e0@- P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#0\0R 0B  UL b  003e 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B .0Sp@A-Pp`^@P !30H10@0P 0A!&0D$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S``` /0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`T0S #S PD0S [y000@cp@-P@P 0S p000p$030/@c@-P c-@ $M0 * , 000 00P [$ЍBEc@=eA-P`pP @P20 1000000 @ 0@AA-P`poP @22010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO-Y(0 ,Q x@ P0HX 0W` yv @``K p`#EcDc@=ep@-PQ@PTpHP 0 D B"&0:00 $00S 3/ `C@A-p`P<0V`!@0 UP1UP!{P @ 0S*0S 3 0S*0S GT 0S PwЍ0S$0SH0S0 P 00 $"K8SA-P@`pS&S<0V`!@0 T!1Q!)@P @ 0S*0S 0T 0V.Ѝ0V* 

 ;@00CS@0Y p@cA-P@pUPP0` 000 PP00`V D#&R  p@0S 1 PU000pЍ4 R @ R  00B W $6SV X130mPPV40S @0S00 80$0S0 0 0@00@0 P@0S P080 ]pP 04 R@  B@  0VP`U*40S @00CS@0  `3e@cO-P@4M0`<0UP!@0, T@1T@!Pp4Ѝ,` 0 Upt2300 000C0Uv0  pQ @ R p U 0 R H$Z 0  0 U01 C0h0 0C00[ C$ U1Y ( ,p  R0Qp   D @J0@@ 1/p @ `D $ 0P P  $R  0S0S 0S   M 0 S K\P 0 0  BR @c@-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P0 50000p5O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  P*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  P>Z   R 2/  U   U    B    AX D D H H 0  0 pA-@lpP`t&00LP0PP@@P  g@008ЍU x?e@-00Aʌ .  oЍ@-@ \1P0 0 000P0S R 3/0`S \P< @ 0F P z ݛhQЍp@?ЍpDcO-M Q@ 0| ЍOQ 0QSp0ISP#X*WZ 0P UPQ %Y PK3 00 0勮PP@040P04 vWp  J?0P`ph@00(0(0V,4s0s 00廛0S` Y 01 0!W@T # 2RW 0P0S  ?PTЍ pWg 0 0CRb00l"hD$0h00l $P" 0000H00SU4 D08 !HP, R ,0P S""D00<00+!D%"D%!D$0 00  0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !0cP0P `@IPZ0sU P3h@X@@@-@pP`MR  0p? P Ѝ@/ЍG-0@P0`Sp0S 00S R 3/000Z <@  < 0 000SX@`@@BEBPBFcbBFc[BpO-M,08<P4 / H <?00/0 0 E/00 /0 0 /080 ֿ/ 0<0$ (0/0, 00/04 80/(0< H0/,0L /T P0<0DX0/@0\ p/`0d 0 Ht&xL|TX\fjfklkalal`mbm`njh 0n/1!n"  # r# 0΄z/1!  L ~)  I * *! / <" /#΍  @  ͍ @ %- , &- . . @0o/|"!x2"!(1" !2"!"!"!"!" !"$!"/" /$ $  #8!# nI/#-?BC@! D!  (# ,#L1H 0 04PT!8$ <#X\ @ÍDd1`!(0L3 0H#hlPTب6>Щ$@ 0@00@(0 B0 2@@ R"`  0p0?U0 0S?#03@, 030303002ߍ3e]eC-MP@P`` p 0  \ P>H1 R*Q,s @! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221cc3eEc0a/Q/0S //C-Mp0@`00 0` P) 0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 KP Y 0 03/:#:SSX  0 . 0D %6SP0S 0P 46S[0 x00 0Po 0 ip>@c3e0ʠ,ʠ 0C00S >0 0>00@<0 # 3P 3 Q0!03S/O-@$M:#:S0>0>0 T*!`#600 0  PP   [P$ P 0 0$Ѝ R* P R: R ! 0 $p  TR 0T :0 0000Q R:MJ`H[ W ߸0W00[! 0! 0 (,0 D 0P%J` 0T:W [  DD9P QPX@O-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { PP 0 0(0S 00 0<00800400 0 @00Fc|cC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00s$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 0O$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 P0 hUh*P}$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20jY ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P 6 0D00 Pp@p@-P@,U Fp@p@-P@P <T@@pG-`@P $ T0GE 0pM YJPO-tM@$0$0圀@T` Դ0 $$FJ0H0 p T 000@  ,00 000 000,00 0 1/pP  $0tЍ P埴p,0Q P,Q,0,0@TÏ6 ÿQ Q00   0P000P0ƴ` j0S P   pmB74@-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6 Ѝ@-" "&*C6P Ѝ@-" "&*C6 Ѝ@-" "&*C6 ЍO-A11 0R tqs0\ ,R 0 (R 0!L P ` Ѝ P @`V2 QE A00S00S  R 0  rT PP\ /P101101@@@U4ec3e@c0cG-` PpGP |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T c4e 0p@- @P!  ` 0( 0SQH0;H0)1剌 P0RoP  0.Q 0+M 0< 0000p@ 0p@- @P!  ` 0( 0S!H0;H01Y X0R?P 0.! 0+00C0 0< 00 0p@7@-""&*C6@PP 0 Ѝ0 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@P@ⱋT@Ppcp@-@P@T@PpcO- s@0PSDM@0S^ D0S@Z b10  B0S#0 0=/`0@`F`0`0@00=0S @0U5DЍO%/ ?@@D @00r@P x0 Q"0p`0[) 1 pW1 @  P T .DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@F   3e4eEcT?e5exB@-T R*0B 00 (HR0\ 3eBA-`Pp@P @P0SPD0S TH P  6P4eBA-$aP0AS =0!>00000000 81Pn 6810`U 0CS*MH뤀p0W!W000N@N@W\0ЍP< 0 FJEcT?e3e B@?e6Bp>cBO-B2 ApP LD PU@@WpHW`@^P$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0aPTP`EC@0   S0P    @P 0>0000000x (0D0 , *``F X뛦*@c@cB3e4eB}EcT?eEc/p@-`P@M-0`P @ pT?e0@4ep@-PU@Gp@x0@QX00 1Ġ  S0 Rp@mG@cB3eB \ @- 0pt0S]es@-P@ ` `"""&*C6c 00#  0+0 0Ѝp@A-@ PP` ""&*C6K U`" 0p P(,`0p S 0: ` S 0; 0@`P 4@@@-@`P0p0:0C0 p~ Ѝ0 /@-@0:00M0 Ѝ/"&*C6"0S/_ 0S/c 00CS0/@-@H3e@-@d P@U @-0@S0003e0S/@-@L P@A 0⑈Pp@-0@0P*ኈp@臈ᅈ@-0@ R0 @蹈00嶈@ A-@ P ""&*C60S7 0d P , 0; 00  Z0:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(0F 0 00 0S0SPU 0#P `V' 0S 0x0U 0  :0V281` 0 >>⣂R P A 0S 0 `(0` 0p 0s1Q9 0 6 &! R  010@ 0"61@ 0"601008 000003e@cc4e3e0cO-M 0DP @@pH뤲2 a  00"603S P0 PYYHP T|EY  J PY ,"($($ W     " "| 0f0W @(0 0p,0<  0+ 嗇$ X  Zn0L PY 0 P0 PE ЍP  0,P0SX  R * |R + 0`L  P  @ @c3eB cc@@A-Pp`VUAA0Ds 0 0 0P 0P' 0  0 0b`0 00цI4ep@-0@ RP0 @00 R TpP0000TUpp@@-@@p@-@P0p@@-  @-  @ @- 0S Q ꌮP0Sp@- 0P p @nP T  0Rp@pp@000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/4O=N=M=L=@-@QPЍ@Ѝ /A- @@Q pPW`/ Q 000  0 +P(P0@/@! R!/! !AT xP 00S 3/V@cp@- 00S@ SP` Q @p @@-|@|p0 S 0R``&0!000P0Q &0( Ѝp?e3eDc0@-@t0tM@@@0 @2LP @^ @4P00S 3/@TЍ0EcDcp?ec@O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z' 0S 0 0 0X0 6$0$pU0$,Ѝ d 0X 00L ^0 PEz@c4e3eDp?ec6B>B@-PfMv0@Z0 06S ۄ0 0Ѝ@p{p 0 hPȄ 0S  p0 P PЍp>p?e3ecO-P0M  R0 Q @K `pᣫ0Z00 0Z$[ T{ ЍU Z `@ p ( , "&Yp@ `p@` T@ 0S0`i 0200 0S QU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 U  00 04d T 0 P0  (,,Ơo U ,U {3e4e@-0 . Ѝp>G-`@M@fo p P娂EVW0 0  *V0 ׃+@ЍpC-@PpȐÃ`Vk7G9f7P@`pV 0 t@oh0@PK`X壃E|@܃;PTPE_o@RPYEcc?eHB3eTdp@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0p3eQJdVUUU?e7@-@L0SHAPZ0#L0Rp00SdU?`0@AX X 00 0I,0 004 Ѝ0@4eQBc@c3eBEc?e5e3e@-X0 < PD&@'@0`@0PpP&P3ec5e3eP/@-aXTH0, P<@(;,@ R 0 03ec3e5e?eA- 0@S0p# PU# ~P`ߩւ 0S `U 0S 0  ; 0 B 0SP0S`PV p@- 0@  P P 0 0p p(0, #6 P O-EM } 8 5@5 `>o`P p^@l5lEp#d5 DL ,f 0S 0SC0S@50%0000 00 0RV `]000@0 0 0S#1 @0D0@0Dl4pX~W @0 ~?$101>}p@c?e3e?e?e@Ec@O-\MP P 9A0.2h !0S000C0< 0S0 00 00000/4e0c@-@P R00 O-TMPx0 @S@S#2[@T U0!:3A00C 000|00  U00 Z0Sl ' '(0, 0P)0SZ H0L00H#6$000c,0x00c(0|0J600P @0$#6CP0#v0P,0  $0$ 0S[@jTЍ6$0Pv0#fVnWj* @)P@!@1 V`!x0@D @#60c@(00S00PIW@1@!@D @P`1,@x0S (00C $ 00C 0@0D 4 B Q 4 R00C@<08 8<0 F A0|00Z ~Pl 0 fPR 08 0H0S0H0L0Hh0 pS00R0S<D ,0P`s 60C00 0@G @D@ @T@1T@1x0S (00T@1d0VSP1x0S (0px0pUP! E R %p# 6`F :  T* 804  80 $4  Q* `F$ R 0U:Z @PZ@HP {$ p 0 p R0L0 0P@8 0|000|0 R0L0 08 0|bC @ 00#"(0, 0P@0#0P00S 0S @ T 0S^  P2[+X'*PPUP1[`! `1EpV.PppW PFE0 S0 0Z" l@XP1P!pP`1gEp 0  |Z PP @|uA J@h3e?eB%B z?e04 S/P @- 80c.B/0@/c/0 \/у0P1cA-@p`H1ƒ RL R^!^D*   R `V`F`Py8 E@V P^@o#PA A B R`V`F` V P L@cSBp@-P@y2 Q*    0R p`VH+8`F`V @ LPpcSBO-10S8쀟`Pp U@"60 @66W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ K3etBcBBB0@-@X0S0/"R\:@\*QL0@0C?0c@- pP 02 0  Ѝcp <0 P 0 D R 2 P///c4e@-P@-@@-P 0c@-P 0c@-P 0c@-P 0c02P 00 /c02/c02 /c@-@P02 cO-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000#ypc3e@-@PL0"D0S 03>4000,02Ѝ0004e"B?ec1B@-0XP`B 0\`R 00P@0 0 0x Ѝpcs@-P0@D0S 600Sx TlP: X6`A P<64`P@Ѝp4e@>B3etBjBBBc0O-M`  0p0P0dd400ЍZ04 0,,Q0D0BS0S Z5*y6P .0LP Z`Ve60`F`@V @ DpD @Rh 00C 0R P 06# 08 P 00C 0&@BB4ec)BSBc3eO-,MPP@P U.` 0pqP 0㤠N@T P,Ѝh ``F&&$ $    01/ 00`@0/@- P00 QPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P`៞0vw6 00DЍp0 P/0S  4\Q 8< Q < < 8H  BH /80 Ce3e P00S/P 0 (Q, Q/8 Ce0P  /xEcp@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P0S  00 Ce3eP0P/@- T000 T0 @S CeG-@0Q00P00CP0-w2P'P""R,40Xq0S)4D140P !+vL00CL0$ T00CT04;P4 `v000P00P0v`0``FV`,F`pv, (nC0;H,,P`Q `\ X%F3e@c Ce$FeT@nBxEc 0 `F Ce0@-P$0M 0 0 wЍ03l!2@-(0 0600wЍ3l!200@- 8J 80@2Au0$0 0Z( 00CS  "p! s pbR R#  $,0,0` $00,$ 0 ,0 &:P+   0P?W0^ 0P?W0m `t O@ptZ 0V( 0P0CS  "!s8   aR?R800   0 0`0 0 0&:P  M`xEc@c4e Fe@c@yc!Ce1DJd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddO-<08P4M4;T@%VZT5t@otX00$004ЍO4`(0唐PEQY" Y 2?8P<0 "0 tJt tT00T0Ct`004ЍO+ p$0p0 0$00Ż0TY0@ $0? 0$(  4Y+0P0"sr1m00000 0S P`&U$00P?4Ѝ@` ? $0D !0A S $`0 (00$000) 0  ,8@/< D 0 P "p R Q`&  H(0Pʿ 00 Ir@c]@B0Ceh@B Ded2A-`@ 0$ p B00C0 00C 00S0 %0S   R0$00 L00CL0A0S0% De0Cep@-@a@81M @H@   sQ1 MP 0P '@Pi*000!@ @@@@1AP P0 00 P@@L"h0 00 P@@ B" @0 Ѝp Ce3e@c Fe@x@BBBB!B8B@BxEc,Ce,CeS QN//O-@0CM`S$@X7H00CߍP8S,坙0$'0CS0 7 03/@ >60`B>  e0 0000 0%@P0 S 0h d P!L6p2P @0S %$0P0%00CSm00h`P0S %h X$0T T0,0h0X 00 #\,t`Vh @@p0S@0P5 44Hv`PqjP`  `*rV @%P04p00`S 00 4$ q<P rHP%yv@ jq$h 0$ ,0P0 / !h340X ![&`PY$ Yp0`0P %30X !T&qhqH/%,@l!h{&`P0 0 0@0S0D0?d4;&fj0S0F0Yg 00@21P0X10 0 4C#"#04>0CYC 0J[}  I%- "-뀱t!(0m=Pdk0S !0S    0 0(!@P .(0,`(0p00000L L P P &q`VpTPdq@0Hq @@3e,Ce<@xEc8c`Ye$FeBHBD@@cBfBewBBBB Ce BB%2@B1 0S/G-H0Sp,嫗pPU,pG@T P 0  4 F c` 0\pV  T,#R<00# H00CH0]8@xEc3e+B,Ce@c CePcB?BG-0H0SG0P SQ@ 00TppW R00S0 00@T p 0$  0 0S0p` #R<00# 0800X<0@800 00 0T0 0T0]p(08@ Vp3e@c Ce@-T@L0S@ D pdX40 0P@T@@;p3e@cxEcp@-@4Po@e$0 0$0p@%p@c3ep/p@-`LPop@( 0F 0 0C 0T00CT0p@ p@c3e000#1 7@-@HPt@ ,0 6@PA Ѝ03e3e@-@aM }0Po@  N@@ ,0D $\030#R0#02S o `Ѝ. & R o`*t 0 D`P o 0 D"60 B+ 0 B"6C00S("06BS-XN, !004 0 #6:S"& :///R/>0 0 y@-@#oH0 0@Xoꨋc!'O-$MPH0TQ@`LpP0#0@ 00S 0SZ0S R0 0`P60 0 H00\XTPLp$ЍO&O-Mp8024?2<>2>2P/R 0R /@D0@D \0/A-P@pT@00p P`@T"  P P @ `@T  P  P0`S0S0PPP`P P /qEc 0   /0PQ/Q   / P/P0S  /@0@-080@0000(0 0 00@2l@2@2XA2P P /(6EcG-@`p夐 0IZ P1P!0 Z0 :Pz E 00 0 0p000 0`FU*G-PM0S : ` 0C0@ H@IT  Tp1{#I0 PL@D  \ 0*WAD 0!   0 00  * @ ۍ0LSA-@`pP(  pu q mЍA-`pvW@1 @P@00'c<0 0|0՚PPD0 !00F? 0ۚPP 0 0%0v'ЍBBO-Pp㠀AM @a`pdH1 h0L1l01Jp0@@ d mq `0 000 0 0RЍl ` 0 ,` BPT pf2d2\b2P Q /CCFcO-|MP`x D]h@ pT PF 000000 0 000000 00($00(0 000040 080(2<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 vF0PT00PE 000 @ӏP @@ ˏP0@00|Ѝ`Ps@-@P`AP Ѝp@rЍp@- L@kP 0S 1(S2S PBO-0|M3S `PP1S S2S @$J$@P $|Ѝ22 06 00 00 0$pP $@E $ 000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J vJ@D@0> $@"R)0&0CS$@ 0000 0$>@P $0SW00CP $v@"R"T@10 @ " 0TL000@ @,@2S0$S0S(0 40s0N@N@4@800XSB 0tp<1W00 @P tp0t0x0S3 @d n C0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!z@P00( 0;0@P40〰 0D0@PDP5S7S 2$0 $00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$  0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $ 00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@o  0(@1!00L0 0H0c T ,0 S0002 02000x0h@|0l0$03/@P! H 0@H0 ? 0@0@\b2 00. 0.0 0 (03100 >0#60ЍЀ@cA-P@U 00 ` 00000p}U`  u`hFcA- $0p0 $0 0@R`P:    U@` P s00 00$00hFcx @0D0@0D0S/p@-@P`0S6000p P 5PhFcA-@T1  0`/ @+ P!pe@P0| 000&0 q 0  0 0@P 003/Ѝ@@-$Ma01@00 0000 PP0p  ܭW 0 00 .  00?P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 000000P$P,ЍA-X0 00$@0#,C04@ R1D@(2Dp<`C0PB` R 0 00000H0Es 0 0000 000H0P 000 0 PPЍhFc\b2$0 0!0 00 /@cddd@-0`iM0 0 EP 0 iߍ@P p0 tpPd  U00> !0pYeYexYeYeedA@-<0DT 0 !0  !@cO-A`z M☺ b S0S Bb2D vPD202 000*0P rQ0  |00 l 0  \ AT HDDPp(DP|PXDP D0/SY0p00G pD@-0 0ġ s0!00 "0厉PQ  0T 0 h 0  vP9 K4/,00P@  88<@0`P#$ ,wB00  i P0T0P0Sp\Z z ApT00h3ЍBcFe@B ;BdBBx@bBlB7AAӤABBBzBBB0@- ! 0 !@- @0S 0@wYeYep@-T0PO`d !0UF Ϡd 0!T@!pl?e@-0`M0@ 0 Q00 00  @`T#ʴ@Q   4/0 0 &#:Z 4/o?&6 :  NX 4/`ЍH@DFe6 A@BAA AFc˼A46 A A=Al?eKB^BEA0O-P`p'DM,00> 0 00P(`$ pT0,0> 0> 0 00P(`$ pA'0 !d> ,0  00P(`$  p, 0 ,00!> 0 > 0>00P 0(`$ p 0 ,00!=0= 00 0 00P(`$  0,!t t= 0 00P(`$ `0,0 ,= 0  00P(`$  p֪0,0< 0 00P(`$  pª0,0< 0 00P(`$  p宪0 ,00!D< 0 00P(`$  p嚪0,0< 00!;0<$ 0 00P(` p僪S0,0 0$!; 0; 00P 0(` l0 ,00!P; 0 00P(`$  pX0 ,00!ʟ: 0 0 0P(`$ B0,0: 00!: 0: 0 00P(`$ p,0 ,00!`:0X: 0 00P(`$  0,0: 0 00P(`$  p 0R!9 ,0 00P(`$  `R`: 00,!t9 $0 04P0p(` pةR, 0 00!90 $0 04P(` p忩R00$,0 0 00!8 0 04P(` p姩%0,0p8 0 00P(`$  p哩&0+,00! 8 0 00P(`$  p(0,07 0 00P(`$  pk)0,07 0 00P(`$  pW*0,0@7 0 00P(`$  pC+0,06 0 00P(`$  p/,0 ,00!6 0 00P(`$  p-0,0;$0\6 00!H60@6 0 00P(` .0,06 00!6 0 00P(`$ p10+,00!5 0 00P(`$  pۨ20,0|5 00!l5 0 00P(`$ pƨ30 ,00! 5 05 00P 0(`$ 尨60 ,00!4$ 04 00P 0(` 器70 ,00!4 0x4 0 00P(`$ p儨90(,00!44 0 00P(`$  pp<0,0$3 0  00P(`$  p\>0,03 0 00P(`$  pH?0 ,00!P3 0 00P(`$  p40,03 0 00P(`$  p @0 ,00!2 02 0 00P(`$ ` A0 ,00!l2 0d2 0 00P(`$ pB0,0<$2 0  00P(`$  pC0,01 0  00P(`$  pΧD0,01 0  00P(`$  p座E0,0L@1 0  00P(`$  `2B2BEcBBT2Bp :bBt*5BBBBBFeB2B BBEc<2B2`AiB*B.B6B>BFBVB^BkBsBBB}c@2BP}cBB@BP2B2gB2YBBBBBB2A2 BB#B4BCBPB aBc{BĈ2B2B(2BBB(FeBGc02gBBB`2 0 00P,(`$  p4 00!4 0 00P,(`$ 5 00!(5 0 00P,(`$ 0!h5 0p5 0 00P,(`$ pߥDЍO- 100a,$@ @@ @PO 0(00 00a,$@ @@ @P> 0(0l0 00a,$@ @@ @P-4ЍBBBAAOABh}BBv3BBXABP ƒ #60 P *R  P 0 / 0CA-0@`P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0L0 0!d 0 P:00 ,FescBB@-L@P 0S  $00P 0000,Fep@-x@`PUpPy>00ST}4 y<0 80yxB8Fe,FescBEcB0000 x,Fe0@-M 0000P 0`@PP8 F@P 0 @@0@ 0 @P Ѝ0S  @!!l@P @0Dp?  @Spr!@@Dpd@Pp Hx`0S@|x0000 @P L0S00p 00=@P ,Fe8FeBP2O-RM0SP@ AX' x0SP.t,0 Ёa,0zX₩P08 0(r*Q0(@8(0H> C'!(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$0$0 ( $0,0!@0<]|x|P[0) 100S$ ,(P?0 00000000 00 @0X PP  @A ,0a0wЍ 0,Fe@BEcEcc"B8FeO-MQ@L @pP `VTP@%ЍH0 0D00@00 01/PP P@ `p@-P,0@Tp[P @(sc@-@m@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  o` ЍX/\/RA-PR`@P\p 0!S 8P d!X@vPP@@-X^ :S!\@ w s@-D0`P  @P``00Ѝp@Fe@-@0'Q@Fe 0 a@Fe0 u@Fe@0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/@cA-pP `V@P PvP VvV @000V 0 `@ 0S 0 00 P000 @  1vDFe(sc0@-@PMu0@0@ @@@0        t d T  D $4(Ѝ0@Fe?BEcGB]BBvBBBBBP/H0 R R 04 R R (scp@-@`!Plku*@PTup0`0 00$P 00000@u@DFe@-@PIu 0S 0 0S0   L00C0u@ 0S 0S 00  DFe@-$ P P UPЍ@-  Ѝ@Fe0@- 0 Ѝs@-@PM`8`+N0 0Ѝp7@-@[3PPVPP8P 0  Ѝ0@ Ѝ0@Fes@-h` P0@0@PDPHPLPPPTPXP\ 0PPЍp@Fe7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ@FeB@Fe=@Fe@-p@`MZ1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  ZЍ @Fe @Fe$@Fe@- $Ѝ@Fe@-0 0 0$Ѝ@Fe@-0 00 0 0$0Ѝ@Fe8 0(  R@0/HP 4/@-  @((nP @ tP@Ѝ@Fe @-L0 00lFep@-000@S0S00 L0P0p@clFe00CS0/0LlFe@- MPlFe/@-p0M`0@ 00P0$00|0 0, S00` (0 ` 00 000000KЍEcEcEcFe@-000S ,0 R@5Ѝ@Ѝ@c0M00Ѝ/Fe0G-aA8Mp 0kPU 塽<1国P1?0PQP0S  R00RC20@  0,00$0,1P0$1`|00 (`000 P Pp֖P0,00$00(``00 000 `P Pp8 "; |8 0S X; P8ЍG8ЍEcFe@BEcEc0scB2BFeBFe2B!BT0 / 0T0$0! R!/ R  /FeT0 / 0T0$0! BR!/ R  /FeP0/A-(b0S  (B 0x R x0t0SsP0PQ}K00S-T0  1SL t00CSt0ڑAK0 001 S P0T 0 P0T 0Ut0H0L 0 H0L U 1ST0  $0L t00CSt0U 4S32@ U 0 0 0 `0d 0 `0d U 0 0 0 X0\ 0 X0\ h0l 0 h0l Fe@c@-`@P@sAoj0S]0SD00CSD0O0D0p00CSp0(嗳00000 Ѝ@eFe@cA-l0p@P`4?P0 1#A$'@P@Q@ EcA-@pT0 Q]P`J ÀPp0 ɀJЍc@@0p@- AM@PJQp@J acp@-P40 AM@JQ  Qp@JcH/@-, 0#@0 ˀ@eJ@c@p@-4 0#P0 㻀@UJp@c@p@-@4 0#P0 ᨀ@BJp@c@p@-@4 0#P~0 ᕀ@/Jp@c@G-@0 `0p0 0#`% CPPP `0 @pJP ?0 RS  W: 0 Up p^3  0S 0S 0 EcG-@0 `0p0 0#`% PPP{ `t0 @pP ?0 RS  W: 0 Up p^3  0S 0S 0 Ec0S/ 0S/P/0PP/@/Pp@- P- p CJ "0?P.001P PP0SPPSU`P P 0 0=0d1  PP ϼͼ0S @ kTPP 0$P80S101?1?11` P@V@@pp@-@HPE@080C@00S  0 Ep@Ec@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PE਽E @0 PUEttlp0@00\PS 0  P@gE403CEEpJdcEcBB@c@c@-@@Tp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0 Q2-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|WЍO:QQ(0pS<0(00 0 00?o 2?B0HS?0 $00H?oR20S50H?or20S.XD`xW01x0#L0D4`P(000U L0S:Z0S7 $0S`0$ S0D0@0 P 0,@DT`?D0!l`P D `=,0|D1@4008040 0S`,DmDDkP80Z80 0T0T@T XH3$ 0R 0 S030#R0S 0H0KD`0H023rX`x `\V`@d0X `X@\`S 0lVh0(0p000t040x00儐0X00X \`> 0V㔐0X00X \`, )0V㤐0X00X \`(0S V0000X00X \` "+0V0000000X00X \`H0000 0000|0D, DL00 `@i`,CVR00000 00C 0X0 0$000000Cs  0005X @00S0000PCX<C됌(0S 0 '" <0 Ѝ`Yecc\sc@cO-p3|M3WW3@03?0 |ЍZ0@mTh3 0,,00,@P W8^C4\C030JP`U L0SVZ0SS MC0 0000P 0@~CTA? 0jP: sC =$0/C1@0000 0S  0S  0000@T  C00S $ 0R MC000?Z0F 0CC $@CB [jYWP13"W@ 8  #0S/ 0@0 0D00H00L00P0 0X0$0\0(0`0,0d000h040l080p00S<0t00< t C@0 8bP0@J@`$00 @Ԑ0 4ϐ40 HD00Ȑ0 LÐP@00S0x000 B`FB`/@ccYecc\scG-@8M 8}B010Q0q@,1P@0 1@@ 0 0@a1 00@@ 00@000p`P\,00 000(p$@ @ @`Px%M0,0l0 0d000`0(p$@ @ @08ЍcBEcL22Dct22BT2 He2Bs@-@ `]$B1 R]B@Ѝp@1S 00@T `B00000HBFB0@-@P$MB000CS00 8BP$Ѝ03B 00PU 0  0 ! 0 0 05/ PU 03/P0 DcO-1,M 3쑓1]00AA0 0 `V 7P&A ,Ѝ0001SppGp $p W p4A 0S = 0$03/A01$9L0 000S 0@!!$@A@ 0 0p 07/sA Ae @cs@-0P31!1  SA0S0C0Ѝp@|Ȯ0` @pV PЍp@c7@-031! Q@APT 1S000 q렮00@T Ѝ0@cp@-@P0P ( R p R p0pp@-`P@P (0S &p00p p@- ЍO-@ PM @1失0,0p10Wp!0`1V1!0020[ 00 0p@'  T0p@ BZ0a0Sc1 S 0A`@@ЍV `3`#@EcO- P$M1@00p1W2Ӈ010; "ɒ0ȂX`@ò @  1 0&@000= 0e@1 W @[A $ЍO=!  00 C0 BdWڜ!0R0[ 0 !j O0  !j EX 0A1`嘭0 1$ЍOX@$Ѝ@-@`Pp@00000J@ 0P100Q}@ Ѝ@- `P1 @00}1 ?-@T 0 Ѝ@ ЍDcG-p`ܐ3 PP 0 @P  PU03aP  0 `? ]?0 ,00 @P@cDc@-@Z@ ?@-@?@@L@-@P 40 @01 Dc031 0g@cgO-l2M 31 T2h0@1=0b?q1WPPӄaՇ0cU.  `P n  J bPR0?Sòʂ?1?1P1`11Q1儡Uk?ЍSP  6 2X  Y P(P1SQP`>008?U00002q EŠ0 3 1@cDcO-13A1LpFgPP\A넁`pU0^U \8 ԶQ020?SP !011QPk?QQ? ᶶ ?10 ЍO[ 00P 0SW ( R 尐uU 0P00 Ѝ@cDcs@-0Sa @1S@ @A1S1S Pk?P10``1SЍp0S  R R    gPQ @cp@-@T 0`QT@dPT\#>IPHPP[>UP@pT 0d3IPvtc@c1MR  !Ѝ/1MR  !Ѝ/G-pPt3a @P    T<@@c@-M@`Pp0P @# W#!!  0@@ @ 0  @C  0  @P@Ѝ@cO-%upWpMH@Pl3졓1 0 00S?=` = 210030 10 .11 R`` =%+ W- T^X 0\P0 03 9V Ѝ3 =0P g 9=  |@cB0Q`/wt@A-@PxM␀ Pp`x :dp` P=T HP  m,M=xЍdHP 0 mcA-P`h0hp@0 0"+ - 0(00  03 b3@cQ-//-//-/-/-/-/-/$0 0!0 00 /@cddd0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Q7@-P@ h<`0 R 0SP D00000S! 0"PT < Ѝ0c`scp@-XP`@ PD03 1pV T( P p#pc@cc0 100S/Icc@-@><09@v<c@-000S 0#  Ѝc@-@0S0 R!000000S 0s0000S0St 00ddVPX00SLb$A@t90 0 0 Ѝ`sccBB@(Hecpcxc7@-@P  ᮕh04t 0E00l00p0000 Ѝ02p@-@P, ڳ00 00 0X0$00(0tp@#2@-@ q@ W`@S7@-@`PKH0 0 00h1S\0\PZ_00 @00 0 $00@0 Ѝ0D"B B B Bp@-QAM0 0$0 0S$0 S*U;01S< `10X00a01;V  \0  V 8;!(0,0(0,庋 C   0R1!0CSQ B0 00 UP t.S1! B0C 0@;0  4yccx2Ecpc4 3`sccFe@8He( BW BA-P`P p吀H0L,A0 U P#H0LTp0    0S ;|03/0S:@`sccc@-<0DT 0 !0  !@cp@-00P@00/pc0@- ! 0 !A-p@d` PH0S C C0CS0#T P$ h0l0h0lAc`sc@-00@0c@-(0 @0 0Ѝp@-PHM` P@  (WP P`4:(  ( $   ]:HЍpc0@-A4MP000S :b0S)  BR/*  tŌ00 000X!h0l0h0l810000Ss0P=P4Ѝ0 Ro4Ѝ0@: ,aR !00 0 0 000p 0`P P0 N0 `10G0 0!#4#0 !Al 40//x00CSx08VЍT `[ _@cA-pP `P' 0   ( H @ /h8J.`0@@@%+3 1 03Ѝ<@2B@cA-PU@d0p00`h0/-/|@p@-@d0`P/-p@/p@-@Px0Sp8UpA-@P pPo/X0 @ 0P  /x0S/zp@0x`X03V00  ///@cA-R@P` |p?/h003/x/h 0 * !01 0 R) p (/X0$ @00C@0 R 00 X00X0V/ T/h00 l⠜A!#4#0!10  ;/p@-@`P @0 1p0@00F=00`'t` pA-A@ `p.@0Q0@4, /@c #U #V P 402 /,0P/0 0R03 0@2#/ptc`Hep@- @`]0PT 0T@)0,Z@P"UPP@ 00tUdUP ,Q<U0Z@*p U@k hHeA-P` p@0U @TP S. A-P0@(PP3paA.?.@01@0y.1S1S q.,.8,H1 Q  PP10SP@ch0 0///C-@LM@  \0 0`0 0PPP0 P:儛 PLЍ(`P ߏpp-` qp` 0".0 Luc.3@-T@ WhHe'3vBO-P 0pQS lQ`T#P20P < U r @ UP$ @0R @R0@ @H D ॥[    :@@000㓔$ `0T 0DC1 00"  ȹV00T`HehHep@-@P 0S YTP |Tp@P\TpPU @Tp PP  PTphHeA-P(-hAT h0pS ``-\0$ 20S$0 P-@AK-@A-Ppᘀ-ATA>-h0S ``,\ $00$0  tP$00$0$0S  -@@G-p㔀oATPP,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101,0S 0h0/ᐠ@O-M( 0$0 ^0P 0 (0S $0 Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` \SP 0S< SP3S 90?00P03 @#04/PP30C3000 Z S P P  ,1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>0!#4# 11 | p+h003/PPp@pP |+0 0P+X00X0+0 P+X0@0 X0Ry0X008 0@@0@@0@0$)f0 R 0R @T @k |+Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|+0@S+X0@0X0H7300+ pRW Y U0@,0@`S 0 0C 0000P(+X0@ b+P@0X06300x0S  U+P+ + PF+ 0\00`0; P~P|3Sp< 5310 0P3S7 H@Xp0s0( PӀ h0`0xP*00@017[@ +s@ 0S 03# @04/3pC(0PpA 8s@P @0!S3S XH^Pt@ #T@0p00h t0 p00*s耍0 ** @hTX0x# @00 00S R 8 *0SZ 8**k 0Q 00 0h0T83S *{X0 X "0X0@00C@0 *|00<* (0t*3*X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@0?*  )) 0S@ 8].* ,* 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 83* * 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| )000h0 0S 0040)h P 5/P40)U ) )6hHe@@c@-,0 00000 00Ѝ̠@p@-P@Tp`QP ~@G-`p3aMT)1 PUG)P B)@cp@-P@``9) 0@I @p@q)p@-@PP,) 09 0p@e)00/A-@P@pET|`)h0000h0Q)@@00/0S00  0S00o/p@-@PP(X0d`y)P+)jX00X0F!)p@)0 O@-@LӝzPP@@-@8X0 0dX0h${`03$!$eH@U lpP ptP l@@cxHe 0'|xHe 0)|xHeO-p`@嘰  HQ:/PDPWe \   0TP ?P Ѝ0S 40A3/0`@00@`XYeO-dMZ@$ ` +B0T L0P $0(`:T ᣢ`P8p$p* dЍ P&`P$0p$p 1 00,`V /ǁP 0Sy@!PPt!("PPn00i( 0;0!PP_P1 00 0000 0 _PPN`0$ 0C0:P0 1 T01 R L! ` !l  2/`PH0T S *P S:00S18 ,0 0Rn pP vptP qtX0Z `x\P PM`RPucxHeG-M@` 8pHYP+0 P@@0/S W-ЍS0 0 S?@# ,* b塲0 C /  C1$@ gN00<`00 当` NV@ k`F ဲ0W@C0`F`O-`4Md@q̔ 0L0 ?04NX) k՛4LP0 0/0 0,0p p00 000P ,0/pt0Q0*#P,00 0`PP,0L 0P0P000 PhP|P00(0L0 C5<0X0pPtPlPxP$M >^PP X0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S p20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRm:D04Ѝ(PH! E'b$ @$ R!0 R $0_$0P(P`10`1Q\`X00X0 P\`X00X0X0 0dX0_$!$$ H P pP tP dwM<sM`0 0R0U0S \{ xHe*`B#Bc44XYexc00S/ P 3/DcA-P0 `p00l 0 0010 (@0MP Ѝ MP'0QP 0@00 0 0CS 0MP`V pZMPp MP'0QP 00@0G-PM" @@L a0 @@9 PxQ1 010;0 @00d!PpL(@T $`X-W0AU2@P 000` S'Ѝ 00S S S 100@0P0p 01@ 01p@ 00P!0 R cEcDcxHeTuc#B#BPuc1@ AC-@PM> (0S; $ X7 `V6 )g0Ԑp03/ @0^P00^P 00` 0 ᠈`P 003/Ѝ F Do0 +(0p`003/Dc#B@ycP/(0S/P/ R  00/G-Q @DK08( Q!P( U Lp PU PU ^Kp R(0 C @` jpP <PU *\K(0P(@S0`(`(@0S   0 cPucxucG-PQ pcK@(`T `(䀟VKK$t! 0S$@0S LPPtv$dKv"(@T 0Q S   0 U`@cPucc@A-@`PpU 0S A  0S S P@-@pbHPk]{_#hP lP 0@A-@`00Sʬf#Ѝ0 0 0cPPᨊ0 0,0pp00 00 0QP ,0/pt0Q0!*ᎊcEcO- `0  0卛 RRЯ  ׄ00 q$1|pqL0 48<0L0 1 111M#  I#RJp h#Jp <0<0>$,0SGF,p,[ppPpulP`0<1xp8pN4$#P P0$(, 0P0QV#T0T0(H(^v`0pQ h1d0l1=0c?0h0040083pp0 `0$40q40pW 4pe40q40q40!0R "40p #0, h001"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@e 1\D03/"(Js40004Z0c"@"1S' A"{II(0 T 5@ h"5`0`S "<Ѝ-E'40?40p=Wev $M"  S @wITI ~"BY Ds#@@#B.gB#Bw3ccc0O-,MpQ #0A`P#@t@T ,0〠X2 PH@PP T P` X !P P`@#0SK؈儏V 0U> :$@$ H@PB `0V): `V 00 ` H@P0 00# $ 00`00 @PQ  $I@0@,Ѝ 0S S+$0M@P X x$F$ `?PEccN3|0S/@-@h3/0|0h0O-a0#6040080>0#60D0>0#6000<00@00匋x80S /N)!0/1000L09L0]!5@ 0 0  0PpW(pWL0<L00P . .`1Sp pPe0  0  pW Ppq!0R  p :T0    [0 l 000[  [ 0H6p30pGo r$ =GqP U$j$0 1 p0Y0#03W0S$9!$L$%WpW /zz BzDy PDD0ĐN  Iv`1H!<1d1D1l0 $p $07/pP[T!@X0A  81((0<1,0@100D140 (HpPGn l0 0,03/l00S 3/l0 0$J(0Sp Zn Yk 00Lp @07/(0 03/3 0000 ( 0 0壃pP(01J 0 03/JG0ShEG X L#嬰^H<{ pP tP 0S  pW  00 0003/p0xxr8HdE1S r Wl0q 00S p0Sឳ$@F$0p  $@F0tp0P C 1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/@10S XF0S,FVX 0"#  "pM PGP0. pl 000p<(p(p ,p*L}0 0Z000C0hXfo0 "^(0S K>p<ЍRXYec@ccxHe#B*`Bc0@-_MP P@P0 _ߍ0@-(000000 0ЍN3@- $0000000ЍN3O-dlQAQ0 P0x!SI0P 0GP HE0SB __0]‱1E  P  R 0^ P [ 0OrP `< 0 2 P D@ccc,@P/L0S/C-`1,p0P@Rr `0S /)P@ Z0S l0 S 0`0 Ѝp`(0 Z0SM U 0000P0 ? R002   00`00/(000(00 0W PX (ᥩ0 P>X (X0Ph >m10S'`10$0P X`;@p@-Pa|@T 0Sp 0oP T F P06P0 0S P0 P08P0^A0C0 D l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/FeH-wA0`SM P0P:P00Sړ00P0*  I!P|0l 0\000Z 00C0  0 w\s0 1111_I0Z00S H81S 뒏`Cly6$円0$04G1僟` 180S 3/>SmT0  o7r1[0 00[ 0 [ 010S2 [ ` 0`Z0|`` 0M 0S  LHD ,8 `0 000 0 V &[  .(ǹZ*5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x l忓%0@ ( H R( S0,02 P   , @0`080i(0< 0 D0(00H0L0(0 =}s1S '  01501 0Z0C000000Bl lV n 0 AZ4($z9wF1 P 0PL 0S 0S5p@ 5 =5Vl0Q Q*00pWN `* x0S d`JFe#Bccȍe@c$Bc#Bp@-a@PP0  !\ !O-M00S`؀  X 80S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y 0&P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0 RP  !P  00C0X 0000PB ,0Z R R%@   B X /  5@00PPUPP0,0 ,0p0bZ0S000lP030dP0:0 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< 5 =5`V2`H0S& x 0Б%0@ @ H R@ S0D02 P   D X0`0P0zT(0 0\0(000`0(J {ʂ|p(;(X;((X;0S X (ۥX (0ե0020Z00S   00C0p0St t ' `p%D% a P-4,_<(a>b`P DQ :6 :@W%; B/o"S R0 400P%`0 _0Z 0RP B+ 40 0? Nc@cc@cFec0@-q@M QaT0P0` ,0 TP X LЍ00@-P0dM 0 0@S0 0S0 Q  @?o 2Q0S X @dЍ00@-@0P SMS0R  0 0 0000?o2Q0S  @?o2Q0S @?o2Q0S @Sߍ0p@-5lP@0U5Pp@0`P * Pzx5<50 Spp@@-X0C50S[0  SJI 00S @Q@cXYeO-`$10|0L048<0L0 !80 !!L0?! 0  > >;0 0? r001P zDP  ㅻD+ <0<0, ᷁,0S(:0[00,00[` P055 l`0<10x080B4lP P0$(, 0P0ᙀT0T0(c< ( .hx4[$ =0c?0h00400h0 0`00,00?j 40!! 140S  3/.10 0S [0[00[0x0*Sp p0t (0x@tH05AAQ  RB0BS  R ly505`0@1d0Sd d0h 0d@h03 R @0@Y 1\D03/2022! Z! ! ! ! !20C22S WWd20S ,PP1211S  T0  p(Jg?4pP04B 0 0Z 0000 l0S `0l 0005AAQ  RB0BS  R }5A0AS l0k Gq@  @ d$.90pZ0W0S5D0DSXTFl0 GcEcucxIe$Bv3B<$BC$B.gB#BFe̐3cc@ccXYe@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC+ 1彸@f@00@00 030 !!0400000, !  ![<<P 0 JU@0"g|<PDx<P3S @cJdddd@-@0M 00000 p0PP `pP00P0D00S 0 022201ЍL$Bؚ3T$B@vcA-`|p0PS dP @P U ]< p0S0@U@` <ucН3p@-P`@0`S LT ><PUTpp@<0 3/ucН3@-(< 0%<Iep@-PP@  <0S   " Upp@j< 0uc@-0@0S R 2/uc 0vc@-(@ P0S   uc$0 0S/ R0/0uc 0_vccc zvc 0OvcIeIe jIevc 0>Ie vcIep@-X@P0`S @A8;@Tp@ ;03/@ucН3Ie 0vc_@-0@T0 3/@ucA-Pp `` @P  p `=n00 (R $@ @0@0?ucn$Bvc R 0$0 ] ucPA-@`.PP0q$0 PU(0 S 0 ;0 3/PS 0X .0 3/00P(0U(0SApucD@$B$BͺAp@-`Pķ@  ` m000p@-@P|@㦷0S   垷G-P`X 0003 0@T@T. 0pSW00  y@pW @ 7/0SpW  W @ @@@cA-Pp`G@ ``p0S0@@PA-P`@pv0S 0S   %A00 00S<0 3R W pW@cp@-@PJ@Tp@- 7@0Ie$BO-`0Sp,M@PTX0dP ` x/o 00 00P0" 00  `00 @00 @>`P d,Ѝ[  徶$ \0 $$0wZ`p?p = U 0S $ 0 0P 212 2<22@022 02S Y 00(wc@yc@-|0C0P $l!Q`2  P1S  < ,&$1@c$B%BIeIe4%B0@-@D00810S ЍIeIep@-40CP0[;P0UKp@cp@-@00SP00#;#P0Tpp@K@c-0 0/@cA%B$0$$1!S1z?0T@ci%Bc 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd00S/A-@`uăPqqPX`00S 8P P BP4 0,,( $ le@cc%B\@%BrBFfAL"B0 0 0/cIeO-`Q,MxC1'xS 01O000,ЍO| 㤁0H0SP 1O ap10ll0@^ c0S x 0H0SP 1O apQ,ЍO0S3 ? 0@0P+0 0$0000000S0 0  b @ Q |0 @Yd$1!S1Tz?0mPhRJ@cccFeEcDc 3Ie%BcG-霐P`VU`P@@ t@0!0C8R#8 @< A@02S Q B!0@cc0@o/c 0P/,մ@c0@- 0D0R@00,$00ĴP t @cC-p0MP0 0`` @V0 P 00 000 0@W?o2P0S  R ЍDc@-@08M@@00 00@ 00@@0@8*%*0|0 0000,00 (00!P0 0H0$@ @000'> @00~[8Ѝ@c3 3%BcDch3%B@-p p@p@0@@SC 1X01r@ Hr@@<< 80W@@c@vcwccl4%Bwc%B(wc@ycA- 0b@SPpb}b0@X4100S S[0 !!04L0H0@000, !  !@cddd@-@Q't T 0310,0|P0#P[ЍxT 00SP 00S t T0 #!R `0S@cc@-P 00Sp@-P@aPpTUp7@-P@U}00 Ѝ07@-P@K}00 Ѝ0@ 7@-@00PNP 000U  Ѝ000/0@-P0M0@000TЍ00 0 @P 0 P QPp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@P?0S P00 0000@-2 @0 0R  R@\ 0CS00S$@o0 C 5m@p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3S|@5@cp@-PP@W t PpP0 l t BR 8P08P0P0 P8P0MPu@p@-@`Q- P08P0Z0S P0S 0 000C0.p@ O41041/41!0CS41/)p@-@Qp@p@-01Q@101`41Sp1 PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT&@ a0`` 0c81S-8A[Z. tPh`0 !0L @0;/2 00  00q`P RsЍo*8APU 0R_ `0SNPXϱPܡ  2/0@ ! * 0 0q`P <X㵱  2/ `0*k`P * 0*7sXឱ 0000@ :0<`00S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* *N'@c#Dc#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S 5Ct20z0u1 00$nV;0 0 `!`0  0 0 0 004 00 0(00{/1S ! !! 1 00C000C00100C0P { G P g P90S v9Z0S YP ծ00$P 㢰``^W,0  Ѝ?F@yc@cccO-PM`pDT 3RU 埼@s,0 \ *00 0 0P 0IP s #@T  ᠰ5/ⲄL h Q4p 3 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S L0P0<P0ɳuKn nZ20H0S@1 1O]X@00#]0 @p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S ?P ֭00LP 00S # | x p@0@@SC 1\0100 1<0SЍ3/@yccl4%B%B@ c@cc A-0p3a 8Q@T0S 00(p b081 0*pXV@@cDc03hl2/@c^@-@1 0S@A-Q 2@s| 0  BR 00 1@0S 3/Gڲ|lm^ 5P0PSX P0   1hS!!1 ! H  P01 P  !<4 @P0#ῴu0$ 0P+00C00S  Z ^W\0  JX(1S,1S |`V J8[a=@cc%B%BG-@QdqLP00`P  衔 帺'P03P07 F7S  <P > l 00C0  0 JJ $  0 000P00P0Ѝ O-pA000,P0   P  x W& PP_ 01^0USS [G  `W P (1 S0(100C00,1)|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010s $ Q 0P 0R 峿`P ` ```A- Pp`3@2::P@1@!<`J\PP   0@D@P0Q @@{p@-@PPp@U``FUPP@p .  B PR / t0Q   0RL     / Q xcIep@-P00@Tp0 P @xcp@- P0Sp8 P`@;0 QV 2 Pp!!0p@-P@&@0$P0 pIe@-@000 P @@IeC-MP00`0p0 0` @奕0 P 00 000 0@P?o2P0S R0 Ѝ7@-D 0NP0PP0@EU Ѝ05|&B0/Ie-@-,00  ЍЍ/&BAO-P`С,M @TpPP VPp P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #b0S 0 PP 0x P N0 000!R00! 0V0C0@xc.&BIe&Bg&BO-0@!T0TX q'P `1 !R  !t1 `V`囻 ` 10 VP `P `V@&0Q@D0 hP `Y0 `  S      Xp@ӫ Ѝ`0   0P (( `Vꀡ@xcIe@&B7@-P p 0$@P X Ѝ0Q000 $!@ 'B'BC'B'B-@-<00S 0,0 ЍЍ/c'BAG-`2Q " @PpX  p$0S00SpQp @W 003/pP  X 03/p80S 8T$0S Q0 0C0!R 00! 0S% P $`X!P  Y0000000@0@@000000!00C0'B'B'B(B)(BD(BIep(Bxc(BA-0a0Qn,q@T z$ μ@\$0S- 0* }<0P000@03/ P R00S % 80S (0, 0 bW"P<000@ 0"  xcIe3eIeEcc(B(B0 /$/@-@RP` Ѝp@L갷0 0 00 0UP Ѝp@-Q`M P0 ( 000C@P @P ЍXp PU@ 0  ő@P0P S  !  00C0xcIeO-DMB,0RS20,0 m002"@000S200 " xxtBT:0(00p<`@PH"0  < 0A ,0p,`$  < Q<0 SX ' 0 01< 0A 0,p(`$ Q0 01 0< 0A,p(`$ P|1 0< 0AP,p(`$  PD1 000<< 0A 0,p(`$  @P0  00A00,p(`00$0 0< @P9X@s0000DЍ ^P 0 l@nIe(BIeBDcIeIeAIe c)BL3B̄B3)BJec.B:)B|AgBxc(3L)B@)B@- @0 400`$0q P Ѝ̣@U)B3@_)B@-߸$0 0S@   0xc@o/@-P`q0 H 000@P@͸Ѝp@-@ᶸ000@¸@-@᮸00C0@躸G-`PAqT:pW @P P  0 rPP  : 0S  oP.P0 cPh p0PP N 80p0@@@̄BB@xc)Bf)B)B)B0   <Ie@-$@ 0$00o @?IeEcO-M00`00W0p4p Q @p8 00(0 0a00(P$@ @D@0젟,00 0a00(P$@ @ @P0@/0,00 0a00(P$@ @ @P`@00,0`0 0X00a00(P$@ @ @P @8Ѝ{c$4&3BKehC4v3B53B>4;3B000/p@-00CSP0@@$P,SU ʘTpp@(Ęc A-0 0 2#PU 0`S@T Al3pd0S R@D($ 0R @TA㕘Dccȍe@-M`pɴ@P00Fb 0 0  00@00T0S@1 0 0S д@Ѝ˴ 0S 1S Dc@-@P0`0b 0 0  0 0 @00T0S@ 0S@Ѝp1S1S Dcp@-P`w  0 0@0T 0R0S 0S @P4Pp@QZ 0ScDc"DBD 0  !"P/ R0S//DcQp@-@ @PX0Td0P1@0P !0@@T@[pcp@-P(@p`Lpcp@-`Pa\ T `@00  RAP @p.pcDc `0S  0  /Dc 0 Kep@-@Td0QDSh h h0d 010Sp@p@ȍecA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0j  BR bO-SP ` (-`)pm"0 0*@T 0 SV`0S Q0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#fboYQVT T R S+@0`00@p@S V `0P @$00@01 00001U[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@x @V (yW tcDcȍe@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0cp@-L0@3P1S P0 00SڡR000pp@cp@-P0PSA,00S aaPp4p@r@c}cG-0PPpa|@P @T P03P0ATAU YL0<L0oWFTGA@c 0 偳Ke0媳Ke0@彳Kes@-xR    @ ⌧8≧ | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/   0 R0d1`0S00#0H1``0S/00 /0 Uh/6& *P 1:Jh@ 0|i0`0/0? ?,0l`00000Bt0*|`R4  s Ѝp@Y@yc.gB#B@vcKeycDccc{c@|cEcEcDc}cLep>Oe0@ Ke@-H0 V0@Z077pp@Ke 0 @Ke0 @)Kes@-@P`V ` V ` V 00 P0SЍpBp@-P- R@ *B B0 0CS0 B " pՠ`ҠVΠ@ϠTp\02S SMp8000CPp谢@@ycEcp@-L0@P P` Pp@#* p@0v 03/@"pcO-TM@  0b ^000P  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Pt 0 B@P ?0 QF R  QR03@0B  x00 0O0$@ 0;00 Y@ T VJ8@y 0P5  x@P DATy @y54ЍuV@y 0X01  0@P0X@0 Z 010@P0Z@W5hV P% P[00 @@00P@ VJ0700Z0 CSRL0 k@꒟ @bT@ ]0J0 H@P Z$0,0 00/0@0 f00 0p`K@c4C-M p#@P0S !PU  A` 0 q@P`P ᒏЍ@@-@Ḝ0 000 0@0boЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍO50S0000(00S40RU YU  U00=04 9P 41L0:`@t40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S T0 00080@ 0P  @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S H 40SW; 0000  cW000  9 c bW& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@bH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/Nh8<1W<1@1@1D1D10Q/Q[8 RRv1 1vW  11222/W22!2? !. (2W(2,2,20/*80 DB0Z 01$ 8-[ 0S%PS 10 Rx ?RQ 徙X帙彙帙,㇍ ᄍ2`P00 70  70 70 70  70$ $70( (70, ,700 0704 4708 870d d70l l70p p70x x70| |70 70 70 |70 w70 q70 l70A/Af70B/Ba70C/C\70.W70E/@R7@0F/F10K70G/GF70.A70/;72@0@ 0 Dp370/70 00C0$0 0$0(0 0C(0,0 0,0 0S @T00 Y00S $0 C00,0Y * !=@,00 U=0ᑌ ᎌ1 LЍ R@cc@c1`00/1`<10/1<10/p@-@Q100pcp@-PP`@V11 HP@ 10$00@pcp@-PL`@V11 /P@ 100@pc@-@Mp@-P@EDp@-@=@-@:p@-P@21p@-@*p@-@`PQ PpR0p@ipp@-@Q0` `00p R0Q`R /O-MPp8C`u@w5xGuYw ޗPWx   ΗP @ ʗP  0 {P  Ѝ᱗P  ᪗P  ᦗP᝗P    ᖗP   ᒗP቗PᄗP u {P w~N{N널Ini|N yNrx qw j ZPzO-MpP`8壙w@u6vHwZu DPXvl   4P @ 0P  0 ڙP  ЍP  P   PP    P   PPP Tw v u  ӖP@- 0  Ѝ"0@-00  Ѝ@-0t`q᫖@uᨖPᣖ$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`q႖@uPz$0P 000 Ѝ71M000/s@-@`ᶘ00 0Pᔖ@PЍp@ዘЍp@-@PT@#a8f1  r JЍpc0A-a(M 000` 0P@P p0 L@P ?T@(Ѝ91P0 ` $0R  bP 0p0z/`00 0 00>UcE3B(0310S/00S/㩷@cJd@-d03" " R @" B"2S &@T*P @cp@-P@Tp 㗉000000@p@-\03Q0S m@T 00@ |Tp@cG-@`T; T[ T[VY h1*ERU:0CVQ ]p81`3  1 0S`} P U* W0@ 7@03A }s @T@0U00CS  @00J @@@c|cA-@ `u60 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `PG60 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#:@P 0 |0| 0 00 60 P#3S<0 R00Q J@c(YecFecӤAle\e0@-M 0000 0@R0P     P ЍBA-@ `$P B  p{PxUV#3lPkU V VX031S ( ,02 0P03#7P @cA-q`pQ TdPP<@ ovB Pc@-QM`@&P0T  R 0@ 00 0@`іPP P P  pW pWP Ѝ3MO-QM@p帰Q @PH0P @@0P 0噖@P:00CS@5 aL0` 000 0Mp0 00P 00 0 0 p*0@?o2P0S` 00 0h@P  P0R00P0 Ѝ@O-QM⨠崀:p0PS5` =@P0 @@0 0:@P⒟ Ѝ 0` o0"00  P 0 0 _*?oZ20S@ @@O- DM 0!. Ppa B, 0  0p ,`(P$  2.0 000@!. 0 .  4p,`(P$ @L.+0$ /!04.  ,.00 0 4p,`(P . 0!- 0   4p0@,`(P$  - 0!- 0 4  8p0@,`(P$  H - 0!L L= 840 0- 0ʟ!:4 0`)@\0PU L0S T1P1T@PccA-pQ@<0S S2 SPT PUN , @d`aV@=T P8 `PU@ @HT`dPTߎ`0PU L0Sӎ0P@ @`'TP!@@`cc@-` V@Q,  /k  Ѝp@-@P 80< 00 #3  0 0 0 004 00  23 48<0@S- N/LHL 0 P030 0 0S 0 @0 D R0 0``#`0  00000 0 Ѝp@O-`ᑿ4B  0  /0Yep@-$0@S,$0 P R$  Upt`0@o>0~0@0C0000   0 S p@vcEcC-@`Pᰐ1qS21 0! 28. h R R R ' 뻍X0@00P0#*1S0Ap@0 0@00002S000000SP ЍCeC000@K4BJd@-@0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@G` T`W p W 3U  GP 0SJd|c@cp@-@P- p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0*Bp@-TPC%0C0\0(@T@ 0S 0ABڌXp@c@-W 0!0@@C@c0  /o4B0/000S/@- 0 00} Ѝlef/Bb|cУ@00/00//O-H`Q@S 0p0202  *[0WF3" B"2S1 ЍO_p `00S; ; 0  [ ;0 40;V 00S 0 Ѝ@c@G-P@0 pspF EY UP;`P WVV `XE 0G><E0 XE0 @cQA-Ppp `D0@c`  TE@@cA-PE`@ @V`Z;pX# w@a;0 "S kV@0 A;M;p@-P @H0c   T0S@Ep0 S p@cP/0S#/P/ 00@o/@cP/P/ /p@-@P;{@0000p]Ӆp@-@P,{@P 0000p]Ӆm@-@5E mP0E@G{/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ ^@PR  03/@0 @\/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` c0 P 00 000 0P?o2P0SP00S 0 0044 03/P  0<0I!@P<0W0 00PSPDT`@ЍaPp@@|cS? 0 0CS#0T P@G ! 0 S 0 0000@S P@@ @@ꈤ@O-Z0M0C/1@S F(P3 <00Jp"@03 qp[`) `P hP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  70P pQ   BV *V /`P [3  @P gP> 0@< B "Vx1Sp` 0R] 0p!x!ZR|||!xKtZ0SP RU R>0|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R /1P0jWꐤ@ccG-P葐lp@U" PP1@T' L0S` ZR`y 0  ``PX P@T P @TUЍ`0SL``M 0  ``PX Z0S 0CSPxd@ccp@-xM@?x ` PCH0U0000`0 0(0$(P lP, 000RP0 gHxЍp@-P0@1P00Z00l 0000l@ _A-p`@T$ L0SP0S @\0SP`PU , UVA1PcccG-1`pAZ0S'P\W :P0SP0SP=0S|PP0S G&0 QU 1@ccc0@-|M@t PG00Pn |Ѝ07@-PRQ0@2  0$100\ P P P $G Ѝ0@A-P`p@TW [0  d@p@-xM@`Pt ?G0 0 0`xЍp01 10/O-`P1Mpp0ALP0  @(>yS654c@㇒) l 0R[0"? R (`pap0` 1R:[ PX 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOWYP k` 0 0  2ЍOЍc7BO-p1|MSA僿P0  hXN TH%@4|ЍO R (alSFDt [F0! Rp 40堀尐1!` p$Z0  fWl$`0ST]P 1`@T 0c/ 4/|Ѝ噃@cc 7Bp@-@HP`50S 8p@5@!p@}cO-p`PA죟$MZ0S P R }U 0 cSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000kPPνP04P0޽ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` Y !!  Rv UX [  l Q W   0 0?P}=pPPP p402S SU 000 000 000 000S0X 18E HQL!`0S7ڜ01 [ Q - lP) %0 ?PP01 P03Prp c@A-`@Q` 4R{pD2! !! ! ! !! !0 0F"0Q!V31 $0110102Aꐤ@p@-@P0` $w` Jp@ &37B,7B@-APP0  P08P0iw  !p' :P0|`V0S 0 00݂ 00C0᲼VP08P0a7P00;/000X kD0XHqL1' 䀟P&  03/`00S P |z?V` 0 t`&VP02P0P0 :P0`|`$J7BT7B@cP}c@֥@C-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  D` RLX1嬁p0P  1 ` X 0 8/Y0 gP  0 Lw |Ѝ@cp@-@ 314020SS \宇Sp@z<@P`Pp 03/p@@c^7Bcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@p@c0A-PpZ0P01P0?`0Sl 00C0|@Tt 0SP0 ၻ RB AV  : ` p000G-`1SxMpA 1 0t C001Wpp00 0 0$00(00,0@ 0C0( S :P0  Uˆ0 R (! xЍ%@ S\`40` 㠐p0`1RW P 1 `@T 0c/ 4/Y@cw7BA-Pp@ `0`V S R @0OXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/@cdddA-D`DpP@O0S -00U@`00cDYe00/p@-0@00S00P00R -  P 0Q 0 p@$&b 0 }&0C0d0_3P 20 0`p@ꌦ@p@-P@*U Op@-TC\  P 0 P  &p}`@&3@cp@-@P R` Q00l=#0`PP0 ù p@P0=P0/G-1́`S0Sp YP@I DP@@D P @P0Y0>00@P 4M RPP \) D0a0CQ R P R0@pD@P MP  MP 0 MpPt$4MP/MPL0y0 cRY0 0PÑL뉙! &ခ"** 00LPL6#::00A8BXB2AA-QMP@`0pDQP 0 wPPҁ J?P@ K?W ŁÁЍQPPLPLPLPLp |奁WLPLT嚁 >tLPzL$厁AK8Ba8Bg8BӤAXB2AW8BA@-03@M` TV 0   n30S& PP B0 rs #8QPP  r=0"0 !& 0! "x @PP&LPCXZLP>HULP9<2$b0`L@L7:!#:  : 000@0QJR1LDKP+LP &LP?a/p-Ѝy>P@% KP>  LP9 6XPP5 pX|0 pz`n yiV!PPT>TU K Q`PNKPKP04 40 0000=Fe8c`Ye@cb8Bu8BXB2AHc8BAAzd@|8BO-M@0 S800880S PP8 830:QP>@xKPP l8dOP0ST \@80 0 0S ~?CSw=KP30w000000000T00 `) FT +K?KP PKP|KKP 0la-d+`)8Y0P00S K 88=MQڷ0 0R`A*S 00B80 (0PP0 08(0PP (,00JP/ 0#tZ J\L8`P'Z %0 +$6 006 #:: 00 40 `!#` 1$0$0[JPJPV8NPG   008`P h# `5 %00[7H D8P9 NP4% jJ@PaoJ孂`JPJP JP|?a☂4PC`D R  NP hPH8NPQP(8vNP 8J0P D RB3[ <P8_NPD0S -h 83 2$p30S ЍPUFT6 J aOPP/IbPdR* JP%JP I 0 0s0cR0S  !) I 106 #:: 0000PII 6#::0K 00nPP' # I@PZIIPIP |IP81l?aӁ1P 1 uNP`0 h~@1PUs0P0000f0!0 $U_ 8:0&6``0 81000 0~8PP8 j~g~00Pc`YeHcX}cvkA@c8B! a v```P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,pYߍР010804 P00F0p<0,cP`B?P H1R0!sR ~ |pPP1 00 400 80@8@lpP` `84p40SR40 8✦$@TR4`SVp` `0Y8 @T20@P @+PD0S1S X@T01X0| O=p@Pt  }@X@070l@ .,00 0@0QP P0S p0 0R  O 0$0S !0(0, 0P$0 , ,$0 ! E@$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@ovP 0p 0 Ѝ@-@  00Ѝʚ;@-@  00Ѝ@B@-@TpM00PP` 0V P0SyЍ؁c@-@  00Ѝʚ;@-@  00Ѝ@B@-0a @ & 01 0Q1*S10Q0 0olll`P0 @$00R000R 0P0*03/03/@FX Ѝ@2SD  0 0(;lEc0=B(>B[e؁c[eFeP>Bc0@-0Q@C[eA-PЭ1@ RR $0$ "?o2W0S A$@$ 0S p倀0x`000 0D\堭@THڭT 80800"#e[e؁c[ecMbcEc>B0M0000Ѝ/؁cM-p0Mw 0 ""$ O!$" (@,$[`3# 0SP@S  }"! ,   ` \@  Ⅽ R   4 0 !j0Ѝ[e Kd[eʚ;>B1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P0!0 0 0P0 R00p؁cO-@Pp`.0$(0,0 0#   \$0 z$ $@ \ 3 Q\ P0 00"0(00(,4S0$P \ P \ P 0  L P0@ rPpQ0 j؁cdʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P0S a$000S4/p@[e؁c[ep@- xͫp0p@Q0}/’\ \#3$0-P6 8@#4j03/p@0/[eEcMb[e@B؁c>B0S0/0C-DM@`p(00<  0 80a0,$@ @@ @PmP00H0000'>a0,($@ @ @<08 ZDЍ>BD5?BC-Mp 0@P`` 堐7t0 00  00P 0 0;?oY20S 0S0ńЍ者c80< 0S 800< /ap@-@B@0`0@0a,PU 80< 0 r`p@*aP`@-@PP@N@-P@`0S 44q4a 0S@0 Y( 0R0000 :`0 "c+{` 0SƂ 00"#! "#1`P&3 $103$!30 3/ͪ0 00000@000@ccMbdEc@-h ?B0p@-`Q@P0 30`, fup30` p@fF}AB0H-@`,M0噪P0S? T$PU? ,YO80< 0 80< Ū bP@ `H p@R D1 pP000 1D H.pdW  b !0  t,_@0I_p00 0P00000p`pw?x70S2 0R 0(0 0 ,P0$  R 0(00$P 0[m?P`S| Q 0   Pq`?7d4?B  e 3P Ѝ0@-R@P$M 1` lbT U  P  @04 S#*/00$Ѝ0?B@B@-0 ЍA-@QP  !0!`Ap0 R pW=) -` p`+UP0 S00 10\00 1 p 00 00\ @@S0P S0."? A(Je[e@BZ{c /[e?B0p@-0M 00000` 0P?W@PP  w0P@0S!Q Q  }@0ЍppC-P `0EQ@P XP\ ` q HUp0Sp0 0@S((0,0,0p0 pV5[e\e0`0X00CS/@-@8X0S000S(0S, , " d@-@X00CS@G0@-@00S &R, l00& 00@G[eA-X0@0CS8NPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0dʚ;ɚ;6ep@-P0S H LA  R5k9 SEUt $\RnE#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A: Pܦ@@-0 ЍЍ A-1`P F?o2!R0S0!RX00CS 0S 0SxxS 0mHHL@LpH@L@PPp^P@HL@P0ɚ;6eO-4MX0p @?o2!R0S P4Ѝ`ePePP`ATPW 8H0L 0P0S# X 0BQ%SR  HeP H0 L0 H0P L RP 0 H0LP  p ;S f HeP H0 L0S H0P L BRP T0SH0LP0P0S0 $0P0Pɚ;6eʚ;p@-@HM` P P1U(P0 0UPU (HЍpA-p`?o @2!R@@TPP!P v@-@ M P  ЍA-1@p0Do!S``V@P1S0 S 00Q)p@-` MP@0S PP  0!  Ѝp +!!04 ?A3c00?A3c0/Mb0@-@Q$M  z P C$Ѝ0Q/ЍO-MP`dPdP@p0 0PW 01S 100[%T {C@W :pU0 @ U 0  0t pxP 4|0匐P@@Ϡ0H0L0P #0 RQ @ U U% p <T# HVdP H L d0H PL QP H LPvC6eܦ@ɚ;C-P`U@p,M0S U yP ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@Ecp@-@`P[0SpG-1C0(qN@@XP`X R00G聟 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80# pPR @> 4T`@ A@0@}0 @H0@|Ѝp舅c \eTDBԩ5@-d@0P }0P DD+L0P }0P   L@3 \e@_DBp@-P<0@Tp0 R3P @ꈅcA-Pp@P`  0RP `VX00PW@ G0S PP00舅c0@-M@PPP, *0QP`UP 0S   p00S  QR000 !R  R 0PЍ0舅c @-@x0P@up@-0QX0P@ @1Ppp@*(Pp@Tp舅cO-,MP`PC NpP> P 3Pf3 0@00尴00a00h0l0@P0<043\0 0PpST U0Wp00 01S PU 01S PuG@,ЍpW1 00S00C00 00H 2 0S 0R d8 2P!  G!00S  F0 Sp 0p%0%0 UC0PPC&P PE0S L 00"0CQ 0 ⮎\X A/p1@,E,0p P0@,@Azꈅc \e@-@<5P0 SP T0 0D X @T@D@@e \ecp@-40SX KP`0@400(0P `L  @L@p@GEB \ecp@-h0P0Sp@/`0@400(0` PT  @T@p@'c \ec@-@LP00CSP0 T X0,R( X0D0X0T =C@ \eP\ecp@-P`ƌ@Tp@pV0  4 R SD   03/d0 姌0@ \ep@-@$PHP(p@ꈅcp@-和`P@Tpˌy R0T0 L P 03/<0(J.0q \ecAEBA-0P0`SxpX@ 6/P0S 0S @T 0@\0` P0\ \ecG-?PAA堁@0S-yQ0SJ`XPUJV0Ta0XPHEL1@0 X   0S P HWT1TG  H? @0R :<RP!`%`56/@pW 6//0t"#0A6/Tp3/P0 3/P` R0\0  / \ecMb@FeEB!AAEBEc466jEBAA$0$$08S 0  Fe5(\e \ep@-@PH嵋T 0S 0AT 0 0 @p@Jd@-@L`0A-P`嗋啋U㰀q@͋ˋ0S 0@T 0 0d0S\0S #S`0S (尋0@l \e@Jd@cG-MP8 `p@PHDI 0S0 0,20SV 20SR GVQ5I0nJ014XXpPn100 00kB?0 03/HT\A4R+$P`KV<0I5dTЍI I JW 7/pP 0R  P0 4S 0S pEB \ecFBcFBP\eAEBЅch\eEB FBA- Mp` P @P 0 @@ ЍU H00S <00S CG5/01,I \ec@ A@-$M@P8 `pu0 $Ѝp@-PM ` @P 0S0 0{$0 03/8T00\0@ 半f}Ѝp \eP\eЅc L0/ \eG-@p7PPU`0S23`0p0?PP \eUL 0 0 4Y$(`P@RPЍb000H=0S0S<0K 0SH 3/PPD0e0<00<0x!L0.h(4P 0(0S 3/4Y.0S   IЉ0`08@ 00U0C0   S(0S%Z-P  GP  0R P 0S0 4S "+00 \e@c@JdP\eckA#FBp@-@Pp@A@-@P 7@-@/Ѝs@- P`@P 0 0@Ѝp@HRFB@-@P @-@9P@@-000~ Ѝ5@-000v Ѝ05@-000 Ѝ^=@-000 Ѝ^= 0Q/P /@-00 0SP Ѝ5@-00 0IP Ѝ05@-00 0[P Ѝ^=@-00 0QP Ѝ^=0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0ᛈ<0`0<00Sʸ0Sp@͈>>@-@v0P|0S@/|/A-`@vpȀ<0P 0S#Q003P0 000=00C0>ᕈ@cp@-@PN00CS00>p@胈//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS AD+0`S0Y030#@D 0Shl`zW /+ P0!!0A-P@l`hpT1S S@ R Tgh@l@KA+1GQ @p@-P @SP30P  $     PU $  U p@pWQ P  80R 0 Q xP 80R 0 @Jdcp@-P0 0S S, S@o@'ph@P`F`f`V80S@V@P``T` 0V80S@@Jdp@-P`@P P p@@-0@Sl00@p@-A_Pp00l` `P@p @DP(DPD]eqFB.1B&1B@-@=@}@-@0t,0@T   B B  @视@Jdcp@-M` P@P U 4 DEЍp R 0 R L0 QS8  )PPPP ꈅcFBp@-MP` P@ Ѝp U @P C-Mp `@T ЍTP8 h1 S(0Z?00Ѝ7B HB;HB B@-@%P {> H$t@D$OHB@-<0DT 0 !0  !@c0@- ! 0 !@-PDMp@`}+ 7Hd+0 000007 $P ,>7 0`DЍfHBp@-P`#0@`  +p5$5O- ` =0P|,00 00000P($@ @ @pQ0,0X0 0P0000P($@ @ @<Ѝ|HBBDJdh}B5HB5HB@-@ +@#A-@pP*D G0`S  0 Y0 z$P  0 J0 l$P = 0*ЍHBC-@_M`p`  xP R, 00 X01 0101HP0100X@,?_ߍDJdC-@`pM ` pP0 0 000000PP00.@ ЍDJd@- 0h ЍDJd@- 0 ] ЍDJd H0H0 0 0 0R  @ -@  R /@cJd 0!< 04 0 (   !/@cddd@-8@ 0~  !@JdJd-@- 00; ЍЍ/0]e/0]e03 /@cL03"248<00 /@-PX@c-000 0Jd 000/JdG-RB0S T n@0T =@00?Td"0P 101S@0T<@0 @0<* 2 @  P101 R@ @@00ST S@  R@   R S0S 0S,K:T 0S@0@0@0T @0 00000 0 0SЍ7< T 0S 0 S*<`P 0!<p6Z<@X q 0W``<V <HZ/ЍG <Jd@cHB݃BHBHBIBHBHB S$ @-0@(M0T (Ѝ@(l03100P (Ѝ@ء0 00!4 Ѝ0 0  (Ѝ/p>@c@yc S& @-0@(M0T (Ѝ@t03100P (Ѝ@â0  < 0 Ѝ  0}(Ѝ/p>@c@ycG-p@ࠟW `PU0``0C00S 0WP1R 0S0 P0pG0000C00 0C000 0  cp> 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q o 0R  ^P 0 @T   0S  R `F P0 Ѝ  p>@-P`pᦇ@P0  @ Ѝ@-P`pᓇ@P0 &@ ЍA-@`pz᳅PPd?z@Ѝyp@3z,1zT0 @c\ 굠\ ơG-`p0S0 0@P202Ĩ@P0 Sݨ@20C22S <1 0|@c/፨//ᥨ//M0P PЍ/  /M0PЍ/@- P P R:H0R 0R  0RЍTVRPA-` pP@Tl@lpT: X@0 8/P ЍPP `P꠆BB00/@- 0  00 Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-oP/P/@-oM0 Ѝ/   /@-PMp`0 _@PV 04/Ѝ@-0`S@ 0S0000000HPP000 @0100Ѝp1  0S !S_.B"B(BPP OPT10L1P) =3;0P? 6;0P0`V) 0P0 0P`V 0PG0S =P P  00@T mIBatadrbmngnts@-P @$Mp`-TU80pP@ 0$Ѝ WP0P@-`Pp$M@  p PAP $ЍPUP 10SS 00T00p@-(MP`@ ` Ѝ P(0 0CS"00 "` UV000! R 0 1   0RS "(Ѝprbmn@p@-(MP`@ @` ЍP 0R  "30%(Ѝprbmnp@-(MP`@ ` ЍP0 0CS00 "` UV00 (Ѝp1  0RS "rbmnħ@@-0 0 0  00 ЍdЍIB0@-@P$M 4 PhP$Ѝ0@-0@-@P$M  PRP$Ѝ00@-@P$M   PAP$Ѝ0@- Ѝatad0atad@- Ѝgnts0gnts0@-,M@P 40P 0PO@o,Ѝ0loob@-o@-@ P@Ѝ@-!o@-@ P@Ѝ@-0o7@-P @(PP@ Ѝ0p@-P M@`$`P o Ѝprbmn@-,MP`p @0p ЍPP@,ЍrbmnHHHTHqHHoHHA-`PpP P1 10RQ0P W4 @0 00RQ0@ GV ` 0  0 0  0!W\P0 00  0!V@\c`ccc8_e@- u@0z+8_eIBO-M @ 8PRP@P t`u0ZV 0S $4$0S?0 SJ1 @*Q P 000V 0S000S00 0R0SRV SR !R @uЍ# !RVO!RR 0 S  X 0S ,P  0 0R P 3 !2<0䲟 01S  0  a0S "2"0S 0 Sll81 @!RR 0 S  0S P ౟ 0R P 1 !h}1z<0刱 0Y@   010 0d 0!0 S @K P%  S! "+0 0P}  K㌰0 #P t00 P 0 0 0 0  @ꔏcc8_e\c@`cԧ@IBcc@@IBcp@-@Pt>p@t8_eqp/<0M 40000P0000Ѝ/\c`cqp/<0M 40000P0000Ѝ/cc@-T0@00@ 0   PЍ  Q \c`c@-T0@00@ 0   PЍ  Q ꔟcc@-@tT00Sڰ001S 000 \^  R @P@t@ 0DP8AT @-t8_e\c`ccccc@-@P@PsL0H0 0P@\@t 08_ecc@-@P@PsL0H0 0P@\@s 08_eccO-PP' `@ps0S000Z.  P% 0 R 0 B RPUlsPh00S\001S V  0@0Ds Ѝp8_ecc\c`cO-PP' `@pYs0S000Z. v P% 0 R 0 B RPUlusPh00S\001S V  0@0D_s Ѝp8_eccccp@-P@ Ts00S001S 00 0P\ 0S @P@l2sPp 0\ RP !R P< J4L @s8_ecccc\c`cp@-P@ Tr00S001S 00 0P\ 0S @P@lrPp 0\ RP !R P< J4L @r8_e\c`cccccqpO-MpЍ@A Dpq2(10T10 0 010`V` 2V @T% 4/ppU 0000T0 00PU QU $@P @00 0;/ 0pS @`c8_e\cA-pP`P ^ 0pA/A-pP`P p0A/@- x@P00$0 0000/cA-pP`fP p0A/A-pP`TP p0A/@-FP(@-@P(@-@:0P 0S @/A-aP+P a0A/p@-P@Pp 0Sp3/pp$Ppp@5qpO-MpЍ@A Dp~1(10T10 0 010`V` 1V 0@T% 4/ppU *0000T000PU QU 4@P @00 0;/00pS @c8_ecA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ oP@0/@-@e0P 0S @/p@-P`WP 0p@/pA-pP`HP p$0A/p@-P:0P p@(0/pA-aP-P a,0A/@- P8@-P8p@-P@Pp00Sp3/pp4Ppp@/ 0 6/O-@M(0嘱p#09ᡱ ⃡P@Dlqa` d"-`q0\!PT100 0@7/$08`jBIBIBJB JB$JBIBJB@-XP0Sp@-@`P hot o0|0x0X0 0\0`dPp`@-@f  >`A-@tP`poP@T @ U@ 5/@o@-@`C P 0 0fT @P@-@toh@o`Z```LG-<@Y800P$A`Ϡp ?X V: `V p0 W$PO-@8<M Q00Ѝp0(  R:8 R ( X`Ϡ !R F f5 $8 0  / 0?V;; 0 4; $U *PU0P  X$P f PV FP< Ơ8Y X` : 0X*0 600 ( 0$8 0p@-( \:P80S @<4;$< 80(0$00600<085/p@p0@-@MS 0 0C?o2P R R R4 R1 @Ѝ008@P|@P"080 S  `"008SeJB6JBA-hfMQ`P! Q4 Q, sv 3Qe B3Q ,7C0CQ 0Q @tpFn PUV` H`|nVV@ D@=fߍ00@ <# T2QQ1 f/ (R@E/w2QR 2Q 60Qr  fߍAlO1Qe  fߍAMQf/@ 0 S0;30?`aV! 0S 2     *! R R 0S fߍAYO# oP PO<?`P3a:@pVp 0 Wp0pGd @]d@edAd@edA|dhd ydA-0`S<$0@b /o bX c0?o 0c\0 P$0 ," S  R Q G$  !p  R ("(z R ("(r$ R 0r< R j@ f tV  `j1U `  = 8VA#JBJBJBJBJBJBJB\JBBKB0 60/80S/p@-(0@S ;;S0`s- P S  R8SᦿP peo(0aSR a#"P R 02UXᅿf/%p"2P 0R*pWEVs@-P p5 `@PA@6 #:@$:@ P  |y*xG I!@P TL034k0 ,}(#ЍpXB@ KB@ 'KB0p@-M0@P0( `"Pi0P X <2 CP*P0 Ѝp00 0 !Pzd@hd A-0(M pP0`!@P. 0 !@P&`'d0' pp)q ap ?(@0T p6(! * *a (Ѝzd@hd CKBAp0S/@-l0@ 0P 0 [P0p0Ѝ踴@@-`DM@PP `& l0 00S p0StP p0pS0l0@0 0p0,pP$00004`P0tpt0TDЍ00@-01;0P-@0  PPR 0S#@ ` p V000P0 0@Gߍ@ 5, ,@-- Q`@p   B BJdJdG-0M 000'0㬠0@0 pP P@. 0` 0 000 0 PP`<?o2P0S@@@D H@P P@ 娝@ЍA-PSP& 0`埝0P-P 0@@Bᒝ @V@P 0S P3:p8PP PJdJdA-P Ğ@\ʀ`0p!`d`0`p`p`p(!Q@00 Q@00@00!Ď 0   !@cddd7@-P@P U@0 Ѝ0L0T D00S.0 @_54@cJd4b6G-0M 0000㬠0@0 `P5P@4 0` 0 000 0 PPpg?o2P0S@@@/D s@PP@ P,ncE@c?ЍJdG-0M 0000㬠0@0 `PP@) 0` 0 000 0 PPp?o2P0S@@@D %@PvP @Ѝ@@c?PTcU-t`P@ pW@hc!FPP @ S@P@PWJd@-@p" ``P`= @` @`@PT=IDP MD /0@BG-M0S` QPPRp`100Ѝ  \姉U1#H1@ U00T0S `  H000P040h080p0<00@00D0#""$(, X\ 0$0 0 #%@D `d 80<0(00 , h00 l00p00 t00x00|000D`P0pJ00@l`ep`eHcO-@Pp$MC0`VP哉@$ЍZ0SWT@@`  <U   ⧺@ B R PP0p@I 0  0叺p`eHc 0SP// 0SP//G- 8M0@`p\,00 0000a0($@ @ @P堬0,00 0000a 0($@ @ @厬 0,0\0 0T0000a00($@ @ @Pz8Ѝp`etj6LBj6LBxg6LBp@-P<噈80@T$pP @p`eHcA-p`P4@XP aLH✲v0000 @  000l`eHcp@-`P0STB@Z,R8 040, 00C0奈p@l`eLBHcp`ep@-@P @ p@合p`eA-@(M`Ux0P |PU0p SZPU=p  0R0 00?Pp (+P 0DP0S 0P=9C =CP 0x@(Ѝ@BO-@,MpxP `|倠PY XZPU=  R 0B000?P 0 P0P0弰ZP=J JP弰xhPl0PYp``XZPU=i m 0R0 00?P `0 P0P`<0嬐`VP=iF mFP嬐`h@,Ѝ@BG-@(MpᲱXh0l `PPp0`VZPU=i m P0B000? `0 P0P`0嬠`VP=iF mFP嬠`hX Y? 8 < 0# 0$ 0 0$ (Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /@-@pT0T 0PS10`V q03/@T Ѝ@c`Lds@-`RP1`0@0}Ѝp@Ѝp@- <_,0 $$01000E Ѝt`e@Kdq6+ALBp@-@H`PS0S(0p @Jd`Ldp@-@PT`_L0!RQ41`_p@ T_@t`e@KdLBs@-d000S `@8P0d0?oT0cЍp!C13/@c@KdA-@`TPp WPhd圀PVpʀ 0! $ 0    ! 0!d!0    !@cddd 0 Jd0G-P0p@0儀`cP@  }P  Z0 0 0 ZUP㉘JG `Ld@Ldp@-`<0@BP@Up0p@/@cp@-P(0@00C0xUp0p@/Jds@-P@00k0S ЍpR`FVT@`0@-@PH0MD0@ @^40A Ѝ0@ _4t`e@Kdp@-@P@|0T00  0pdLd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd G-0 M P   @ p X@`lP X 0000 ЍG@1  @PdLdPcx`eA-X`PpW0S8 Aq P@$m@Pcx`eMBp@-@P0 p@dLdp@-@0PD@TpdLd@ap@-@PDePpUp@00@p00S:؄/dLd00S:/dLd00 R !QdLd0 dLd0 dLd0 CdLd"111/"111/ 211/ -L0!0\Q S0dLd,0 0R/Q0 /dLd@-0 RodLdD0 0R/- 0RdLd <0Q/1S co `/ dLd -@0^1 0 co ` dLd40@0\/- 0\ dLd40@0\/- 0\  dLd40@0\/- 0\ dLdA-@`P$0pW紶@PdLd 2 2A-P`@$p0SQ @dLdA-P`@$p0SQ @dLdA-P`@(p0SQ @dLdO-` Rp;:Pа$M0@T$Ѝ0S:?T@Q; P 0 ?0@4'V`1  L      T: 0I37c@-@0@T t0Ѝ@\P0 1 8*b0 uPЍNdLd =ep@-P@P  p-0t  B^\  ŠP0 !.0 . ㇰNdLd =e@-0+00Z,@  0*QLd@Nd/-@- p$P0 P?@~`0 P5 Ѝ@Ѝ/A-pP`:@j0P U @e0p@-@`PW@P  U00p@-@P@{PA /R/qN/@-gNBN/@-gNB@-gNB@-gNBN/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-`P@0 0/0 p@p@-@`z[PP 0 000 p@[0@-@0Es@-@0 PЀ `[0 <,i,K[0 000Ѝpt6bp@-@`Pc0S /[0 0S 00 a[p@B/T`eG-`MpP@ᰐJP!0 63 0000X0P3/H3 00P00 Ѝ`e@csNB{NB6ANBp@-T@dZ\00 P@ B?"@U$ [p 00C0/(0, `e@-@ Z0@ @@Z`ep@-T@`Z PUP 0 001`00 0RPPZp`ea0@-$0P 0 0e Ѝ`e@-@Z0X@Z`ep@-A@ <`PzZ0 0RW@Zp`ep@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PDZ0L$PBU 0P{ZPp p@ 0 p@|f~f`e`eA- pM`P$Z| 0R( p@T1 00S 0E0C@S@1T( T@# n00S0 Sph?Z ?@LYT W 01Z#@Ѝ@P &Z`eaep@-@T P,0,h0Y VWZpp@`e`eG-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ Y ` P@U`1YV @ᗢ0@0Ѝ 0`` 0  00  00P 0 0b@PEUP!U @ g0@S 0 ԒT0p`FP@`ea0XYeQ/p@-P0 @AlP Q PP _ @ 00H0p`ea0O-@p@-QU@`PpV 01p`U 1S 0 c>A-P0QppU@`P `U1S0 V c>G-pMS`f@Q03/ЍG@Q 00000 ` 0PЍ1 G@\ 1Q  013/ Pq181@c6-1R001@ 1S ; @ 1S/ 4@-(0@tQ 0 @@cc>1 2/ O-P@|80 S2Ԁ<0t`̠Wʀ ! , !8!< P Ѝ =eX0 0x =e00@-DM000,00(0L0 0D0@00P0<0A$ <0< DЍ0茦6OB@-\ l XX! S*l 48 DR  l  ЍD@OBOBOBO-BRMP `p R@T !S000[ Ѝ0ࠉZT0 0lT0⤬X0p 0"t  ! "@ #H #L $P $< %4 %8 & k& l' l' k( ( m) n)  Q[ !F P$0 000S 0 T0s R0 yRT00CST0[ @0S ( , İ İ ذ ܰ ܰ 䰝 䰍 $ 0 4 00 0 0jXc ae$aep@-@PTp0!5/@PB 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-P`p0t0@T @N@DT0V`00@ !T0Ѝ0@A-P0p01A`pQp 0 S 00000V 0 S 00000A|Sa40040Sa40040@c0@0@-0$M @ 00P0U: R 0U  000 0 0S 0S0 00 000  0 $Ѝ00 @ U 0!*  0 R 0 p@-0PS@ 00  0R :p 000 0 @p 0 000 p@-0SPp0@ P\ `R` 0 `7@-1PS0@ @0C0H00CH00S   t0@ 0D S 0 0l XX0S0P<00C<00000S000 Ѝ0V@?PB0S p@-E@ P0Rp/0-Q$M 00!  0S  0 R 0  0S   0 R 0 Q 0 00 000  0 $Ѝ O-M@P<0@U`8D0  Q0 Y$ $45%0SrP0 S 0 S:00 0  YP0 c0?o0c 00SPy V `@0p00800p pppp0CR0S   0S0P0P0Pꍩ@.QB@QB@@QBp@-P`@Tp0S   t0@&7@-@LT0S; R!0 0+R +LX mL\ `0RX `00`0\ X L_LX 00CS0X RLtxPLQL00QL|?L Ѝ0 & aeXc,aeG-@Q` 1 `Pp@ 0S 0>S@@T`臁 13/ pje ieG-p0 @0 0 P  (`,(0, 0/X(0, 0Q L000C00Ѝ 0$ 0 0$ P@  13/P oV 0 P0@p>A-@Px`K@pPEPE804P"8%< 40R:AKop@-@Px`KH0,PU< 40R*p@Kp@-@Px`K0Pp@KA-`@xPpyK? 00+0`@`PPPEP0pE8AK//\00S /@-X <!t  L  R0S Xc@-@K@{K aeO-PP@4MAl4ЍO/lR7 pR7 cR sR SR0 RS 0S# 0,0,pW4/X0Z0l $ $00 0000000L0 0H00<0 0 4/4Ѝ`0`t(L4/X @4/<080804 ,4/P0 0@$4/4/00-4/X 0S 4/ 0S 4/ 0S 4/w0SE4/V|4/W P` 0FNQ  0 `$0P ZP4/ 0@4/4/Y 4/QUz  4/`p0W:P4/ r 0l4/p`\4/ZQByQBQBQBQBQBRB;RBoRBRBRBRBRBSBA SBBSBfSBSBSBSBSBSBp@-P` 0@Tp @XcA-@xp`,JPU  PUPU  @PP 8P PQJP +PP@-M8PQP1 ! !1@11/ qQaH00yHpFoNPU Q 00Q 00=U 0VA aeXc0@ke@-@@kedh /hzE//A-Pp@`ᘀ010 R BT1P000 0 0 Ѝ P   0P P@cA-t0@@Pp X0 0 `ሀ010 \ *! Pp0 0 0 A~ \ 1:0 SP@cG-<1@PY`10S 00 1 8 000pW2 V`P 0V00  TPZ v T T00T00S Z oTrpW <003/YЍGkpЍcledmdc @-:G 0 lec00S/6Gꌈcle00S/mGꌈclep@-P<(G[@@ 1 @T Q1@ZGpc@-@P G@Qc@- 0@ leO-`0A?oR20LMS$00$00 00pP?o2 00 000%PPppP  0@p 9RFR< RE$0S0`803/LЍ0[00 V 0 V03S000  +p X6R @( g 00P 0 0p@l  BR  D B6R P0 GW p@ R b @ *Q  !0@ P K  0 B  0 @ Rz@@@ lR @   @LLP0000 p00@" 00PQ0-ppZ[S S G000 0h0SQ000HBN  P  P @AP@  00PZp0P P P0@ P5 0x0@0Zp0p RZ  KGG00CZ W0P|4XZE ᣳP @Zʟ p0 R0 00 40(00 0C W [V 0 V03Sp(0 S0 pC 0p0JZ0Z0 @ C Y[V 0 V03S@I@  00PpZ0G5P|P  00PP0@ "P P P0@  00  I P0I*0IWG 0 0!0h0L[ V V 3R  0CSi   ,09,0  3ig [Vc 0 V03S] 00  Q R`0`0FP 0   [ V 0 V03S000pGW> 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    +ꌈc@>@$@SBO@-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/`e-@-T031[  1 0S 00 00 ZЍЍ/@c-@-T031[  1 0S 00 00 @ЍЍ/@c-@-0 0001Ѝ Ѝ/s@-P@`0 `"Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@le@-@P`00 `TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <!1 @P >`Ѝ  00 U00S`C 0S. z,@T@p T @@⢔ 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 AcgfffSB@-< 0 0 0,0" }@ le>@ t@-@@-?@-@P0 @ @ @800S @ @!Ѝ0@ Ѝ/`e0Q   SBSB@-`@P 0 P000S   Ѝp`e-?@-@P@P 0  000Ѝ0@ Ѝ/ 0S LP P@@-0`Mp@  Pr0 Ѝ0-@-0 000 ЍЍ/-@-@Md0 4 0 000 [Ѝ@ Ѝ/A@-P`{10S A3S  lqPT #T212@00@00A0S<$10SA0 00S 0 0Q000 Z#p0 Pb 0 pp0 0S `0` 0Q010]P/0 `@vc@clelec`e`ea0-TBme AATB-@-`00/s@-@P`T 0 ,@J0 `Ѝp@FeA-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 `$00S Ѝ@ ЍFeAle-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`BT 0 ,@0 `kЍp@9FeA-@-  ЍЍ/-@-00K Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0  0SЍA)ЍFeleA5TB-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p$00S Ѝ@ ЍFeAle-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_@@@(p@01 010101/A-a(P!R Ap@1!#880Ro@$1 q0$12020fAk@@-`R( q@_c@T0  (0!R@D!!!R Ѝ@@A@@ gP C@~@ Ѝ0 00&hP '@Odp00S/@-`0`@0S@0D 0 @0D @@0D 0 @0D @J@leJdOd|0P-  !T LD.!      /@cdddl 0CS@-T0 !< 04 ,   !/@cOTBddd@-~P 0P@cp@-4 0P@4OoBPp@c$0 0!0 00 /@cddd@-<0DT 0 !0  !@c0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P` @6 C?Pp@-@7? _@00/A-@Pp` 300$0@p#0 <A@cA-P@`wp 0S00  0S00 "x0SAgA-@PpY` 00@000#0 A[@c0@-P@`xpM00Q ` 0 T9 0S0Ѝ> r?[Jd6?/0 0 1PS/ /@-e @>00@-TBG-@Rᜐ> PU``1S `VA PQ pq  70 P00>`6p@-@Pm>0S` p@>0U* `V 0a@-@@ J>p@-`PG>@Tp00D>`0S   0Sw>p@ s`p@-@`P&>@T 0S@A @[>pP/0S /O-p`P >0S R 1 ЍO;>9>=@X:2> 10@=@T R A>>  ЍO R !.  R   ==T  ЍTB@- M@  0 R0 00CS0 R=9 = 0 Ѝ@- M@ ͎0 0S 0  AQ0S00  00 Ѝʚ;@- M@ |0 0S 0  AQ0S00  00u Ѝʚ;p@-P@P@Zp@-PM@ R0 `\0` p^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00,ʚ;A-qP M3 B=T t13AT \6=@ ЍH@<000 z^#=!=0 000@0 0t@P! /00B! 0㨀!!3Ba<T ,P<p@]2TP Ѝ000 @ 00@- X( b0A*(P Ѝ䨈c@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@PL3 X0P4 R0 40 Q Ѝ0@a0U -,^ :!!<  12QX0 0(ꨈcX 0 p@-@P3`Qp@J31S.A-@pP`20 00@13ЍO-s,M@0`PVP`$ 0+t3B 2 2  2404#C8("<pXw/ 0C0CVp40 2p8<000Td0ai@PY `3h 2d0H0> T`X` 0t0J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,Q垪1011410Q&3*`5WpF&8!U. P0`Pd PR0 〪 0 PSD d0 $SP= F@,Ѝ`QH  B(`z`1QES 0 @APi h00<  W0O< @@ Q ? P q`F pఃd0 lL2( @,0,@SI$1((0(1E2ꨈcneueTB$7&7TBoeԈc@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 08$Ѝ ne%7#7TBlC1XB1TBcEcTB-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-hTB00@-M00|0|@| 0x00c00PP  TTQ] <崓80 0 Ѝ0@ṛ@neL7TBp@ UB,7Ec,,00 C#' ,00/JdEc00 Q0000$  B',#  /@cEcA-@PM` p10 0 0! 0?P W 0  \ \0P  PP 0Ѝ$ 0  0 P7B/7 Ap@-P@0 PP!1A-@P0t0 3R 0SP` pX!VU A1SL0@cG-0P3x0@ *0p `V 00 00`03/V00 0 0 @c@-@G@Q@cs@-0PQ0 7 0@S o00 `0ЂЄ 0S 0\0 @Ѝp@@c.7O-0Pp,0 `0@ `F`! P Lj(0P@0 0 PP PUP@Ec@cp@-P@0000PP|p@L0/A- 0P@0S 00 `=06// 0$ 0 0$  $0RPUr@Pd@cDPdHc@-L@L03/@/`0d 0 RS`0d D:@ 0@PdPdA-`pP/@"^\Up `0 0 P0 @0 00 AT/D%0 000  0@Pd@cDPd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd0@S@-50 /DUB@-DaP@MT;0 (V ./1p0 @I @!/D f f  f f0  00e0 0t0^00d0 0T00000<0Ѝ$c@PdTUBZUB27kUBaUB=AsUByUB@27\00S/QA-H@H@`PQ.p"R0:A /WJdPd@Pd 0h 1g@PdG-pP.|@X\`&V\U0 X0LL0PTp/P 0`XPh0\`.'Pd@PdJdC-`0@0PSX 4/X  Ѝ|0#2q12`03"p'qrX Ġ 0 0  ЍCJd@c0@- @r<27G-P ` @R 0Y 4/Y p0#2q12T03"p'qrY Ġ   Gc GVJd@cp@-@P.000CS00Q.p@p@L.p@-`xMV 0@S x P 000(`(0- ^1.xЍpcC-M 0`p` @FP0 P 00 00 0 0@t?o2P0S RR! %*Ѝ(cC-M 0`p` @P0 P  00 00 0 0@t?o2P0S RR Ѝ(cP  0R://O-!\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 00@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 R00 00 R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`*@*(Wp@*p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4M* 0SPX H*`%ꔰ[Y( @`@P  (@`$ )0 0`P ( *4Ѝ@A$@(`&Rl00& 0T0C 0Q `)h 0l0P$0hP P0$0) @)00 ) PU T`h0Sr`P@$`(Pp@-@ $)P0P@ P00P0H@PpO-pP`$)@T @)T w) )000p d),Vp[) ЍG-@Q8@T80S <`O)P@0U:)@8080D0@0;)6)GL80兑P p W 80 0   Pp@-PL@y 0D0<8@0 <)08 8  0 S  ((80S 8)p8@1)A-@`P$p(h`0l0@h00 00 00Q0)p@-@$P`( @T)p(0S H0S)p$P ($0S(@H R(h07@-P @P@P 80S(@ Ѝ0<00(18P /p@-0P@ PP00 p@x(UB@-@u(@0 2@- @d(0 000A-`@p^( 0S P 00 00(AH(QU qF(00CS0~(`y(@-@6(Xq(@+(@-@TP 0T0 @峕ȋee0@-p0 0lPP@`TV P Ѝ80S A(V P@00TP TP0 <0@ 80,(V  uȋee18P /O-pp3TM`3@ NP00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0OP @@    Hp p~'X L尵TS`P@ `P80S g'00 000'T` @p`}D0<S'80!0S0 80R1``80a8000~'='$w 1 P 0R,:p' 0  @#T0T0峔W W  S'T0T0TC0C' &0Y000005'1@cȋee(c0SS  S/@- @P1@8@- @P1@8p@-P`& 0SS w0 000np@&0AT &0S 00 0 00CS0&`&@-@&0TP0p0XT0&L$@w@- @%0S(P@ $`%% QT R00 00C0(00C(0%(pW($% %% R 00 0 0C000@0@00%%x%$pW $ p%X &Rl0 0& $00C$0 %X .R00 00C0UB@cO-@Q  ዚ 0 03/@P0W0>   OJ@ `3V0 0,Q * Q :@  0  D@001 001 000       @u#000 S 㣏0㸏 00C 2 0 0 00 3/@PW 0  "  00 0 0 3/@P 00 3/@0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  e(0`S10 0តP@0+M@Q 0 03/0 0 0 0 00 @@Ec~f}f3{f@|f@-@2P p p@-@P%0P @ 003/@p@-@M P >IЍp@-`@0P @ 040S-@  3/@p@-$M@P @, 00`V-@% 0 10 !0S! S S@ 1ᫎ 000 00p qḎ 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  OnP0000Ѝ7@-@P BnP HP Ѝ0@-"0`p SB@ pP P`0 @  O-@oopb W T0!03SEP (0S0P p(0SY @ 1!H  @@ PU @'P-dM"h0 (00@#0 00 ,8dЍq7A-0P`p@0 TЍ@- #ᔬ0@-፬G-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;0L ЍO-`0#MPܰ" 0$0P @Ѝ(0SpprW @P (0S0pWpWp_W @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 -P@x  @q0  @P @g0  @PP ([1 01  010 0PPQ`0 @ @ Tq7Ep@-0PS@`M  EP0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqP  (0Sj[X\00X0 00 ` X 0 !  0[ @O-0p IR@4M, [P  kE@P!@T  aE@P @  < @0` @P "dF@ +4Ѝ?@-@hp0t 0 0x0 @p@-d0d@PS&r"0@3@#Vpp@-d0d@P?h0l (00, @@Vspp0p@-Q@ 1CQ 1CQ pP"h0l 00010Xp00f@p@-d0@P0S S p80`h0pP}<p0@`@0@p@-@d0P@mp@)p@-@d0Pap@p@-P@Pc a0@.pp@-@P` ߕ&'00F= 00'`P000@0 pp@-P@A` h0l 0H0` &r0`3:0@p@cG-0SP'@  pḢPP srF mh0l Y^:0 h0l n$AЍX#x0S `P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PA-0SP-@ `phl 0 y0S 0Q h0lKn s$@@  @PX!x0S P2Ѝp0t 0 p0t p0t P0Sp0x0 t S PP #PG-50S`5 P`P-00p 0 0(00 0t@  QQ< <`4@0pT40S@  @004PD00$L0CA|z9@0SD  D 040S8k(@dT0@P0S 0AQ 0S 0 ,P ' ,#P`,`ɚ;6eEVBʚ;>0@-@M0@d QP#!0  XP@   k@ T@Ѝ0@cA-PR  p@P `VP $0 p|P(0PЍ@P/@-MP@`P V0 ! 000Ѝ"RS+ P `V $pߟP2U0!ʟ0P  RR   *⿟P2U0!㪟P!SS@-,@  =0@Qd@5QdO-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO20P ,ЍO<0P 0 $07JY )P@/ [, $ @P&$P Y 0 0 0` )$`P ; P 7,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P @Pa0+ S0&%&b"x1Y, 0 $0˞@PM$ 0RXP 0 00)P[2 *"*kA 0 BQ    "70C?o2S0S0S000  P S00S00S tPP IPN@Hꄫ@@@KVB0@- 0@SP$M  >P 0 P     $Ѝ0 0 R  //p@-`Q0@0 QP&p00 p 0@-@ 0P  ?P ?ЍC-@$MP >P 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V PPPXX V  \VB@BVB@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @PP0P4Ѝ@cXYe@-P@`P 0 Ѝp0 ` O-R@|M PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@ᮺ` =@P V ᢺ ~8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @P_ (( R LP0OP H @@cXYe0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0hJ3 FP 0PED00S 0 @OX0P4Ѝ@ccXYe@-P@`P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@ᠹ`  <@P V ᕹq8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 F (0X0B 0 R  @NB (( R LP0NP + ѡ@@cXYec0@-0 0I ЍO-1PMp0P P @@ P @f ㄂ 0 03/PZ  ᠸQ@f [ $/   P 5/PP [ $/ < P R 0 N  ^0 S @> 0 0@Pub xz/  $4`` 0 , $(  @ T4If rdAedAedAXYe}f~fg~AxA`AVBG-pM7 P㐌 *0` S7P 0 刔 埙@,!Ѝ>    7@P  07 000LⶸP8'7 (P0S6  S1#U S1 #0 LP  7l@P0@7 L⮸@P  7 ԁ0 @LĸPd @@PU @UP0 LAP @HJd HB@cfHBHB00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0@c/p@-P@W rpG- P @`$pX X X@(0WPP@ 0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0 f[@#dRЍlpp~Np@W02\: 0 @  01/@A-@`Pp@ 0@xG-pP@`. S!@"0R  2  00@ 0@S0"(0  ,0`$0 J@A-@`pP  2`p0#΅"^0@@A-QPp Q! Q`+Vk`@2` R`   Q`02@20C-Pp`2  Ѝ S @ R0P0@A`0 006Z(0 #c 0R P A-`Ppa S@"@Q  0" R0Q@H0 00Z 0@ "c~ЍG-`VP:Pp  @ HTi 0 )>PP$!]c2 021PP 0 ( h @  &a  00ЍU ᮵ī@̫@G-` R P0S0R@9@ 㙵0+=@P)V  U @$Pስ0p =@PP`@ P0 .Z@ ᾤpW ifO-0TMp$00S00 0p8`P#`TЍ0 0=`P0  0Y8`Ph003 ``3 1P00Cp$`W[3pWb 0`op@⫲W[<3pW4@T0,0 T 1 #0p$, 49,0 @Tp00P00S Z 1 !, !9,0` T00P00S U 1, 9` شմVP P 04P9{0`$`P 5PPp0`$`P *PPp  j R<  <` Ej`` P  R , (( $ , 0 0@@00 0$0000pu  j R<  <` Ej`` P  R , (ܴ( $ , 0 0@@00 0$00pOxP@t<P 0 03/`NV`I`N``g @@cxcxccWB B @-\00S/A-@P`p ለj00P0000 0n?@r?v_`36 A-P@pFA` $0SH0( ` $ 0R`0P n@cp@-P80@T ,偌PpAQd0O-"LM@!2Pp`0 < 00p0,`(P$@ @@ @<D@Z10< 0D0<0p,`(P$@ @@ @PZD0SU '`Q`1 P0D 0<,p(`$@@ @Z0 010D 0<,p(`$@@ @Z0 000D 0<,p(`$@@ @Z 0 000D 0<,p(`$@@ @zZd0P00<,p(`$@ P@ @D iZLЍ )WB3WB0c:WBFWBRWBaWBoWB Q< 0 Rdp@-@PBoPPUP '( P ^p@z R00 A-\0P3`qL00CS@@0$B@T <|@cA-@` 0p 7;PP Ѝ#@P` 0 PP 0`P Q `NPòP1S!!1! PU020db( t P p +Rd0@-@PM TP0QPP+0@@@T& lQP0@0@ @@@0  'xP0 @X@RQ PTTEP0Ѝ0<0c0@0@Qd}WBEcRdh7Bep@-@P`W0P ( R * pU  @@p@-pPPM @P @  I5@P0S00C>S@0`S@ 0S@ x⽚10Ѝ0@-@M P  P ⥚ *6Ѝ0@-PM 5@P  p@P @p0`S  ⁚0W000VQ  5@ЍO-@$M 0Hp幱0` :PP ᰱPP<@(3 Pz{@P   (  , ^ R !W$  RR R0R Pzw@  @>8;0j/ 0R( P 0W`0" 1 00 0 100ru嬡@ ]pP= @   P $◅D1 00? 0@0 4<00000 P Py0 00  p,0(0$@ @RX00P000a0,0($@ @ @< R@ЍWBe7WB7BA-@pP T0 P`㨀0 V:ᶐT` V 1q/@`7qPЍ0`1S 0 + 5aWBJdeWBC-M 0@p` P弓$a0 P 00 000 0P%N?o2P0S@.0S@*:PPU@$ @0pU*0!R0X ᄓH@P\ժ@$U Ϊ@PЍ贍eJd@-808@ P 3Ἢ  @茸EceH7B0@-M 000 00 0pၹ@P@,P 0R 㙪`0 S |፪ @ R \@0`80 @.@P Ѝ贍eJd@-0 000 0 000@?PЍ@}Ѝ0C-Mp0 000p0 0'PQaV  0RF@P0P X@ЍwP w3pU W @0U@cPU0pPpU#Q  A.@0S P rP d}T{@ Q0S 2y, Q@cJdcc@0G-M 00 00 0`᫸P@ hpP LG@Ѝx4143P@刀0S S@ u`q tp P@&$TQ  -@u`L@@@|PU Y W 1S  0ሀ0],OQJd@cc0"!S/ 00/P /A-L0C@1S`H1P@ATAps`@@c00@-Y @t0P(06 00 S+ b4<0f PS <0D1 0 2/P<0 ,!P R 8!4 p) 0P0S81 Fr81S PS 0`P 81: 0 `:0| (:PP 81S00BRUbPEQᆢBDU"XOW[YgP @Pa ƧX g *0Pe Z  0巧0XWYPELD  *0P 4P 0  *0P 'P  *0P P   *0PT P   *0PrT P   *0PdT P  {W < n*0PY 7  e*0P0 01 0 100/oX" R0  f+0/oW" R  [+0/oY" R_  ᕰ O+0X v{  r{@c@p@-P@U`0M  *PPP  *P P 000Ѝp@-@PP4M  *P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PᱦP )@P81 00H|@P *@ U ᗦEߍ@c4@@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  )PP P  ~)P0(ЍpE/08!PR/p@-SP@HapP@10D1@A `0p 0 poqO-0`SP 0S 0@mQ @280SP81^0S 38@0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00!   0 8UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍO @ PRd@A-`唀p?`@T|@0C0~P@PEP]7 0 F0 f021@& 0@@ARdEc@-@( y@|p@-@{0Sp 0P R @1S0@1  0S0000p@@-0M?SU1p`0@SPT:4u `P Z@@D@ V@@ S @Ѝ$`;V00SS @@0` 00@P@T /@~T|t T T 0 d0 Ѝ@00@cp@-@xMP` x :y` 'P0 xЍpp@-P@xM`x $y001`0 00$ uxЍpp@-@PaM. y .(. (ލp0p@-MaP. '@P 0@  .@ T@ލpO-A$M>ZL`0R00pPA 0V4U 0S31@0b x " h H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 4-W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[VLH1H0S ,1 [0(0[0BVH0SP2 x2 020R00008`1 01 1R 0  08-P "P0 4P0 0P 0S C,$ЍP[H0 ꐤ@ceWBcc0@-P@P<U ߝP ͝ЍZ 1 S4 0S DqWYP ⿝U ṝPgP*@cJdcA-0MS90PS5 f@Pz`P@p @@@1 00DP 1@ᆝЍQ 1 卝@ꛝ@p@-P@`u 0SP S00C00 xP|PU x0sP 0C0Pp?U p0PS ʀ000h0S x0UP@-;0O-@`P |p@-P@P ;Pp:p@-@P r9000,03/@pp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@)P1QB 1CQ [?0Q Pp@{ 1R::1Ppn!0Q 0 0!0000\0S: R :SP0C BS000DKPL s@<@s@Dc@c~f s@-@VR0 0 0h0e@ORp@-d0T@`ER0\,0(@P@U?Rp0Q/p@-t0@QP d0Q+R\0S0010'Rp R0*R0\0pp~fTf@p@-PU @d0`(0p`h0Rp.Rpp脭@p@-@d0PQp"p@Qp@-P@PQ:UQUh pKpA-@Pp qQ\00tp00@`0Q00F= 00'`PPGJ @-0 @0 hƯp$@A\  \ R/ A-0SP(@ `Qhp\ 0R$S$X#P0S0 0 0 Ǯ0 P0S00 S PPuQЍP S lQWP\0 PJeQ  L~Pdp@-A@ PVQ\0S`V0p@ZMQp@cO-50S8QpP Q1 @P)00夰 0 0(0 厜`hYp"J QWKK0 :TQ%+  `岺,03堸00 Ѝ@ꨭ@WB@c0p@-@PeP D0R 7p`PIUP-p p設@@- M0@ P r ЍO-P4M`UXpϼP˼P (P  81R  4Ѝ@PW U8H0L 0P0S XX0 S'IH0 L0 H0P L RP 0 H0LP Tp 0\0X0SPP0P]IrPᱶ(Iꨭ@ɚ;6e@-@LM`p P P0U(P~?oU20S  LЍ B 0  @o/p@-dPp@d| 00C/(0, | 1R@0@@1B @@V pȍeQQ03 0# 1Q10C2q0Cq0CQ0C0C3+C? R0//p@-@pP#p@ȍep@-@pPp@ȍeO-M0(0P`p` @\$ X $  Oo0W>BP@T$ЍOЍHc-@-0 000\Ѝ Ѝ/˼A 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd$ȍe`ȍe@- Pȍe@-@(080|(z@JȍeDs@-Pn10@T HOP4d(Ѝp@3 D8&PЍpȍe̍eA-<1P@ "000000D1hzPVPTP U D1 _```fh !`F000000000U@!000000D12 !_ 0? R(  U P D00000 h#P  U  _?0S00hPS0C 2NQ 0 0 0 01Ǹ\0(0, 0 (0, 01ZP;5j 2  0 $&"% 2 0@1ϠBl(  Ba!d0< <MЍ쐟}萟{ 0S S! $0d < L0 ϯ< eM1S ]M0q$0dL0\ <ⷯ0SD,XBD?eQXBXB@BH'hXBIXBeXBXBXBSBEA/A^B1 |0Q@-@0_O0i˼AG-MZXqPUЍ0`AT0AT( 0d@Oo@@d D12 1"!10CS1!1R10!1 T䠕 eV. V1 V# `V00d@Oo @d0D00 H0 l Y   #Y Z Z P m#cȍeHcp@-Z`@`0@1B @ V @Upȍep@-@ 0 cOPP <0<1Pp0SppQ lWȍeXBA-pP`W@ P0@S@@@V(` @0 0000@P0C00@1B  @ȍe0 @-#PO-`@pᄡpS|M b0@!B @ < |Ѝ0< #" (120!Q/[0, R) D!& $ P 1 0Sj Fvcl" "T[H2R[ L_?0WP ` D1 |0 S7W) {v` dVd`#~wPp`WN<1) ?0X!KW#0P|J `D1pG|0 S|0 ` S)Q0`h 0  0A000 pG000/P0 0D1|0 S0<: =ȍe@ccEc@p@-a0,P($ <08 :DЍȍeYB$88B$YB+YB6B/YB5YBՁBHc$8;YB- B 1011 S!1 0 !q 0$(Hcȍep@-@PX0U00 00@1B  pPȍe@-@$K0  (@+p@-@P LQ 85Q 0 _? = 0>;0p0<0~|Q h$p@p@-@P  _c/0000`0001S 0V (rMpȍedmdc̍eA-P`ap0| @@ @@1B  lAT 4/0 #P@P ȍep@-@0P#PP@ 0m jpEcȍe@- @$!^[ȍeG-DaP@ 6|8$ 0 4 0 T 4 T ( ,8q U( ,1:00%<$ P - 8 < 8 $ < $  R P @t q nU <0SPLd@a P @14 0 LS 0000?Y$0!D1  L0S81  UP h9P000@1 t1S 3/P0000  P * 9\0+4 V1SSQ   ^zw090@W1SSQ D15 0L s D15D1IT9 P1SSQQ1SSQ ViP1 S S  b0 3  1T!U1R*,R1SSQ VG   U1SSQ 0<0 }T1ST1SSQ D15D10<0 U  P < SK1SSQ 0S M< U@ PM1SSQ# _ 0 R P W  RQ $00"0S0>;6RF L1 S S RP N1SSQ/ e P P p\ p0U P P  lp0E P P V  "@ Z1 S S R .L 00 S   | 1R$T {  PX` U_ H1S I1S J1S* ( U& 0 08E0  :/0"H1 S S R  P PEUP#U  PE0 S = ȍe@@1  p@-P@$p/ȍe@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`PpA@@ | 1R@ 0@1B @ TPT Q X @ȍep@-T@p`<m?P,00(@@UpȍeO-0DM S @0 Pp#48@3@(00FD h1 Q/[ , S) d4P[01 0S4f`DЍ` X3`OVp<0Ya00VX0FS[`0#4 0=0 0PS!RRQ   R V`0# 0 # ?0cR81  TP hw P000@1 t1S 3/P000"Q8 SQY0<@0T0R@2 @A0.@!B +@) `qQ C0CU P<U D<U50 .C <Q ]k0CQ$0CQ;0S 軟3!1PS ;U;U0CU;+0S00;U %40cS KS V0CSX{T P 0 :/zC { P 0  9//:Q ::0S[  S 1 0S [0 P ^X  @ V 4:P L Ѝ:0AUE 9UPu 1 0R6[03 PP9U9088 0;b9U 0CU 0UiD 10S 0RS&9U 90SQ9U( 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0vPz k\8U >0Uu >C0CU 0R000U(U d7Un70 S' S007U& |7U0Y_d |P4  u K+,70Sd70S  P;H7UD~0pp1S 3/P  L,p8f,$|000| 0C0;PUPPMXvX 0 0Z - RT 0H0HS ]PP  0D @0D 0PؙHAcP ]%!,۝,匍]Z@QV T ЍO, N+u%0S ! S [0 0S00c0 1 0R[0 0S00\1 0S[  $0|00@1$0\1(0S`1 {r,4U D1 "    2D10D!810 R<1 0;; 0D!"0D1 t 8P D12D100FNx Ptt60D!  %<D!04 Q}[z   Q0(03/t0<0'wP GEoP7 100100@[00[0x6CP0S ! S-[0* UUp"ePP 1 0RPPQ 0 CNP0S ЍOvSF !UЍO! Petrtht@t0^t ȍet,@Bt @ut@cf@@t@cAYBcKYBCt gtcEcvtt nt ot st@jt@wt@HtH~ft@t,dmdeBp@-@Pl0U R  @  @1B  P0pR00~PȍeH/H!/81 - p@-U1@ C/oS" R 0\ <0 rP 03/pT1 S S R 0<0l1S (l13/R#/#pȍe/p@-P,0@Tp/rP @`c/@-@PD0@PP  80P  R 00 0"ȍedcp@-PPL0@T 0S 408 CTT 00 0 p@ȍe`cc@-@P($08 CTT 00C 0@ȍecA-@oP/pPP` qPa00|0p @R 0PQ 00400S  R  0?ȍe@`c@-$PP WdcUYBcqYB@-@XdT08 CTT 0S 00S   ȍec/dc 8080 1l1S 0 0//ԉc 8080 1l1S 040//ԉc 0 601/ԉcp@-PT T0 601@0003/(0lQ00>pԉcȍeA-pt`P@@@ @L0 @ S@P0/@(0,   AR SD1 WP00Cȍe0 /@-P0 @"6 0<  $0000P08@ԉcp@-@Q@ x0`"6 0h Q0000X00X0 0$0p$p@ԉcG-0hMS~ 1P!0 & q`y됀@@,   XY 0X0 j@P@  ,Q,#NjhЍ YY 0DY0 hЍGi|0S  @ Z;ݚ@P | w i@2T0@@ @hpdRd #B@Px_ _j@\T0@@ 0R0T0S=@#@@ԉcȍeO-p@`x2Pt"0tM & 000L @  I L Rh00 4 Xr 0W#000  ` @P R8n X1LPTdRd #AQ@!@1l  iPOL @000(CT GT p RdR@1d@#  iP. @ `D!L"$ L\ "P R (d ( 2/Hl@D8(Zr 000 tЍԉcȍeG-PH!D1 60q0`LA@ 0@ # | R    X0S  Y0S@ 0@  L0  S  0@ T@  BQSD1  @T Q qY 0l@Dԉcȍep@-@p p0 601 R R p@ Ph p04e $p 0PԉcЯ@ȍe@p@-@pP0Sp@ȍep@-@pPGp@ȍeA-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @O@Wȍep@-d0PQ0A TT 0SlA@OoBU $p@T@ԉceA-q`0S3@ThhK0VT@ PQ 0O0TS@ R P!o0@@s 01S`@0Pxvl01S TWpn`ʆ0AFԉcYB QBeA-P0` VP@P@ x0x0qPl1S X*@H0@`l1̀!0003/D1;D1@Eԉcȍe<[8Qp@-4Pp@$0S@@pԉce@-@ $T@ n0eԉc,sr/p@-Pl0@"6 0\ \ a $ 0$0p@ԉcȍeA-`A0` F@PpPP84z0101@0@$ls 1810<10D1K<@1=`1\1Ql1S000( 0 03/P @ 0%P \PЍ00   p0PP0C0 nȍeԉc+p@-PP0 601P003/@@dpԉcO-쑟p3`!1 ر 60P@ @` 1 Q$ L0S1 8pL0SP@T:L`p)V#51 0S [ `@P  [  S P @< #@ X@T @|Yf@dT L0S8@l1S 0 03/@@cԉcEcȍeG-`,$(4 6 0Q4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;lP h3R `3Vl 9>C1CV %@3Vm 0 $p 07/pp{ 0 #ppr0o 2 Rk0S Y`v2V, 1\0CVh|V|2V" 0CV 0TR 0 00D0A,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>SxD1S0 008|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0ԉc`thf8ft_t u wt@ȍept tttut 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-`@PU VBP0P0 0`p@-@P уP 0SBȃ000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP (l0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0SM  0000`P  BR1 " 0010 0000S000pYBO-`QI@p0 S> S 0S4 000 0R*PP P%PEUP Xk R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [ YB0PQP/@P - Q^00@S0\3 e X0P/-0^  0CS0\3  ep@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P */@c-[  \ @- @ [0  P p Q  Q\1P!  S[ @ [ @M@轓@@at cp@-`d0@31[  10 PU 8ᭇ0 Q@[p@@cp@-`d0@31[  10 PU 8ᎇ0 @<p@@cp@-0@1[  10 PU 0q s@ p@O-@p`\DM0 0<0000<0,(p$@ @@ @`Pc(:00L0 00`<4,(p$@ @@ @Q(DЍeAYB7@-@00Pj000U  Ѝ0@& Ѝ0@-@H`$0S 40 S   0 eA-Pᔀ MF@T hhP$~r\TPP` rf  6 p0S Ѝ@ceYBxc0S/⹄c{8A-tp@hP`V U0PD 0 p@['hPR`ce h000@-@AM,P TLA #fQ f, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01)"PLaPU 0S 3/P ^ [0$L10J/@-PAM@zU 0SAߍ@, `P Aߍ ``3pP` +0PS 0S  e0 L1S0Sp0LQ:03/PU`P  $IO-MRQB 0,P|ߍO&Q 0S 0 S 0 00L\0$00(0%s`P % pߍ00 3@00T 00PS, (0S)pW& 0( S"0$ 00S0 000,0p 0峎P0 S030#[0Sw 00S@000 08S 0 0`023 - PS0 P 0T000X0@0\00XK 8P0p01 `00' 'QJ  g0S QE b g ) 0X 8p> "2 2" 2" 2" -8gpmTrPU000 W >0 =00 =C00Ks 0 0  v)0 0 Hp)00P0001P0100 _)00 *0X)00 0Q)00 +0J)p,gጛ0S 02$ pc@c@c@-8=0 =0$ =@0 =e@e܆8`8p@-` P00P0T0@Tp@D0D=P0SX@$0S 3/,PecEc@ep@-h T00T0\0@Tp@L0L 0?0c<P0SX@ 0S 3/,PecEcgfff0p@-X00@ X  $Rx01X0S 3/P0S P 0S00@ 08 04 0c0p0S 3/,PceȑeđeБȇeO-LMD@p`\" 0  t 0p,@(`$  @PQ%H" 0  0 4p0@,@(`$  @P?%" 0   4p0,@(`$  @P-%0! 00 0 4p,@(`$  @P% 0!hh1 0  0<8p40@,@(`$  % 0!1 0  08p40,@(`$  $ 0!00 0  0 8p4,@(`$  $D0 S @tPt`tpU:T 0LЍOP 0"S &@LЍAeߡAZBZBx8OAG-MⰠ P`p ` @d0P00SS00-ЍS0 000000@?o2P0SQ $0S S S h 0QQP<0H 80(0$00Ece@EcEcC-釟M|@P` pOp0p $  I0` 2d2 020202HX00ߍ蘏e8p@-1@SHP坕L0S0L0 %EHLlP UpH@0100p@ ɏEUH  L00L0H0P @0` 巏T^ p@X0\ /ZBe 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-$M`0@TPp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P 0S 3/ 10@c@cee 0O-DM!3Pp'`0< C (PP00p 0,`$  !3 0P(P?0l380  04p,`$  !03 (P?03<0  04p0,`$  !0 000'Ȳ!2 (P 0  04p,`$ v!0 000x!t2 (P 0  04p,`$ `! 0'!$$2 (P 0 0 4p0,`$ I!0 000!1 01 0<(P04p 0,`$ 2!0 000!|1 0< (P04p 0,`$  !<1 041 08 0嘌1 0@ 0< 勌  0P &R+3'! P<0  H0$<0DЍOnuBe@ZB@ZBh8EcZBEcZBEcZBԒ8^BZB48ZBZB`8l?e@A-@`(pP$!$A`꘏eP 0 0S/p@-X0PP Lō@P 0 H@Q000 0p蘏e@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` 喍PP0L00H@40 400;\00T0X0蘏eG-0MZf0\ 0pWЍ@L\ T 0E0 0 OP@T 0H0 0E0 0 D p<` `FV`!  apG@0ZB[B/[BP/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ0/0\/ APQ /p@-@TPPP@pp$00$/$0S0$0/ 0S00/@-@p@-$PUp@Qp@@-@0 ( 00@~Lp@-@q0 0P0 p!R 5100 qZBe RA-@P;bS`:pc@P PU0P SA-@P;bS`:p_@P PUl0(PPp@-P GP@ V0@pp@-@PPlTp00 00FS08` 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 _0@DJ0000CS0000`VTT`p蘏eO-pPU' `V':S`F' 0$ @P 2V2(0 0C(000(( 0 ` 6P(@PHV@` [@P 0 0l 000 000HLchH0H0`0000+ l_0O-rMP`@0 ``(`0 0`S`F 80000U Vn0  ( R(|pPEWY80 fXp000<)0" 3SH L0SP0\ 0fX, <Pp 0% 3SH0L RP \0  <  0CSS10U 1 !J0PI00<,00 BX 1U  1Jp@Pp@ppWm 0j 3SH0L0ScU 0< pP7Ѝ<pP U)0& X븀V0008000T   #RH L R!X B/o" RX0@0C0pfV0 X 1S  0  00HAQ00@0Wp!S  _^000P`V PU @P@-P   Ѝ@-0000P7 ЍP/@-rPQp@-pp巏`P@Pp0 0` U PM@i[B@-@P@Ѝ@-  0S  Ѝ0bSG-@9p`PP2 0 0 0  I,b0W`!V`! V `!0 ]0pGI0000CS0000@TWW@xP蘏eO-PR``Ap0PPPM 0@P 2 (`200V [ ^@P P Ѝ00pJWp!fW{  W 1+#  q] @PZP`F R[ 000R000 p꘏eA-0@S" `;(0 S8ʸS C< 0CPHP\P (00 AQ(0000PP 0 ?0W@ ]OpP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP \pA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` 0T PQPp000, vVQ@%U 0SPpGW0pUv    0 & P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S000 0 00HLeH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! [y[BW@[B[B@-R Ѝ@-L ЍO-0P0ppg RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 p0000H 0CS00C R0 0000 5[00C0P0PX!0 ZDPB ` [00C0 00 '000c00rg@AG-0P 偌p@P: ;  0 0  000HLcH0H0`夀VZPP P  0  0 00HLcH0H0`Zy@r@[B/-/-/-//-/-/-/@-@a_-@-A-PUp1p!0@W`DS W c c`PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  EXP   ZWPp  Z`G-4pPPP8 `1@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T V @ 00040"0P 0  0SD20@T D@DT@0 Pi T1V> 1CV VO `@a4TC@@ @T @H00@N0` @T'`1@00C?o270 T:0 `T `V4 `V1 yT`9`P @ 0 }u@0@T@#C  4@@iiip@-@PPPU@` Y`Pp Bp@- P`8@{|<0P px|@0PppPp@- pC0Pd00S P0pDP<@+~80 @zfsg0|@@SdԑeTdp@-P`0` 0@ 0AT 0S`S0S@ 00 0pTd@SdA-@Pp? WD, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0`P@@SA-P@p 0`,PGVU  ACQG-41p!,10RC*Q`= U PP<*P00 /R0S /UPPo@ %`Do@ |R0PP 0,`8$0 Pa{<{@<2$`@P?@Sdc[B@-@P ^o00@-@<2l,9 0S \0LS   ,P 0@o @D8o@SdSdp@- 0@0CS`P 040,PP_oRU vpp@p@-@P\ 0S 80 31R00 p@cp@-P40@AT ,nVP;p@@Sd@-0 00 0}P Ѝ0A-0SPp` x%@dwTP҉P (0S ᥉@ 00 0@PSd0@- @P ,0S@uT p ЍЍ@@-@ P$0 0[  Ѝs@-` @P)P,0S(0S@ 00S |0 31R@r4T <00S AЍp@Ѝp@ˈ@@c07@- k@P@P$0sT@ 0$0(0S  Ѝ0O-@PDM TP\DЍOlQ i@A@AoH1  &d @00{,ap0 !@(0 0 <00,p$@ @@ @"0 00< 000'>,0(p0$@@ @0\00 P0< 0,(p$@@ @@ PP DЍ@SdTd8Bԑe[Bc[B;BB|@p@-@P8m0  @P mp0@-`PP @AT'P ЍPPp h P0XS   @00C@0 `V40040V!Td@SdA-p MaP 3/@P̉@P 0 (00 0<1R 0៉@ Ѝ0 @P  叉0 PQ"03̀1 0Gp@BP 0 @0@ 0QPQX   803/@P   P?Բ@DRSP@cSdTd@Sd@-00 0 Ѝ4 Ѝ G-p`0 M 0*@PR@P  Ѝ0 (00 01R 0 @ D H03/@P% PhaP bUZ0F@@000 P @7  2@ ET  P F`P 00 0V @x0!0R:@@1PPS0P1@01@Q00  P壈Բ@@SdcTd@- 0000 00gЍ4 A-Mp xP@$`'X``P$P @@$(0V0(0  0@P  D~@(0T0C(0  ЍW` #@0 0@-@MP =P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0eO-TMP4L0p0L 00RZ(Y`|    "200 \20\2x0S@|0x@3080|00(05<0X008$ P z4S @|  $< +LxTЍ00 ?o2Y0S 9@40SN  <0R0 YFTD0S0ST00à R0S  6|0 3  8 Pa0@0H0Z|0 L 000L0,08L0S 0cq 0`(0 000D4 R8000S3# RQ. $ 0  0 R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6@00 $H@ 0S@@ [fY70 T 3 0{b W p00K  G@C0`H01`80 D $06D0@0S0$ 0$ 0H`\p:XP#:0 P000L L"4040T 00 0C0000 00C00 R0000C0 0SK ,0p`L(00(08pXTY,`C|00001`P LR   Y;( 10R04 D0x 3/0@S000Y1;ò10PL02Y[xY Y p{p [ 0 0 RppR@@TKd I`0[00S  @@4 x04/'@(@#@ @0x0cp>Бe8I0O-@Pp'n.U 0QR000P1 0S0;0P l1 0S1;10S00S1 9Pؠ[1X*0.p0@ -? P 0y XPX0000UPWf*p0SPЍ0S  3/PP *Uc Ecc@BEc0@-@M,P  0  ( " @ Ѝ0p@-@P@`(@0 0@S0S 0T ! 10 Wp PP pp@-0 SPO@P 0S w0@p oH00@-1@<10 P~$Ѝ@zp@-Pd0@0S S S0` C0h0_X00p@! !@-@pp@p P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,01d0 0!T!0    !/@cddd,ce@-@Q Ѝ0l  R:` <P#!, i` @ P 00@H 0TD@D0<0RH0e@c,cG-RpP`0=  ( 08`w  0R<8 P/D @R+ @ BPS@P P㑯PP  0H@L 40B300\00T0X00 %W00 EX0ST0S@L@T@Pc\BG-`Rp 0 PV T0SPLPT0XP05w@P  EUP`(0 0(0@Q`Q@PU7p\BA-@R0 wp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@P\BA-`@PpTXUZ 0000 0RX 0SUG 01QT0S0T0`@U8  R0#&  3SHL0SP0\00<0CR1Q 0D 00080 080@P@0P00@pL@At\B@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@rQ/T RT 0 0Sbp@-@QL0LPpS00S0T@@0Q 0 00000 p@D!R R0P00p@-PL@Q``U`QV 80u0S0C0000800C80Q 0S L`L0SP0  RpT0pPEL`\B@-@@0S87@-@P1 < @0D0 Ѝ0A-0Xp@P` U[<S !P  P71 S010S0PR 5 cA-4$P 4p0?RL1S(@8P ,1S 0,1010:01 01`B@P 00000111010044P0P041418181@1@1D1D1H1H1'00 P =00111100!1.01 0.000003/P&f``& 2R 101m@-L@Q0L00P0T0PL0SO-(ppP U [  s@`(/@P U U PP  H@L BÌ\PTX0(> 000P . G.ꎳ@\B@-P `@P   !CЍp7@-P@000T Ѝ000@᪶s@-X0,`0 ( P@,  Kl0@00U ЍpQl@-P0P@-P/ R/@- @@;@reA-P`X0@0X0ЍV,@p k@000W T k@#@X0, 0X0ls@-P`Q k0@00V yЍpk 00S/XYeg7@-@00P!000U  Ѝ0@[ Ѝ00BSp@-P@`PP  $0S0$S0ĕ`p\Bp@- 0PS`(M  @P- (Ѝp0  t@P0V" 0;;0@P R 0  R ! @P  @ 0 S@ R  @P pHtp@-M0000`P @P u00Ѝp@-Pp`t@P @t Ѝ0@-AMP@ fP Aߍ0s@-P`~t@P @sЍpO-`MpP8< tP (0S s&@Ѝ gu@P s 00PY V00 v 0 !* 4S  #@k,v@Pd!401  504DT04U0S ⣋0 Pdr0J(0=0@0  0, 0  ::1@PdPTP 0000r3 tmsY ~*.  v /v3 t-@Ts40 3t@@ @]xBD@@c@-Pp`s@P'w1%@ @P 1 $@G@1T tT 101t@Qs Ѝ$ R 0@4 @ 0@-AMP@ NP Aߍ0G-L1p30Ma0$000P 0 @P/$0 (00000 0 @P*$0r,0 WP@ @T (@P , t( s0Ѝ,  t ( t@cG-Pp|UUpW @0 S0S``F``T@PrP r@O-`RYPP Ѝp@0 T    R R @ 0P0l UpW@@IYW 0JPp\BO-tM  ᜀ^ 0X  q_ RL R(@W6WP RD 0!  0$ (\F! RL` 0 0 0$ 008A 4/ 0@0BPS 0C pP  #P ROV= H! R   @V.0P @P 00U VtЍ0P  #J }WP V `m?VT `0'0X` `@V@@\BXYeA-PM`pq@P 400000 0>@oqЍ7@-Pq@P a@[q Ѝ0p@-`PV M  V00 R0S@"  q@P0UV ;0@0  D   j@P N&q Ѝp @-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1010 S;305<0@ T C$ -r= 'r $  r r 00$00,Ѝs@-`P$q@P19@ 00003/@pЍps@-`P q@P 00403/@pЍp@-pP' c@0P0  P ЍT@ 0 S 1H05 PV00  \B0p@-M00000P0` H@P #0@P P_pP oލp@-p PP`IM  e@P0 0000 0@P # 0@P P4pP oIߍ@-pP* c@0P0  8P Ѝ RT@ 0PR 0 ;PV00  1\Bp@-0M@P` P) 000 00 00 0 0`4,00002PP #0PP 0Ѝp@-P4M`p @P&043,0$0 S0 0 @P$0S 0@ P T @ @4Ѝ @P\BO-PPlM%  (@PnB00S@i8(89uP- ( 80,00< (0 @, Q00(0H2 , 000 o@PG0DT@0` S;# p0 @ts0S@( 10@" H[@P 0冲*S`   @X0 S$0 00  H0P #0@?oV20S@ P TV0`D@ nlЍX0S- 0HL@P H0 Hd01@P`0`0S 8x(,08< SP00@ S00S p $ HA@P P000ɚ;6e\B@-@0M 0P 0# ܍@-@0M 0P 0#܍G- pW`P_R/R-U@ԥPP 0L00 H@$ B# \PT0X0Y P`P b$<W@ W ` 0 R $R ÕP`0311  U`pV 0 0F0ER8f000  R` R\B@c\BO-MP 0L 4qM Q6 Q(@A"S` R. 4  0$0 8^4 Q Z R7Q=@20SF WP? R P;8@`  @P @0V RNLЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* [ tT00#T0S  T 0 0$; |׮ XhU T00S 0@ 0,}R0K@@\BXYecA-`MpP m@P 0 0 Ѝ000! @-m0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` HP3`$00 (ЍpO-DM`  Vm@P0P S;# p0 ts0S 0 P0l0U@DЍ 0Pⅲ! 8p0P ,0 <00PP\B-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppeO-P0㄰U`!R `VP R@ R R ppG'qZY08/07@-@00P᳭000U  Ѝ0@ Ѝ00R0 0S  0Q 9@ @- @-p@-@0`PVp@0 `HိBp@蹭ep@-@P0S 1`0D0L]HO]@0L0@0pp@-@P m P @PQ@-@vt-p@-@TpP0P R  RpPp@ R   R4k Q  101p&]B@-C-@MP,]` 0` P 1 p`00\\\ \]0S PЍ]`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @0(00M  XЍpj=]B6]Bp@-P@e Pp00Fp@-@e 000S0S P A-@pP`V 劬pƬHQp0S 0`V,`x` 0S  0S 0SDg@bA0塬6P Aec$e@-@5p@-0@SP 0S%Qܬ0S 0S POP0@Pp0S@`00d jJP p0ceD]B@-@P, 80 S 08  @< @Acep@-@PpP 0  p@3(0 S 000}ep@-@P400C40 pp@iep@-@`Pᚬᘬ 0 ` ᐬBp@1M/  \@-  0S 0S00i)/O]BA-@`pPP 00S0pO-k@Pti凫S0S 0S4 3t| )a`V/d```V8Z@0SX`(V p_(0S 00S 8 R4 S 00S ጫ ``<08p80倫Wt=QpG p&xW`p(      B 0 RY 0 R  4R 8 R ( R`V  1Q   R  @ 0  0 .4,0 @  % hުZ   e(pW0pW  8p  8p0S 0 0@000000Pph$婪`V000 ;\]BceEc$e@ccpB90S p@-0S pP@1` 0 偪 0S 崪/O-PM0S@i@0%@e@`0@0  Np 60 `PR 0,0X000`3[4$@P @T ,]aPNN0@As@00@0(N@I00@0$0 00D0, @0^@P N\ ST0 0$pzaN@00@0Ѝ @O-pDM@0%@(@0@0P0ܟ H60`P @ T0,00`Z4*$@P x @00@0DЍk0S&@ !^@P帩`V=@^N 0R )@001 0P @`0S $}$ 5$0$0@0@01`0D0\YH_Y@0L0@0@0 DD5@00@0 `@P 00S p@0@ 0  0Su/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ P0 00!'> 0`,`0 08p4($ P0 00!'> ,`0  0 8p40P($ P 0!'>X ,` 0 08p40P($ P 0!1 ,` 0 04p0($ P0 00!0 ,`0 04p0($ P S``$@7^ @0`@mP (fDЍAe0cAg]Bp]By]B4D9]B0@-00PSVP`. P0 C  SK010SG @P0S S S @ Ѝ @0R 0 0@0 @0R00 @0R00p0S S S *@@0@ D@@'00S @*@0cO-M`00CS@|#0Q0pK$@% 0 Rs $Q Y0 ! g@P ' 0[T^lg(@T R 0P 0p P pY000/ ;g Y';0} 0000 p0d  i  i g  4  B4 e00Y$@jK0  BЍ@(@eP/ (B9O-@S4MP` 0S 5R0 SppSpWX%C+1#0 000<5!05 1 0SYpP 3  x 0 01QM 00< 0S4*# pp 000YT[0 ] d@0 L00H@Pp4000 0J00p\0T X 0c[= @> 4ЍeP (0Se pp$  (3( 0,,*0044,$ 0 00~e[ u0SP 0S0S @ p  X@ @ @0 0@0 P P" 03/@ #Tz  P @0 ,00!0C00!, 0 (00  C@ 0 ( T q 1R0B S8BX P<0S=/ pPH!@0Wp  1N@0@0  ⾤P  03/@ Ƥ0 P7sq 10 10S, )S9w0S S~(d9@c0cEce]Bc@]BP P// R0@-@d +0  000R  0 /0@-cMPa/@Pcߍ0R@-@ 0S R0a/@-@0  R 0  /0@-R@cM P cߍ0a/P ,P0S p@-@`P4SOt 1]P\ps@-P` !@P @=JЍp00긴@00@s@-P`Jd@P0 @cЍp@-IP00 IA-@`p PY@P <N 1k]@\@-P` p @P0 @I Ѝ0@-00 Ѝ临@0@-00 Ѝ@s@-P`c@P @cЍpA-@`p\PN 1\@Q\T @@-P` p] @P0 @I Ѝ0@-00 Ѝ临@0@-00 Ѝ@s@-P`c@P @5cЍpA-@p`7 P@Ph 1\@/@-P` p @P0 @0I Ѝ0@-00 Ѝ临@0@-00 Ѝ@s@-P`5c@P @bЍp@o `P/@-&b]B 0(8e(008e`O-QM0 | @ЍЍOqQe0R 0 0p hW01h0#0@T_WPUY b[P[PPE0Pb|P@T d2`VPL"0 @ [030#Z0S@x 23Ph  0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%0U  &H & 'L ')(ӣ  P卣U0S' 00S 0/ wm0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#Pl8eUdTdHUd@c0P R0x/G- P@ U `ἀD`00@0$V0:Pp' 01St`0 H0L 0 H0P0L T 0P0 T %R0XP5\p5)`Pl0p]B]B8eTd0P @-P8P/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd/P 0%%#3/8e| `0R 2"-D | 1# H LH RH P LR P Tdp@-`P@TQx^0S<@@ @DX  S d oA F0SpP!p_Q}^_Hc8e]BDc]B@-P7310! 08eO-3#SDM  R NW#0S 88   < P`+`@$@P3 00@3@@ @@00X003 @@ @@00X Y#3 pBԢ(Eg V""0&5=^ V00 S"0  0 ,oQ\VpkVW0@<"[x 02`  2;L0 ,00! ! (0 0 00`$ @p'1少 01 00` 0,p(@$ @l 0lQ!h1 00` 0,p(@$ P @y{ 0E 0 0!1 00` 0,p(@$ @yg0E 0 0!0 0 00`,p(@$ @ySDЍO;0  cu98eTdUd]BDc^Bl?e$^B*^BhePc0^B7^B`cUd@ea9^BeLc0z9>^B\eG^BN^B]^B`e9]B  @-0P0_u98el^B000U-P @P\^\ l8ep@-@ P0  XpVp@-``BBd X 0$000 0T000V0.:pT00T0p@.~9@-@P`qVHnV 0"00000 00 t00 0^B^B!CeUdG-p`DRDX($0 S* X@P8 000岠 S p0S oG0$ 0C#2 BS*p@TX@( 0`00W2003 DɠE>,儠 ၠ00 0>P0` |@TX 0#0L0R    #V@ V 00 000$0l0 PSp  p p0l U >%yTd8e@c4eTep@-40P (a,X@P <UP00p8e@-@U`@Up@-@000l}V05000  00;0C0)000 Q :0`P =>09#900S? . 0R9ڜ  I S `P 40083/П0` =V0 $$,V 0S 1pp@|Q t  | x x |000900000 0S" Vx0p@ WxS0000 |  @|    , 0C1p@UTeTd0Ud8eUdp@-@PoOp@娟Tdp@-@d0  J]<00 0GG PU 0 0匟0p@/0 僟p@Up@z^Bp@-Y0 0JpTd8ee@-@0@ (U8ep@-@T` PT$0S@0S@ p@A-P@ `x0p#p0L0R @ ŌV X <` {RV@ ᵜT@^R@c4eTdG-P$`p(夜) 0a@P' 0 P p 4ќ@Pɜ0 >  P8 l0Sp p p0l X  @P  0-P Hx E4 PllpA d0ic1p0O 剜P00Td8e@-pM(ppP,`@P" 0 "0V060000S0#T20T20SmqP V 0 0 0 ЍV 0 0 0 @c@- (pP @ P@P $0 ;`P Ѝ`q0@0O-@0@Dp8<P @ PЛ4` T @P@0 X;`P Ѝ |P L10 k,孛@``10@0TdA-P`pᛛ 0Z@P 0 p 0 0(90ěAcA弛Td0/8e202/@o/ 0R:****.//p@-@|PZ0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@{Ud@-P`pAT 0S *-P A030#A(0000S  ЍA- P$`@ZV Z Q+ a 0R010 ^` #0 S(0 1D 0 (00a@00C@0'U *A> 0R010 0A SUdDVd@-@0Md̚`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4&0 0000S0Ѝ@r@Vd@ceEcDVdPep@-]@.L "Pp@{ PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0UdEcDVd20C22S/l0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0g 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0Y "!Wm0 0NP D!00000  `D!000$YX)0W0WPPU D!@000t @D!@000g >PU D! 00 0D!@000Q80DVd@c@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY P D0s: 1sT W@@K 1R" I  .  @ : #:0 1!D>c  0DK P T + QD!(00(0 0PP T >D!000$`V4D!000Y T@0@`$D!000DVd@cO-`2P 0$MS ao@p᏿H0S; 1s޿@1fI@K 1R" I  .̡  :L #: 0 1!b 0yK P ᲿD! @(00(0c$ЍA81T ᡿ !D!$00$0R2 @ *0.SY Y+0.S (0000S X 0 0CX:00x"@ *w$ =@kT X0 0000$ D! 00 0DVd@cO-Mp80 0 0S:RP0|b00T @ 0 Sۗ`0cV`V``V:HZS  Wq O` $@ 0 80)0  *$ ṾV t妗 P0(  0P0D00`0D0<חT a_ᙾW 0 W7 .R4 .R1  ! `1ܾ ЍOؾ 0=0P0 Q L  L 00 L0ៗ C幾Y*;!R 01a@ЍDVdUdEcG-`0 S@Pap@ =ZPp` Qq a勾G舾0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝx@@-0)  0GЍx@@- 0  Ѝx@p@-@18M0@@ @@@0 @HMP` ֖0@@D00H@L0P ˖X X! 0X0000,00 (00!\0 0T0000<$@0 @0 @8Ѝp^BEcUdDVde,9Ec9^B@-0@00CW0S:DEc@-@ ╽a⓽( ;0 !1011 1|@@-@ ⅽa@肽O-@`p a x!R ɽ 9V< Pd0 P : ЍO讽 P  0P  * ᠽP0(; ᘽ > ᓽ?; U0  0 Ѝ^B@- ,@P :Ѝ蠄9@- D!000@ @c@- D!000@@cp@-9@@t031$P@`P :P :P :; 0 000p@cp@-@031$P+$Pp@cp@-@A+PpP;@:ļP }:P y:p@m9$00S/p@-@P$$Pp@-@$0P@`:,0 R P/20O-@Q1DM0 00 @@@Dt1 0 0 @@@DP1Pa 0z3S4#S630aI0A@(0100p0<8 00 40p,@$@ @@ @"0 0<08 <0,(p$@@ @`00'>0,(p$@ `@ @<08 DЍ耚e^B^Bl?etc^B^B^Bp@-@Pp0SpP`0S  ! GQPUQ 0L 0000 0C0p0S  ! Gxetcp@-@TpP`Pz 04R00 0 tG00p耚eheep@-`ɔ@PT E@ 0 S0S 0R00 0 0 ,000R 0P0@@phee@-@嚔0 0C0@ӔheO-`40@SPp0E  0S>Q  0RP?S 0 ! G 0 0S 1zf100P+坔]Ep `000000 00 00 00 A 000S 0 @ Ѝ R RQ 0 0 9CR:0S 0xetceheA-@p`PUddE0Pp `P00S 0 000$ 000 00PxetcA-@ `PV00pQQ0S0 R\S  ! 0< 0C0 00C 00 0C0 0pA^Btcp@-@0PS` 00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`]8[8X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 8U 88Cߍ*870 =P@@p@@0$ p@W`<0S J@T P$<  H@Pp81X10  h!H@P J0 0 :800<024 @00D04G@kJ T Xf p0 W|00 06 <@P 7 0 H%,,H0pLXp\S (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* $ J J6 @T($0S C$ /  CG701 P0CVS @@01ڀp41p@H X-<T(  eG@P" I0CW Iꔜe"A@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@5`F F !p$@ &0TC0@0 |@ pT0 F @5$ЍC-P`M0F000Fp00 0Z@P t@Ѝ0 C /  C07s0 0pB@6T8 1 !S X p &P000`F !00 寑pe@-@,岑(0 R @0@pe|c@-@T塑P00S@ S @R 00ϑ0pe|cp@-P8冑40@Tp@徑0S 3/@pe|cA-@`TpoH0PU4娑 0S  3/@PPpe|c B@-  Q &Q  GFP-/p@-@@P0S0 0S!0Sp00Q!4` @ 00`00Q \R HH M@N C0\St@y_B=_B0_B]_Bp@-P@@0Sp0400P 0S!!//G-18M@P`p00 00a0,@(P$@ @@ @8000,1 0$100a4,@(P$@ @ @P0'000 000a04,@(P$@@ @x0000 000a04,@(P$@@ @@dLB <<B ᢍ8ЍG8Bte8:_Bc_BDWd_B@9B@-@ld0 0Cd0@襐Wdp@-|P@x``V`803/0@Sh h0l 0lPd0@,匐pwPh`@ꀋcWdp@-@t=dPUh00 P Sh Rlll h00@03/`+fp0SPWdc@-`\0@T@DS<0S d0,0d0K<03/d00Cd0h@WdcA-@@?`pP3%VT H0T001S*@@3M[ w_B0@-$0@M P P0ePЍ00 S 0S (A-@0`P^V(@` ^V0S0(0(0(Pp`pD@ rLD0 000  ,p000 0S0(0  (0(`ꄋcp@-@P,Pp4 80R8000804 (PTE@-@<vkD@@2A-$0`V0 Pp 0  0`P$ @0FP( 0 ЍA 0RP0 0 0  p(0(0Ѝ(` 0`0 (`0S 0(0 0Ꜵ@O-PQ$MQ`š P/Q`QA`p0 - R!W0S QA 0S S S \P PP n$ЍWV0`pW 00 P P P000{z0S /P@ ,0S 0S 01/a$1`00(`,`00000 0 0S STtTPP`p p0!Py P4@(PzS P0 #P@'T @ 0@ `H0  `V00`0(P400080@4000,aC(0PS 48 Q8 0 804 0(0U | }0S R ~ 0~ 0(0 @ `31V P [卍0SǍ0[V0@0(0P0S0S|00 0R  0RP0@(P? %b0S$0S!Y0V( @0( (  0_`>48 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00Vdc@c@ Vdp@- 0@ 0PP 0p0P00p@-P@ `UAPp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P P10P@J1O-PMU@  =DPC R& R#     \P (1T R@1P@*+P W *pW`/oU" R 5 0Ѝ `P  0|*V O-p2`M0 @U Q Q 20S@0000-   R  5P Q P``;z_P0 PH0 00000P @0 Ѝ 0    0 000 0@000 0S 0 o5 9@PP) MU a5P CP@U 0 0  Pk0<0Pu0 7SP PUPPT  000 B 00 @ce_B H0R  R/R20R/20@-@/@  /@-@ / @  p@-PP@P 0+P 0#pp@-P`?@P P 0+3PP@ pQ@-@@P 0@-0@S .K000p@-PPEUPp@.PpO-MH00@,00D8 <000 ,0(P0SP00000000PP  0$PH0S! x?0S 00P0/0 /00000 0 0S 0S t/0 00H> c0 P d/0P _/0001$p@ᚱ`0V  x.`C0 /RI 0S  0 0 ` 0 0S P/0 P K/0P F/000ñ0S =P  `pR0"  ! P !PS w0 0 TP 0 S !" 00 `Sv r 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S .0S00T0.0 X.0T0S P X  Q   P S0S .X.0 0000000S 0CSg| G 0 00 00C08+  Q~  00x0d0 p0~Pm pP\0 00 c03Sa d W.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S .0 00000,00SQ 0N <0< (000000,00,0(H0(0b0S .P 0p0p00S 0  0UG U- .d剰[/ -TP0S p00Sp吰[ .P 0 pP0  .P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU ES-zX0 0T00 0S 0S0'0-00 0S S0S w- -0 00000[S009   R S R S0Y- 0T00US0S 0S0@0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d ;2 000 40@ o=P ?2-B $,\0 p00['`0\pp0`Pt`P 40p  l? ?X  ,ꀀx,80Sh50S 1@0+80/P$0 `@R0 r {R`" /U  0X P@0凯 F 0 S o*000/U  ` `q0/P$000N0}P 0X0S 0/U00S 0S*0S 0NP0 SC*/U 0  L00/P C00`$0L0 /UZ Z2* 0S/ ,P) 0 S*/U  `0 "00 /P$ X$ R  $0$0f+ 0 0 S:^+?//U  X X 0S P 0 S */U 000 ` s/U X X 0S `P @0 1  0 S */U 00/U [ [* 0S P~ 0 S *000/U   `6/U [ [* 0S xPh1 0 S*0/UP <1 `00g/U[ [* 0S vP ? 0 S L0g*/U00 000#/U4[V ^P1760 d'C 0 S 00J*/U deꔜe@cXYe'`BJ`B@cRBJB,`B#BZeZeBAXA3`B A,BYeYeBAB@`BAE`BB[ * 0S /U X @"P760\  dB 0 S */U00[* 0S /U X X 0S P76@ }U0 { /P 0R00Ǘ 0  0   :* 04 0 00/S9+ 00S0 00 .R  .R0/S0 0 00:+40 0 /R" 0 T0+0 00S* 0 00`pd0  P0p0gP 0  }  { -4 0 0 0 00C0S *wT00 0X  900S00@TP *T@T0 0X00(0S ,0Ѝ*6*Q** R 0CSP S0S *X*0 00000*00 RX RI=0S0 X R /a>P: X 0S /U[ tP65:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@P?Pq/x`PPkP(,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0*0 0PS <00U0S R 0S ,0  0 PP )U`V ,0 .``4ЍA- 00S : B0pP`q900@   0S P )@00WP@.@P )[`Bo`B0@- DMP ^@, 0^ 0^ ^P  LB 00 05U4PP00DЍ0@ ꤴ@`BA-P`pN@P P 0 P00 A-P`pE@P0 @Ѝ0 G-P`ሀ#p_@0T00/ 0P0TᑄN(P 凄@ H,PV  6/P 00S0P00P0l)P07@- 0P @P  V!@ Ѝ0`Bp@-P`@`` TP@ @XE    0!pxeVd@@-@mEPh<0(E0屄寄孄P p@"xep@-P "@@ $"@pp@-P"P@@@ "@p@-@ "@A-P`P 00孃p@T00 0S0PPP@ 0S@@уV P@僃Vdxep@-@QP \00SpPT ` @ Vpllep@-P`U'@[0 R000@00P0千@pp@-@%P 0PC/R 00/ 0P0wp@k'0A-`@VP p*/R 00/ `UP p0000@@@QVAO-`M@'$P̡̱$006Pk6@!OCAd@ 0P p- 0 S   '4 pW ,PÚ 8pP# !(7p 2:W 'W' kPUPW00S XPrX R0 R 'P $P ڔ  BR;*'U'PW ЍEc@cgfff@-@>0 !!|0x0t0l000, !  ! 40 @Pa>`B@cdddleAQcB 0 Cxe0Cxe0(Cxep@-P`6 %0P0P0P@0т͂ɂ`0, 4"0 0@0DVp@WdxeA-Pp 0`VF@ _@Ph`d0l0d07PP @ 00 N/ V?U 0WI=.dPWdc0(Cxe 0 (Cxe0 (Cxe0@-0MS@PW@P@ 0  VP W@P@ Br&Ѝ00@-@P0VP0S# S  Ѝ0`& @P {qp  0P 8`J&VUP0 P (`@0@ R/"A-P`@ h0Q30Dp6@0@W 0Sh吁AqAXA芁 Q TQ1@010xeVdep@-P$000@ 00),0$ R @@0@^@pVdxe@-@P V0 R$ 0 J@$VdxeJs@-P`@P !0R!0RЍpA-`p@PPЍT$ P*R0*T @A-sMPx% P P8 P L<@,@3 sr* 0" ">2qp>R PP* R5@7T <Ѝ@2P `P' PPf D0SO@ 3/@d00Cd0T\7`dPK0 (b90d00d0 @Pa A>SPU D0SK d00d0净D03/@Cd0T0Cd0<k?xU|50S2hoVd `1{2p@w{ꠜeH0 /p@-@DP/{H0 49H00S0 1 . p@^{ꘜeep@-l t0@SP Sxxtx0t H0; Sd0S0000p@!CeUdA- t0@SP Sxxtx0t H0; S``d0S0St t0x @x` d`0TpS S PP  0S 0@}!Cec@- @0 0S0 S0?0S0 ? 0000;080S Q蘜ec0;0/O-$MH0S`0Q@`,` p}|z0PU W@@hP  V   0 0` V`hzM@$Ѝd0H0d0z  :`$Gzd0V0Cd0p@JWdcG-Q-PBM:p(1SP5R`@1@0zN@P@)@ !O?P@D  P Ġ Z P @D@Bߍ Y PP ܡPU   @@Xd@- @000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`Pr Ѝplep@-M`P@0(@0 0`P\ ЍpleP0/Ĵ@cBp@-@M |0U `40 H0`0L 0/0 4 o50$S-!  Q p \5\0 0X0S5T00" "K5= F50 00`p=5`P`0FST55 0H15ݍp8,5@t@dBcBaA6AcB"dBLdBudBdBAdB2A@-@P (50S5@0A6A@-`00VM@YP 0 P0pxdPU*yV0 600y R00SP ЍtPx@PT0SdPxU D.TdeB eBp@-PHxD0@T0xpPh@d00d0Wdc0P/p@-P@ p1Fx01000.%/&.%/&  N+VU +# + 1|0pO-p$ML@P`H NP04WM 1U㤁$10S[  @?0P 0L<T00 ᕟY  $ЍW P1 ! V0[ V I08/P 0V+c(V  h0UNR@TPPP 05/P +` 0V8/P Ꜣ \=e0@-p0MPU U@ UMPЍ0Ѝ0@ [ /00Ѝ0@DDWd0 0 $ 6::70//0/ᘜe00/Ĵ@-/0 0/00/00/00/00/0 0/G-Q MWa@Paiw0p hq0S@0@0@T&XY0!,1 (Aw0  0 R8 R BQB03!`P`w!P0   ]-`4w0S SV(!ꘋce@cEce9B-0/0040/0H0/-L/0P0/T0S000/p@-T@ $00$0$@@T@U2wpv꼜e@-@v0M@!w꼜e@-@,v 0 0 00Mw輜eQ3O-M  @ (R0嘝@PBU1# (pU< ` P``0 p@P 0卞@P( 0兞@P  ,@P@  y@`0V =0U 7ߍ0`,PC-$M@`100 00(00@ 0 ( 0P1 0  !000p p1-p 0#.pP  # >6$ЍT   &8p +8@p@-P@`M$ ? !|`2+Ѝpp@-@P`M< .!! +@s-Ѝp@-DMp `P@P 0P,@@00P&4>@P DЍ -@C-p`M!*PP*0@S+   0P0`'0(PK0  000`0&0(PK0S@! @*P-ЍyKxA-PpZ@Pzdu` 0/S f4@P0 z!Ѝ0 du@ 0/S 4@-`PRdvp 0/S >4@P 000dv@ 0/S 3G ЍC-1@3p MaYP9+ 0<@P,@P'L10S 8 B≮0<00@00000&D@P (0S" ,<.,,(0P(@Ѝ'  YP @P0P0$0,( <0P0T0< P0+@P(,@cXYefB@-DMpP @P`P0i @DЍ ,  @0 0%4I@Pp0!0S RW# S+R@ , _+@F:R@, *@,+WE@+G-M⨀`P pO@P I@P0@0L%@@P($pY +H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0#%L|@P}0d``PSx08x0V +0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `@P<U `PU 0R'S)XD X 0S#YH 0RD@P 0 8 n*0@X03/% {yЍS@@UV 7+5+0X03/ *}U y8 * tr@@@8 @-P !M`#q x@P 0,00@0000z$4#@P 0@T ,*T @> @Ѝ"@0@0$0 0 00+8+D 00, @0*@P  @c A-pMpP`@PE?`00\@4@80/$4d@T pЍHP0S@00000 00!0$0100! `(0 `3*@P !(@P 0`F0`@-Mq` P@P 0,00000@0#4@P 0S , *0P@Ѝ@0@0$0, 00:#:D0@0z'@Pu@-0I@ r꼜eO-5LM@P $ p`tAP P p$P$P hY [ LЍA8, $00x0PYPSPUP |PUPoU00&8pP|P|P0E S p!#P# *4| p MP5 0S U0 (qP TT4Q (4<(Pf0((0P 00 ((o(P pP pG |0S 5$` @ 0000$P0 GP0!r0 M85 0|0j 0M( QrQ[x0S | |[Bq0S H5r $0  @002 00   0S 00 0l$P^ PY0q M8M( 0& 00001 0! 0 000 |0PW  2p [* 00M(  A +%R0q[0dV 0 pP V-040w    R Vj 0 SPb tVf-00|00 0$PO-괴@@1 Bew]fBgB@- 0 0 0000 zЍA-`PMp@P0@00<@@0"Dw@T PЍ(P(0 @@0P 0#@P  0 0@ p@T(Pp0S wG q꼜es@-`@PЍp0pP @00!.0@P000q@-P@pM0 0 `P Q! T@,0 /!bR 0tQPU @00 Y@ЍQAEc*gBL:@-@-T3\M`  @P04#P0 S0, `@P,  $\Ѝ Pu @P ?@$ Pd @P$ ( PW @P  @P(  p@P( @P  @P@ `(@P@ @ ؖ@Pp@ `̖@P @P@ 0000p@ `峖@Pv @Pp  `@ ⡖@Pd @px+`ᑖ@P pP @Z@D괴@@@-@M vP ЍG-@!MS$ ` p! WP0O80-PP%W$! (P?@0Sp 0l<P0@0 P ᶖU Ѝ yP@ Ȑ  P00/S S 80SP +4@+  e*`B@-PX0M`p @P 0 0 0{@ Ѝ贴@p@-@`L 0P@P @p @-PM p`-@P  04 00#0G@v-Ѝ@cp@-@`L 0P@P 巖@~p O-1MP`@0Dn`@ pu0 0P[0$0P 00 00P*U!@UT@H0@0 UT*0 0 0P@0 3/0P` P P@@0 3/0P 0K0Ѝ *`B@-0 000Ѝ 4 G-p`.-@P.0  0S@ !5#PPY %$@@60S&   P  PP @,Ѝ 7@ T  j@ JTG-0Pq$@, @`P  PPP>o{/ $ G}{@c0@-Mp 00000` 0\ @P,@P0`Pu0S@@!"@ %T?,Ѝp@-@MP `y@PU?000,@@0|4@T 2@Ѝp00,0S@@!w"@P$$0s@- Q@P $P@`n(00忔Ѝp0 0p@-M 00000P 0`@P0 @PBЍpO-5,MpT @P= a$$H-@P 0 00000 0P  000 0@P$0  -,Ѝ R  -$0  6/@P$00P@Pj$$  ,@ C-p0MR`P0'=kP 0 3/@GkNT T+ du40000 000@S [+"@ @P0/S +@P0  QЍc@-p0@ @`WPP @ (0 T@7 Ѝ@c@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR000BS` E00S03P R30Ѝpl! ! C- pሐ(P@``V`31P01 0@PP  ЍS0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@ `גPP00S!3 T` TS @P0p@-`M 0000 0Pp@P@PT0P00L@$@(0T$@T j`Ѝp8`ep@fT  ≒@P`0 0S030喓@P 0S@3:匓@O-P0!M0#q` 0000 0@PcUPd  b+@PX  a@PF@T0SG  Y@P   @P  P+P 0S-@+" f 0$  W @P  04k0X  X mk 0 P@P" 0  +Ѝ-@@@c@- x Ѝ@-M pP 0`@P @P`@ TP@Ѝ@-M@ 0P ˒ЍA-M P` 0pa@P @Pp@T 00 00@\Ѝs@-P@P_ 0`00@P 划@ OЍp C-P0M 0000p0 `@P  X@PepP0 @Ѝ @ @0 -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<T!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,<)!,,P0< (@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0,@P+X@P$0`800 @4`0 <G@P 0$S@0S 0R@4  @$!$]?YHЍp@4 $ 0PN P4괴@@@-; 000c0 Ѝ@- 0;0 00Ѝ0 c! 0c000@-DM #@P$P0@,P000084@P 0S00,_ 0P  P @DЍ0  ,!@P ,F  0c H0E0 c@@-0S@`@P'0P @ 0,Q@ 0P000 1/@'ЍpC-pM`'PP 0' @Ѝ 0,Q !!1/@P RQ@@c'00@-MA0 0@QЍ0C-pM`u'PP 0H' @Ѝ 0,Q !!1/@P R@@+'00@-MA0 0@oRЍ0C-SDM@`p.  E_U_`@@P#00P,@@0W|Q4 PBMCN 4P@T WjDЍV@ `c 5@P *@0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P4@P @ЍpPi@ @-0 c Ѝ0@-MPP @@0cP ڏЍ00@-MPP @0cP ɏЍ00@- 0MP00P0#@3P 嵏Ѝ0@00@- 00 c[ Ѝ@- 00S Ѝs@-P@0` 4@P v@G Ѝp贴@@-P`r&@P 0 pa@& Ѝs@-P@0` @P K@ Ѝp輴@s@-P0` D0D0 0@P C@ Ѝp輴@@0@-0 c Ѝs@-P`%&@P0 &@%Ѝp@- 00 Ѝs@-P@0` @P  @ Ѝp輴@@-P$0` L0L0 0u@P@0 *@ Ѝp輴@@0@-000 c Ѝ@-PH0` }@P00 0@ Ѝp贴@@-P` %@P @0@d%Ѝp@-00 00 Ѝ@-P` %@P 0 00@F%Ѝp@-PD0` 4@P@0 @ [ Ѝp輴@@-PH0` @P00 0@ D Ѝp輴@G-M0`@S11\p @T0s_޷ 0s0Sp 0PPp?X !(YPP 0 SP? P0UPP([0 s` 0 s pUZ0!(00<PW  0S  PP Ѝ 0s{P0PP괴@@p@-PM`$@P @0 @0c0 f@z$Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S (⌌P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` _$@P @0  00@$Ѝp0@-0  Ѝp@- 0MS@$P0` @Px 0S@ >@P!=@Pb #!T@ Ѝp贴@p@-P@#0P @ 0<Q-@ 1/@#pp@-PM#@P0L` 0 0 +@v#ЍpG-PM#@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  @7\#Ѝ@p@-PM#@P0L`i 0 0 @8#Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp>#@P 0 @ 0 @@P0 0@0@0S 0 姝00"ЍXYe@-,0@31!$ @cp@-P`Mt  /@T0@&0S00P0/@PЍp07@-<P @P@ Ѝ0贴@O- ` 0M&J0 S1 0C 0 p "@P 0  @ PT 0S@  0 c@9^"@Ѝ@G- `@ 0p%J0!S B   "@P 0  @ PP_ 0S@  0A@  ."Ѝ@@-@(c$0S( ( (0$ @cWd@-@, 0xc,0$ @R$$ ((0cWdĜe0S ( #P QS//@cp@-@pVc 0S0\P 0 $#0Sp Q R$0WdĜeȜeԜe0@-@ 0 #@jcĜeWd00CS0/@-@P $ 600C0@ Ĝe0M, 0S*00Ѝ/Ĝep@-Pp0 0AT 0S P 0SP@p0S00   @ĜeA-p䀟3AT b`Pc0S @000cPU PPhbX0 $3`U3@103 P000 @@cWdĜeL031S  R R0SQ 0/@cA-`@P 0S00po"P P 00 ""V DfbP 0$0 bWdȜe@-0@M@ Cb ?b|"0l 0 ` `0 X 00  , $0 ЍWdĜeDgBKgB4d:pd:EcRgB1S/p@-P`tbAT`Pb\@Q p0S `` ```@` $)WdĜeA-p` P0@PP0PpPP$a 0 0! AbWdĜep@-P@`a0P 0 1S 01  0S 0 0000p@aWdĜe - * 'G-PP0S0C04q0S ʖ!0SB !a00Ga`a3}?@T aV @ $` R   R  R R R @ 0S  B 00 0003``}?00Gr!ĜeWdԜe@c@-P0S003@oѠ@c@-P003@o@cG-`P@# PpW@ Ѐ$a ` @TW% V@ @00@P Wtv`Ga0U 0S  3R  P $@030ĜeWd@cԜeȜe@-J0@-D@aWdp@-00S-@ `P3@P V\ UaP#@`@P (`p@@ @leWdA-@t`p`0@00L`]Pp `D0S0P0P0_WdA-@`p`P|`+@TWHT0S0 R @S    %WdG-0 PP;0`0S5P $10S00@S00 : 0S' [ =` 0S00u`pW`0;00S0C0 0S A p#`0h0X\`LP001 0 3/`Pp0% leWdԜeȜe7@-PzP00@1S  DP?T Ѝ0@-@- \RA-@`PPpYpVP,DH035@A=ze0P R05/p@-0@S`L X_0SP P Q  - `Y0SPE 00@0@@U04 @ V @ 08OU@P@ 0R08<C0S  B2@ S * p00Sd% 3 @0T"#!Ip@,_0@(00PpVXdXdeEcEcMbYgB@-@_!00CS4` Q9"6@0@ ljep@-@@P0SSpP@-@ P BT@DpP P p@-0 l@-- _0p P5T@Pf0P00 00""00,pe@bBXdp@-PX0t p0ATp 0R 0RP @eG- P@ᡸ U `ἀD`t00@0$V0:Pp^p01St^0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P0p`gBggBeXd0P/- R  0 RP <04Q0 4R/00C-@2 TMc刀pn0S @400^QH^H0   . b?SH0<9H0y^喅 00@SPP0S &^ P^^c0 000P T BP 80S ;40789/0 00CSk3+5`P !0SP `0S h`]0t p 1S01  0S00^0U ~]t0 0000]0HP00y]TЍ@cXdX@xgBepeleP0M0Ѝ/O-@`P㨃娓娣Mp 0R0S P001 U ۄV ]u]nPP ]B`P00 ! P⪌ [P X0S "d0S&U 媄V ]D]`P00P1S  EP⁌UQU \0RS~ЍL 3S00SV 1P X]]V P FV `P0 0 0oH0 0 U 呄P0]\PYH0   . b?H0p\40 00\ p@lepeXd/p@-M 1 Q 0<0G\@0@00@00@00@0@ @@@0  ` l*\ x0t0xdpT88➲ <D0D右 <0<Ѝp@舳ЋcleXdgBEce`gBEc4w:gB:gBЃ:p@-p0P l-@0 @00P\P20P0pe@p@-``P!\@H[D00@ R000@00p@<XdXd@-@\20@ le@-@-R 00- [@[XdA-`[P@PPCЍA[p㈀Pp@PW 000S$% 3  0"#!KXdEcMbgB@o/7@-@Tg[00zPP$ Ѝ0@[0SXdp@-PP ڼC@PpD[ p@@p@-@4PPp5[ p@p@-@(PPp)[ p@Pk\0S\/@- yP@PXd@-@[@I[@-\0 S00 00CS\0[P@2n@gBXd@-@Z@)[p@-@Z`V  9P  [p [8PZUb &p@-@HuZyQ  J @ C-@MoPZ_0SZbЍ`0FSPZ0@؀Z p 0S/P 0DP 7@-PP00@T  !P⭉T Ѝ0@@-@\00\0\0 0CR\0 SPZ}ZO-p`M4PG@PTo0S`@0S*dЍxP ZP pP0S IZy@xCZ눀JP Ѝ@0 t p0 P! A`ĀpX XdeG-M (8<p  `X @ PXXWp0ĠȐ t p!R !  R t  At `!R ! 0 R ЍGXde7@-@PSX0t p 1S01  0S00P00000{XP Dis Pl p0$XT000000[X  Ѝ0Xdelex@gBxgBe0S/T  BRT @- /@hꉶ@gB@-@P@oC-PWP"X Ѝ@Xx0S 0`W0Px00ptp`t0qW P UHX 01Ct010qEcXdeXdp@-P@`nX00p@kX00/0S S\/ //G-S `@H@ VBQA<`IQpQY/ `PnW,W`V `$GpQ`n` N@PT0W~0 (00 `$GQ蔶@ @-@P` p#0  Ѝ0S0S@-l0  C0 $ , 0 P *0W嚇SW/@cc H /p@-@0 0P0:0P0<4P`0@ P P  p@ ppOpppH0 /@-@}VH0  .?H0 L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVYS 0S [ YS 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000 I00UP48<40=  , L06   03 009pP * P RP[P2 PV UG@Z0@01[D00, 00@0P !y[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P RX  X 1S, 0P0[P0L P P@ 0&@ P -OY 1PZ- 1y 000 20 @cp@-PP@`e RX00CX0R oPGp O-,M\@`ကP`dpP>0 0%!X0ЍS`! =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡@-TV@Gߍ踴@@-PGM`p0 'y@P\0 @P 000 @-TV@Gߍ@@-PGM`p0 y@P @P0@] 000 @z -TV@GߍA-`0 Mp d@P'`00 0@PppU0PV0 `F000pP P@p!00m-TV@ Ѝ踴@A-`0 Mp ,@P'`00 0@PppU0PV0 `F000pP P@p!005-TV@ Ѝ@G-P MG @P)0 000 @PV0`W0 pG00 0xP P@!00 -TV@ Ѝp@-PBM`0 6x@PP0 @P 0  @-TV@Bߍp踴@p@-PBM`0 x@PP0 @P p0 @-TV@Bߍp@p@-PBM`0 w@P @P 0@N0 @n -TV@Bߍpp@-P`!0CS@V Pp0Pp00p@-@PK0 :"p@Kp@-@PK00PPKp0@-P0M 0 0P@P0 03/@Ѝ0@@-000 03/Ѝ@@-000 03/Ѝ@@-M0<00  3/@PЍ8@@-M@000  3/@PЍT@@-4000 03/@P~Ѝp@0@-0M00 03/@{TP PK<0 0R 0!IKЍ0茷@pe@-000 03/Ѝ䨷@@-000 $03/Ѝķ@@-000 (03/Ѝ@C-0M p08@P% 0"sr`@ P`J $ K0 ,03/VP T 0"Y0 3:UЍ`@@-M@0000  3/@PЍ@C-M P 0@P @ 0 `J $pJ@0403/ 0P Y` X0#3Ѝp`4@@-( "!0 803/ЍP@@-( "!0 <03/Ѝl@@- 000 @03/Ѝ䈸@@- 000 D03/Ѝ䤸@0@-P0M 0 0PT@P0 H03/@kЍ0@0@-P0M 0 0P<@P0 L03/@SЍ0ܸ@@- 0 00P03/Ѝ@0@-T0M0 0 P @P0T03/@.Ѝ0@-00$M0"!#!0 X03/$Ѝ0@0@-,M\!#!@0 00P @P0\03/@,Ѝ0L@0@-@0M  PP 000`03/@PU 0IT 0 ~ 0IЍ0h@@-@000 d03/@PЍ脹@0@-,M080\ 0<0 $0 0P @P0 h03/@,Ѝ0蠹@@-M@00l0  3/@PЍ輹@0@-@0M PP 0 p03/@PrU 0IT0 0SIЍ0ع@@-M 0400 t03/@PNЍ@-$M0(000,0 00 x03/$Ѝ@@-000 |03/Ѝ,@0@-P0M 0 0P@P0 03/@Ѝ0H@@- 0 0003/Ѝd@@-000 03/ Ѝ䀺@p@-x0M` 00P  00 @P 0 03/0@P Ѝp蜺@7@-00P00 03/@ Ѝ0踺@0@-,M!80\ 0<00@0P 00 @P003/@,Ѝ0Ժ@@- 0 0003/Ѝ@0@-L0M 00P x@P003/@Ѝ0 @@-000 03/ Ѝ(@@-000 03/ЍD@@- 000 03/Ѝ`@@-000 03/Ѝ|@-,M 00H0400800<00@0 0D0$00 03/,Ѝ䘻@-$M "!00 00 03/$Ѝ䴻@0@-X$M 0 0P @P0 03/@$Ѝ0л@@-M@000  3/@PЍ@0@-X$M 0 0P @P0 03/@$Ѝ0@@-000 03/Ѝ$@-$M0(000,0 00 03/$Ѝ@@-$M0(000,0 00 03/$Ѝ\@@- 0 0003/Ѝx@@-(000  3/Ѝ䔼@@- 000 03/Ѝ䰼@@-+jBp@-P@`P00@000000 0(0P0Pp耞e 0 //00// //0/@-@-@-@P 0P hP @-@0$ @ 忧@-jB@-08n$0@@-0/n/// / 1R *1 4SHP// 0 //0S  0S 0@-@@0S  00S  /0D 0C S 0 0( /, 0 0@7@-@00P}F000U  Ѝ0@跏 Ѝ0Fp@-0@ R R p PT `h 0pPCX0U 0S @cjBjB1 011M/ ⟉G-`@ PpY0S 000S00%0 `#][ `0 00CS00 00CS0@-0@0S((0 0 " kB kBAp@-Q@`pP 0S R0C BS0(0,1 @V p0( ,0Q0@@ Q0Ls 0@ 0 0@-0@0 C D@ҦO-TM `@(0|0 00pS0p0 @ "1/0@zS 0000 $0 00( [D00 X 0 SCT00T0CZ R x0 p000 $00X3p #H3PL0R0 70  0# "00#00000p( 0c,0y 07B, 0SB[CQ0 [3$0800H00<00$0 P9 0 00; 0S- \r \dXBXVʀ 0! $ 0    !03/ 0!d!0    ! TЍ8$00 @,3<0S ZHL 0rq R x $0B $0   pJZ  ([W  Z  R 00墢 000 G40庡040$ B, $04 L@W b4LBH PX@Q@0L <8@X#< M$0@c4edddO-$pM@0L0?o2D00@ 0Zp0500#40040 80S200#809$0H000  BBX 00SiЍD0S00<00(0`0 0` 0$000P00  01/0 0, 6 ?R 01/0 6?Q 000Si(0S `0S (0( 408 03/(s0000 0 00SZoQ00 0S 3/00SD ZC K 0000 00 0 0P E P D 10Cs0 S0 !p0R00S/o" @ 0Q0Es̻Pʻ@0Si0 S 00˟ 0#0S !ϠUN  P b B  , PP/P P/P 0>^0PSP 0PU,0%V Z1 S\0<30P0 A!⌹00(0S#0(0eAgAX 408  (0(\*40X803/P  0R \$0S40S  Ch"R 0$0S  0R \~ 0 V,0"&0:808 01<0D0 000<0000 0 0P $0Sf <`h<< l0& $0SU P<` 0P0 00S8 00l08 Poo 0bp @4\  0P$0S+ 00, PYV`` 0U`V <\ Ӹ00D0 0000000,090P $0S g0`@00@PS 000 $0 P0<731|0L0S  /0PX0 @00`V,0P0U`PY0 `<@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 cI P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ  L0S4 00S @XT0X00S 40S 0| d0  d / ,01/Pf@0SCg$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C ᦷ40St 3^P0x >0 PS 0%VZ}f0H 40U f0T0tPx`F)0 0, RS00V00S000  00 E4 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 0&00X 0##@0 080UDWY 0@ ^ 0  P0SYfPaTk 0D0 0p0 P  0<!?$0SL4 L00 eX &fw$0S0`0~ W1kB@c1O-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,0I0`S P00 0 >H0  d0SM>W ,0S 408 03/ePEߍW5@12 0 SpPP) ee`눀X `,0 0Xe 0p,08P @1 40/0\3/PP 0 0$0( 0` @1]V` @1 0S 00<0 ɷ0@`D800 0 0 PP "$R( 0XP ⹷ >X H0  0S0000 0S 3/H0  ᣰP d0SFeL0+ gH` >i&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0~P (`,e-~[d 0`! 0  D1 SD1P P0  S 00(`,S XjBjt$哴(0 T0,0X05040 X `X 80` 0S4`080܊8`᪷P @ xw 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000d[ `x0 A !Vd` B[x0x0   -> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`000}d `0 0`0`0 \0`0S"X# d (`,0C6`ï5d0` x0P 05/PzcU 0xP`0dx0X ᥯@0PD0  $0P(0 R \0S  R  ڳ `40S    <0 0 Sw ӳ 0 S\ 101T0S@` T0S uc@c4e1kBVkB3e@-0 000! Ѝ 0  /A-@0MPb ,0F00 00vЍ1A-@0MPb ۶,0F00 00]Ѝ1O-$@ @` pLM 00 0 00 0 0 0AOoBBLЍ06 ?\0Xc@@Rc|13100 000 ` 0`pr>c 凶0S@bQ(T Ҵ1 0@  @& (  6, ?(#<@$86 0(@P8 R  óT 0@ 0 0ᣵӲ`@cG-@0(MP3 聓0b/Fa@Ѝ @ 0p;T0 0T0; 30000 0$@ b62< RW1Q00Wrp @0_(Ѝ@cO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+pa0 @20>00 0  .p0 P(0 S00 ,40xP1~pp p,00 00pG<010801 1!&.WK8|1 0(0` 000 :#: 000 80  ,IXE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H <k 04 HKp>1kB@cDc3e:p@-@P0:0 p@f:G-P`$0@p3/@PZ@00@800 4/@P 40T00S vmVx P P$03/@P P 0Sf P @0S|00S@0SP 00L0D 8/PP H0U00S @9@ 0W4 V4 P 0S t P 0P l 0S0S PP 0S P P ^<0 P0Ѝ0P PPSSA-`Pp@ T 7W 1AO-P @`TU  T 0 0 06/@  ЍG-销@0H?oP20p`PS V TXTYGO-DM,00000l h 0 @P QPሠ$0 3/@PF`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Ux X880 R R<`VS <`0S0S VV8=<P @84DЍ8pW0S@; x0S@7 U l0 0Rl0 \@P*   03/@P0 @t 4/ 0tPp@P 000,0p 0@ 0 t4/@L00SF0 80S @@400 @ 0 t4/@P40S,80 0,0B 0<0 0p0@000l0P0 0 #P`@p 8p40<`S0 `p@4P Tt o<0 0p0 000l0@080 0,000V9`@ 0  4/@P`t0 @ 4/ 0Ptp'+0@t!@P000p00l0` 0,0 0@ 0t4/@Po00 00g 0R S@`@ 0 t4/PB@VS@RA-P `@0pH0S 0@W 09T0S A0.0@-P @ \ 00 0O-pM0<0P0H00P0 8`@DL 0{@P& W0V04 P0Y04  0 ЍO  ^P0S UP @Ѝ /A-@` Pp?P W $0 Al<@- 00 00! 0!""##$$ ሾ@-7Z7Qp@-@ Q  88PPpp@p]kB4@Qp@-@ @Q \0@$0@0$0ppP6$@,7Tp\0$00$0$@Qp@-@ @Q  ppP6 0"7 0"p@-Q@pP @Q @p6d 0$ 0S (0, 0@@6d 0$ 0S (00, @@p 0S/S 0 / E/0S//0S-/@-jrkB//@- G-`@0S 00s  r Pl 0 r 0 pW S S W  P UȀ- //@-0  @-   ]  ^o    ]$]/@- t]@- 0   ]  ]o    ]]@- R]@-@M]P]P/@-0<]p@-@P\@p\  ? Ra0 ? /0S S S00 /$0@-h0p0P@d@x@\\<]\]A-`p@ PqP @A=: <900   P1 @0<3@0<O-@`Mw0;*}.0Сd 0ɡP"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H"n@ ` 0Pd2 S n2@`{? W!2@T`0!M!:#@T`0!A!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @0< ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@ Q<0S00$00V (`嘀?`aV $'0#$+4=P W8P< * %!  (R$0 ᔠ V (00100 @ D@-0@00$00kPp@-@P`R/㠠PP`n SPp@-@ k(0!( :@ @-0@0!80@W(A-P?@ `!tpRO( W\00\0  WX00X0%0S`00S 3/050u(A-@`PP p+(⚸៦c(p@-0@pP(喦@T(Tp@-0PS@p 0x 0000ᒷ\`'0 $A&i1(0@ Ѝ@@MAA0/G-P`t@'U 1P0GL0SG (0S0p SڬP嬐U:PP -'03/' Z#Z P &00C0Z $00''@cp@-@PPpp@p@-@P'00P 00$00Tp@'O-M00pQ  (@`TB  0 G : 0@ 3㙱t 0U0Ѝ0 @00D0 0(( 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  sp`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/ⱝE/p20S%0 700y`P1 TT *600 0!00 0`070%f 0R88@9S}E/᭱@F%P` `y%0$0> 0S`: 0H`P3`)%@T ƣ00^%T{ ᪣xT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp -!%6000!0 0.pP Pt` l~(0S00 3/w0%  (ЍG0 (p(P  Wpt UPT<$',P * 8SЍR 0030#  P0l 0$0 "ǃ Q0* 0 (a lBBlBlB mBO-@ᄠ?t`pP Q4q$0SU`V` $ Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU/A-@P'Kk{KG-`p-@0P M`PO00kC)$01>$a1墯幯0  z 0 tl֪  0 t# x00Cx00S  . t$^&T4J 0!400K#J@<@OmBeA-@|`8 Pƛ X0 0 1@01?::0 5:1<,Q@p`ӭ`  0pWp0G­0A A-P@᠀e0 (P_`tpj#lnJdPJ#O rZ##ᄳj00Ae 増LcG-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC &PTP1#p|8BO-M`8 UFn#@.P`**0؊$0F0 (0J PEa P Ӂ *k?  0PPP|H PXP*R0:P @؊FG R0 0S RP  Y P [Q耘Xx00x0|0S 0 0|@0\R PU d$jFs=8P4UY(KPP 2 0 0POFĂ0  0 R+Z>, F)t9F, R 0SS  !ᇫ }FZ ,Y (F PZ)8ἐ0(, 2P, P@嘁XFU x0P0Cx00S  . ) u$EfPP$  $E 0 4Q+Fx0 P0Cx00S  .  J$E䢥@`ت0 SX0000D句 txVPtBAmBA-@`@EPp吀0T*0QU P kᩩP0壩P ђ(EU A)@脞eA-0MP00p 00!t0  00 H|@T`x00Ѝ0SP* % ( x 8⑪000 w*, w}Y (Y`͓V 00 0@G-Pp E@᠐0U:[ET ᵓ0aV X P T ֤Ӥ 0P<@ꄞenBG-@pPD@ T:t'E@aV X 0P,E@T@@iꄞep@-PD@DP0Sp@0D0Q 0S @ꄞe6nBA-@PD DP PP i D`PPpU:ADQ  R 00 00 0P S $6ꄞeLc@nBcnBBBeenB<1L0S/0@-@(QM BD P   უ P P {DЍ0  P R }PU 03/P L P (PLcenBnBoBeEoBloBO-M 0PΩhpl`V7 `l`@`p0 0T*  |60008000<0@@$0 00(,800<0 Z {@ Vl00Cl0  Ѝ  01@O-@p04PC܀0U:CT F Ѝ0aV! R k ᨧP 0WSHZY T WT  gP@ὐꄞeoBp@-@lPd`0$4SS @pDD$@᧐P XP 0@@<@Lc 0`( "4`#/O-M 90000 02PPs00  4+40#400$4"4 8#x#<00p4 8 40 80 < 0 0`$4"40#4 0 0$4"4 0#4 0 04 8 4 0 8 00 $4"48#8=S1=#*408#8 S&:3[ W0!<30C(r* 00r!0CR0C Z V <lP0@[' 1|ЍA 0P4 8 c 40 8 00 $4"40#4 00$4"40#400000$PP 4!404"4074 1 P.PT+TX(X\%\`"`ddhhllppt1tQ00 0sP |0sPIPh1 QP唧!4"4!14"4!14"41 $0$Q 0RP ()0 t t  8  t(PP0\8  p@P 0 400P7ERoBPMoB pB@|8BpBXpBO-X`@fuM} X0`p#00 0?PP)0P Xo0P P  R R0vX8F&  ,T 00S ~P{uߍPX X o ,4L HZpdPFS {3 0尤PEW}pX P NΠ0 n :1 .sPP  @0#u P 0`☲c P X ځ& 0⑁& X⍁  L0 0ݬP070㚳#, s s $(0, 0 0S 1!3S$ ?6.~`0S S*Q #?0000.V A00 Z00 Xs P 6X P.  Q#?0000Q 00 s Xs PpX0 oR 000X00 0@dPb @pBpBpBpB"qBVqB@ApBwqBqBT0Tp@- 60@@P P0S@@DpȷcA-@Pf/pᓑ<(00`S3 #01 1@ ##:!#0<,8  q00 q0 H0<0 0008|0X``00``l8 `(0 0<0`0,0$0@000(040,0A訫ȷculBWEVG-1( @"6 0PP 0S00Gy꤀ $0 BR0 08 pRvW00 BR`!`1Pn0W  W'*e00C0*ȷcA-` P &0)`5@P@ |p UT00T0  UP00P0%0SX0 @D塟P-@PlȷceG-`<1 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 pMP$ pO-p@ 6 0o RQc 0Q0000C000 Sc0 0`S 0n`S MPP HZ%ZeX!4!  0 ^1`!b   1_b 0`S:#::cSP!P10S  9gP  ɛ0S00 Ѝ0S 0S00 ,0 Q #@YdYdp>p@-l` dW0 i@H0P*0_,Pa  0@ipDcYdp>Yd0 60S#3//0 R@#0 Q /RJ0h0//@0( #&0  R /E/00S-/კG-`0 00000P@P< 0 @@@@p 㤹P@TT ,ᨃᖹY ЍG T1# @PW01H VP0 CP @Ѝ@ce4!  \ / (: %rBe$0 0!0 00 /@cddd0S  0 00/p@-|0pPd3@1`00x0/(0, 6Q 0/(0, S @@Vp@c@-@]0 00R 0(0,000@p@-P`@P @ `T`C0S $0CS@ R(08 8@@pp@ep@-PU @`00p`h0#P]pp\@p@-@pPPp@Mp@-@P`0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $UᎸp0@ep@-40@SP 4G3\0,0S S 00 008@Tp`0 6/@@ep@-@P` Ἄ^ 0P6 #::0t $00000@0`0_b: 0pp@A-Pp@n3A`1`00 ec0S60S50S 0S E`LP Q 50S0 xPv050@c@e;@-@BD0S (P0$ 0 ]<0400 ,00 0000a0(P 0$ ]<0400 ,0X0 0P000a0(P 0$ ]DЍ1rBc\;5rB;^B;@rBO-QdM@0 | PdЍdЍO\Q0 00000`0 gPPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@ [ RH  H *l X  ::P `J@ GrpT @DP@eO-造Mx@P` pI0` ጞ00l ,1 0(10$10 1H00XX 1?o2P0SЍ@eP;C-M 0P`` @\|p0 P 00 00 0 0@X?o2P0S  BP Ѝcp@-@P@T $@DT\TpPP 0S(@0 ,0 0oIP@e@erB;FrBA-0pP@TU,`T`1 @DP0rBD0S/0@-0 H_ ЍA-@dp`P0S$0C(@@e R (0S $0CS `PA@erBp@-@P T-p\P U-@<0@ @8$ ~ p@e1rB Ydce@-<0DT 0 !0  !@c0@- ! 0 !A-@`XpPU 00`0S 0U0  03/0?ep@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#212@T  0"0#!"4Ѝ00 030 b`P0S @D R 2x# P1  PT  C\0 : :0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ :07s>?00A0Q01 0儕P00 R h: :  P( U 0S40S ₜ81  00000C0( @D0P0*3>(  2 f80S 40S 0 @PU 0 e@PP220:00lp\ 7/U P @p03/@c Yd@@eZeXeA-P4,a @T @DT@T $@DTA0S 0S@0S&$v008P0(00S MpP ZG<B080=00=(@@e YdO-@$Mpi,00@T P8b8@DT$ЍL <0RVSM (⣤d0 0 0 o H0P: U`000PPPEH0 0 0 SW  0R H/ ( 0 S$ 0SZ,b#0 0 0 .P0 0 @T @DS00 6P5Hoᨂ0 pQLa :/0X0 @eMbA-@p `PBM 2SJ@ @(@0 0@S  ن02 100 0 0P`5Bߍ輫;@-0  Q:0 0(0 0QS Q   Ѝ$>;00@-AM@0 0 0 0P00! ! 0@ך CW >0W >C 0CW H4ЍOa$8$(0 S008(0 Sx007W 0Wny 0S 00`7W:> W^i 0S  Ę`l7W  ;CW0CW5C 7C0C87WA H4ЍO6W` 97W >C0CW/`䖟 W 6W'`VfX! 0 W0@P0X# ! &0`W`ppyP$VP N V L,6W! 17W 6W 000 RV 5pW $pGW`5W 00  0S0Sx%0 R01 5:S 000  ` XX  z `2P rP `~00m D f 0S 4 R6`P0400 R0S 0 S `00  0L  f3`k 0 T(00pW $pG`Ps` ^ 0S R0P  WS R (PU $PEU`4pr000IW  P040 2 0 B R`+0 E0 0A0CS…Q%X1 D`P,0(S(0SîP 彮P`` 嶮7`* 0S S  000(pY1X*,1`=|@?P 01 13| P 0S 0 00( , 0 !(00,00z060w000s8000S080l<00S<0e0@0b@0 0D0@cwt@HpB@~B f@pBEcEczB@e YdoB@|B@oB@(@D@fB@{B@}f|fvtgBBfBwBcrB@B/P/@- і0`( "4`# Ѝ0M0000# Ѝ//Q02 //00@-0^PN^000@A\" \ @@T00 ^< ^  800000 00 000\ @-L\ 0 AS/P 0000S000/AP/G-Q@1 P`@A0pS S0P@S S S @S S 0SYS 0SQ@@-@A-000pP `PnpЍ@ T#E00 p rBA-0pS@` 0S0SA0d JT[0@D0 pPU#A00 5p rBA$0 0!0 00 /@cddd03!"/@c03" /@c0M0P@Ѝ/0M0P@Ѝ/ B PP ////////0 00  / /H@o/@- @~< 0C-`Mp<ߏ 0@^ DP 0@ P0BS@SV00PЍ R 0PU0S  kXPⓑ0PP X DR RW0S0 B ^Q##rBdce p@-@3X02@W#?$0PUp(0S 3/XPc@-U4p@-@PPp0S00P00C0D4@-@(ҩp@-Ph@1 01  hp@"C-M 0`p` @ZP 0Q 00  00P 0@ 0 LoP@@T0SЍ060g G-p 0P`M !` @!P0 X-0 000000@PL?o2P0SЍ;@-@0(U@_@-@0@t0/0(P/0S -  0/e@-<0DT 0 !r0  !@c//0@- !a 0 !p@-P@p@p@-A`J50S 6PU 4 R040`0,p@w2S 0C8C8_o2RU0BgYdEcA-P `G6}<0@TA00S p3/qX@cp@-@P`03/,`D 0S 08 000 0S0(Dgp@%rBEcG-@d@ 81@P"10U T`@1@U_@00S00 000 @GISUppQWtD =$pW 80S  3/XppW 80S  3/XpYdcA-@P(p`*R'7P20 0 0 Uhy004 0  004  @0D 0 @0D h|3 000SP0PP0P0A-P`pK@T  R    B QTp03/@-K 宵0 4;BDc$ 0,p(`80MPP0 00!10 ,p(`$ 80< MP@ <0< $  00,p(`MPg1000<0 ,p(`$  rM0PU     '. ,p(`$0 @ 0< ^MPD @P1S ~?S?11~oS1O@oaP<;sBsBc4;TsB;@YdeL;eBsBoAGsBNsBsBd;sBO-DM@c `d` P@: 0 l廭 |D1n00,($  p<0MP@ -DЍ 0!<0$   ,(@LP 0!0$ 0<0  ,(LP 0!P00H00,($ P 80< LP P;;sBsBsB<;NsB@-@P9 R @ 㑥;p@-@PT`٬ Q    /p@R   RP PP  ̬:0 <0x 8RR00R0S 0S/ 2:L;;A-`pS GPTP@ p ;90V`` B; ;p@-@Pcp0p@/A-M{``~Px@ppT{ЍAs %p.HP 2~q@eYd@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@h;p;t;;x;;;;;l 0@o/h;A-P`p D@0PUA&D/00S7/@P@-@400( R @@0000@(edc@-@00$S   00C0@e@-`pP@MPVP@ЍT@UP\0pWU  CY0S   (@PpPE`?@edc0L lYdO-0M0ĉ5p  2PP, 0 X`0@"40200  2 x$0(0`0`Ѝ;0Ⱅ@-@m0ⵕPm@m,/0p@- 0 `   H0D0R@U DPU ?D02DPSH H0 mR0p@肕PH0S D0SH0D0H0D`SH H0 mH`0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S MPP0000 Ѝ0p@-@`P5 0 503Upp@00 L Yd0S/ L YdA-M@`P<p0P00G륿DPP@<ЍAᶿ *.댿PD@-3M@03XQpyD`PPᕿuPS80PUЍ&V`D0S00P00C0t-,0S 3/XPcG-VM@V/ ZwpL75 }? 08c1le$3"02Q  ! R!J0S Q050? 2a,n a8ᮢ䁄刀 2S 6  夢0 2WRU DPEU RU& DU# 0ZHP $0 RS ź R H0 3/0,P0 8P7.&U$1PU" ⺿ JL~8&P QS01OVߍ40S 01Q 403/0SXP0S    H03/,Yd@YddcesB;c0L 噿YdA-~`p@pT l0S~n@DaPP 0 R D^$P@3 P 0S $Peh;p@-@`P@P B-pA-~`*PpU@ l0S~'P3 DP@ 0 0R DQ $Peh;p@-@`ӽP@P pG-pW0S !S* 1S l Q`~`P̐Ul0 S DP@~P 0SP 0 S:V ` ,  D.Pdch;ep@-@`sP@P ᏽp@-@PZP@p@-@`XP@P tp @-DqP00SDpA-@p`9P@P iTA-P`$V  l0Q R DEP@ 0S 0S #P Q #P   0S*p0   D"h;A-@p`P@P P/@-(0pMPL0`  @P %(0, SS  3/Ѝ;Q/p@-P@0} QQ* 0SCA\T' S("0S!0S  S 噸!R01h0lS8Q Q p@8C80## IBsBaAsBYdA-`pP40@TA80S 3/X@cA-pP@HHW`40 p0H0(0DbP@AX#P D\DOP 0 0R DLL0S e$e@-@@P@-@ @G|0/0/0/0S/  Yd0 R0/dc@-Pl 0Rh;C-0` M `00Q@S 0`8`0}? >aCaakq s#aab ⅼVb'T!0 ߷ 40!` 0$10V!0 $0 p䐟00S0 SW qpP0Q:0PSdp`W !͇y`2$AЍ0dcYdsB@YdesB@-@l@0A- P @0L ^U 0S 4~`pY@hpT O 0S0@A8l0S SP ~G@eh;p@-@`P"@P 0 ܻ'pYd@-Q@MP@`pPP@ \ V  @Ѝ0<S %0! }>@0A- P` @0L ^U 0S ~p@ကT l0S PX0 ⃻κ 0S0@A~@eh;YdO-p0M#08PQX 6^0Q@t XhP  03/@NTdhP   03/@NTTGP  03/0S  P⾆ `⹆PPPtGP  0# 3/0@gS8'SSX `V@` PLr?$~@IpЦW >8@X0`C`Ѝ< <0, PR_0SCD %P `rX` Vڐ P!@P0`FD@ P ߹@ <ɺ~pX` ` :Vڐ P!@P`F@D?@< 妺3@73@D3P3k%Sl $ Rt (`Pf@W (0 00000 0\Y@ (T P0S$@P4 <P <p@0$3/@@P 0S-@ <PP@ X3|`|0<M03/@P I|`@ i@"0<#S 80#S %'B BS #S #S#W6 0 0 0` 0@P* (V"S  S"S "S's |"Sx"p"S l$'a S `M BS[ BS30 P@0S-@ 8P[ p @0  4/@ >NT0 0 (@04/@#00#  AprQ#0T00S @q P/  03/@[   0{ S#B%B}e Sb O!"'S s[ SX *.l1@1@&i@c@c@cczixieYdxi ex;iiiii{iFi@ui niiiccIii7iiiG-PpL~`q@|T l0 S 50S0 0P80 S~Z@eh;Yd0  Yd0 eYdA-p`P'@P 00S0L ڴ e#PP o#@  ɴsB'tB0 y;; b;p@-P@j40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@- 4@QPM `=1h0Q o0CQ 0Q 3QK `Ѝ3Q 3Q 1}0Q0 00P0 0u`P0@S?` SRp @S? pk`P @J3Q 0CQ 0Q 0CQ00l2Q 0Q XH`0!  Q SS  @#!@  ! ! !1 ! ! ! ! ! ! !! !! !!,!1<13" 4`t3 1 `1 3 1#>0880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @㛚qP 0?S@ Ѝ@S``iui vi iiiG-h Qp`PM L1Q-@UV44塴랧0 00 00{@P ލ@26T @.P  0R M늶DPP1@ ᥶ 0Q D5E@P W14  41i i@ctBC-qM@`P)  03/PNU# 0S  ⯂ ૂPp@0S   Xn  0SЍ/PpP ዂ @cx0/p@-`Q@P R 0 0 0 5$7p000SP0PP00p*R 7P$0 0 0 -U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  mR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PwPp0@-@0M0S0R@P  UЍ0ϖoztBp@-Ph@a1 01  hp@j@-p0$M03`A0AS P R R R1  %/@ S#MRY R ⇁@ ₁000 S( )04 0 #RH L0S0P  4# 0 001   01^000000000 0 00000 006@P #T@$Ѝ3  6&0P0C@0@ 001 0 S"0 < 04"48#80CS=10 001   \110000000081000 00@P @j0  0H   C Rw0C0000P( 0 (00(00   Ѐ0T0 0 ŀ0 @P| Qx 5@u2@7@@33@-3A0@S AS S :<2@S 3/4P@-O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20弗`H2Y H9岗YRpUH*p0 0pW0\70PPY0吗0 00 , (pP0@cp@-P`@Tp fP `P @A-0PXMP- 00 0XЍA/`@p 1#`1014"410 0CH00UL 800(080@`, 0 0 0 03/XЍep@-@M`Pzh000 00zP 0 <o|PЍp0 e|@otBtBtB\00@-:PL@0 R 00 C0.APAAꫪ>@ e0@-PQ@M 0 040060000 $0T l00p0 200P000 %U 0 000#0PR,R02p0HLR0d00 P(05/H 0  DЍ0耖tBD<4<#<@euBp@-@0|0DDx0003/HRUHHHRQp0S  0 j20C24e40SD/Q/D 00S/   ! """ @00@-0PS0 O T  RQ7@-\70L QALQ 0,aL\(00L S A@LT 0aL\  0C70C020 ^0S?.S,S :S/ 0C70C@-@ 0R R% RB ~0 ~ R ~   ^           R R  R  R P^~ D3          /$@*@0@uB@-`P㙕@H  `P/`%0, 0) "  P 00 0 &~ "~0 024`S 0 0B0@202HT dЍp`@-@HP  a`P/` "@P 00CS 004`S  0 2H0C28Ѝp`H</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Spq4Pp3" p@81Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S603P p4Ppp@.PpL2!4<01p0 " $"S $2p@p@E8"Rp0S 0 0 8匃Pvpi1iii2i(#iX8i(i6@ 2 @-$2@0$20 P$20$2/(2S /@-$2@ 0$2 P$20$2G-@NpP(ᰀH(20(2p02P0H02(Z p@2S,`Ypw`V v Hl(20C(2,2S0S,2?02HW [ p 3/`P  0S0S0 0"p@-@Hj;,2&jPU R,U 0S,2?02(20C(2HfU @2S 3/(2SaT͓p 0S0S0 0"PpA-@` Pp0H   CR0C0000T7@@#RH L0S0P  @0(00(00S@P  z0  $' ! "$ &$ "$ (?Q0@ a060<@@-0S 0 P0 P Ѝ $"$# &  $ "$  $"$# & z20C-M 03` 0 SPdp0弐cS0 800004PY 0@DC5( 0 0Yv 0 00S:0 3  00ہP  Ձ0P<<00  0:0(Ph(0, O0@,@(0h# I/oP"0#2 D)D NPP p0D#DH# $H)3  0 0P0 8 PPU p0D#DH$H ꑶpzq Ÿ Io     3:#:SC1T Th & 1T (0Sf0 $00C S.0 S  Z 0:0d1T?T  PP  z ? 1T,  T 0T0@  '0T00S 0@0000@000 0 R r  Pv3Ѝo ieG@d 5Zd݆%cĿcc1O-0QDM@00`p(00 0<0a0,$@ @@ @<@8000< 0a0 ,($@ @ @8 0$0\00T0000'>a0,0( P @< 8DЍ8@e!uB!0 3/0P! X \ W P#2!12$0 S 010 9/PbW  P05 0Zw 06 06&PVQ Q 0X0 PV\0?=W   0S Pƪp u0010`V`ݪV  0 ),`FV 0 S 0T 00`,@c@0uB8e(e(d@-@<0@0 0(0 00@@Ѝ8ePuBQ/ 00$&/e@-@0Q   R@ x Q#S #` ( P0\ 4PS 0S S /iϖoiXPH<L00S @-@3@03,0003//eep@-P`} @~0 $030|0|0l0030U600`0@1080H0 0P(05/3@03dp蘁pHo\࠳ࠣSp^ 0$0\@X`6pP@X@\`w60T`!C`@0@0o(0@,0((£@`x0e@Ec@[!  @cuB@-H@0S <⮇0 @T@\P@Ydi  0 400 ,p$@ ` @)T00L00 ,p($@ ` @400 )<ЍuBk"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PRz T @(@ЍU E`h D[h0Y`* sR `FU T`T B+U` 0 ` @  oP@0@P  0 0U 'h0  `0pS`P 尙@U *PQ l Q`FBo B10P0 00 00TPÐʂġec(vB<@p@-@Q`P 0 h0P @poPTp0SpPO-P0M`Q@0  IpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUgf0 S0 0 T嬘VV 00 0PO P5PpPUvBA-P@l`P p   BmnP TO  nP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@.Q (  BR  \R\Q 0 Sl!0 SD 0S0S0 0 S0Q00 R Q RSR ؗ0Q `U P0P0 RPPQ AQ  0 vBvBġevBvB0A-`pP0S l@PT 0 P 0 @6/P A-`p@0S LP@U 0 @ 0 P6/P <00S/p@-P@ I~0P@  pġecA-@`pp R( `0PX 0 0`0d0(0 0 0P0000 0ġe<0ep@-P<@m 0 PR0F00p@ZdZd40+ 6p@-40@TP@`L0S0L00x3P0tFP80S`P@T}Wp0忋廋/@ZdZd@cZdZdDZd@-40,@640@0DL0P0册@@VZdp@-P@0P 000P 40pP X0 `d0  `d Q0`5d 5 p0@-@@p P Z 8g`T7 T T`,PU00Gy,fPP00<3`@ce0e xBewBZdO-`TMP|pPq 0P0%3 @PAZ @A20x@PT0L0S 'P 0S 0S40@ 31 4 I0P DP $`(Hp0UQ4PP AP [ Z RZT 0 0 0 P @@ P4 4 @3h "$  "$4 Ix0 80 0 $`(; TЍeee@-@Pp`8e :40000 P X  YH \H 0  4xBG-p`) P@PG8kee+@-@P`CMp,p0  CߍcxB( @-b\xBA-P@M@@AT0p` 0 S S( 0 0(0? 0  R:000P0 ( SP0 J00000 (P @Ѝ 0@-PDM@p0`S S' 0 0( 0  0;S 000(P0 0 (P DЍ(0;SP0 ( 0000 0/S(0/S0/0S p@-@Pp-sp@/0@- 2/P 00@- @ 4/P0@- @ 4/P 00@-@ 4/P 0&[@ A@- 0P  U Ѝ0ep<@- 0P  h Ѝ0ep<%P0/0ep@-000P@Tp0S 3/X@c0e 0/@-xB703" /@c 0 /Ȥet0 @ P //L00S/800ST(00Sx//h@cc@c-/-/-//-/-/@-嬌xB@-娌xB@-夌xB@-@-"0@-`M 0@pP8PU 0S80<000@00C@0PU 00, 0p ЍecȤecp@-@ $' $'  %(@ %( &) #& #&phPl`0 PU`P`pO-` P0S0M 0Xp@V V00 KQ   RpBpp pS G Z Y 0 DF 0@ [ S  R Z" 00S 00S QP qq@`V7@ЍS 000@080S80@ 0S @-9/ 0S @-9/0"SKPp@-@B P pPP P *p0 S  \3, R:,(Q $lqP$ dqP$ (7pP 0C~\0C00  R( $Y0S*Vp*/TppA-0@S`@M4 0^ 4  E0000000H00S 00 00$0H030,000 0 P:0S6 PU3 0S0400@00'$'$(%(%)&&#&#%"p圀0 phplH0@2@@0 0@ 0 P@0 00@ЍL0P0  0  !P P  /$  $ /,  , /᠍c0"SS@- 0@SPM(0S? 0S;0 j0S R 2#! 0C?o(`2V0S$ (0yS x0x$PPx 0B~S(x0Q:xx0Dxp`V  @T xl_PЍT@@D@@P*/-/-/ 0!< 04 0 (   !/@cdddA-p 0P0`@ H00000#   20 000 P0 0S ]P7&  X@0 0400'$'$(%(%)&&#&#%"pP0 pPhplP0 0Ѝ"0O-_M00x 0$0(0#212P7@&_ߍ0`Sn`P 0  (PwUp@PPpPXP $P W 00@700SU x 0kHTPPp7@PP0 Y0Sp+@Pp3L14 `00C x0@L QTpp ^0  @@P! 0 R  B  0PT Ao\Q Q  a  0T0t0P0S 0$ST0S 0$S0( 00 0PJ~P,X0S P0 X@P W  JCX0\%0CS00T0S  R$ R R @T , P,00@ P0 R0@&@T x( @Pr ( (0P/T0S  R   00&0@00( @PO(0$P000T00X0j p$ 0k@P 0pS0P @ @P 0$ $0m@P*0S- P$@ ]PX0S0S;@0Sn S S $k@P  $0X\X\ (, /  X\ 0?0::S $0PtP $0PH R R |!$! 9/ Ir450", 00 Y F $ 0TP' 0EKS0 P,@K@m$0P000T00X0 p$ 0@P 0SZ& @-@p@@ >0UpW01X㾁V 000 uW"010 7(0SF`.AUpXp㾁@c@ Acv@Ȥe\ P/0 !8 0 0 (  , !/@cdddO-QM`p @tЍO5\r^oܕ000l00p00t00cx0 0|0lPUU47[@@T@P@ mm0@0 ER45004 0A53!"唉50,0,@00T1 ~OD0T+ ᪉U p0S   0S lXP@0S T `l WPlFPP&Up0S "Si20000Sd DSb D& n0 0 0(00l0P|0堰S8 [5 x0S2U U UH pPI \ (0 l;/ [ N[30S 2 030('0 0 |P|0 0|00"4 4Z DJZ0000D1@0@@T^ ~ODZPEP@H R  Q^ X$0$00U00000>800 l0kP%|0S" 0S x R " ,  4   R㸰 R԰8 |$ P|0$ 0|0唈X$ [$0 ᰈDP  0 l3/ H < 1SS0SЍ 0C#^10SY0CS!23 U !5% !D!C aP  03/`0 D`0@00800L01H0>2040 0,00131`000S0 S000 0 ,yP 0, V W 0`x 8000`400`b>h03` ,1`0p02640h00x0x0FcFcc!@@xB@c@c0@- 0F Ѝ@-@ Ѝ0@-  9 Ѝ@000S/-@ 8:40 S;000050< 0oNZ0<0   eN _N d@YN`00l0 0 00  00  m 0 Ѝ̦ep@-@0@P6M0 !.   S  0P `$1 Ѝp@7@-P`@KX0010P @P Ѝ00S 0S 00(dA-@p`ᇁP@P ᢁ@-`00 00 'P H0SL0S 0 R000S  $00 0$0~<Ѝ0` Td8@yBp@-`@P4@THp@m0U@8$e 0#Hdp@̦eܦep@- PS`@(M 0S0 @5T!>0000!>0000P @ 0$0N(ЍpTdZ@-@0S00̦e@-0  @0T0S $ $0}ЍꔎcJ@yB 0 0 C-0PM  0!S1000}Ѝ褁X R00ЍC 03 HdXq@`VT8 w 0S10 000U`T HЍCd  p"P X0`` 0 0``0`@T0 @S `p `D08 Pp%}gD0J 04 _"ЍCV@yBͺAc̦eܦezBAEch<@-@M=PU 0   0"S2000|`! R   04"<S02000Q2T0S 0!0|`BV "HcᒿЍ R% 03aA0AS   00  0Rf`J0$! ! R%000T0S `p `0 p|000 0S0 0 00RT0T0S `p `|0 0p]|ܦed@7zBͺAyBcAEch00 @ @$1 03/@0ЍpO-`0Mأp P@P 6 6S 5 K@Ѝ3 T V@0T1l$1 0@4/@X [T06/@i0 0 0 i@'P0! F{@꬀ZP  q$1 03/@T0@ 0 8ЍO̦ejB@zBjBO-M0( eP0`pW0@ ⶀ0PP@ L3@i`0d 0 `0d KiP0 @P 3!  ~J7 $xJ00  {i004 0 004 %i pW$pW@};$  /H ((P @P(Z Y!} 50R' {h@0D 0 @0D h h5 0 h zU T pQ Q ,,Up T pP}PpP Tҽ }W (ZhX0\ 0 X0\ h5 BPPYhh0l 0 h0l h hdh0 FzP4(4ᔙ8က#80 0Sl`vhP0T 0 P0T h$Z (9hhH L9 H LrhX0US 0S SZ00 ( 0% PP U OP40" Ph _P 0 U`  0 0˵`0C  `00y 000 0Shp0t 0 p0t hX0S h00 ♵d0h y$0S0 SbWg(0, 0 (0, gVȠ̐ 0 U  `00yGJ PZ6 X0`S00ʠZ5 0S ZS!.(000 0 PPc$1 0P5/PY RU06 00 5 /OP 00 '6|倵 ygx0| 0 x0| gL0S  hD Hh0&y0  fPPl@00S Ug0 0 0 `gP0S h` @0 000`0x9g0 0 0 DgH0S  h 0Ph x5 vH6 & [& [㸶US Y !>00 0@0 KPYD !>T00吠唠0PTTSFf ?  0ff 0 0)f 0Y0SZ06oᩒ0S&2 0S6E `Rf 0$ 0 0$ f$QP0"cP  G0 0GT G $G<0004 Q0P<<00000(00,018rf0 0 00 00 wf 0@MЍ!>0吀唀I$1 03/X 6ᬠ  Y  G G <00000Z8TEP/̦e(dzB{BcAI{B|{B{B{B{B(|B[|BG-aqQ@PG50xe0 0 0 f0S1@PA zP 40 ᐐIoᩒ S)zY e80< 0 80< zeX0\ 0 X0\ e00S@P  4"4X ;C RLe@0D @0 @0D eeZd̦e~|B-/0@-(0,0@<,00S 0S 3/0000008004000 $ X R0@``P 3 EzGL40S 4(48#8SX 5zG X\0S `0Sd0SP Z0 X0 LP 4UF  OF0d0cee0O-laMPd00TT `\0@P 50(p 1  5   F}P L0? 0#PY@d0\@S3  pE \EЍ00E0 <00⸰AꔎcEc|BeeA-8pP`@d1!01@@Ad̦ep@-\0 iup^0 RP0Ƞ@,Ƞ00   ! 0 p@ 0, 04@|B|B0 zp@-@`P< D1  p@O-<`Pl2M@0 0 0-1D2U5P0``3Xx`@P 4l衟< l@PP q00PU:yЍ 0 S/ R 000h  y0S4pP0p x @$04/px@W  y W V hy y` 0S 0 S S Rh  qyx @$04/xZ@  xy00P Y V hmy y`  eZdp@-P`PUpGx@@8y @d Dm0LP0p茏cZd|B|Bp@-@0@TpP Pl` fp茏ceO-$P2M@0p@ 0Z0!>540@P吢H0 0@X0*xT DdP< du~`PH00`VM;xU 0bh@Sw Yt  $09/ xЍ 0 X S R 000h  ,x0SDT0 x $09/wY  ,xY U hx ,x @P 0S 0 X/ Rh  ,xw $0:/wZ  ,x00`Z U hx ,x @P  x keZdO-$M pp@P0 `fP 0倐hS [  $0;/@ Xx$Ѝ Qx @ ߞ@ZdO- qdV Q ʀ !  , !p0Z@p W/00  0唀0 0$ hw R $@ !d1000  ! Ѝ@cdddZdG-P`U U9 $0ppZ@ Z0Ud0 P  KC GC$0h(P 0(0$0 00T0w 0< M}T`00`00<peZd0SnO-0S4M$PP!P@3 P 10S T. 0 0S0U0SvpD00`Vv 4Ѝ`` 0 lP 0h kwhG0S" 0 S/ Rh0  0;w 0S  0R v 0 p$07/Rvp h0 P 00 0 0 p@?o2P0S 0 S$  Q0ЍeFe 0O-DM(0 0P`! 2 ,`0800P$  @80 <00!1 0<0 (`,P$   0'!0tqt< (`0 0 ,P$  p 0!80 (`,P$  pv0 00!08 00 (`0 0,P$ a'(` `08! 0 ,P $  p`M 0 ,00 ! 0 0P($ =DЍH}BB8~B)=~Bj`B@- R0R0 *0R \ \ 00Sډ `\ \ \00SL00S0 80Q L\00Sh@e R0 Rp@-0@P*0 R ዅP@D T00SpT V/P \0P0 SpSp(00S0 00S}@e 0 /e@- ttnbp@ lhhb `\cb T P^b HDYb 88Tb-=Be(=vB(=B(=B-=B\)=B@-0@gbeb cbab_b@\beP@- P0@ P@ dd d0 0X B@P HlЍ0C@P le)=$~B~BD~B}~B@- B 0RS d00S Q PQ @`P ,,0CPЍ0e@}Bm}B@-B B  \03< x00S @`P PP0BPЍ$00S `o@0e@}Bm}B 0O-`Pp@DM(028 0p0 0`,P$  80<<042 0p0 ,`(P$  '~ 0쑟00A-@`PpWPV0SA0SW 0003s0#0S0  " \ R0@-#10lS0! @. QBo0PP P. /0S/p@-0@S`P `UFUp 99 $00#00p@ +9 $00#00~PE0-M 0$ Z$Z ZpZ ZP S?P Z$Z Z[Z ZUZ Z 8?P ߍ Z$Z ZkP & ZeP  Z1Z} Z}\ ?P Zx$Zn ZJP & ZDP Z` ZZZ ZZ >P ZU$ZK Z'P ZC ZC x>P Z=$Z3 ZZ- Z PZ% Z% >P Z $Z ZPx & ZPr  ZPlZ Z >P` Z#Z ZPU & ZPO Z ZPG Z Z t>P; Z#Z Z d>P+ Z#Z ZlZ Zd O>P Z#Z ZP & ZP  Z 4>P Z#Z ZZ Z >P Z#Zy ZyZs Z!Zm Zm @>P @@@@@$@4@D@T@d@t@@@ P0C /-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/ꞃB>@ AP/Q //  00  00  00  00$  (00,  0004  80<0/@-@N@P @ "G-@MPXp @p P` 0@DS @Ѝ@`$N@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@MP000//o/00//p@-@M P@ `@cM@T@@M@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ GMPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU/QO-R@M2 `ᡰ@[N00<0唆+00 0<  BS 0 KSP`F0V6*0PS㔃'!F<0pG   RVKЍ蓄% 8 09/P0P0'8 09/P0 Up0V* p꓄' 8 09/P 0p0% PEWP8 <9/PpG0 Q /@-0s ЍQ= 0 R/R 0@0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P0$08R0* \ A/Q :@/Q* @-0@-Q K @\@ ,0CS @PUT S @CP U\0^ PL_UQ@A,à0@ 0@ 0@ 0CSQ S`0\\QPAQ00@0000 0@0 ! 0#2 /UUUU3333 @-// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00M/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-0o @-@oQPO-(p@@@, P`T @q.`VPW:/@P WRQp@-@@P@T@ P`Q@N.PPPpQPp@-``` P@>.@T`PpQPA-`` p@P,.W PU`@@@-0 0(0000 0P 0@Ѝ\=@-0 0(0000 0P 0@Ѝ\=@-$0000 0vP Ѝ\=O-`pP-  vH@P W  1 1W gH@Q @-HR @P,30 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,U @k0@P`TF  00 0S !,! @D ...|.q!!,/@0A-@R0@P0`?S + S# *S, R& M[S0^\PP^4 ]^F S -^>pQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  /Ѝ@-@P $w/@ (, 0"AO-@0$M(`00p 00P0$00D2 0@00  S/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0A$AA-`P@. $QY ?PU(p8 0 8S($)8 ce `.7XPP0Q`pDa(!"$a$"  .0Uh ЍAE@S )@ c>8 7 )30(0G-PR2 p@q?p` @g(U: f. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (G. 0$ Q0 0$  0$ @H< 0$ @ 1.  0$ @H< 0$ ?XG @-Z@-@P $.@ ( 0"A@- @-@@-@P @ (- P 0$$A0O-P \M@000 0Pv00 8`$000 : #R?0V FA#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@ A0`( a!"$,a c"/G-P`8 p#T0.@``T%0  $! Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T\e-M Ѝp@-@ P` !LNp! !@ApA-PP@#*pᚌ`P @  w@P ᭌ0@PWP )P )PᛌUP@@-MP@@@`@pT:Ѝ Pp0P00 E갆BІB`c00yara0tcid 0 c 0 cyara 0 ctcid\ 0/\ 0/yara\ 0/tcid0S 0 }/c0S 0 r/cyara0S 0 f/ctcid@-0p3AG+`P @ 60*.P 0@PP @P0( Ѝ@c /p@-@DPF)0PPptcidp@-@8P:) 0Ppploob@-@(@ @-@"@2 @-@@E @-@@\ @-@@s @-@ @ @-@@z @-@@u @-@@p @-@@k @-@@f @-@@w @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ p@-@P((0P pP pgntsp@-@`P(@0P pP TpatadA-pP(X0P `@P  P @!gntsp@-@RP P(pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P6 p@p@-@PJ p@!P0/LAA@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  L_PP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`pP@TY FTl g:T =T *T # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8Ѝ33 S R 0C# M0   Q S@0S00S > @ @@0 SbT& fT ?R0@SfTQ `p b6b` B@S7a7r  C# c,1 cp0 0 FT'0?Sq Rn  @  c4C C@2A@o 0  @T H  0  X=  0 f@00=0D?ofY20S3:0D?oFY20S fY*0 A B0C QR#_S!  0R WS-=T 0  Q  P @Y 0S X 0 vP  P@0  0S P @ Y $0SR 00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` Pp-@-@`P P@ Ѝ/p@-@P EPp-@-@`P P@ Ѝ/A-@`Pp P-@-@`P P@ Ѝ/00/ c0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

pxe @-克07xeA 00 S  \: P03#/S  \ P0///p@-P0S 2P@P R凋儋D<@P tAT9LPP ;4p0=@p%@c(=xe|ee A@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@  A /P/ 0R" 0 !SR* R0*/-0  ^: P*0  S */@/ //@  AP 0R// AP 0R// A0P L P ! R0* /0 \0:// A0P L P !  R0* /ɒ0\0:// A0P \ P  !R0 * /-!0 ^0# %/ A0P \ P  !R0 * /-!0 ^0# %/ AP/ 00R!  S // A0P D P  !  R0* / R0:// A0P D P  ! R0* /R0:// A0P 8 P  !\0/1 // A0P 8 P  !\0/1 // A0P < P   ! /!S // A0P -?o42 ^0S0 S[/ AP/@\   JQ\// AP/D\  Q/S/Q\// A@-@pMPW ` `0S$(0S!0+ C 00 0S0xSW  000000SЍ  rPB0BR"SO-GP`0@ pD TWpp-T@p` +T@`00T 00XS0 A B0C QR@`9U70T PPſ 0  000D ^aD\WDAD\7D U0S0:0QP00\00S 0!0@P0 pY ЍY S F0 A+B0BR"SO-@ `  F0P pE UWpp-UPp` +UP`00U 00XS0 A B0C QRP`>T<0U @@gĿ! 0GcW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0S9 A+BH-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0 `PO PU# 0S zP@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00=(=>|=>Q@- o/@-IM@kpP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 \P ` 0 0P0 5/P 00L AA-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S )P0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@D AA-`[pWR SSS P PPPyyP(0SP 0p P V` P PP   PEBTB?BNBB{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P lyPP@pPHr4@P <om0 P`000U pyꀩe A噃pe$0S @-*@N cpeD=@- @ =  耩e AieG-@pP`VU@ 0@焑QPU@ `F¦`@-@r@op@-P@@wPcpp@-@P X0R@xPP@p,00$000@00 0 A,==  A0 0C0s@-@P 0U S xԩll5Ѝp1PP`P 0 0%PP0 0C0PPꀩeA-p `Px@P V  !V @pxC-P0pS`@M>0}S "S x00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0SKx0h P ,0S(0S  ,bP \P4=A6Ap@-@P `\0 R@VP PPPV @p] AO-0PS 00@ 00S I ЍO <P@ ; Ѝ%P P 0X0 0:P  00C 0P B@U RP Q `p Vpp _` P 0S|nP 0 03/P  0R#PP D`A A A A7A0,S<S 4ꈪexehe@-@ tep@-P@P_ 0 0 0p@讨G-@P 0R@ pHPP`ᘨ@ 0冡ᆁ!8 6 0冁 0` 00V:000 A0P 00R@-0P   0/ Ap@-@P000p@_p@-@P ,0R@P@Pp Ap@-@P L0R@P`0S@#*+@6p Ap@-@P֧@(pA-@P x0R{Pp0S `VP 08`P p Ap@-@P @0R@ P`ᝧ v@p A P /o00"\ RP0\`/ AO-@Pi pl2 R0p  .PP @hpg@L0S 'S PP U劀0Q=P8J/| g P,U<UU p/1P` `+ j 8P" ,PP $YPPU@j Ѝ` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@ A cD=peteexehe AG- pPW` uW 00@ >P 0S0,S  0 G0P -?o<2 ^0S0P S/ A@-@P+ 0R'P`ㅦ0 @P 0 0 B! 00C0000ki Ѝ@蹦 Ѝ A0P/?o( 2\0S/0P S/ A0P -?o42 ^0S0 S/ AP/ 0R/ A0P -?o42 ^0S0 S/ APG-@6 @`TPp P*  0 S @US  S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@t0P@ A / Ap@-P(/@P 0P0 0pXeL AP 0RR @-Go//0Sb G- 0PSGt) h@PR  pPWW(G0 0"!00 Pa#(<`P%c?P6 0P0 `0P* P0P$ pGP唀W%10``P R0P&RP0P Wa<`=0P =P/l AL A@-@0P +t0XeO-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR30| AA-p`PV@PtsPP  P `PQp@-@@ P`^s@P0p  0P@ PTksPQPp@-@PP@PP @p@-@P D0R@00S D @P000L AP/ 0R /L AP/ 0R/L A\ ?o@-H 2^0S0 RQR k 0 /L Ap@-@P D0R@ P@ rPP@p O L A0P -?o42 ^0S0 S/L AP/@-@@T ?o 2^0SwoL AA-0S6 (P@U2`P& 0$!P( $0S%  M$ 00 RprPP 00  0{P r 0pPЍ 0X PP XrP@PP U yr@AA/P/?o4 2\0S0SP// Ap@-P00S $# @U 0D@Ip(c>Te@-((;0@ 05 AHe0 SB A@-@P 0R@$ AP/ 0R/ A0P -?o42 ^0S0 S/ A0S(0S @-0@ / A00C0/0 P R   //A-`P qPP@PP,@P Dpp伢0 P`000U q`e A@-@@PG-@" @`TPp P* ᙢ ᖢ0 SS 000 0! 0 0!@$0  ဢ @ѢϢ@p@-P@@nPpp@-@P X0R@HqPP@p,00$00R0@00 0 A> >G-`0@S,=0SᏢG P@ႢmP PP 00 0 2pP  00C 0JP l@AP0 03/P  0R 1#=PD`A8 As@-P@ T R p`|-ЍpADAP`@ 0 05P@00C0@@`eA-p `Pp@P V  !V @pp@-0`SP@p0]S @0 @P  Ѝ P 000$ aP ,0S >1A0 /p@-P0@Q l 0 Q000pPpp@-P@PT 0 0 0p@裡rqA-@P x0R@ =cPP` ፡@ 0q0 0q`0V:000 A@-P000p@-@P ,0R@P@ep Ap@-@P ,0R@P@Sp Ap@-@P L0R@P`0S@#*@9p Ap@-@P٠o@+pp@-@P̠000p@p@-@Pῠ@@@pp@-@P @0R@ P`㫠0S 0@Ap AA-@P `0 R@pP㓠0@0S@ݠ 0 0a000| @ Ap@-@P <0R@ P`i@Ạp AA-`PV p@PU S 00N 0Sy0,S00 AA-@P 0RPp00 0a A~ 0!1 0S0C0000oA  A0P -?o42 ^0S0 S / A 0Sp@-P`@P (0S p@:p/8 A-0!!00!1Q100 000000 0#0, 0#000!R0Q000! 00000p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0}!000p@t000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG- P`pX@0Q0000R0000@ @SA@@ @H :/P  1P@0R000000@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!00000\00!0000000T   0Sp  T`"P P- 3 T!, ,  1000 T R`T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-:4`P0@ pD TWpp-T@pP +T@P00T 00XS0 A B0C QR@P(V&0T ``g\ 00D \a0DSW0DA0DS70DV P   S  R 0 @`  X`EXRT A+B  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0  0RR! R/P/0@ 0A0S&*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//1A-M Tp @00S 3/P0`7P V 6/0p `Pލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0`` 0R,0 @0 4/@P T p0  P$ 0 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@J@Nbp@-P0@Q LbPp0< 0 Ppp@-P@AQpPp@-0@APS`0q< Q< <Q< >Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 ( P  Ѝr@t@b@n@@T(P\ ABBBBp@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPUa@P  aPa<WP0 Pp 0 03/P P 0S PP|P`P`T T6P P(VP Pd AB Ap@-@P` Ppp@-@P Ppp@-@P`E Pp@-(뽄B011/A-@pP`P ~`Pp` P102 P @-@\& P QRS  T00q`LQ R S "  T  00 A-% M222 p]X`=vV@|û "')둟]t>}b, chJgb766tHY*}D=뢆x}YFu=<̟nb,"9!Ldu4p8< 3Q% 30S#* :3#Q% 53#Q% 5Q *cO' ?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_R> T> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    KwG,m B`h `i j 4k k 4l 06l 4 IeRJ*MZ`i8qX$)u}lw|n3r>]2!!!!!!!5=lsllsrasrror AAAA"AA,AA@2A6AP9A6A`=AA_MAAEAP KAOASAA@ WA\AP _A\AdAiA mAiAqAiA vAiAzAAAAAAAAAAAApPAAAApAApPAA5ASA5ASAp AAp 0AAp `AAp pAAP sBAP AAP @AAP PAA- jA7AA7A AAAAAAAA AA AAAAAA AA0 AFlA00AFlA00AFlA00 AFlA'AFlA,AFlA1AFlA6AFlA<AFlAAAFlA GAA KAA QAA UAA YAA ]AaAdAAdAA hAlA hApA/tAIAowAA0/SAIAp {AAAA@AAAA@AAAaAAaAAaAAaAAAAAAAAA AA AA @0AA `8AA BA AA AA AA +AA 0AA P AA pAA AA AA AA AAYAA AA AAAAAA$AA*A.A4A.A 8A.A0<A.A@@A.APDA.A`HA.ApLA.APA.ATA.AXA.A\A.A`A.AdA.AjAnAsAnA wAnA0{AnA@AnAPOBnA`AnAp+BnAAnAAnAAnAAnAAnAAnAAnA AA AAAAAA AbA0kBbA@AbAPAbAAA-AAAAAAA AA A A A0A AA AA A A A0A AA AA AA AA A%A A*A A/A AeqnecsccmiplvsvchilsgeltgtlenvAAAAAAAAAAA AAAHB`A0.01.02.03.04.05.00.510.0daiadbibedeafdfafafdeaedsdeppmzv v 6  "w!N_bus_dma_busaddr_to_paddr_bus_dmamap_syncG!AU!AU!A`!An!A|!A!A!A!A!A!A!AU!A!A "A "AVA9"Ao>2PVAI"Ao>2VAT"Ao>2AVA'#Ao>3VA.#Ao>3 VA5#Ao>3pA<#Ao>3qAC#Ao>3qAJ#Ao>3qAR#Ao>3qAZ#Ao>3Ad#Ao>4D k#A8o>4D r#An>4i z#An>4`Rf#Ao>4 i #Axn>4qA#Ao>4TrA#Ao>4TtA#Ao>4TtA#Ao>4TA#Ao>4T A#Ao>4TA#Ao>4TPT#Ao>4T`A #Ao>5TE`A #Ao>5TE`A #Ao>5TE%V $Ao>5TEWV $Ao>5TE i"$A8n>5TE $i)$Am>5TE0$i7$Am>5TE ,i)$Am>5TE0,i7$Am>5TE .iE$Am>5TE0.iS$Am>5TEAia$Al>5TE!ih$Axm>5TE !io$Axm>5TE)ih$Axm>5TE )io$Axm>5TE-iv$A8m>5TE -io$Axm>5TEAi$Al>5TEAi$Al>5TEAi$Al>5TEA $Ao>5TE A $Ao>5TE`A $Ao>5TEJ`A $Axo>5TEJ`A$Axo>6J`A$Axo>6J`A$Axo>6ZK A%Ao>6KPA%Axo>7ApA%Axo>7AA+%Axo>7A/A8%Axo>7A?AE%Axo>7AAR%Axo>7A/A_%Axo>7A?Al%Axo>7AOAy%Axo>7AA%Axo>7A/A%Axo>7A?A%Axo>7AOA%Axo>7AA%Axo>7A@A%Axo>8A0A%Axo>8ApA%Axo>8ApA%Axo>8AA &Axo>8AXV&Ao>`A&Ao>XV&Ao>?A&Ao>@XV'&Ao> A'&Ao>@X/V'&Ao> aB9"A5"A>"AE"AT"AP"A]"AY"Af"Ab"Ao"Ak"A|"Ax"A"A"A"A"A"A"A"A"A"A"A"A"A"A"A"A"A"A#A #A#A#A7&A>&AD&AJ&AP&AV&A\&Ab&Ah&An&At&A{&A&A&A&A&A&A&A&A&A&AV&A\&Ab&Ah&An&At&A{&A&A&A&A&A&A>&AD&A&AP&A&A&Ab&Ah&An&At&A{&A&A&A&A&A&A&A&A&A&A&A\&Ab&Ah&An&At&A{&A&A&A&A&A&A>&AD&AJ&AP&AV&A\&Ab&Ah&An&At&A{&A&A&A&A&A&A&AD&AJ&AP&AV&A\&Ab&Ah&An&At&A{&A&A&A&A&A&A&A&A&A&AV&A\&Ab&Ah&An&At&A{&A&A&A&A&A&A&AD&A'A'A''A='AN'Ah&An&At&A{&A&A&A&A&A&A>&AD&AJ&A&A&A&A_'Ah'Aq'At&A{&A&A&A&A&A&Az'A'AJ&AP&AV&A\&Ab&A'A'A'A&A&A&A&A&A'A'A'A'AV&A\&Ab&Ah&An&At&A{&A&A&A&A&A'A'A'A'A'A'A'A'A'A'A'A'A'A'A'A(A&A>&AD&AJ&AP&AV&A\&Ab&Ah&An&At&A{&A&A&A&A&A$ *A *A$ +A $+A 6+AS+A i+A+A +A+A +A+A ,A ,A 5,AU,Adata_abort_handlerbadaddr_read  @````` ```pmap_map_chunk,c  # !!!!!!!!!!!!!!22@wuQa~>uuw>\bb\\\NbbR-pp },  A5AX5Ab5Ao5A5A5A5A5A5A5A7A5A7A5A 6AES-6600 q  "/++-N(8V]]]F\gg\gggg?D!l!!!!l!|!!!L>AU>AA@f>Ao>AAf>A>AA>A>AAf>A>AA>A>AA>A>AGA>A>AA ?A?AA$?A-?A>?AC?AL?A]?Ab?Ak?AA|?A?A?A?A?AA?A?AA?A?AA?A?AA?A?AA?A@A@A@A @A1@A6@A?@A1@AP@AY@AAP@Aj@AAP@A{@AAP@A@AAP@A@AAP@A@AA@A@A@A@A@A@A@A@A@A@A@A AA@A@AAAAAAAA0AA9AAJAAOAAXAAgAAlAAuAAA{AAAAA?AAAAAAAAAAAAAAAAAAAAAAAAAA@AAAAAa>ABAABA"BA3BA!7BA>BAOBA ?ATBAAYBAbBAA0AAhBAAnBArBAA0AAwBAA0AABAA0AABAA0AABAAABAABAAABABAABABAABABAABABAABACAABACAABA'CAABA0CAABAACAABARCAAcCAlCAA@7BAsCAA}CACAA?ACACACACAACACAACACAACACAACADAACADAACA%DA4DA 9DABDAASDA\DAASDAmDAASDA~DAASDADAASDADAASDADAASDADAASDADAASDADAASDADAASDAEAA@SDAEAASDAEAA@SDA(EAAAA2EACEAAAHEAAMEAVEAAMEA\EAASDAmEAASDAxEAAEAEAAEAEAEAEAEAAEAEAEABAEAAEAEAAEAEAAP@AFAAP@AFA0FAP@A5FAFFAP@AIFAFFAZFAcFAAtFA}FAAtFAFAFAtFAFAAFAFAAFAFAAFAFAAFAFAFAFAFAGAFAGA$GA@A)GAA:GACGATGAYGAbGAsGAYGAxGAAYGAGAGAYGAGAGAGAGAAGAGAAGAAAGAGAAP@AHAA HA HAAHA1HAA`!!44D! 4706?34KwG!dHAy!U!6c!!4!!! 4706?3p!4>6cAAAAAAAAAAAAAAAAAA!!!! !@!H!!! "p!!!! _CK.A\MERROR TIMEOU DFwd_flushcachewd_trim=QA_QAPAPAPAQAQAxQAPAPAPAPAPAQAQA*QAD""")",",("'"4>6cwd_setcacheQAQAQA""D""p"t"" " "p "wd_standbyD""("(")" 4706?3'"4>6c2"="1"P;"1"0"l%%%XX"0"0"K"atastartata_thread_runatabus_threadQ"4V"44N" 4706?34 #(-27<FP d'SpectecSDIO WLAN CardSDW-820e @ J_AaX_APi_Ao_A ,v_A@P d' #(-27<FPKwG"`AaA C CCCC !#####4#L#d#pxa2x0_i2c_intr_sub  CW[jM_a8]ox]#L[#DnATnAdnAp[#0\#444e# 4\#06]#4JXjj[  "$5 >>5>>= >>=>>V$>>V>>fsAksA<>0>sA}uA!AȎ>>PT>H>sA3@A>Ԋ>l>`>%  8  @!!@! ! #/ ''w0 g'' c0c ttA}uA!AHT{tAtAztAtAztAtA tAtA ttAtAtAtAtAtAtAtA@tAtA@uA$uAuA+uA}uASxAfsAksAlBuA}uATuAHhuA}uA!AquAvuAttAuAuA@IeIIuAuAI0I0EtAuAuAuA@&II  IuAuAtAuA@"I0uAuA9uA-/uAuAuAvAuA'vAuA;vAuAOvAuAdvAuAzvAvAvAuAvAuAvAuAvAvA")vAvAuE o@o @o @ttAwA!wA$wAv{AsA}uA!A@& 3BI@4wA=wA @(#0jwAtwATB wA-wAEAxA2'ExA xA'xA*xABxA[xAcxAttAwAnxAvxAxAvxAttA xAttAxAvAxAxAxAxAyAyAyAVVwhuA;yAuAOyAdyApyAvAyAvAyAyAxAyAyAP8soo P q q sMkltxAxAtt3yAyA hCyAyA h&FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~ aBr{Av{Az{AGA~{A{A#####4# 4d#06#4usb_desc_iter_peek~AAA%A1A7A=AGASAZAbArA{AAAAAAAAusbd_fill_iface_data@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@eaQ@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@o7@O@R@T@a@c@q@}@@(@v@&@A@N@j@o7@gO@%@+@4@>@0@`1l703% cU cU c9 : %mZmw`%  2 @@KwGX$A   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u     u ;u )%u&5Fu 3 4u&6F  0 1  2 5  :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F PPP(@W$hW$N$N$XN$5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;< =>?@ABCDEOMPJQNRK QOOMO#9`@`'T~h$xg$j$o$ o$p$AAAFAlArAvAzA t$ t$  % L t$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ fc 46l!|!!y!F  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |܅$$$p~$$$\|$|${$KwGd{$AA $$2VZP~" `"'`{%1KwG$GAA# # $$,$T$$P$KwG$AA@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0H$$$Л$dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^dKwG $AA P@9WPurl_uno_mii_read_regĠ$$$$ȣ$ $Ĝ$`$url_uno_mii_write_regKwG|$ދAA( B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn $$̺$|$ܨ$ا$D$$KwG$AA$u$u$x$x$Pxmue_csr_readmue_uno_rx_loopmue_uno_tx_preparemue_csr_writemue_read_otp_rawmue_eeprom_getbytep$$($$$$$x$$mue_chip_initmue_uno_mii_read_regmue_uno_mii_write_regmue_dataport_writeKwG$ AAF hF $ $$$4$|$$`$$KwGL$AA42-#  !)$$$$$$$|$0684 % %%P%#% % !% "%#%%P% %P%%X%%%P%t %4 %P% 4706?3%KwG%aAA   +-/, ,sysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrޕAAA/AEAnAAAA A A A 8A 8A 8AYAYAYA|A|A|AAA!A"AyyyyyTHIS is A memory TEST pattern ##$D%%%%% %H%@ %H%@x%H%44   @ @ @  0        @*  ) 2%%%%4%0%+CP]j 9999:%%%%<%%&%(%`%D%%<%%|%,%%X%D%%L%D%%%&t%%<%H%D%4%T%H%@%%L%%     %H%%%%%h%|%%KwG&A???,&~????n@ f????JڧoM?? ??a:?? ??Q?}-&?? ??@ZC˔??I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 T?? ?t? ?D?  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./KwG`&Aexpand 32-byte kšAa& n&,k&r&b&0z& r&@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&ܜ@T@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q@@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH\@T@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH\@T@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@\@@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decapūAl&`&&&&0&&0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsizeA&&&&&&D&222*(*((C#'I`% < ieee80211_hdrsize JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scanieee80211_next_scan1_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_init$$hhu Pieee80211_encapieee80211_compute_durationPPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update>{4%$$ AAAA AA Aieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupAR[b]G)GGGGUGGGG <<L!cl{((̄((L!cC`S(J(J( @xN(L!c)J(J(, @h)L!ct(J(J($@#)4)3)L!c̹(J(J( @L!cC@=J(J( @=L!c)C@=J(J( @=L!csC@=J(J( @=L!cC'J(J( @('X''L!cC̹(J(J( @(-OOTOO)|OOO     }E#(D(@AAA==A*28;OOOOOOOOOO  ;% ?????HC  .   ip_outputd(\(L((,(D((Ľ((<(8(4(l(<(<(D(0(L((bqA  #9L7Ptcp_outputS syn_cache_respond @@@@@@@Y)h\)])4_) 1DW]e_ace!!)))$)a)<)))L))p)a)) ))X))p)p) )))h))D)))4)))H))p)x)""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwww)))))))))))))h))))) )#B)A )A4)BB)A)AH)8BZ $>FN2:BJRZbjrBJh%YbxnJJicmp6_redirect_inputicmp6_reflect_icmp6_inputicmp6_errorNYin6_update_ifa1in6_get_llsol_addrin6_join_mcastgroupsin6_if_link_upin6_if_link_downin6_ifattachin6_ifattach_loopbackget_ifidin6_ifattach_linklocald&c)ܹ*)\)h)d&c:C5*ܠ*ؠ*'@(*d&c+Ԡ*Р*L(@+d&c(̠*Ƞ*$@*4)3)d&cd+ܠ**'@d&c<d)d&c++d&c,)d&cC(=**'@=d&c)C(=**'@=d&csC(=ܠ**'@=d&cgC|+*'@|*d&cCd+*'@+3!ip6_inputip6_get_prevhdrip6_nexthdr(@AAA==(A*/1cW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aip6_output ))))))))nd6_initnd6_optionsnd6_resolvend6_rtrequestnd6_na_inputnd6_ns_outputnd6_dad_timernd6_na_outputnd6_ns_inputnd6_dad_startnd6_rtr_cache&.3;CKS[cks + +܈+$+++4++$++Ԋ+,+++4+<+++<+  sa6_recoverscopein6_setscope AiB aB aBA aB aBA aB aB aB aB aBAudp6_outputP+ԩ+T+++ +P+H+(+++\+++d+l+h+ȥ+X+*&Rik  $ "X>@D;@OL=@D;@N;@6;@7=@D;@O:@ :@Z6@D;@!5@A4@vb/@D/@F 8@8@u-@~-@J3@P^3@D;@ 7@ 7@ "7@7@ 8@ V7@ F7@ N2@H22@X1@ j1@ T1@ j1@[.@p.@U,@o+@ 9+@ D;@ N0@aAcCeElLBAnNDCoOsS[ZuUxXzyzZ|{"5% mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0), --_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\5$#"12< 3>!(4[")5]#@6^$+7%-8&/9'*0-=.%`bB|_pP&oO`!vV  dDlLjJ/zZ0wWaAuUiI eE ,;' cC' tTsSrR3nN4mM2\yY{xX}.:kK~'?qQ 6gG7hH8fF(, _d/^ q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ 5 12 3l#!4>"5<#6$$7%8"" &9""/'0""*----.' xX.vV_lL[cC]wW^kK!hH<7 gG>8fF=9qQ&+/f-0uU\iI/aA{ eE} oO* sS? nN(4rR)5tT-63dD:,4yY@.#$ |pP~ zZ`bB+:mM%16,-"27..'38jJ;;2 9 d .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>|  9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm +8+ +++P++4+ 4+06+406cKwG+A A++44+ 4706?34KwGD+*AKwG+!AKwG+DA     !A  !@@@@RRTRRRRRRVAAAA!ADA gA A A A;A.AAAdAAAA4AA;A5^A6A A A A < A ?'A ,DA -dA A A A =A :A 3A VA"zA6A$AA A80APTA##   1 @", ,,",\,,",h,,",,, 22     * #hhu hhhA LA+,(,*,) 2AA AA80,., .,) 23A 4,`1,3,) 2UWAUuAU2AU3AU1A7,@6,,) 2AU5A:,8,,=,,<,M V xA{ A4A,,@,4A,D>,@,) 2A A)AHAgA`E,B,D,) 2}A}A}AH,F,I,H,F,,) 2vAvLAvjAv Av Av An`AL,dK,,) 2X9AO, N,,) 2lR,,,xor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zero|`,h,b,\_,y,k,c,b,_,\c,4 =( bAĄ, ,l,d,@,, !!!c        BBB257#A^bgejzuxwsemul_vt100_output_c0c1,܍,(,ȉ,,,,L,,H,,,t,A,,,T, ,T,,W\((FgmsLAt  "$&((((((((+=????????B`@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" AAAAAAAAAAAAAA.A4AAAA AAAAAAAAAAAAAAAwsevent_copyout_eventsH,l,  d,,̶,4$, 4H,06,4 ABCDEFGHIJKLMNOPQRSTUVWXYZ,,@,4p, 4,06,4rasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?0c&1c&1c& g@g@o i@i@                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~j@ak@ask@)k@2k@/l@0l@ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠ%'-79 &PX8-;-TF`9-T9-PN08-RR7-CE7-ST7-NM:-0>-CL9-0PL9-0REt7-@RR7-CE7-ST7-SL>-RR7-CE7-ST7-ER@-CE7-ST7-(;Lr@p@Lo@KwGTL-A  eTo@t@\9@h;@:8@:|@:T@:p@:P@:l@:@:@:ܸ@:@:@:L@:h@:@:@:@:ع@:@:@:,@:H@:Ժ@:D@:`@:@h;@:@:@<`-ķ@#;@0]-@W-@:4@:@T;0@:d@2-@2-@ ;@;@: @_-(@;@`y9 ep@t@\9@h;@1;8@h;|@h;T@h;p@>;P@;l@2;@PC;@8;ܸ@p8;@t;@C;L@x;h@h;@h;@h;@h;ع@h;@h;@h;,@h;H@h;Ժ@1;@7;D@3;`@X4;@:@;@4;@<`-ķ@#;@0]-@W-@t;;4@D9;@T;0@<3;d@2-@2-@ ;@; @_-(@;@`y9 eTr@t@\9@;@+-8@;T@;p@x;@x;@<`-ķ@#;@0]-@W-@Y-4@;P@;l@;@T;@l;@,;@t;@;0@x;L@8;h@;@;@;@;ع@;@;@ c-,@`[-H@L;d@2-@2-@ ;@;Ժ@*-@^- @_-(@;D@_-`@;@`y9@:@;???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥt-s-(;s- ;s-;updatefats-4-,-<--Щ--D---Uw@KwG-A   . ..  ew@t@\9@;@,-8@-T@;p@x;@,-@-ķ@#;@-@-@d-4@-P@;l@;@T;@l;@,;ܸ@`;@t;@;0@h-L@8;h@-@;@-@-ع@-@;@-,@;H@L;d@}-@ |-@ ;@;Ժ@(-@- @-(@;D@H-`@0-@`y9@:@;AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZCE[]_acegikv`bdl;.`:.;.9.nfs_sillyworker>.<>.>.;13/ @l@`@F@2@&@@@@ʊ@@@t@^@@@@@@̉@@@@@ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  D@č@D@KwG.;P@;l@2;@PC;@8;ܸ@p8;@t;@C;L@x;h@h;@h;@h;@h;ع@h;@h;@h;,@h;H@h;Ժ@1;@7;D@3;`@X4;@:@;@.@.ķ@#;@.@@.@.4@D.@T;0@<3;d@hA.@8B.@ ;@\. @.(@;@`y9h.eL@t@\9@;@.8@M/T@DM/p@.@$/@l.ķ@#;@.@@.@.4@-P@;l@;@T;@l;@,;ܸ@h<.@t;@;0@И/L@8;h@/@`.@/@x/ع@l.@d/@@.,@L.H@L;d@hA.@8B.@ ;@\.Ժ@.@$. @.(@;D@t.`@.@h;@\.@;ffs_mapsearchffs_nodealloccgffs_freefile_commonffs_blkfree_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snap   ffs_isblockffs_isfreeblockffs_clrblockffs_setblockĒ@Ē@Ē@đ@        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?00 ;0;ffs_newvnodeffs_reload 000/x*0@x0p|0 ffs_sync8@p@@KwG0A02 B1 B|.e@t@\9@h;@:8@:|@:T@:p@:P@:l@:@:@:ܸ@:@:@:L@:h@:@:@:@:ع@:@:@:,@:H@:Ժ@:D@:`@:@h;@:@0@#;ķ@0@@0@X0@T04@0@T;0@0d@0@hw0@ ;@;Ժ@ؕ0@0 @0(@;D@$0@`y9x@0$@0@@0@0\@0@0л@;@;@;.ex@t@\9@h;@1;8@h;|@h;T@h;p@>;P@;l@2;@PC;@8;ܸ@p8;@t;@C;L@x;h@h;@h;@h;@h;ع@h;@h;@h;,@h;H@h;Ժ@1;@7;D@3;`@X4;@:@;@0@#;ķ@0@@0@X0@l04@0@T;0@8w0d@0@hw0@ ;@; @0(@;@`y9x@0$@0@@0@0\@0@0л@;@;@;.e@@t@\9@;@408@0|@0T@00p@0@ľ0@#;ķ@0@@0@X0@z04@q0P@;l@;@l;@T;@,;ܸ@`;@t;@;0@0L@8;h@0@h0@0@0ع@T0@0@0,@@0H@L;d@0@hw0@ ;@;Ժ@ؕ0@0 @0(@;D@$0`@0@`y9@:@;x@0$@0@@0@0\@0@0л@;@;@;@KwGh0qB2 B.e$@t@\9@;@h;8@h;T@h;p@D0@0@h;ķ@h;@h;@h;@h;4@h;P@;l@;@l;@h;@t;@h;0@<3;L@h;h@h;@h;@h;@h;ع@h;@h;@h;,@h;H@h;d@0@0@ ;@;Ժ@0@Ԋ0 @l0(@;D@h;`@h;@`y9@;ufs_inactiveufs_dircompactufs_dirgrow04000,00\0000KwG01 B ...01040uao_put 1 1111uvm_km_suballoc999T9 =999@@T@#@@@@1eB8eB?eBGeBNeBVeBaeBkBeBeBeBeBeBeBeBeBeBeBeBeBeBfB fBfBfB(fB0fBiBD@$3iB<@%*iB4@&iB,@'iB$@(iB@)hB@*hB @+hB@,hB@-hB@.hB@/hB@0hBܽ@1hBԽ@ 2hB̽@3shBĽ@4chB@5QhB@6BhB@t@@@@8@T@p@@@ķ@@@@4@P@l@@@@ܸ@@@0@L@h@@@@ع@@@,@H@d@@@@Ժ@@ @(@D@`@|@@@л@@@$@@@\@x@@@_B@pe@t@L:@`y9@;@:p@:@x;@:4@:P@;l@;@x;@:@$:h@<:@<:@d:ع@P:0@x;L@x;d@,:@x;@;@;Ժ@D:@: @:(@;@x;@:@:   ::L::te@t@\9@;@:8@h;T@h;p@:@:@d;ķ@#;@d;@d;@:4@`:P@;l@;@:@H:ܸ@:@t;@h;0@x;L@h;h@h;@h;@h;@h;ع@h;@h;@h;,@h;H@h;d@:@x;@ ;@;Ժ@:@h; @:(@;D@:`@;@x;@;genfs_suspendctl,;@;;;;h;genfs_can_access_acl_posix1e@ @@ @ @KwG$;kBlayer_bypass  e\@t@\9@;@1;8@h;T@h;p@>;@4;@d;ķ@d;@d;@d;@t;;4@D9;P@;l@2;@T;@PC;@8;ܸ@p8;@t;@C;0@<3;L@x;h@h;@h;@h;@h;ع@h;@h;@h;,@h;H@h;d@1;@2;@ ;@;Ժ@1;@7; @3;(@;D@3;`@X4;@`y9@:@;devclsdeviocdevoutdevindevwaitdeviodevopnKwGN;Adm;0f;q;`k;h;f;@f;de;06Lcdm;0f;q;o;n;h; 4706?3de;06LcdkdumpoBpB pBpBEFI PART(s*K>;A2IчH|8B|nQn- q+|8BZIчH2 B|nQn- q+2 BSFU0eC2 BIчHBIчHfmB-чHqB-чHpmBSFH0eC쬍pBS'@ )ѸqB*1@ )ѸqB1x )ѸqB3Dh&qB=rGy=iG}qB|nQn- q+qB;3ȏ;Ԏ;;;; 4706?34ȏ;Ԏ;;;4 ;42KaaaaaaaaSV;4;;ĕ; 47T;?34h;;;\;4; 4;06;4J3/////91?~~~~'~~~~~uuuuuuuu ;`;;4444 4706?341rB(;Ȯ;8;2;П;;;2_bpf_mtap_softint_initKwG̬;1rBrBsuŇ! Ȗ" % ˊ 6 C Α Q ՚ ] j w{ MO 7\KwG;rBifaddrpref_ioctlether_outputd n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ey}vr}nd_set_timerB@ijm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGB|8BBBpBBƃB2 BABɃBσBAդAԃBpBكBqBqBfmBqBB, BBBBBBpmBBqBqBqBqB  gnts=к=(==t=|A?VA?VApe BB==rbmn=T===H=e("Bstrtoullstrtoll1A>YB>^B>Ax=A(=B=|A|=tcid==|=$== ===x= 6A?VA?VAAnAxAEAyekd== =e dBhemBxe<vBe,~Batad=<==AABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/XeBloob>>> A A A Atruefalseyara>>l>>>1AXB[BEA`e Bstrtoul#!% NBCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025, 2026 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALLsrc@cvs:HEAD:20260216191442-xsrc@cvs:HEAD:20260211000912 NetBSD 11.99.5 (INSTALL) #0: Mon Feb 16 19:14:42 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL @(#)NetBSD 11.99.5 (INSTALL) #0: Mon Feb 16 19:14:42 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL 11.99.5NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopunable to acquire bus. error=%d output write failed. error=%d : GPIO controller ioexp%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDzlcdstdw100lcd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) lcdctlcouldn't register event handler zkbd: pseudo power management module zapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn und%s %08x , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsriep%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)scsiverboseperiphtapeprinterprocessorwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typescxsplunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer %02x DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter %s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA illegal length indicationATA volume overflowATA command abortedunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: %s error (0x%x) wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out atapiscsibusdetscsinitq: SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info target %d lun %d: <%s, %s, %s> %s %s%sLUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307PiSCSI SCSI CD-ROM QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA Virtual CDROM scsibusscsibus at %s channel %dscsi_subr drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %sALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibusoptical mediaread_cd_capacity: extra large block size %u found - limiting to 2kByte cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectors (%lu bytes/physsect; first aligned sector %udrive offlineunformatted media%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASrecalsetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %swd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer error "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d unable to create new screen (errno=%d)lcd_free on active screen : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacunable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciausbevtusbrhxfer: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hcusbtask-drunable to create task thread: %s usb_create_event_thread taskusb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usb at %spre 1.01.13.03.1usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach %s: bad descriptor %s: descriptor length too small %s: descriptor length too large hub-addresshub-portsubclassprotovendor-idproduct-idvendor-stringproduct-stringserialnumberusbverbose port %d configuration %d interface %dusbififusbdevifvendor %4.4xproduct %4.4x%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %dusbdly%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDwatchdog timeout open rx/tx pipes failed: %s tx list init failed rx list init failed usb error on intr: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) usb error on tx: %s Ethernet address %s usbnethub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %s reportid %duhidev%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lockuhid_usb%s: was console keyboard too many Variable keysbad modifier sizemultiple key code arrayskey codes not on byte boundarykey code size != 8attach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). ukbdusing %s over %s quirk init failed endpoint not found %u/%u/%u %s: Get Max Lun failed: %s unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=%#x not supported bus attach failed %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s ATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumassumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cb%s: reset failed failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out if_aueno union descriptor no data interface setting alternate interface failed unexpected endpoint could not find data bulk in could not find data bulk out faking address if_cdcecouldn't get ep %d %s: read MAC address failed if_cue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed could not read Ethernet descriptor if_kue%s: %s: bad register %04x failed to get interface, err=%s couldn't get endpoint %d if_urlmedia change failed read PHY failed can't read rxmodefailed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axe%s: reg = %#x: %s %s: packet length %u too short %s: rx_cmd_a: %#x %s: invalid packet length %d %s: packet length %d too long%s: not ready %s: timed out LAN7500LAN7800failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints %s: PHY not ready failed to initialize chip %s id %#x rev %#x failed to read MAC address if_mueif_udav%s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %ddevice enable failed timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTNXP UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled Could not create workqueue: %d unable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration %s: NIC memory corrupt - invalid packet length %d ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1timeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardlRoot hubOHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted ohci_setintr: 0 interval ohci_device_isoc_abort: early return ohciabt2WARNING: addr 0x%08lx not found , legacy supportohciabtohcixferOHCI version %llu.%llu%s unsupported OHCI revision SMM does not respond, resetting reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed too short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xreassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u %s: chan %d->%d ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: in6_setscope failed %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d : input=%d, output=%d, feature=%d uhidrea%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' WARNING: ignoring bad device address @ 0x%x : I2C bus i2cdevsti2c-child-devicesi2c-no-indirect-configi2c-enumerate-devicescompatibledevhandleWARNING: ignoring bad child device entry for address 0x%x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %s bus %di2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/C%/@%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleteextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx %s[%d %s]: hogging kernel lock pserialize%s: %s caller=%p%s[%d %s]: kernel lock spinout Kernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %d%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%s/modulesBuilt-in `%s' failed: %d moduleautounload_unsafeautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-registerconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfinifini rollback unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings: GAVE UP%s first in package: %s ureadc: non-positive residureadc: non-positive iovcntdevice-get-propertydevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectordisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_poolaiodone%s: invalid operation code {%x}naio_process: invalid aiost state {%x} efdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d found only zombie processes not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultfstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... filedelaydirdelaymetadelayinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvnfullvcachevnode cache hash%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_write typespec_read typeinvalid specfs vnode type: %dspec_ioctlspeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged DOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lxether-get-mac-addresslocal-mac-addressThe multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d %s: %s: can't handle af%hhd (%s) mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqgpiobus at %sis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempviocongpioirqumcpmioemcfancttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseuhidulptraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuswskbddevuhidbususbuspcmciabuswsemuldisplaydevapmdevifreportiddriveconfigurationproductchannellungpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3propstng%lliintegerpropnmbr%s: invalid base %d?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s cannot create file: %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes%s%dSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraecbetbdchfesprrcdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease11.99.5zaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]tmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700base32gamesgpufwmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sFATNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD11/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%cr%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %sraid%dvnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2d/%s%*s %spartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%lliStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD dataVMware VMkernel core dumpvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d )e,_y/`1fE8k==jBmF]GpGvEIzJJ~M=NRRUWWWZ_`Pro[rs5wpa}§YȧΧ}vrۧ:шш=5 5ټNM"i'i-i4}:}@~D^p}LV`yM̮q ԭ[@@Ѯ) ֮a @@ܮ Q zX-5  A  @@L  @@ unblock and -DNO_CONV?$xTH?> 100 0Usage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directory/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xmalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not found%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkn z EZ)>Xn#x x_^F<>?PATH= tfhdscmlr pnv  b    EOF reading here (<<) documentEQY]afkosw|' &+039A@=[.fK}-+?= @ &,29C@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'0 0. 1. 1/ 8/ 0B/ 0/ 0/ 0. 0Y!lfpt x!^>@1b dF oSOl d ]\Pf h  j                  9<9<%=a*$L2y=5)==`E֫# |QQ]^=-qŊI Gnn}="uPa(U ~06wQC$CN=>WJDaKuQ Z n @FLT Z^bNg"lrv | o  :fl| u-!qIq. Auq &,{  4@:@>  F C$CC$C']  d @28Av}HPZb@j@r z [@  0 )  @   #3# 3233#@QeuXj (.4:@FNVZ` djnt (2<FN^fljtzB. j (.4:@FNVZ` djnt (2<FN^fljtzB. 5pB^q  c   ɨ 'FY̩+ G!W#W$`&W1W2h3W4W56W899:;Ϫ<=@A(BdCDEͫFGHJLM&N-O=PMQ_RtSTUVWѬ\۬acd;e]fqghipqWsWtWuvWwx׭1>SbtѮ &>Xvӯ6<UUUuװ WWWW!9KdW{DZױ-LckͲ"*\pƳ'WW[`sWW)<O[~[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]hhpt (2<FN^fljtzB. returning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockdOdOdOdN        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?in_addr_flagsin_statuscommit_addressDDDsetifprefixlensetifdstormasksetifbroadaddrclone_commandusagestatusjZL0_printallmainziXMyiC`MDExC3L EHhME3JqM3MzMMU3MU3MMMMM MMM@ NN"N*N 3N0PjZLmedia_statusmedia_constructorOPNOX PPNOXNPNPPPPO PPNN<`&P`&$P>P P>P`EPMP@EPMP$P>P/P6Ppaddr_matchEMIMqIM;J'NGDMCMCsettunnelWQmPPQprint_link_addressessetvlansetvlanif6Rh~RjRLR~RVsetifssidsetifnwkeysetifbssid"X%X(X+XQXPX9_XXWXXXm_TxTT`* tH^XXdX cX^UjXU1a* RXX*S(XiTUTUI`TTi`RRXinvalid major numberinvalid minor numbertoo many fields for formatffs@ &.5=H@NY`gp  ¸ѻ @'8F]@~ռüǼϼӼټbnorripbgensbextattbnojolietbnocasetransbrrcaseins[[[[[[ [[ [[[@[[[[\\ \\ [[[[[[ [[ [[] ] @+]2]8]@B]H]g[@P]Lbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror[[[[[[ [[ [[ @[@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac[[[[[[ [[ [[B][@r`w`g0` `@``````` .@8_>_D_`M_W_a_ l_@recvrpcrpc_getportrpc_callsendrecv%s: can't read disk label; disk type must be specified%s partition type is not `%s'g?gwgggBhYhohhhhhiPiciiiiijJjjjjjWTWTbSS ǐDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY %Rj%Eq˜=kMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbhw.disknamesGr ***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]a: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data:ս./\ @YHYTPY #WY`Y#mY#vY#YYx#YYw#YYv#YYԏ#Y Z#Zu# Z#)Z#3Z#    "#$%   "#$%    "#$%&'()*+.  a#I1Lcs  (2<FN^fljtzB. ghx5U>>@=@:o8??9:=88eI%=B;q:49@EG4H'9988y8 (2<FN^fljtzB. p(----------------------------------- - --------------------   "#$%@//tmp/usr/var###Ծ##/ Details for index GPT part - /RUZ_hpbhԧB.mrvtx kh<]5e)aa)Y}eI= -Q Iʂʂ҂҂ւp ܂8 !SFH0eCSFU0eC쬡Hah!IdontNeedEFIւ(s*K>;҂|nQn- q+̓|nQn- q+܃|nQn- q+|nQn- q+ |nQn- q+=rGy=iG}܂&;Mt?2=mWC 3KOOHSyD<#*=(^hYbBRuoqrr3Dh&ʂ\ M}-@Mjy֬ńք-чH-чHZIчHIчHp)IчH842IчHOL6 %?a[`S'@ )Ѹn*1@ )Ѹ1x )ѸST.qBHo6֯iI-QW}eI ) cy  !]A5E  Z fySAƇЇ؇ $: *************************************************************************************************************************************************************************************************************************************** !    control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_configb cdLef ghi2j k l%m% no, pq&r7 s> F t8uN S vY w$x` zp yw A} B C`D EF G HI J K LM N O P Q S T U!V !W!X!!Zp 10!49!6B!L!|]!~i!}t!r!{!!!!!!!!!!!!!H!!%!!"""0"."7"5"="J""P"V"^"c"s"B|" """""" % % rt_new0 rt_buildrt_delete   "%%%%%% 0" %7"%make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_os''''''(if_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfdhcp_initread_leaselog_dhcpU1`1l1{11dhcp_bound1/11'7/1* 1dhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa) ) 9 9 ! ! VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B2 Ɗ52 ̊M2 Ҋi2 ؊2 ފ2 2 2 2 2 3 -3 BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ dV Ɗ̊Ҋ؊ފ @|xtcs_path(X bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_maxDƊE̊(FҊF؊pGފHH\IJJHKK B 1 -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nn|:pZnF$n31RLHD@;75+)++#+/'++ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>ca'''''''''''''''''''''''''''gm''aj'''''X'X'''dspbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Ktr`+NbP>r`G 2)9'=tr`+NbP>r`G 2)9'= 0C0,8M(*w\m:j kP`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc2;85_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror_inet6_rthdr_init_inet6_rthdr_add_inet6_rthdr_lasthop_inet6_rthdr_segments_inet6_rthdr_getaddr_inet6_rthdr_getflags_inet6_rth_init_inet6_rth_add_inet6_rth_reverse_inet6_rth_segments_inet6_rth_getaddrip6optleninet6_insert_padopt_inet6_option_space_inet6_option_init_inet6_option_append_inet6_option_alloc_inet6_option_next_inet6_option_find_inet6_opt_append__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&_DB?\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating <Q5vf9.z4 }Q5H@5UCmm};Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcG unvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array _xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_ry P ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labels@sJ}J@7r)E@&?ջ-$charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl>ox54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchbVRZ:{fkkmO=8^%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mn /usr/share/zoneinfo/Etc/UTC_strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf222222222IhII xXYIiIIIiyYY  &OOOOOOOOOe@Ce7:I\{~#Y0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentbk]wznQ_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGA$e  a]YUQMIEiea]BJ|xtDD0*m:31HB;\\9############9ZZ99Z#########################o^_getpagesizeqsort_r__sfvwrite__sflush__swsetup,#,#__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup333333333O << 0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk {__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEX+vw%|Y||||0,,-------- -$-(-$-0--8-<-. ,9.... U0           55$|555566$|@mhlkq5 @5 <)??gnts 4 6 4 7F D rbmnhD `C B C PC tcid,l `q v Tz j i i tj hj w??yekdy q $|h8GGHH0H@H\HhHHHHHHHHI I,I @ILI hItI I i IIIIIIJ(JLJXJ$|pJ,PWTW\WdWlWtW|WWWW(+WWVWV`+@+WWWW**TV`VlVxVVVVV,VV*VVVVVV(+VV@+VWW W`+W W0W,T'tL[& [&[&0 LP&81 [&:G[&OPV` &THS8'ld&P'[&XVWİk (mH'P.~ VJ 5~tbjijcfhkl&m8oDoPpapvpqrutHtvwwxx"z-zBCJOPSTVVXZ Z.5J V_ g Dt(_Qy15(!_Qy1/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin# }-+?=###%%%}) ) aEVenF IiL$l*m2C<nCfJPpWb^ufozqshvVVx+ @=P4d 7-`f ... ...hB1H1C'$$$]+ODFDPhAabCdhlNsuvW:w:zȼм]Ll]_L] 6BM]1e]Lؼ]0KM];5M]L]pL̽̿]{Lܿ]L]LXRT]2yFQ]-CDXY]52lFsFUؾ]LP ]LDP <]LX|xx0`<D\]90JJ]U/LC^EC]/L^E ^E]2M C ]LxP ]/MM]U/MC].C^E]3L 3L]i.E E]1.E E]-D D]O[]5?NN]>PP]e>PN]?O O]=NN]PQ]]PP]NPP]6Rp^D]V~R~R])VR jR].Xb]@XP_]=[QXQX]ZdXdX]Y*S *S]MYRXRX]`T* T]1aU* U]m_XX XX]oXtH`b,ikKZ9oZ9oZIpZnZpL9oZ9o;nZnZ}oZ9oZoZ9o[9o[o [9o@$  '@@[[[[[[ [[ [[ @[@2]......dA..##ΐ.Ԑlu2&`MC @ )  ɚ  eDښCx\ *EC•E ˕!ҕ"ٕ#>$%&'()*ĕ+, -/1$102<3E4J5N6$fl*b"°ְ̰:fKseVs{sls}S$sRsu\suR"sEl[s=ns_&smr_sjs l/ssYn\NsQ_`Msa~Ysb,s l8s\=spBsEpHsypLsElNsyXs []sSsbs1^sXEs_ s\s!hskfsuRms`4sQwrsvxseh]sb~sssqas-dsYpshVs-dٱsbs1z`&sRsu:sQwsyT2sYsyTsiv3sbsnsunЩssQwƱsoαsbԱsbرsbvs5_Ls]s^NsmNs}S~shvsElޱsQjsYrs)xsXsXszsebssr sksMis1v!sps}S*s]sy3sjs1u~s)xs[8sIS@spԐs}s*sRHsYrRs\>suQKs=k`syXs!.sfs]s)x"2s!@$!$-[T ~:hb Hz  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ Fs&Us&^emexeeeeeeee e#e.e5eAeHeTe[egeoe{ %s&2<"BeXk&7>o %3U""    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ &+/ is a directory is not a regular file (use -f to see it)@@ (SW  $%f+5c;m C R ^hs$">; 47   %#22?8Q [k w(!9$&%f)5e:  %6(44 B+P,b-q.*?5E//'FW WmkRkRkYcWbkCkc kG ky wb YMYrWca#b@#ٴ9YB#xc#d#5A#KgD(|e#f|#F# 5gx#Yxhp#ih#1Ij` qJX!T#kPHŲHHK@L#L8P##m0#;HVn("#byo  OpHP=q#r"#1Rs!#S!p# t T#u#/YuVw"\#x(y!XAh#-Ry#pzx#"5~!`# ?-#x':pAd#FVhD#l`H#X@# P(XH4#l@0#U8,#u'0(#Hi($$# $ ##!#/!#9U!#k(Y!##%#Jl###:^!l#t##.W#n#9EN]q\zT$/;AMUcow$W[y&/<HTamz3 # (press RETURN)W tags643{}abcdDgGhHilnNpPqrs tw xy !:#=(#(#3IKJL<<!(U"<0>1t1p2|U'$"*CD++D+cc#.t$t$..s-?>#.7#EFPc.alsh7# !"$'(+-.03569:ah=#ELLVZZQ b_,a p=#jjdt@=#{d<=#d8=#tal=#/bin/sheees[uQYQ5Q]TXsbQeieQsAc^;c][`ca}[U5cWcVcXcPPPPP.PUPaPmPyPPP=PIP PP%P1P[/cccPaUJeK UL-[MQTcTUUH/VIVJUKULUMNTO [vOOwP<c=)c>c?cR%OOOQQQIZMYe=eOQc}ReRMR)RZYRiVqORO MOYO<eOR%)O5OAOMWcs_cgcoc!wcRRRR#c1SSSQdddcES9dddjckcYSd)echOO cOc cNGccSmS!diddcb9T!T TSSSZYS;Vcb1W!WWAWWWWWWqWcWUWNNNNsNXXWWbbNN&cX'UX(GX)9XXXQVXX%yXXXXXXgM MhMhMhN<+NhCN[NKXqX c% sNhd XN(N{N H QF HV_FV`  xXF QAaFVaF8VaFV1b  # h 8F JP-^F LP^$ ; h}f2$ U2$ 2$X        X   T S\x sF8 cubF _]`F cPb1Rbqvz<nx)v9I[favz~(o o!0Mg8fDeȧq 4E HgOv$p]:X l    X  bv  = i ~       $ 1 ] i { 0%Q(uKp .VI in -AO^m{ '3?Md{| gA!!U""S###$$$$$2.$7$F$^$|$$$$$ %%"%4%N%Z%g%y%%%%%%%& &<&W&&&&&&&&&&&&&&& '"'4'M'b'v'''''''''''((,(6(@(M(V(e(z(((((((((( ))')Y* ++,,, -'-9-N\-j-n-r-w-------.G.d....../0/Y/%0=01%01E1d1111$2R2b2J+2222223A333 4m4{445_555556#6L6S6a6n6v666667> hc7778"8C8]8k8|888888888999p<<<< <<< ==7==> >V>>>>>>>>R? ??(?D?p??????@6@@@ AA)A.A4AAAB>CCC>PD0D^_ZDeDDDD7EfEE^FwFFFFF G@GfGGGGH;HQHfHyHHHHHHHHHH II;IT^JlJxJ~JJJJJJJJJJKKK$K6KGKVKhKoKyK KKKKK&KKKLL0L;LMLYLdLmLzLLLLLLLLLLLM"M6ML KEMPMeMrMzMMMMMMLKMMNN$N6N?NR2XNsNNNNNNNNNNNQ;QWQtQ|QQRSSSS TTQT[TlTTT[UsUUVVVeeeeeeeekkk8kks/ ftpr@iFrR%(r0r m@Ql =rJrUrdrpr4rrV| r irrr |rLrrr0rrr rr10r&r'r(r)r*\N+s, s.1//4<0#11=05>/O/?xM-@ xM-AxM-B .C xM-D M-E dM-F xM-G,R,,QU7UJ1sJ1c YsJ[Z[Za.dA;(  C"&*.47A V D Q G J W Z E d t*w{ !ό"ތ#$%& '());*D+N,T-[-h.o. //01z2~3456789:;<=č>֍?@[\\ ]5^@^R_]_f`s{~{|}}~Ŏ   ' '@'@'`'''#####$$$$$%%%|"%$%,&4&@&H'T'`'h(t(()))***+++,, , , - -( -, -4 .@ .L .T /` /l /t 6 ; ; 0 0 0 1 1 < < = =!> !>!? !2(!24!2 H#? T# @`#!@l#"@x##@#$@#%@#&@#'@#)@#*@#+@#&`#'`#,@$-@$.@$$/@4$0@@$(`P$1@\$2@l$3@|$)`$4@$5@$6@$7@$8@$9@$:@$*`%;@%<@(%=@8%>@H%?@X% `h%!`x%+`%,`%"`%#`%-`%$`%.`%/`%%`&C&C$&D,&D8&E@&EL&FT&F`&ch&ct&dx&d&ee&#&#&&&&&0&&&&&&&&'''' '('0'8'@'H'T'`'l'|''''''''''  @@n   @@,@0@@@H@T`\`hlt| @8 ,33333333$|$|FGG0GHG3333PUTUXU\U`U,DVUTC33    9 U  ; 33'339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[SžIIII  33UU33UU33UUN@>:d=;hJN@>:d=;K PO@>:d=;8MONH&z {({0{8{z\VhV+ '@{''D{H{T{x   @ 333333333333333333333333333333333333 33 33TS33 33\\(& 0000000000000000 H'3333v3333b33TTT (root)`33CPPPPPPP`Ttx|VZD]ZT\Z[X[[[VVVVW\4WDW^XX$Y\]ZZH]WYService unavailable|lA*aeabi 5TE  d7<p7xܭoAYrV`.T`0 AP:D"MP(onѽl _vX{[vgPx9g2$-'a;+e)owZT\n糈2ˬa}w=[?;IFr'"ت݈{f[`)k{?sqAykqo'YzQċ?76zg0g5e^i^>6:Z[Yg+;}Qo-jz.emD\)EwFzg>>D\F|,c=8ۏD|=E|is5+~ߢVG=׌g _Y(A6H7#_\;#YG۵'];!M~EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+xFramdiskbin.debugTx.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink /BHHHHPppVpp$bgt<<\yxWWV 'p+< MSGTXTS620 4976 5001 5018 5040 5043 5048 5056 5063 5071 5079 5082 5085 5088 5092 5104 5113 5126 5155 5170 5713 5747 6430 6718 7426 7482 7556 7652 7827 7850 7873 7879 7888 7910 7914 7918 7921 7924 8029 8232 8471 8912 9350 9385 9400 9412 9418 9430 9479 9499 9539 9556 9573 9588 9635 9673 9721 9803 9927 10063 10104 10142 10179 10214 10224 10273 10423 10429 10434 10438 10458 10568 10588 10594 10608 10620 10631 10668 10702 10726 10828 10865 10887 10986 11041 11099 11110 11126 11178 11346 11553 11724 11788 11840 12111 12660 13188 13619 13957 14290 14403 14418 14427 14587 14758 14908 15072 15095 15119 15134 15209 15349 15526 15681 15693 15773 15874 15920 15946 16016 16027 16036 16049 16075 16090 16106 16119 16174 16185 16200 16404 16637 16666 16681 16750 16824 16897 16927 16965 17019 17438 17464 17493 17597 17703 17888 18000 18115 18219 18906 19165 19305 19341 19511 19552 19688 19711 19748 19793 20044 20140 20194 20293 20304 20341 20378 20405 20414 20448 20455 20480 20507 20542 20556 20570 20599 20613 20630 20639 20661 20679 20696 20707 20726 20752 20770 20793 20810 20825 20840 20858 20885 20912 20934 20973 20991 21023 21251 21325 21368 21414 21561 21717 21761 22040 22067 22426 22610 22762 22943 23090 23248 23269 23317 23327 23335 23346 23357 23367 23374 23389 23401 23438 23468 23507 23560 23618 23639 23646 23665 23686 23693 23715 23737 23757 23779 23810 23847 23869 23883 23929 23958 23992 24032 24067 24095 24143 24152 24161 24166 24175 24184 24201 24205 24210 24216 24220 24233 24242 24269 24289 24312 24331 24358 24380 24412 24428 24433 24443 24466 24488 24505 24522 24535 24544 24553 24559 24586 24593 24617 24638 24662 24675 24694 24719 24742 24758 24764 24776 24806 24814 24854 24865 24876 24887 24904 24921 24935 24952 25400 25616 25880 26152 26204 26240 26276 26327 26344 26382 26396 26403 26420 26423 26428 26437 26449 26460 26469 26490 26532 26570 26586 26617 26642 26677 26733 26773 26794 26814 26855 26884 26932 27165 27200 27407 27426 27463 27524 27562 27601 27757 27772 27818 27866 27889 27925 27935 27945 27956 27961 28024 28072 28116 28177 28210 28311 28329 28468 28490 28613 28627 28637 28660 28765 28821 28937 28968 28973 28999 29038 29048 29091 29101 29117 29132 29150 29173 29203 29224 29250 29447 29490 29494 29500 29506 29511 29522 29536 29565 29597 29609 29656 29706 29746 29773 29789 29798 29841 29847 29855 29859 29879 29896 29908 29939 30195 30244 30820 30847 30879 30907 30959 30965 30971 30976 30997 31013 31035 31064 31205 31339 31352 31488 31490 31492 31494 31511 31524 31542 31569 31573 31579 31584 31592 31598 31638 31640 31650 31665 31682 31716 31748 31786 31815 31844 31866 31909 31935 31979 32115 32117 32119 32158 32225 32242 32256 32260 32267 32389 32458 32746 32884 33025 33106 33153 33159 33182 33228 33231 33257 33300 33365 33427 33497 33565 33658 33877 33902 33906 33942 33960 33988 34030 34074 34138 34188 34264 34286 34338 34382 34421 34455 34485 34516 34541 34550 34562 34570 34581 34593 34612 34636 34685 34702 34726 34769 35091 35094 35108 35121 35133 35140 35151 35158 35165 35174 35184 35201 35217 35267 35275 35283 35293 35304 35322 35339 35360 35382 35391 35401 35428 35434 35444 35463 35479 35497 35517 35526 35537 35544 35561 35580 35601 35611 35628 35634 35650 35665 35680 35701 35723 35742 35752 35757 35762 35780 35799 35818 35824 35843 35863 35883 35901 35906 35912 35929 35945 35966 35979 35987 36007 36031 36048 36056 36067 36088 36094 36106 36128 36142 36151 36172 36190 36199 36233 36256 36283 36315 36338 36358 36369 36401 36417 36428 36441 36464 36486 36994 37024 37055 37083 37097 37298 37520 37687 37774 37791 37809 37826 37855 37902 37913 37932 37954 38033 38225 38253 38371 38393 38534 38553 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVDDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzSendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): Kernel (GENERIC)Kernel (C700)TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.th cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.ny length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS620 4976 5014 5031 5046 5049 5052 5057 5065 5073 5081 5084 5087 5096 5108 5120 5129 5138 5164 5175 5710 5737 6303 6603 7244 7291 7404 7497 7531 7550 7568 7576 7585 7610 7614 7618 7621 7624 7746 7931 8159 8679 9030 9059 9072 9085 9090 9110 9129 9150 9209 9226 9240 9262 9307 9333 9374 9452 9570 9684 9738 9767 9799 9838 9844 9877 10000 10007 10011 10019 10043 10125 10131 10138 10150 10164 10173 10206 10225 10237 10347 10409 10428 10547 10598 10650 10662 10681 10733 10937 11145 11336 11396 11445 11711 12169 12834 13256 13578 14003 14135 14167 14179 14357 14554 14715 14849 14869 14902 14916 14985 15098 15270 15405 15425 15537 15629 15652 15675 15734 15749 15770 15785 15806 15826 15851 15865 15889 15901 15919 16129 16379 16400 16416 16469 16537 16610 16647 16673 16749 17206 17232 17254 17361 17468 17669 17742 17826 17926 18421 18659 18810 18844 18979 19023 19162 19203 19248 19295 19539 19672 19734 19828 19833 19867 19901 19916 19944 19977 19984 20009 20027 20053 20060 20075 20090 20110 20150 20167 20187 20208 20230 20245 20265 20287 20302 20315 20329 20341 20353 20367 20390 20413 20431 20474 20525 20562 20747 20810 20846 20895 20986 21116 21169 21429 21476 21837 21987 22156 22296 22416 22548 22588 22635 22645 22653 22663 22671 22682 22693 22707 22732 22773 22806 22839 22874 22928 22953 22972 22994 22999 23005 23034 23051 23078 23096 23117 23139 23158 23168 23198 23224 23251 23300 23328 23355 23408 23418 23428 23434 23444 23453 23473 23477 23482 23488 23492 23505 23514 23545 23562 23589 23610 23630 23649 23675 23688 23696 23712 23743 23774 23795 23821 23834 23842 23853 23859 23883 23893 23905 23923 23934 23954 23970 23996 24018 24034 24046 24066 24092 24098 24128 24142 24156 24179 24198 24217 24235 24253 24671 24872 25112 25296 25374 25429 25496 25536 25559 25593 25604 25612 25635 25638 25641 25647 25658 25670 25683 25713 25757 25770 25783 25820 25834 25845 25856 25867 25884 25895 25942 25965 26014 26255 26288 26543 26564 26597 26650 26676 26703 26859 26865 26908 26928 26947 26976 26983 26990 26997 27002 27051 27089 27123 27180 27208 27253 27270 27371 27376 27453 27467 27477 27501 27624 27705 27815 27843 27848 27864 27893 27901 27942 27949 27963 27976 27984 28003 28036 28056 28076 28292 28323 28328 28335 28342 28346 28360 28372 28387 28420 28433 28488 28546 28582 28600 28618 28636 28673 28679 28687 28691 28712 28729 28740 28762 28940 28984 29686 29710 29744 29763 29808 29815 29822 29826 29850 29861 29866 29929 30050 30173 30186 30320 30322 30324 30326 30336 30345 30358 30385 30389 30395 30400 30409 30414 30441 30443 30456 30468 30483 30511 30555 30602 30618 30640 30651 30684 30704 30753 30853 30855 30857 30898 30989 31006 31020 31025 31031 31140 31199 31450 31591 31718 31786 31823 31830 31857 31903 31906 31927 31972 32023 32082 32151 32198 32303 32446 32471 32475 32509 32526 32550 32602 32653 32725 32791 32889 32906 32937 32973 33007 33031 33055 33088 33108 33118 33126 33134 33144 33155 33169 33195 33243 33266 33286 33327 33626 33629 33643 33655 33662 33681 33695 33702 33709 33718 33728 33745 33761 33809 33817 33825 33835 33846 33864 33881 33900 33920 33927 33944 33961 33968 33981 34016 34033 34052 34072 34082 34098 34111 34129 34149 34170 34180 34200 34220 34233 34252 34265 34289 34312 34325 34336 34341 34348 34366 34385 34404 34412 34431 34451 34476 34494 34501 34508 34521 34530 34551 34564 34572 34592 34620 34637 34643 34654 34685 34693 34706 34728 34750 34759 34780 34798 34805 34828 34847 34874 34892 34912 34925 34940 34961 34975 34982 34996 35011 35030 35575 35608 35636 35665 35673 35710 36022 36199 36276 36293 36311 36326 36348 36398 36408 36425 36447 36506 36664 36688 36818 36843 36969 36987 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVDDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroSendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): Ncleo (GENERIC)Ncleo (C700)TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system wiMSGTXTS620 4976 5012 5029 5044 5048 5052 5057 5068 5074 5080 5083 5086 5089 5093 5105 5117 5127 5157 5169 5598 5625 6201 6561 7246 7307 7385 7480 7520 7542 7560 7566 7575 7601 7605 7609 7612 7615 7737 7922 8150 8679 9097 9126 9139 9152 9159 9179 9198 9221 9264 9284 9303 9326 9370 9399 9440 9506 9618 9732 9786 9815 9847 9886 9892 9925 10003 10009 10013 10018 10059 10196 10206 10214 10233 10247 10256 10288 10329 10342 10467 10525 10544 10663 10719 10771 10782 10798 10837 11087 11259 11431 11486 11521 11770 12173 12471 12738 13099 13279 13598 13618 13631 13820 13964 14160 14294 14314 14347 14366 14467 14622 14810 14997 15017 15096 15194 15232 15255 15345 15366 15389 15408 15432 15462 15506 15539 15562 15574 15592 15860 16179 16210 16245 16309 16384 16454 16485 16515 16607 17098 17128 17145 17285 17426 17623 17742 17889 18056 18614 18910 19091 19136 19299 19353 19488 19524 19584 19634 19925 20034 20091 20188 20193 20228 20263 20278 20302 20335 20340 20365 20381 20404 20411 20428 20443 20462 20494 20498 20518 20536 20548 20561 20579 20603 20621 20640 20667 20694 20706 20727 20757 20787 20812 20845 20880 20918 21171 21240 21295 21356 21474 21633 21687 21948 21999 22375 22530 22674 22814 22922 23107 23137 23180 23190 23198 23208 23220 23241 23250 23256 23288 23328 23364 23402 23439 23487 23511 23523 23537 23545 23553 23580 23597 23626 23647 23670 23679 23698 23710 23754 23792 23819 23863 23891 23918 23971 23982 23993 24000 24010 24019 24053 24057 24062 24068 24072 24085 24095 24125 24148 24177 24199 24221 24243 24270 24282 24294 24313 24347 24380 24401 24425 24438 24450 24463 24469 24495 24505 24516 24540 24550 24570 24590 24607 24633 24657 24670 24690 24724 24731 24760 24783 24806 24822 24837 24852 24867 24881 25312 25503 25738 25926 25968 26018 26072 26120 26142 26183 26194 26202 26226 26230 26234 26243 26254 26265 26280 26311 26357 26370 26383 26413 26427 26439 26451 26463 26481 26504 26549 26572 26632 26884 26911 27173 27191 27218 27267 27297 27328 27460 27467 27516 27539 27563 27592 27600 27610 27618 27623 27676 27725 27765 27831 27864 27908 27931 28032 28037 28114 28128 28138 28162 28285 28366 28476 28504 28509 28525 28554 28562 28603 28611 28625 28638 28646 28665 28698 28718 28738 28954 28985 29005 29011 29018 29022 29037 29056 29082 29091 29103 29157 29215 29250 29269 29286 29298 29333 29339 29347 29351 29372 29389 29400 29425 29603 29657 30348 30367 30402 30432 30478 30484 30491 30495 30519 30535 30541 30616 30766 30885 30898 30966 30968 30970 30972 30982 30995 31012 31039 31043 31049 31054 31063 31068 31095 31097 31110 31122 31137 31165 31209 31256 31272 31294 31305 31338 31358 31407 31507 31509 31511 31559 31649 31666 31680 31685 31691 31794 31846 32092 32253 32408 32479 32532 32539 32566 32616 32619 32640 32686 32741 32800 32869 32916 33021 33164 33189 33193 33227 33244 33282 33335 33375 33451 33516 33610 33631 33669 33709 33745 33769 33792 33831 33861 33868 33877 33885 33893 33907 33923 33951 34003 34020 34041 34085 34427 34431 34446 34457 34465 34484 34496 34503 34510 34519 34529 34546 34562 34616 34624 34632 34642 34653 34671 34688 34704 34722 34729 34747 34764 34771 34781 34812 34831 34850 34870 34880 34899 34912 34932 34952 34973 34983 35002 35021 35031 35048 35062 35085 35109 35122 35132 35137 35141 35159 35178 35197 35202 35221 35241 35266 35281 35285 35292 35302 35311 35332 35346 35354 35374 35400 35417 35425 35436 35467 35472 35485 35507 35522 35531 35552 35570 35579 35623 35647 35674 35689 35706 35720 35751 35775 35806 35813 35827 35842 35861 36406 36439 36467 36496 36504 36541 36853 37030 37107 37124 37142 37157 37179 37229 37239 37256 37278 37337 37495 37519 37649 37674 37800 37818 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVDDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : Kernel (GENERIC)Kernel (C700)TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of aMSGTXTS620 4976 5017 5033 5051 5055 5059 5069 5078 5084 5090 5093 5096 5105 5115 5128 5136 5147 5172 5184 5692 5724 6216 6505 7050 7096 7200 7286 7322 7337 7355 7363 7371 7398 7402 7406 7409 7412 7523 7708 7936 8412 8746 8775 8790 8805 8813 8827 8845 8866 8917 8933 8943 8963 9009 9039 9092 9149 9260 9381 9425 9458 9497 9531 9538 9571 9648 9654 9661 9668 9697 9809 9815 9826 9843 9860 9869 9898 9910 9920 10021 10083 10103 10223 10260 10316 10330 10351 10388 10598 10773 10922 10957 11009 11225 11538 12061 12422 12712 13105 13240 13253 13264 13410 13589 13720 13854 13874 13907 13926 14009 14124 14265 14390 14404 14512 14605 14634 14654 14730 14747 14765 14781 14800 14820 14837 14849 14875 14887 14905 15106 15345 15372 15389 15445 15507 15567 15598 15622 15681 16027 16057 16074 16182 16292 16432 16506 16582 16660 17152 17372 17483 17514 17641 17677 17805 17832 17872 17918 18134 18258 18326 18426 18431 18467 18503 18517 18540 18573 18577 18602 18621 18647 18652 18667 18682 18701 18726 18738 18760 18777 18790 18802 18820 18844 18859 18876 18889 18900 18911 18931 18960 18989 19013 19048 19083 19110 19297 19346 19378 19426 19523 19656 19702 19894 19924 20246 20375 20515 20655 20772 20907 20951 20994 21002 21012 21024 21036 21044 21055 21082 21116 21151 21182 21217 21253 21300 21320 21337 21355 21360 21367 21392 21408 21429 21446 21463 21481 21498 21511 21542 21567 21598 21629 21664 21691 21744 21754 21764 21770 21779 21787 21802 21806 21811 21817 21821 21834 21844 21873 21889 21915 21932 21951 21972 21988 22001 22006 22014 22029 22055 22074 22102 22120 22131 22137 22143 22164 22174 22185 22203 22225 22242 22255 22276 22296 22316 22327 22340 22362 22369 22394 22409 22429 22441 22458 22475 22495 22514 22824 23004 23215 23403 23469 23516 23571 23615 23635 23664 23676 23682 23698 23702 23706 23714 23724 23736 23751 23770 23806 23817 23828 23867 23879 23889 23899 23909 23925 23943 23992 24013 24058 24302 24328 24582 24597 24623 24680 24714 24749 24891 24908 24957 24978 24994 25023 25028 25033 25039 25044 25083 25118 25148 25203 25236 25282 25296 25375 25380 25434 25448 25458 25482 25568 25616 25722 25756 25763 25778 25805 25814 25853 25860 25882 25901 25917 25935 25967 25986 26003 26160 26191 26198 26207 26215 26222 26236 26254 26273 26283 26295 26336 26381 26410 26431 26454 26473 26511 26517 26525 26529 26550 26567 26576 26595 26741 26783 27293 27301 27325 27343 27387 27392 27397 27401 27432 27445 27454 27500 27626 27717 27729 27793 27795 27797 27799 27809 27823 27838 27865 27869 27875 27880 27889 27894 27921 27923 27938 27949 27964 27992 28036 28083 28099 28121 28132 28165 28185 28234 28334 28336 28338 28373 28449 28466 28480 28487 28493 28592 28648 28924 29048 29159 29221 29259 29267 29289 29338 29341 29362 29407 29462 29521 29590 29637 29742 29885 29910 29914 29948 29964 29989 30037 30073 30134 30188 30269 30291 30330 30367 30399 30423 30450 30476 30490 30498 30508 30516 30530 30543 30555 30579 30620 30646 30663 30692 31016 31019 31033 31045 31051 31067 31079 31086 31093 31102 31112 31129 31145 31188 31196 31204 31214 31225 31243 31260 31273 31299 31306 31314 31331 31339 31356 31380 31399 31418 31437 31447 31458 31472 31490 31510 31530 31539 31562 31582 31593 31608 31620 31639 31658 31669 31679 31684 31690 31708 31727 31746 31753 31772 31792 31817 31834 31840 31848 31858 31870 31891 31907 31915 31935 31955 31977 31985 31996 32019 32026 32040 32062 32079 32088 32109 32127 32136 32167 32183 32210 32229 32249 32267 32288 32302 32322 32329 32348 32363 32382 32927 32960 32988 33017 33025 33062 33374 33551 33628 33645 33663 33678 33700 33750 33760 33777 33799 33858 34016 34040 34170 34195 34321 34339 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVDDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymSendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalowanie bootblokow na %s.... Twoje partycje NetBSD na %s wygladaja nastepujaco (Rozmiar i offset w %s): Kernel (GENERIC)Kernel (C700)RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm sh stty sync# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  . ..zero wsmuxctl3 wsmuxctl2 wsmuxctl1 wsmuxctl0wsmux3wsmux2wsmux1wsmux0wsmouse3wsmouse2 wsmouse1!wsmouse0"wsmouse#wskbd3$wskbd2%wskbd1&wskbd0'wskbd(wsfont)wd3p*wd3o+wd3n,wd3m-wd3l.wd3k/wd3j0wd3i1wd3h2wd3g3wd3f4wd3e5wd3d6wd3c7wd3b8wd3a9 wd3:wd2p;wd2o<wd2n=wd2m>wd2l?wd2k@wd2jAwd2iBwd2hCwd2gDwd2fEwd2eFwd2dGwd2cHwd2bIwd2aJ wd2Kwd1pLwd1oMwd1nNwd1mOwd1lPwd1kQwd1jRwd1iSwd1hTwd1gUwd1fVwd1eWwd1dXwd1cYwd1bZwd1a[ wd1\wd0p]wd0o^wd0n_wd0m`wd0lawd0kbwd0jcwd0idwd0hewd0gfwd0fgwd0ehwd0diwd0cjwd0bkwd0al wd0murandomnttypfottypepttypdqttypcrttypbsttypatttyp9uttyp8vttyp7wttyp6xttyp5yttyp4zttyp3{ttyp2|ttyp1}ttyp0~ttyHstatttyHcfgttyH7ttyH6ttyH5ttyH4ttyH3ttyH2ttyH1ttyH0ttyGstatttyGcfgttyG7ttyG6ttyG5ttyG4ttyG3ttyG2ttyG1ttyG0ttyFstatttyFcfgttyF7ttyF6ttyF5ttyF4ttyF3ttyF2ttyF1ttyF0ttyEstatttyEcfgttyE7ttyE6ttyE5ttyE4ttyE3ttyE2ttyE1ttyE0tty01tty00 ttystdoutstdinstderr st1 st0sd3psd3osd3nsd3msd3lsd3ksd3jsd3isd3hsd3gsd3fsd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2asd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2k rwd2j rwd2i rwd2h rwd2g rwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1e rwd1d!rwd1c"rwd1b#rwd1a$rwd1%rwd0p&rwd0o'rwd0n(rwd0m)rwd0l*rwd0k+rwd0j,rwd0i-rwd0h.rwd0g/rwd0f0rwd0e1rwd0d2rwd0c3rwd0b4rwd0a5rwd06rst17rst08rsd3p9rsd3o:rsd3n;rsd3m<rsd3l=rsd3k>rsd3j?rsd3i@rsd3hArsd3gBrsd3fCrsd3eDrsd3dErsd3cFrsd3bGrsd3aHrsd3Irsd2pJrsd2oKrsd2nLrsd2mMrsd2lNrsd2kOrsd2jPrsd2iQrsd2hRrsd2gSrsd2fTrsd2eUrsd2dVrsd2cWrsd2bXrsd2aYrsd2Zrsd1p[rsd1o\rsd1n]rsd1m^rsd1l_rsd1k`rsd1jarsd1ibrsd1hcrsd1gdrsd1fersd1efrsd1dgrsd1chrsd1birsd1ajrsd1krsd0plrsd0omrsd0nnrsd0morsd0lprsd0kqrsd0jrrsd0isrsd0htrsd0gursd0fvrsd0ewrsd0dxrsd0cyrsd0bzrsd0a{rsd0|rmd1d}rmd1a~rmd1rmd0drmd0armd0rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rcd1drcd1arcd1rcd0drcd0arcd0randomptypfptypeptypdptypcptypbptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0memmd1dmd1a md1md0dmd0a md0ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullest1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drumconsttyconsolecd1dcd1a cd1cd0dcd0a cd0 bpf0bpf . .. dhcpcd.confgroup master.passwd netconfig protocolsserviceswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  ... . .. dhcpcd-hooksdhcpcd-run-hooks fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dmesg fdisk fsck fsck_ffs halt ifconfig init mknod mount  mount_cd9660  mount_ffs  mount_mfs  mount_msdos  mount_nfs newfs ping ping6 reboot restore route rrestore swapctl 0umount ... ... . .. binmdecsbinshare . .. ftp gunzip gzcat gzip less more progress sed tar `tip ... . .. chroot . ..misc ... . .. db log runspool ... ... ... . ..lock ...&A%KccccccPccccc"#'(),-h"#'(),-@AX < A ! + (- - l( ,, $, `A|d( ( `A`. / JA82 4 = p###< A>zA(< ? c(A $L J \K @ ADP>A(@ C xcAhL `M R>`R>W T P P P BApP `Q X X X $` `a Z Z X iAX ] Ac c Ad e cAs s t t t u u t t u u u ć ( u X p  0 u u u  v (v Ј H ` x ؉  8 P h | A8v v  @vc earmzaurusbAtA~AAAAA < D ̧ h ħ  Ȩ    ( 0 4 p 0 , 0 (   ` ` AH  ʏH!H!BHA Н!!!4!!IAP!!!p!qB! !!#B"`A@Dn"h"(p"`A8"""\caATcaALcaADcaAcA""""""""p "l t ć h p ̄ ( 0 Ă ܂  ȃ D Ј ؉ l 8 P h  4 ,   H | bA"$" \mnop0123789quv./*+01236789 ./"'*+bA-""fA""""""""p """"ć ""X p  0 "4"P" X"`" Ј H ` x ؉  8 P h | @8"fAdfAH""x{x{hA8#L#"iA|'#L$### & &,#'#(#'# ,#'#(#(# (#D(#*#P(#.#tjA@G#F#@N#8K#TJ#K#K#J#M#M#\J#O#O#dJ#pnA`g#Xi#xA@i#j#i#i#4k#BwA`###X%wA#l#8#xAt##$# zA"x##,#(s%cA(###8##????A4,$(4$8-$-$@,$A4,$(4$8-$-$@,$Ad<$<$L;$:$APL$tL$dL$A4V$Q$@P$P$P$*Af$D^$T]$\$\$A\}$T$)$+$JAH$$)$+$A$؏$)$+$A`$4$0$+$AH$̠$)$+$AT $T$)$+$AH($$)$+$AH\$$)$+$%$$@A& 1&$1& &#&0)&0&'&,&& &P&zټ|Ff梂 &Sk@5 5\-gӿ6C* fFq{ Ց ^)>ttmk%Czټ|Ff梂&Sk@5&ܠ&P&AX&t&(&AfAjAnArAuA|A\AaAfAkAqAAAAAAAAA$A+A0AA9A@ALAXA+A5A?AIASAuAAAAAAAAAAAA7BAAAX\A@@|< $p(@(+(+(\(K(J(@XdX@d@ h h 8"'-T39?? < ddi(p%cp)ȩ)$)d)t)ij)$XdX@ X@A*"@$@|<@<l*8n*n*o*Tn*+"@g `TK+hK+xK+ K+K+N+M+ `$A+P++,++yA ,,,p,Al',*,,p,*Al-,@-,,p,QAl<1,2,,p,Al5,45,,p,Al8,:,,p,Al=,;,,p,Al >,t?,,p,AlB,C,,p,AldF,G,,p,Al`J,J,,p,AlM,N,,p,kAlP,P,,p,D\,[,|\,=A[,lq,NA[,p,Xk,I@H@,@,,H, ,d2d#A`,,,,++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy((((((())((((((())SZZys[zzRTAL9CEINCOUYrUal:ceinDouyAa L= S` Td Z} l> sa te z~ C  E D NG RX c  e d nH rY'S^'s_'C'Tb'c'tcAIOaioAEOUaeouZ{z| OP Up oQ uq(A(a(E(e Un uo7LA7lB,h,x,,,H2cf@g@f@f@f@j@j@j@j@pj@`j@Pj@Ap2c">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||AT-(G-L-M-4H-0G-M-H- M-,H-02-t2-x2-S-4(:;;;4o@A-ĭ-ر-|-4ܮ-\-$-u-p-$-t-t-t-x-4(:;;;4w@@2BA2 4S2^2|uc8S24g2_2g2BBBBBB Notice: this software is protected by copyright/var/crash/%n.core $433 7 7 @@:l744dL:M:4<:p:: 40U: |V:32 4 4xO44-:V4P4P44 (.9 89|-9 +9 X29 29Q:S:T:`0:,74O44d7o7LQ464 4 Q44X4Y40244 74\b:L: S: v3a:=:444434444452<1 ̰1 144 1hQ4\X4O4Q4 4444444e7 Ԣ7 g744]: du4 4  9 4 t4444 d9t'994 44444 4 4444T(94 X7 М74 W:PU:4W4W4`:44m7K:$89$'9!9`:`:444 444444Q444 444444444444444>!7h7 74444 N: |O:448(8484W4W4V4 4 444444dS:@m7`(9w444 1 (4 N:\:]:5X11L:4@P4T_4 744444444444 4 44 4444 4 44 4444 k5,k544o54_:p11 47̫744444444444444 444444,744P`: '2 4 01U: W:4 L1444\7 3 V: tW:  X:O4834 LO: ,P: 47 7T749$;:4444 4 4tT:DX4 477 777777 7777747 77 7@744444444444444744 [4?347888T8$8X844 x^:5 4 4 4 4H::x: :\:: :l:: p::D::44 :Ȼ::<:Խ:l: : : ::$::444 `:444 9 B: F:4 444444 444444d-:d177 77 n77\5^5<\:_54h\:\: s5p5W5W5X5[5 74444$77 4R:m7R:4 4 4p}4n5lo54؎3J: F:4Ho7 4?3 ,9L:0`: (K: J: `:Q:U:PW: v3S:Z:x@:S: L: N:Z:3:i3/989\5h7 b: xc:d3 \5 8: <6:  7:G: _9 0^9\9 `9 x_9  ^9 _9 T^9\9\9 `9 a9tS:7L3lr7Hv7w7 e7444444(scD2+B4W B"BW B!BW B5AW B"BW B"BW B"BW B"BW B"B#B@#B@!#B,#B@9#B@E#B@S#B@`#B@@j#B@v#B @O3O3#BKc@4(4؋  1T vc%B3@c@c?@@yc%BLexcxc xc4}/B3}/B3,ycLe|cWeKeOeOe|ucsystem{cearm|ct4B44B4B4H6BS6BL4d6Bn6B\4{6B6B46B6Bd46B6BD4q (root)`%n.coreXcXcc@cccHcccPcccXcc|+5@B>B0ucc5cȅcЅc؅cc4ccHcXc46t646t646t6 46t6@46t646t646t646t646t646t646t6 46t6@46t646t6x6`6c tn p TB$UBTB4UBd$7%7  @ 4LcTcYB858@8(888T8?8YB858@8(888T8?8ciB@@8[BTM9Q9S9@|@ @a9a9lockf2  jBd:d:d:d:d:4d:d:d:t:d:4d:d:d:d:d:d:d:d:d:4@XBXBa;xd;b;pB;qB;vkA;$;;@;P;; ;;;T;;T;0;8;,c;;;;;;;;;;{uBI<@I<"""yB|<@4@Zm0u`,A@CBAHBBBHAFMBGGRBHAIWBJ\BMeBNoBTuBUyBVBWBXBYBZB[aA\\B]B^B_B`BaBcBdAeÂBfpnAĝBh҂Bi؂BkނBlBmpc@@W>@@4@@?>,@>|>p@h@@XH@N@?@@~>P@P?@x>p@`><@,@@@dc̝@(>h@>P>$?@qBfAаc@qBfAc@qBfAc@qBwAHc@CBALc@AAp@aA`A\@yAyAPct@AATct@*A*AXct@QAQA\ct@AA`ct@AAdct@AAhct@AAlct@AApct@AAtct@AAxct@AA|ct@kAkAct@ A zAc@OBBwAc@BxAc@ UA UAc@1BNAc@@1BNAc4@#A#A cL@#A#A(c@%iA"iAc@AABAc|@BHABHAc@IAIA@qBqB0c@qBqBc@#B#B8c@HAHAc@`A`Ah@cAcAc|@bAbAc@bAbA c@fAfA0c@AzA@c@hAhAPc@B`A`c@tjAtjApc@BAc@AAc@AAc@AAc@AAcX@JAJAc@AAбc@AA(@BABAc@pnApnAd@iAiAc@AAc@xAxA@c@AA@AA@AAȯc@AAc@AAc@AAc@AAc@JAJA(c@AA@c@AAXc@AApc@AAc@AAc@AAc@@ @p@L@ @@AHA@A@A@A@AAJAA@A@A@A@A@A@xA@AiA@pnABA @AA@JA@AAA$@B,@tjAB4@hAA<@fAbAD@bAcAL@`AT@HA#BqBIA\@BHAd@Bl@At@vkA%iA|@#A1B UA@B@OB@ AkAAAAAAAAAQA*AAyAaAA@CBqB@A=ϺA@c?%BrTB,@NetBSDKwGA(aeabi5TE  $NetBSD: locore.S,v 1.44 2022/04/02 11:16:07 skrll Exp $$NetBSD: md_root.c,v 1.19 2015/08/30 05:24:03 uebayasi Exp $$NetBSD: autoconf.c,v 1.18 2025/05/19 06:16:24 andvar Exp $$NetBSD: machdep.c,v 1.55 2024/05/13 00:08:06 msaitoh Exp $$NetBSD: subr_disk_mbr.c,v 1.61 2026/01/04 03:16:30 riastradh Exp $$NetBSD: ziic.c,v 1.7 2025/09/15 13:23:03 thorpej Exp $$NetBSD: scoop.c,v 1.13 2014/09/23 14:49:46 nonaka Exp $$NetBSD: scoop_pcic.c,v 1.4 2011/06/19 16:20:09 nonaka Exp $$NetBSD: ioexp.c,v 1.2 2018/06/16 21:22:13 thorpej Exp $$NetBSD: zssp.c,v 1.15 2021/08/07 16:19:08 thorpej Exp $$NetBSD: zlcd.c,v 1.21 2022/05/28 10:36:23 andvar Exp $$NetBSD: w100lcd.c,v 1.6 2022/05/28 10:36:23 andvar Exp $$NetBSD: w100.c,v 1.4 2021/11/20 00:17:10 rin Exp $$NetBSD: lcdctl.c,v 1.3 2012/01/29 10:12:41 tsutsui Exp $$NetBSD: zkbd.c,v 1.22 2021/08/07 16:19:08 thorpej Exp $$NetBSD: zapm.c,v 1.14 2021/08/07 16:19:08 thorpej Exp $$NetBSD: zusb.c,v 1.6 2011/07/19 15:11:49 dyoung Exp $$NetBSD: zmci.c,v 1.5 2012/01/29 10:12:42 tsutsui Exp $$NetBSD: vfp_init.c,v 1.78 2022/08/20 11:34:08 riastradh Exp $$NetBSD: cons.c,v 1.96 2025/12/20 10:51:05 skrll Exp $$NetBSD: fiq.c,v 1.10 2020/02/24 12:08:08 rin Exp $$NetBSD: mainbus.c,v 1.24 2022/09/27 06:36:42 skrll Exp $$NetBSD: mainbus_io.c,v 1.24 2018/03/16 17:56:32 ryo Exp $$NetBSD: cpu_mainbus.c,v 1.19 2024/05/09 12:41:08 pho Exp $$NetBSD: disassem.c,v 1.42 2020/12/01 02:48:28 rin Exp $$NetBSD: bus_stubs.c,v 1.3 2021/09/18 09:49:57 jmcneill Exp $$NetBSD: arm_cpu_topology.c,v 1.9 2024/12/10 11:27:29 jmcneill Exp $$NetBSD: arm_machdep.c,v 1.68 2023/10/04 20:28:05 ad Exp $$NetBSD: ast.c,v 1.32 2021/02/01 19:31:34 skrll Exp $$NetBSD: bcopyinout_xscale.S,v 1.12 2022/10/20 06:58:38 skrll Exp $$NetBSD: blockio.S,v 1.9 2022/10/20 06:58:38 skrll Exp $$NetBSD: bootconfig.c,v 1.13 2020/10/18 16:28:57 skrll Exp $$NetBSD: copystr.S,v 1.14 2022/10/20 06:58:38 skrll Exp $$NetBSD: core_machdep.c,v 1.10 2020/11/10 21:38:03 rin Exp $$NetBSD: cpufunc.c,v 1.186 2025/10/09 06:15:16 skrll Exp $$NetBSD: cpu_exec.c,v 1.13 2020/12/01 02:43:13 rin Exp $$NetBSD: cpu_in_cksum.S,v 1.13 2022/10/20 06:58:38 skrll Exp $$NetBSD: cpu_subr.c,v 1.6 2025/09/06 02:53:22 riastradh Exp $$NetBSD: idle_machdep.c,v 1.6 2021/02/17 06:54:23 skrll Exp $$NetBSD: process_machdep.c,v 1.35 2021/02/01 19:31:34 skrll Exp $$NetBSD: sig_machdep.c,v 1.53 2024/04/14 07:56:13 skrll Exp $$NetBSD: sigcode.S,v 1.8 2005/12/11 12:16:41 christos Exp $$NetBSD: syscall.c,v 1.69 2023/10/05 19:41:03 ad Exp $$NetBSD: trap.c,v 1.1 2022/04/02 11:16:06 skrll Exp $$NetBSD: undefined.c,v 1.75 2023/10/05 19:41:03 ad Exp $$NetBSD: arm32_machdep.c,v 1.148 2025/09/06 21:02:40 thorpej Exp $$NetBSD: bus_dma.c,v 1.153 2026/02/01 09:03:17 skrll Exp $$NetBSD: cpu.c,v 1.155 2025/10/09 06:15:16 skrll Exp $$NetBSD: cpuswitch.S,v 1.108 2025/10/07 10:35:06 skrll Exp $$NetBSD: exception.S,v 1.26 2020/11/21 19:46:13 skrll Exp $$NetBSD: fault.c,v 1.119 2024/02/02 22:00:32 andvar Exp $$NetBSD: pmap.c,v 1.445 2026/02/04 06:00:02 skrll Exp $$NetBSD: setstack.S,v 1.6 2013/08/18 06:29:29 matt Exp $$NetBSD: stubs.c,v 1.27 2020/07/03 15:31:25 skrll Exp $$NetBSD: sys_machdep.c,v 1.26 2020/06/20 15:45:22 skrll Exp $$NetBSD: vm_machdep.c,v 1.79 2024/01/15 20:35:22 andvar Exp $$NetBSD: pmap_devmap.c,v 1.2 2023/04/27 06:23:31 skrll Exp $$NetBSD: pmap_pvt.c,v 1.15 2022/05/08 22:03:02 rin Exp $$NetBSD: scsipiconf.c,v 1.45 2019/03/28 10:44:29 kardel Exp $$NetBSD: scsipi_base.c,v 1.193 2024/10/29 15:50:07 nat Exp $$NetBSD: scsipi_ioctl.c,v 1.73 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: scsi_base.c,v 1.93 2019/05/03 16:06:56 mlelstv Exp $$NetBSD: atapi_base.c,v 1.30 2019/02/03 03:19:28 mrg Exp $$NetBSD: atapi_wdc.c,v 1.141 2021/10/05 08:01:05 rin Exp $$NetBSD: scsiconf.c,v 1.306 2024/11/22 06:52:57 mlelstv Exp $$NetBSD: scsi_subr.c,v 1.1 2022/04/14 16:50:26 pgoyette Exp $$NetBSD: atapiconf.c,v 1.95 2022/04/09 23:38:32 riastradh Exp $$NetBSD: cd.c,v 1.356 2024/12/01 20:23:45 andvar Exp $$NetBSD: sd.c,v 1.347 2025/10/11 13:58:57 mlelstv Exp $$NetBSD: wd.c,v 1.474 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: ata_wdc.c,v 1.120 2021/10/05 08:01:05 rin Exp $$NetBSD: ata.c,v 1.171 2025/02/17 19:01:04 jakllsch Exp $$NetBSD: ata_subr.c,v 1.13 2020/12/23 08:17:01 skrll Exp $$NetBSD: ata_recovery.c,v 1.4 2020/04/13 10:49:34 jdolecek Exp $$NetBSD: sdmmc.c,v 1.45 2026/01/09 22:54:34 jmcneill Exp $$NetBSD: sdmmc_cis.c,v 1.10 2025/01/17 11:54:50 jmcneill Exp $$NetBSD: sdmmc_io.c,v 1.26 2026/01/17 13:56:08 jmcneill Exp $$NetBSD: sdmmc_mem.c,v 1.78 2026/01/09 22:54:34 jmcneill Exp $$NetBSD: ld_sdmmc.c,v 1.45 2025/04/13 02:34:03 rin Exp $$NetBSD: config_hook.c,v 1.12 2020/11/21 21:08:32 thorpej Exp $$NetBSD: platid.c,v 1.11 2006/05/10 06:24:02 skrll Exp $$NetBSD: pxa2x0.c,v 1.24 2021/08/07 16:18:46 thorpej Exp $$NetBSD: pxa2x0_space.c,v 1.14 2023/04/21 15:00:48 skrll Exp $$NetBSD: pxa2x0_dma.c,v 1.7 2022/09/27 06:36:43 skrll Exp $$NetBSD: pxa2x0_intr.c,v 1.26 2023/07/13 19:42:24 riastradh Exp $$NetBSD: pxa2x0_gpio.c,v 1.21 2021/08/07 16:18:46 thorpej Exp $$NetBSD: pxa2x0_com.c,v 1.14 2018/12/08 17:46:10 thorpej Exp $$NetBSD: pxa2x0_a4x_space.c,v 1.6 2018/03/16 17:56:32 ryo Exp $$NetBSD: bus_space_a4x.S,v 1.4 2013/10/28 22:50:25 matt Exp $$NetBSD: sa11x0_ost.c,v 1.33 2019/11/13 17:52:12 tsutsui Exp $$NetBSD: pxa2x0_lcd.c,v 1.39 2021/11/20 00:15:04 rin Exp $$NetBSD: pxa2x0_pcic.c,v 1.15 2022/09/27 06:36:43 skrll Exp $$NetBSD: pxa2x0_i2c.c,v 1.9 2021/12/12 08:49:57 andvar Exp $$NetBSD: pxa2x0_rtc.c,v 1.9 2025/09/07 21:45:12 thorpej Exp $$NetBSD: pxa2x0_mci.c,v 1.14 2023/03/28 20:01:57 andvar Exp $$NetBSD: apmdev.c,v 1.35 2025/12/01 21:24:29 andvar Exp $$NetBSD: pcmcia.c,v 1.96 2021/08/07 16:19:15 thorpej Exp $$NetBSD: pcmcia_cis.c,v 1.57 2019/11/10 21:16:36 chs Exp $$NetBSD: pcmcia_cis_quirks.c,v 1.36 2019/11/10 21:16:36 chs Exp $$NetBSD: if_ne_pcmcia.c,v 1.161 2019/12/27 08:01:58 msaitoh Exp $$NetBSD: com_pcmcia.c,v 1.62 2018/12/08 17:46:14 thorpej Exp $$NetBSD: wdc_pcmcia.c,v 1.130 2022/09/25 21:53:54 thorpej Exp $$NetBSD: if_wi_pcmcia.c,v 1.93 2019/01/08 08:47:21 msaitoh Exp $$NetBSD: usb.c,v 1.203 2024/02/04 05:43:06 mrg Exp $$NetBSD: usbdi.c,v 1.255 2025/10/11 12:54:40 skrll Exp $$NetBSD: usbdi_util.c,v 1.88 2024/02/04 05:43:06 mrg Exp $$NetBSD: usb_subr.c,v 1.281 2025/10/05 20:41:04 riastradh Exp $$NetBSD: usb_quirks.c,v 1.108 2024/02/28 21:52:40 dholland Exp $$NetBSD: usb_mem.c,v 1.84 2021/12/21 09:51:22 skrll Exp $$NetBSD: usbnet.c,v 1.122 2026/02/01 03:33:19 riastradh Exp $$NetBSD: uhub.c,v 1.162 2024/05/04 12:49:15 mlelstv Exp $$NetBSD: uhidev.c,v 1.97 2025/12/07 19:59:51 jmcneill Exp $$NetBSD: uhid.c,v 1.131 2025/12/13 12:22:20 jmcneill Exp $$NetBSD: ukbd.c,v 1.165 2024/12/10 11:21:30 mlelstv Exp $$NetBSD: umass.c,v 1.189 2022/09/22 14:27:52 riastradh Exp $$NetBSD: umass_quirks.c,v 1.102 2020/06/19 11:52:42 flxd Exp $$NetBSD: umass_scsipi.c,v 1.70 2021/12/31 14:24:16 riastradh Exp $$NetBSD: if_aue.c,v 1.191 2022/08/20 14:08:59 riastradh Exp $$NetBSD: if_cdce.c,v 1.83 2025/01/18 18:35:47 riastradh Exp $$NetBSD: if_cue.c,v 1.109 2024/06/29 12:11:12 riastradh Exp $$NetBSD: if_kue.c,v 1.119 2022/08/20 14:08:59 riastradh Exp $$NetBSD: if_url.c,v 1.98 2024/06/30 16:35:19 riastradh Exp $$NetBSD: if_axe.c,v 1.151 2022/08/20 14:08:59 riastradh Exp $$NetBSD: if_mue.c,v 1.84 2025/10/04 04:44:21 thorpej Exp $$NetBSD: if_udav.c,v 1.99 2022/08/20 14:09:20 riastradh Exp $$NetBSD: com.c,v 1.390 2025/11/25 13:23:28 brad Exp $$NetBSD: dev_verbose.c,v 1.4 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: ld.c,v 1.118 2025/10/04 09:38:06 skrll Exp $$NetBSD: wi.c,v 1.258 2023/08/01 07:04:15 mrg Exp $$NetBSD: dp8390.c,v 1.101 2024/06/29 12:11:11 riastradh Exp $$NetBSD: ne2000.c,v 1.79 2024/05/21 08:04:20 andvar Exp $$NetBSD: rtl80x9.c,v 1.19 2023/12/31 03:19:22 isaki Exp $$NetBSD: wdc.c,v 1.310 2022/05/31 08:43:15 andvar Exp $$NetBSD: dl10019.c,v 1.17 2021/07/01 20:39:15 thorpej Exp $$NetBSD: ax88190.c,v 1.18 2021/07/01 20:39:15 thorpej Exp $$NetBSD: usbroothub.c,v 1.16 2024/02/04 05:43:06 mrg Exp $$NetBSD: ohci.c,v 1.330 2025/03/31 14:46:42 riastradh Exp $$NetBSD: compat_exec.c,v 1.18 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: compat_util.c,v 1.47 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: aes_bear.c,v 1.4 2020/07/25 22:28:27 riastradh Exp $$NetBSD: aes_ccm.c,v 1.6 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: aes_ccm_mbuf.c,v 1.1 2020/07/25 22:15:55 riastradh Exp $$NetBSD: aes_ct.c,v 1.3 2020/06/30 20:32:11 riastradh Exp $$NetBSD: aes_ct_dec.c,v 1.2 2020/06/29 23:36:59 riastradh Exp $$NetBSD: aes_ct_enc.c,v 1.1 2020/06/29 23:27:52 riastradh Exp $$NetBSD: aes_impl.c,v 1.12 2025/11/23 22:44:14 riastradh Exp $$NetBSD: aes_keysched.c,v 1.2 2025/11/23 22:44:14 riastradh Exp $$NetBSD: aes_selftest.c,v 1.8 2025/12/22 16:35:34 nia Exp $$NetBSD: nist_hash_drbg.c,v 1.3 2019/09/19 18:29:55 riastradh Exp $$NetBSD: cprng_fast.c,v 1.20 2024/10/15 17:34:06 riastradh Exp $$NetBSD: blake2s.c,v 1.2 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: sysmon.c,v 1.32 2022/03/28 12:33:21 riastradh Exp $$NetBSD: sysmon_wdog.c,v 1.30 2021/12/31 11:05:41 riastradh Exp $$NetBSD: swwdog.c,v 1.25 2025/12/31 14:11:16 nia Exp $$NetBSD: ieee80211.c,v 1.61 2021/08/21 11:55:25 andvar Exp $$NetBSD: ieee80211_amrr.c,v 1.3 2015/08/24 20:58:47 pooka Exp $$NetBSD: ieee80211_crypto.c,v 1.23 2018/05/08 07:02:07 maxv Exp $$NetBSD: ieee80211_crypto_ccmp.c,v 1.20 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_crypto_none.c,v 1.8 2018/01/19 07:53:46 maxv Exp $$NetBSD: ieee80211_crypto_tkip.c,v 1.18 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_crypto_wep.c,v 1.14 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_input.c,v 1.118 2025/10/18 07:35:33 mlelstv Exp $$NetBSD: ieee80211_ioctl.c,v 1.69 2021/09/21 15:00:34 christos Exp $$NetBSD: ieee80211_netbsd.c,v 1.34 2018/12/22 14:28:56 maxv Exp $$NetBSD: ieee80211_node.c,v 1.85 2025/10/18 07:38:17 mlelstv Exp $$NetBSD: ieee80211_output.c,v 1.68 2024/07/05 04:31:53 rin Exp $$NetBSD: ieee80211_proto.c,v 1.37 2021/07/24 21:31:38 andvar Exp $$NetBSD: ieee80211_rssadapt.c,v 1.21 2016/09/27 20:20:06 christos Exp $$NetBSD: ieee80211_xauth.c,v 1.5 2006/02/27 01:08:28 dyoung Exp $$NetBSD: at_print.c,v 1.3 2026/01/04 10:58:26 nia Exp $$NetBSD: igmp.c,v 1.70 2020/05/15 06:34:34 maxv Exp $$NetBSD: in.c,v 1.248 2024/08/20 08:22:35 ozaki-r Exp $$NetBSD: in_offload.c,v 1.15 2024/07/05 04:31:54 rin Exp $$NetBSD: in_pcb.c,v 1.202 2022/11/04 09:05:41 ozaki-r Exp $$NetBSD: in_print.c,v 1.1 2014/12/02 19:35:27 christos Exp $$NetBSD: in_proto.c,v 1.131 2022/09/03 02:53:18 thorpej Exp $$NetBSD: ip_icmp.c,v 1.180 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: ip_input.c,v 1.406 2025/07/17 06:49:43 ozaki-r Exp $$NetBSD: ip_output.c,v 1.330 2025/07/17 06:48:39 ozaki-r Exp $$NetBSD: ip_reass.c,v 1.23 2022/05/31 08:43:16 andvar Exp $$NetBSD: raw_ip.c,v 1.187 2025/06/20 15:15:35 roy Exp $$NetBSD: tcp_input.c,v 1.441 2024/10/08 06:17:14 rin Exp $$NetBSD: tcp_output.c,v 1.222 2024/09/08 09:36:52 rillig Exp $$NetBSD: tcp_sack.c,v 1.36 2018/05/18 18:58:51 maxv Exp $$NetBSD: tcp_subr.c,v 1.298 2025/02/26 04:49:45 andvar Exp $$NetBSD: tcp_syncache.c,v 1.7 2024/06/29 12:59:08 riastradh Exp $$NetBSD: tcp_timer.c,v 1.99 2022/11/04 09:00:58 ozaki-r Exp $$NetBSD: tcp_usrreq.c,v 1.238 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: tcp_congctl.c,v 1.29 2024/05/14 19:00:44 andvar Exp $$NetBSD: tcp_vtw.c,v 1.25 2024/10/07 23:17:00 jakllsch Exp $$NetBSD: udp_usrreq.c,v 1.266 2024/10/08 02:30:04 riastradh Exp $$NetBSD: portalgo.c,v 1.15 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: dest6.c,v 1.22 2018/04/13 11:01:14 maxv Exp $$NetBSD: frag6.c,v 1.78 2024/04/19 05:04:06 ozaki-r Exp $$NetBSD: icmp6.c,v 1.258 2024/07/05 04:31:54 rin Exp $$NetBSD: in6.c,v 1.293 2025/06/05 06:30:10 ozaki-r Exp $$NetBSD: in6_cksum.c,v 1.28 2011/04/25 22:05:05 yamt Exp $$NetBSD: in6_ifattach.c,v 1.122 2024/04/11 07:34:37 knakahara Exp $$NetBSD: in6_offload.c,v 1.13 2024/07/05 04:31:54 rin Exp $$NetBSD: in6_pcb.c,v 1.177 2022/11/04 09:04:27 ozaki-r Exp $$NetBSD: in6_print.c,v 1.1 2014/12/02 19:36:58 christos Exp $$NetBSD: in6_proto.c,v 1.131 2024/02/09 22:08:37 andvar Exp $$NetBSD: in6_src.c,v 1.92 2023/08/03 04:24:55 ozaki-r Exp $$NetBSD: ip6_forward.c,v 1.103 2024/06/29 13:00:44 riastradh Exp $$NetBSD: ip6_input.c,v 1.228 2024/06/29 13:00:44 riastradh Exp $$NetBSD: ip6_mroute.c,v 1.133 2025/01/02 16:10:22 andvar Exp $$NetBSD: ip6_output.c,v 1.235 2024/04/19 00:55:35 riastradh Exp $$NetBSD: mld6.c,v 1.102 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: nd6.c,v 1.284 2025/06/05 06:31:07 ozaki-r Exp $$NetBSD: nd6_nbr.c,v 1.186 2025/04/28 11:39:10 joe Exp $$NetBSD: nd6_rtr.c,v 1.149 2020/06/12 11:04:45 roy Exp $$NetBSD: raw_ip6.c,v 1.185 2024/07/05 04:31:54 rin Exp $$NetBSD: route6.c,v 1.25 2018/02/01 16:23:28 maxv Exp $$NetBSD: scope6.c,v 1.23 2020/06/16 17:12:18 maxv Exp $$NetBSD: udp6_usrreq.c,v 1.156 2024/10/08 02:30:05 riastradh Exp $$NetBSD: hid.c,v 1.8 2024/12/19 00:50:47 jmcneill Exp $$NetBSD: hidkbdmap.c,v 1.16 2025/05/24 16:50:54 nia Exp $$NetBSD: uhid_common.c,v 1.2 2025/12/15 08:38:21 hannken Exp $$NetBSD: i2c.c,v 1.107 2026/01/15 16:56:22 skrll Exp $$NetBSD: i2c_exec.c,v 1.21 2025/09/23 12:37:43 thorpej Exp $$NetBSD: i2c_subr.c,v 1.7 2025/09/23 12:37:43 thorpej Exp $$NetBSD: i2c_bitbang.c,v 1.14 2016/06/07 01:06:27 pgoyette Exp $$NetBSD: mii.c,v 1.59 2024/02/08 20:11:55 andvar Exp $$NetBSD: mii_bitbang.c,v 1.14 2019/01/22 03:42:27 msaitoh Exp $$NetBSD: mii_physubr.c,v 1.103 2023/05/22 02:12:13 msaitoh Exp $$NetBSD: mii_ethersubr.c,v 1.3 2020/03/15 23:04:50 thorpej Exp $$NetBSD: ukphy_subr.c,v 1.17 2020/03/15 23:04:50 thorpej Exp $$NetBSD: brgphy.c,v 1.91 2023/02/22 08:09:09 msaitoh Exp $$NetBSD: nsphy.c,v 1.66 2020/03/15 23:04:50 thorpej Exp $$NetBSD: nsphyter.c,v 1.46 2020/03/28 18:37:18 thorpej Exp $$NetBSD: qsphy.c,v 1.55 2020/03/15 23:04:50 thorpej Exp $$NetBSD: inphy.c,v 1.60 2020/03/15 23:04:50 thorpej Exp $$NetBSD: iophy.c,v 1.43 2020/03/15 23:04:50 thorpej Exp $$NetBSD: exphy.c,v 1.58 2020/03/15 23:04:50 thorpej Exp $$NetBSD: lxtphy.c,v 1.56 2021/08/20 20:25:28 andvar Exp $$NetBSD: icsphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: sqphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: dmphy.c,v 1.47 2020/03/15 23:04:50 thorpej Exp $$NetBSD: pnaphy.c,v 1.26 2020/03/15 23:04:50 thorpej Exp $$NetBSD: ukphy.c,v 1.55 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: dmover_backend.c,v 1.9 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_process.c,v 1.6 2025/08/18 20:59:54 andvar Exp $$NetBSD: dmover_request.c,v 1.8 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_session.c,v 1.6 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_util.c,v 1.5 2005/12/11 12:21:20 christos Exp $$NetBSD: drm_stub.c,v 1.1 2019/11/16 04:10:33 christos Exp $$NetBSD: wsdisplay.c,v 1.167 2025/09/19 05:22:20 mrg Exp $$NetBSD: wsemulconf.c,v 1.8 2010/02/02 16:18:29 drochner Exp $$NetBSD: wsemul_dumb.c,v 1.18 2018/09/03 16:29:34 riastradh Exp $$NetBSD: wsemul_vt100.c,v 1.52 2023/08/02 22:37:02 uwe Exp $$NetBSD: wsemul_vt100_subr.c,v 1.35 2025/11/02 22:16:24 nia Exp $$NetBSD: wsemul_vt100_chars.c,v 1.15 2017/11/03 19:20:27 maya Exp $$NetBSD: wsemul_vt100_keys.c,v 1.11 2010/02/10 19:39:39 drochner Exp $$NetBSD: wsevent.c,v 1.47 2021/09/26 01:16:10 thorpej Exp $$NetBSD: wskbd.c,v 1.146 2025/04/07 11:25:42 hans Exp $$NetBSD: wskbdutil.c,v 1.19 2017/11/03 19:20:27 maya Exp $$NetBSD: wsmux.c,v 1.69 2025/11/22 15:39:23 riastradh Exp $$NetBSD: wsbellmux.c,v 1.1 2017/06/11 03:55:56 nat Exp $$NetBSD: rasops.c,v 1.130 2026/01/01 02:19:01 tnn Exp $$NetBSD: rasops_masks.c,v 1.10 2019/08/10 01:24:17 rin Exp $$NetBSD: rasops4.c,v 1.28 2019/08/14 00:51:10 rin Exp $$NetBSD: rasops8.c,v 1.51 2019/08/14 00:51:10 rin Exp $$NetBSD: rasops15.c,v 1.39 2019/08/14 00:51:10 rin Exp $$NetBSD: wsfont.c,v 1.83 2025/03/25 10:50:12 macallan Exp $$NetBSD: cd9660_bmap.c,v 1.5 2014/06/14 07:39:28 hannken Exp $$NetBSD: cd9660_lookup.c,v 1.33 2024/09/08 09:36:51 rillig Exp $$NetBSD: cd9660_node.c,v 1.38 2017/05/26 14:34:19 riastradh Exp $$NetBSD: cd9660_rrip.c,v 1.18 2015/03/28 19:24:05 maxv Exp $$NetBSD: cd9660_util.c,v 1.16 2024/05/25 06:27:57 tsutsui Exp $$NetBSD: cd9660_vfsops.c,v 1.106 2025/11/29 21:45:57 mlelstv Exp $$NetBSD: cd9660_vnops.c,v 1.63 2024/02/02 20:27:26 christos Exp $$NetBSD: msdosfs_conv.c,v 1.20 2023/06/02 08:51:47 andvar Exp $$NetBSD: msdosfs_denode.c,v 1.60 2021/10/23 16:58:17 thorpej Exp $$NetBSD: msdosfs_fat.c,v 1.37 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: msdosfs_lookup.c,v 1.41 2022/08/06 18:26:42 andvar Exp $$NetBSD: msdosfs_rename.c,v 1.4 2024/05/04 05:49:39 mlelstv Exp $$NetBSD: msdosfs_vfsops.c,v 1.138 2022/04/16 07:58:21 hannken Exp $$NetBSD: msdosfs_vnops.c,v 1.113 2024/09/11 00:27:54 perseant Exp $$NetBSD: krpc_subr.c,v 1.44 2024/10/20 14:01:52 mlelstv Exp $$NetBSD: nfs_bio.c,v 1.202 2024/02/13 21:40:02 andvar Exp $$NetBSD: nfs_boot.c,v 1.90 2024/07/05 04:31:54 rin Exp $$NetBSD: nfs_clntsocket.c,v 1.7 2024/07/05 04:31:54 rin Exp $$NetBSD: nfs_clntsubs.c,v 1.7 2023/03/21 15:47:46 christos Exp $$NetBSD: nfs_iod.c,v 1.9 2023/03/21 15:47:46 christos Exp $$NetBSD: nfs_kq.c,v 1.32 2021/10/20 03:08:18 thorpej Exp $$NetBSD: nfs_node.c,v 1.126 2020/05/01 08:43:00 hannken Exp $$NetBSD: nfs_socket.c,v 1.203 2025/02/22 09:27:05 mlelstv Exp $$NetBSD: nfs_subs.c,v 1.242 2022/02/09 21:50:24 andvar Exp $$NetBSD: nfs_vfsops.c,v 1.246 2024/05/13 00:11:22 msaitoh Exp $$NetBSD: nfs_vnops.c,v 1.327 2026/01/26 20:34:24 christos Exp $$NetBSD: ffs_alloc.c,v 1.174 2025/06/27 19:55:38 andvar Exp $$NetBSD: ffs_balloc.c,v 1.66 2022/11/17 06:40:40 chs Exp $$NetBSD: ffs_extattr.c,v 1.10 2022/11/28 04:52:04 chs Exp $$NetBSD: ffs_inode.c,v 1.131 2020/07/31 04:07:30 chs Exp $$NetBSD: ffs_snapshot.c,v 1.155 2023/05/11 23:11:25 chs Exp $$NetBSD: ffs_subr.c,v 1.54 2023/01/07 19:41:30 chs Exp $$NetBSD: ffs_tables.c,v 1.9 2005/12/11 12:25:25 christos Exp $$NetBSD: ffs_vfsops.c,v 1.384 2024/12/30 09:03:07 hannken Exp $$NetBSD: ffs_vnops.c,v 1.138 2021/12/14 11:06:12 chs Exp $$NetBSD: ufs_readwrite.c,v 1.130 2026/01/22 03:24:19 riastradh Exp $$NetBSD: mfs_vfsops.c,v 1.117 2025/02/16 18:38:59 joe Exp $$NetBSD: mfs_vnops.c,v 1.64 2022/03/19 13:48:42 hannken Exp $$NetBSD: mfs_miniroot.c,v 1.1 2010/03/02 17:20:02 pooka Exp $$NetBSD: ufs_acl.c,v 1.7 2026/01/22 03:24:19 riastradh Exp $$NetBSD: ufs_bmap.c,v 1.56 2026/01/22 03:24:19 riastradh Exp $$NetBSD: ufs_inode.c,v 1.114 2026/01/22 03:24:19 riastradh Exp $$NetBSD: ufs_lookup.c,v 1.161 2026/01/22 03:24:19 riastradh Exp $$NetBSD: ufs_rename.c,v 1.16 2026/01/22 03:24:19 riastradh Exp $$NetBSD: ufs_vfsops.c,v 1.63 2026/01/22 03:24:19 riastradh Exp $$NetBSD: ufs_vnops.c,v 1.264 2026/01/22 03:24:19 riastradh Exp $$NetBSD: uvm_amap.c,v 1.129 2023/09/10 14:54:34 ad Exp $$NetBSD: uvm_anon.c,v 1.80 2020/10/25 00:05:26 chs Exp $$NetBSD: uvm_aobj.c,v 1.157 2023/02/24 11:03:13 riastradh Exp $$NetBSD: uvm_bio.c,v 1.128 2023/04/09 09:00:56 riastradh Exp $$NetBSD: uvm_coredump.c,v 1.9 2025/08/10 19:49:39 andvar Exp $$NetBSD: uvm_device.c,v 1.80 2022/07/07 13:27:02 riastradh Exp $$NetBSD: uvm_fault.c,v 1.237 2024/03/15 07:09:37 andvar Exp $$NetBSD: uvm_glue.c,v 1.182 2023/10/04 20:34:19 ad Exp $$NetBSD: uvm_init.c,v 1.60 2025/11/05 00:39:46 thorpej Exp $$NetBSD: uvm_io.c,v 1.30 2024/05/03 07:09:20 skrll Exp $$NetBSD: uvm_km.c,v 1.166 2024/12/07 23:19:07 chs Exp $$NetBSD: uvm_loan.c,v 1.104 2020/06/11 22:21:05 ad Exp $$NetBSD: uvm_map.c,v 1.429 2025/12/11 07:25:10 andvar Exp $$NetBSD: uvm_meter.c,v 1.80 2020/06/14 21:41:42 ad Exp $$NetBSD: uvm_mmap.c,v 1.187 2025/12/11 07:25:11 andvar Exp $$NetBSD: uvm_mremap.c,v 1.23 2025/12/10 21:33:02 andvar Exp $$NetBSD: uvm_object.c,v 1.25 2020/08/15 07:24:09 chs Exp $$NetBSD: uvm_page.c,v 1.256 2024/03/05 14:33:50 thorpej Exp $$NetBSD: uvm_page_array.c,v 1.9 2020/05/26 21:52:12 ad Exp $$NetBSD: uvm_page_status.c,v 1.6 2020/08/14 09:06:15 chs Exp $$NetBSD: uvm_pager.c,v 1.131 2024/03/15 07:09:37 andvar Exp $$NetBSD: uvm_pdaemon.c,v 1.135 2026/01/04 00:41:14 wiz Exp $$NetBSD: uvm_pdpolicy_clock.c,v 1.42 2025/05/20 10:22:27 bouyer Exp $$NetBSD: uvm_pgflcache.c,v 1.6 2020/10/18 18:31:31 chs Exp $$NetBSD: uvm_pglist.c,v 1.92 2024/01/14 10:38:47 tnn Exp $$NetBSD: uvm_readahead.c,v 1.16 2023/09/23 18:21:12 ad Exp $$NetBSD: uvm_stat.c,v 1.46 2020/06/14 21:41:42 ad Exp $$NetBSD: uvm_swap.c,v 1.215 2026/02/13 19:16:41 kre Exp $$NetBSD: uvm_unix.c,v 1.51 2022/01/10 18:04:20 christos Exp $$NetBSD: uvm_user.c,v 1.14 2011/02/02 15:13:34 chuck Exp $$NetBSD: uvm_vnode.c,v 1.121 2024/04/05 13:05:41 riastradh Exp $$NetBSD: debugsyms.c,v 1.4 2015/10/06 22:13:39 christos Exp $$NetBSD: param.c,v 1.70 2022/07/23 19:15:29 mrg Exp $$NetBSD: bufq_disksort.c,v 1.14 2017/05/04 11:03:27 kamil Exp $$NetBSD: bufq_fcfs.c,v 1.13 2017/05/04 11:03:27 kamil Exp $$NetBSD: core_elf32.c,v 1.71 2026/02/15 21:51:08 christos Exp $$NetBSD: core_netbsd.c,v 1.27 2026/01/03 23:57:09 riastradh Exp $$NetBSD: cnmagic.c,v 1.14 2017/05/04 11:01:16 kamil Exp $$NetBSD: exec_elf32.c,v 1.144 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_elf.c,v 1.107 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_script.c,v 1.85 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_subr.c,v 1.91 2024/12/06 16:48:13 riastradh Exp $$NetBSD: init_main.c,v 1.552 2025/05/08 05:31:16 imil Exp $$NetBSD: init_sysctl.c,v 1.230 2026/02/15 21:47:18 christos Exp $$NetBSD: init_sysctl_base.c,v 1.9 2023/12/20 20:35:37 andvar Exp $$NetBSD: init_sysent.c,v 1.346 2024/10/09 16:29:10 christos Exp $$NetBSD: kern_acct.c,v 1.102 2026/01/03 23:57:36 riastradh Exp $$NetBSD: kern_auth.c,v 1.86 2026/01/03 23:58:04 riastradh Exp $$NetBSD: kern_cfglock.c,v 1.1 2010/08/21 13:17:31 pgoyette Exp $$NetBSD: kern_clock.c,v 1.151 2023/09/02 17:44:59 riastradh Exp $$NetBSD: kern_condvar.c,v 1.64 2026/01/03 23:58:32 riastradh Exp $$NetBSD: kern_core.c,v 1.42 2026/01/03 23:57:09 riastradh Exp $$NetBSD: kern_cpu.c,v 1.100 2026/01/03 23:58:52 riastradh Exp $$NetBSD: kern_descrip.c,v 1.268 2026/01/04 01:32:23 riastradh Exp $$NetBSD: kern_entropy.c,v 1.74 2026/01/04 01:32:52 riastradh Exp $$NetBSD: kern_event.c,v 1.152 2026/01/04 01:33:13 riastradh Exp $$NetBSD: kern_exec.c,v 1.531 2025/07/16 19:14:13 kre Exp $$NetBSD: kern_exit.c,v 1.300 2025/03/16 15:52:18 riastradh Exp $$NetBSD: kern_fork.c,v 1.234 2026/01/04 01:33:56 riastradh Exp $$NetBSD: kern_idle.c,v 1.36 2024/03/01 04:32:38 mrg Exp $$NetBSD: kern_hook.c,v 1.16 2026/01/04 01:34:37 riastradh Exp $$NetBSD: kern_kthread.c,v 1.51 2026/01/04 01:35:16 riastradh Exp $$NetBSD: kern_lock.c,v 1.191 2026/01/03 23:08:16 riastradh Exp $$NetBSD: kern_lwp.c,v 1.271 2026/01/04 01:35:44 riastradh Exp $$NetBSD: kern_malloc.c,v 1.158 2019/11/14 16:23:52 maxv Exp $$NetBSD: kern_module.c,v 1.175 2026/01/04 01:36:03 riastradh Exp $$NetBSD: kern_module_hook.c,v 1.4 2019/12/13 08:02:53 skrll Exp $$NetBSD: kern_module_vfs.c,v 1.20 2026/01/04 01:36:11 riastradh Exp $$NetBSD: kern_mutex.c,v 1.112 2023/10/15 10:28:23 riastradh Exp $$NetBSD: kern_mutex_obj.c,v 1.15 2023/10/02 21:03:55 ad Exp $$NetBSD: kern_ntptime.c,v 1.64 2022/10/26 23:23:52 riastradh Exp $$NetBSD: kern_physio.c,v 1.104 2026/01/04 01:36:43 riastradh Exp $$NetBSD: kern_pmf.c,v 1.51 2022/08/24 11:41:39 riastradh Exp $$NetBSD: kern_proc.c,v 1.280 2025/06/02 16:27:04 andvar Exp $$NetBSD: kern_prot.c,v 1.124 2026/01/04 01:37:01 riastradh Exp $$NetBSD: kern_ras.c,v 1.44 2026/01/04 01:37:23 riastradh Exp $$NetBSD: kern_rate.c,v 1.2 2012/12/12 11:10:56 pooka Exp $$NetBSD: kern_reboot.c,v 1.5 2024/03/05 14:15:36 thorpej Exp $$NetBSD: kern_resource.c,v 1.197 2026/01/04 01:37:47 riastradh Exp $$NetBSD: kern_runq.c,v 1.72 2025/10/03 16:40:26 thorpej Exp $$NetBSD: kern_rwlock.c,v 1.76 2023/10/15 10:28:48 riastradh Exp $$NetBSD: kern_rwlock_obj.c,v 1.13 2023/10/02 21:03:55 ad Exp $$NetBSD: kern_scdebug.c,v 1.2 2019/03/14 19:51:49 palle Exp $$NetBSD: sys_syscall.c,v 1.16 2025/06/01 23:30:36 bad Exp $$NetBSD: kern_sig.c,v 1.413 2026/01/04 01:41:34 riastradh Exp $$NetBSD: kern_sleepq.c,v 1.88 2026/01/04 01:41:42 riastradh Exp $$NetBSD: kern_softint.c,v 1.76 2024/03/01 04:32:38 mrg Exp $$NetBSD: kern_ssp.c,v 1.7 2016/12/06 02:55:42 christos Exp $$NetBSD: kern_stub.c,v 1.53 2026/02/01 19:41:46 christos Exp $$NetBSD: kern_subr.c,v 1.231 2023/01/19 07:40:58 mlelstv Exp $$NetBSD: kern_synch.c,v 1.366 2023/11/22 13:18:48 riastradh Exp $$NetBSD: kern_syscall.c,v 1.23 2026/02/01 03:32:44 riastradh Exp $$NetBSD: kern_sysctl.c,v 1.272 2026/01/04 01:54:22 riastradh Exp $$NetBSD: kern_tc.c,v 1.80 2026/01/04 01:54:31 riastradh Exp $$NetBSD: kern_threadpool.c,v 1.24 2026/01/04 01:54:38 riastradh Exp $$NetBSD: kern_time.c,v 1.231 2026/02/07 01:47:23 riastradh Exp $$NetBSD: kern_timeout.c,v 1.79 2023/10/08 13:23:05 ad Exp $$NetBSD: kern_turnstile.c,v 1.56 2025/06/27 21:36:24 andvar Exp $$NetBSD: kern_todr.c,v 1.52 2026/01/04 02:09:03 riastradh Exp $$NetBSD: kern_uidinfo.c,v 1.15 2026/01/04 02:09:21 riastradh Exp $$NetBSD: kern_uuid.c,v 1.21 2026/01/04 02:09:29 riastradh Exp $$NetBSD: sched_4bsd.c,v 1.47 2025/01/17 04:11:33 mrg Exp $$NetBSD: subr_acl_posix1e.c,v 1.3 2026/01/04 02:10:34 riastradh Exp $$NetBSD: subr_acl_nfs4.c,v 1.4 2026/01/04 02:10:18 riastradh Exp $$NetBSD: subr_autoconf.c,v 1.318 2026/01/17 02:01:39 thorpej Exp $$NetBSD: subr_blist.c,v 1.16 2024/09/08 17:28:36 rillig Exp $$NetBSD: subr_bufq.c,v 1.29 2026/01/04 02:11:09 riastradh Exp $$NetBSD: subr_callback.c,v 1.7 2009/11/24 20:11:50 rmind Exp $$NetBSD: subr_cprng.c,v 1.44 2023/08/05 11:21:24 riastradh Exp $$NetBSD: subr_cpu.c,v 1.23 2025/06/23 22:50:23 ad Exp $$NetBSD: subr_cpufreq.c,v 1.11 2026/01/04 03:15:28 riastradh Exp $$NetBSD: subr_copy.c,v 1.21 2026/01/04 02:11:26 riastradh Exp $$NetBSD: subr_device.c,v 1.20 2026/01/04 03:15:42 riastradh Exp $$NetBSD: subr_devsw.c,v 1.55 2026/01/04 03:15:58 riastradh Exp $$NetBSD: subr_disk.c,v 1.140 2026/01/04 03:16:14 riastradh Exp $$NetBSD: subr_disklabel.c,v 1.5 2026/01/04 03:16:53 riastradh Exp $$NetBSD: subr_disk_open.c,v 1.16 2026/01/04 03:16:38 riastradh Exp $$NetBSD: subr_emul.c,v 1.4 2026/01/04 03:17:08 riastradh Exp $$NetBSD: subr_evcnt.c,v 1.18 2026/01/04 03:17:15 riastradh Exp $$NetBSD: subr_exec_fd.c,v 1.14 2026/01/04 03:17:30 riastradh Exp $$NetBSD: subr_extent.c,v 1.91 2026/01/04 03:17:47 riastradh Exp $$NetBSD: subr_hash.c,v 1.15 2026/01/04 03:18:16 riastradh Exp $$NetBSD: subr_humanize.c,v 1.2 2019/03/12 00:25:44 kre Exp $$NetBSD: subr_interrupt.c,v 1.7 2026/01/04 03:18:31 riastradh Exp $$NetBSD: subr_iostat.c,v 1.28 2026/01/04 03:18:46 riastradh Exp $$NetBSD: subr_ipi.c,v 1.11 2023/02/24 11:02:27 riastradh Exp $$NetBSD: subr_kcpuset.c,v 1.22 2026/01/04 03:19:17 riastradh Exp $$NetBSD: subr_kmem.c,v 1.89 2023/09/10 14:29:13 ad Exp $$NetBSD: subr_kobj.c,v 1.79 2026/01/04 03:19:25 riastradh Exp $$NetBSD: subr_localcount.c,v 1.8 2024/08/16 21:54:17 riastradh Exp $$NetBSD: subr_lockdebug.c,v 1.83 2022/09/02 06:01:38 nakayama Exp $$NetBSD: subr_log.c,v 1.68 2026/01/04 03:19:49 riastradh Exp $$NetBSD: subr_lwp_specificdata.c,v 1.5 2024/09/01 19:56:18 andvar Exp $$NetBSD: subr_once.c,v 1.7 2019/03/19 08:16:51 ryo Exp $$NetBSD: subr_optstr.c,v 1.8 2023/04/20 09:04:45 skrll Exp $$NetBSD: subr_pcq.c,v 1.20 2023/02/24 11:02:27 riastradh Exp $$NetBSD: subr_pcu.c,v 1.28 2023/04/09 09:18:09 riastradh Exp $$NetBSD: subr_percpu.c,v 1.26 2026/01/04 03:19:56 riastradh Exp $$NetBSD: subr_pool.c,v 1.297 2026/01/04 03:20:29 riastradh Exp $$NetBSD: subr_prf.c,v 1.205 2025/10/17 08:08:56 skrll Exp $$NetBSD: subr_prof.c,v 1.52 2026/01/04 03:20:46 riastradh Exp $$NetBSD: subr_pserialize.c,v 1.24 2023/10/04 20:28:06 ad Exp $$NetBSD: subr_psref.c,v 1.18 2022/02/12 16:31:06 macallan Exp $$NetBSD: subr_specificdata.c,v 1.14 2017/06/01 02:45:13 chs Exp $$NetBSD: subr_time.c,v 1.43 2026/01/04 03:21:11 riastradh Exp $$NetBSD: subr_time_arith.c,v 1.7 2026/01/04 03:21:19 riastradh Exp $$NetBSD: subr_thmap.c,v 1.17 2026/01/04 03:21:04 riastradh Exp $$NetBSD: subr_vmem.c,v 1.118 2024/12/06 19:17:59 riastradh Exp $$NetBSD: subr_workqueue.c,v 1.48 2024/03/01 04:32:38 mrg Exp $$NetBSD: subr_xcall.c,v 1.39 2025/04/01 03:16:41 ozaki-r Exp $$NetBSD: sys_aio.c,v 1.52 2025/10/10 17:08:01 kre Exp $$NetBSD: sys_descrip.c,v 1.54 2026/01/04 01:32:23 riastradh Exp $$NetBSD: sys_epoll.c,v 1.4 2023/07/30 18:31:13 christos Exp $$NetBSD: sys_eventfd.c,v 1.11 2023/11/19 17:16:00 riastradh Exp $$NetBSD: sys_futex.c,v 1.26 2025/03/05 14:01:55 riastradh Exp $$NetBSD: sys_generic.c,v 1.134 2022/07/10 23:12:12 riastradh Exp $$NetBSD: sys_getrandom.c,v 1.2 2021/12/28 13:22:43 riastradh Exp $$NetBSD: sys_memfd.c,v 1.13 2025/11/15 19:02:26 gutteridge Exp $$NetBSD: sys_module.c,v 1.30 2022/05/24 06:20:05 andvar Exp $$NetBSD: sys_mqueue.c,v 1.49 2024/07/01 01:35:53 christos Exp $$NetBSD: sys_lwp.c,v 1.89 2023/10/15 10:29:24 riastradh Exp $$NetBSD: sys_process.c,v 1.180 2020/05/26 00:50:53 kamil Exp $$NetBSD: sys_process_lwpstatus.c,v 1.5 2025/01/11 19:42:04 christos Exp $$NetBSD: sys_pset.c,v 1.24 2020/05/23 23:42:43 ad Exp $$NetBSD: sys_select.c,v 1.69 2025/11/07 21:43:41 andvar Exp $$NetBSD: sys_sig.c,v 1.62 2026/02/01 19:41:46 christos Exp $$NetBSD: sys_sched.c,v 1.50 2023/04/09 09:18:09 riastradh Exp $$NetBSD: sys_socket.c,v 1.84 2024/12/06 18:44:00 riastradh Exp $$NetBSD: sys_timerfd.c,v 1.11 2024/12/19 23:50:22 riastradh Exp $$NetBSD: tty.c,v 1.313 2024/07/14 05:10:40 kre Exp $$NetBSD: tty_conf.c,v 1.57 2021/08/09 20:49:10 andvar Exp $$NetBSD: tty_bsdpty.c,v 1.20 2014/04/04 18:11:58 christos Exp $$NetBSD: tty_pty.c,v 1.149 2021/10/11 01:07:36 thorpej Exp $$NetBSD: tty_ptm.c,v 1.47 2025/08/05 23:56:21 gutteridge Exp $$NetBSD: tty_subr.c,v 1.43 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: tty_tty.c,v 1.41 2020/05/23 23:42:43 ad Exp $$NetBSD: uipc_accf.c,v 1.16 2024/12/06 18:44:00 riastradh Exp $$NetBSD: uipc_domain.c,v 1.112 2024/12/07 02:31:14 riastradh Exp $$NetBSD: uipc_mbuf.c,v 1.255 2024/12/15 11:07:10 skrll Exp $$NetBSD: link_proto.c,v 1.41 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: uipc_proto.c,v 1.24 2024/12/06 18:36:31 riastradh Exp $$NetBSD: uipc_sem.c,v 1.62 2024/12/06 18:44:00 riastradh Exp $$NetBSD: uipc_socket.c,v 1.314 2025/07/16 19:14:13 kre Exp $$NetBSD: uipc_socket2.c,v 1.148 2025/09/14 14:24:12 andvar Exp $$NetBSD: uipc_syscalls.c,v 1.215 2025/07/16 19:14:13 kre Exp $$NetBSD: uipc_usrreq.c,v 1.209 2025/07/16 19:14:13 kre Exp $$NetBSD: vfs_acl.c,v 1.3 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_bio.c,v 1.307 2025/12/11 07:25:12 andvar Exp $$NetBSD: vfs_cache.c,v 1.159 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_cwd.c,v 1.12 2024/12/07 02:11:42 riastradh Exp $$NetBSD: vfs_dirhash.c,v 1.18 2025/12/28 21:27:55 andvar Exp $$NetBSD: vfs_getcwd.c,v 1.63 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_hooks.c,v 1.9 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_init.c,v 1.67 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_lockf.c,v 1.83 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_lookup.c,v 1.239 2025/09/14 14:24:13 andvar Exp $$NetBSD: vfs_mount.c,v 1.110 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_quotactl.c,v 1.40 2014/06/28 22:27:50 dholland Exp $$$NetBSD: vfs_subr.c,v 1.502 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_syscalls.c,v 1.572 2026/01/03 23:08:53 riastradh Exp $$NetBSD: vfs_trans.c,v 1.73 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_vnode.c,v 1.156 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_vnops.c,v 1.246 2025/07/09 07:39:39 bad Exp $$NetBSD: vfs_xattr.c,v 1.41 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vnode_if.c,v 1.119 2023/06/15 09:15:13 hannken Exp $$NetBSD: dead_vfsops.c,v 1.13 2022/10/26 23:39:43 riastradh Exp $$NetBSD: dead_vnops.c,v 1.67 2022/10/26 23:39:43 riastradh Exp $$NetBSD: fifo_vnops.c,v 1.91 2021/10/11 01:07:36 thorpej Exp $$NetBSD: genfs_io.c,v 1.104 2024/04/05 13:05:40 riastradh Exp $$NetBSD: genfs_rename.c,v 1.7 2021/10/20 13:29:06 thorpej Exp $$NetBSD: genfs_vfsops.c,v 1.11 2022/07/08 07:42:06 hannken Exp $$NetBSD: genfs_vnops.c,v 1.220 2023/03/03 10:02:51 hannken Exp $$NetBSD: layer_subr.c,v 1.39 2022/04/10 09:50:46 andvar Exp $$NetBSD: layer_vfsops.c,v 1.56 2022/12/09 10:33:18 hannken Exp $$NetBSD: layer_vnops.c,v 1.72 2021/10/20 03:08:18 thorpej Exp $$NetBSD: spec_vnops.c,v 1.219 2025/01/06 09:45:49 mlelstv Exp $$NetBSD: clock_subr.c,v 1.27 2016/08/15 15:51:39 jakllsch Exp $$NetBSD: dksubr.c,v 1.118 2025/02/18 17:09:34 mlelstv Exp $$NetBSD: dk.c,v 1.173 2025/04/13 14:01:00 jakllsch Exp $$NetBSD: dkwedge_apple.c,v 1.6 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: dkwedge_gpt.c,v 1.26 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: md.c,v 1.87 2023/01/13 15:46:40 hannken Exp $$NetBSD: mm.c,v 1.25 2024/08/25 11:29:38 uwe Exp $$NetBSD: random.c,v 1.12 2024/08/27 00:56:47 riastradh Exp $$NetBSD: bpf.c,v 1.258 2024/10/20 14:03:51 mlelstv Exp $$NetBSD: bpf_filter.c,v 1.73 2024/09/02 15:34:08 christos Exp $$NetBSD: bpf_stub.c,v 1.8 2018/06/25 03:22:14 msaitoh Exp $$NetBSD: dl_print.c,v 1.8 2021/05/27 13:40:38 christos Exp $$NetBSD: if.c,v 1.536 2025/12/01 09:31:44 ozaki-r Exp $$NetBSD: if_ethersubr.c,v 1.333 2025/10/12 23:41:09 thorpej Exp $$NetBSD: if_loop.c,v 1.119 2025/09/21 15:11:52 christos Exp $$NetBSD: if_media.c,v 1.54 2022/09/03 02:47:59 thorpej Exp $$NetBSD: if_stats.c,v 1.5 2024/06/29 02:18:35 riastradh Exp $$NetBSD: nd.c,v 1.8 2025/08/18 06:46:43 ozaki-r Exp $$NetBSD: pfil.c,v 1.42 2022/08/16 04:35:57 knakahara Exp $$NetBSD: pktqueue.c,v 1.22 2023/05/28 08:09:34 andvar Exp $$NetBSD: net_stats.c,v 1.6 2020/02/07 12:35:33 thorpej Exp $$NetBSD: radix.c,v 1.49 2020/10/18 13:07:31 gson Exp $$NetBSD: raw_cb.c,v 1.24 2017/09/25 01:56:22 ozaki-r Exp $$NetBSD: raw_usrreq.c,v 1.66 2024/07/05 04:31:53 rin Exp $$NetBSD: route.c,v 1.240 2025/09/21 15:11:52 christos Exp $$NetBSD: rss_config.c,v 1.3 2021/09/24 04:11:02 knakahara Exp $$NetBSD: rtbl.c,v 1.7 2017/06/01 02:45:14 chs Exp $$NetBSD: rtsock.c,v 1.256 2022/08/27 08:36:41 skrll Exp $$NetBSD: rtsock_shared.c,v 1.23 2022/10/04 07:06:31 msaitoh Exp $$NetBSD: if_arp.c,v 1.318 2025/12/17 02:06:42 ozaki-r Exp $$NetBSD: in4_cksum.c,v 1.20 2014/11/30 18:15:41 christos Exp $$NetBSD: in_cksum.c,v 1.22 2008/01/25 21:12:15 joerg Exp $$NetBSD: ip_encap.c,v 1.78 2025/02/26 04:49:45 andvar Exp $$NetBSD: gpiolib.c,v 1.1 2024/12/17 12:44:33 martin Exp $$NetBSD: secmodel_suser.c,v 1.58 2024/03/01 22:01:03 andvar Exp $$NetBSD: secmodel_securelevel.c,v 1.37 2020/12/05 17:33:53 thorpej Exp $$NetBSD: secmodel_extensions.c,v 1.16 2023/04/22 13:54:19 riastradh Exp $$NetBSD: secmodel_extensions_vfs.c,v 1.1 2023/04/22 13:54:19 riastradh Exp $$NetBSD: secmodel_bsd44.c,v 1.17 2020/03/16 21:20:12 pgoyette Exp $$NetBSD: dkcksum.c,v 1.1 2021/05/17 08:50:36 mrg Exp $$NetBSD: entpool.c,v 1.1 2020/04/30 03:28:19 riastradh Exp $$NetBSD: hexdump.c,v 1.4 2017/12/09 00:51:52 christos Exp $$NetBSD: radixtree.c,v 1.34 2024/05/04 17:58:24 chs Exp $$NetBSD: xlat_mbr_fstype.c,v 1.10 2025/03/02 22:04:07 jakllsch Exp $$NetBSD: strcpy_arm.S,v 1.7 2024/02/08 20:51:24 andvar Exp $$NetBSD: popcount32.c,v 1.5 2015/05/29 19:39:41 matt Exp $$NetBSD: strrchr_arm.S,v 1.6 2013/08/25 06:15:06 matt Exp $$NetBSD: strlcat_arm.S,v 1.6 2014/05/06 16:02:11 joerg Exp $$NetBSD: murmurhash.c,v 1.10 2026/01/03 17:09:57 nia Exp $$NetBSD: sha2.c,v 1.27 2026/01/08 11:31:24 nia Exp $$NetBSD: sha1.c,v 1.7 2021/10/28 15:09:08 christos Exp $$NetBSD: getfstypename.c,v 1.11 2021/07/22 13:54:38 skrll Exp $$NetBSD: proc_compare.c,v 1.3 2020/01/06 13:21:18 skrll Exp $$NetBSD: snprintb.c,v 1.50 2025/10/09 18:51:41 rillig Exp $$NetBSD: strlen_arm.S,v 1.11 2023/01/15 08:43:03 skrll Exp $$NetBSD: keccak.c,v 1.1 2017/11/30 05:47:24 riastradh Exp $$NetBSD: strtoull.c,v 1.6 2013/04/16 21:44:06 joerg Exp $$NetBSD: strtoll.c,v 1.7 2013/04/16 21:44:06 joerg Exp $$NetBSD: strncmp.S,v 1.2 2013/08/19 00:57:25 matt Exp $$NetBSD: rbtree.c,v 1.2 2025/10/29 08:08:44 roy Exp $$NetBSD: strtoul.c,v 1.3 2008/08/20 19:58:34 oster Exp $$NetBSD: strchr_arm.S,v 1.8 2013/08/19 17:50:04 matt Exp $$NetBSD: strcmp.S,v 1.2 2013/08/19 00:56:12 matt Exp $$NetBSD: memcmp.S,v 1.5 2015/03/26 13:34:51 justin Exp $$NetBSD: __aeabi_idiv0.c,v 1.3 2014/01/29 22:29:43 joerg Exp $GCC: (NetBSD nb2 20260118) 14.3.06ܛ]x} \U[ju$E0M0 8AD('%%,JtA܀GZYEm!T@woUu3߿v徻{g={yuySǿ'=q:!N$]?yGfk"{m;ː~s>8-+xmUϻ?{U&2q5Mq=G=O|eW޿=;q&Nyזgߊ*1-oJ~?ovu9̋ݱ7{͋麸n KB=jIwڪ___8N rGQ/x-<鱺5-N߫\?Ӥ幔ycnP;T<ڟQHRUNqZ]S?Zճ*?ƕlY8 גu#Q O;C}ř=gW3*uKS s~^wo٫2WUsqz:@l>I &|Ev%`HH +)&syHi"OSZrV&IVp}|n T:7q_O^NߎOc&̤ I:GsxcUoK"o}'t_/t NwqA8[q9N?=q8*N?][t[~$@/}(Ƨ<}l}݊B&o5?wX?lu6!ѾM|dηiKK}߽vRp$J4wbں_}N=zMq_%?a>ޯ_8}HސI~Pg߳7}uEHD8$ WU?{ f=f*$?;w$w.:} >SΊөq:S]Έ{q:M{nJtBJ/{+₿ܣic|_հewF5PK|SJ6 W?w](9Sf}'s^Ւ4_/I{;*xSg,g-^4EuYU `uɖ=Էb>L}<ߝz7'5w|L}Fkzo{}vgu|(H)C.'Iq4WaVڇ)}Z}qD̈́}JtSt5 T^(Qٟ'&?r?>o!!LIj KIMx__K.9V)RҞ+$Xk2jO|*Hy@93Zv̏0\PEf4|.z-k߉d#i;??(igsʿ,ƍt%Q[U_)Ʊ71cEO& rR]_Dqix6tXBx|^=֯d=3xրMLsԓ{ܮ:[r=gjNV''tu|R{x&O~-}9|g~,J &=&O=_+${?>ݚgRmy?9HgWv| wy^>ʂ0c_9OG98eI (zo*9.=9?w8Nۡ0e\-8. ѧvj/ pv-htNȽu\iYwwr~m1hwd4⸭͘>d[: J7z.a)e^7<86ȦapṉXiw@[Ѹ7\Xow>أǎ0.&sJQgy瞡9FF)'|ͯ$Y+1lm(a9:f|b'uFm@C^glM|=0%+b'?Pۓާ=m{s K9?j$:ns}Y7^r6;Plﻻqm G^ 8.}Tog??3g齘N{ 90s+TMhƿ{Lxj7v%pxWk{u>iwoI_D ~je CXv:4N~Hm{tmڜ%^hZP=LoOJ޳2iZq~19ͲM'rN-p~ړ0$-MK!Ň&;قCo:F>&x[ y~EsvTݎ{Y`m\q]RU5Vttj|E>D!5V eC'rA͉uF3wW?:+\ewXhYs"/6Z\(YòT`8fr]eW]>]3km9ZŸ=~Rsg+zW76p7*Q0I4lY7HtX᳻'=_c_YcFoLJq2|)Lšu Z 撢CP@.Ά_wH_WTt}a<&k}w0sψ7oO ||._0rG@,^j(Om=Id]LT'a{nڔLƬ_M7+pgk/7nܧ?}S8töQ{1V:n˝l+m҆_M@5]ggl+Gp@zr.4m: 5`_#*botV+~mw}+=8G٭wu2.i / Gpv>|*w;ןl6?>?~sĿ!^{oza>~z^%]b^]pMn? '/Hg~r[ G`[ F\1#=݄>xKtKƔa^ 3iܐwKm,cu$+IdY(㾄뱍 O߻h=#?}?zue=l%%Q.5q]Yuˏ,rJY|@"qE]cw.Ni}4.,!ku"g;ōln͟ΘWq=؆NtLH٥?5qqq^T9vi{dDJ_خsMj wvx.~y'gN>1?7n)>OHOgMGds)o7wŧ&{+ðU@ƃ3ȏ[>h[]NIQ򝚹N;} inlAiR㹄/}DTx0~Y"< |uwԒ6٥MCUK*uDx 㺧z~EϹ܏VznbBn{NY|Mu{UI> e[t/>#׾oȆ#:i'imcL; ڄzؓzN޻}:Nŋ`z'&/H΍=qobbTJ43|3׎M9c+q*gImT.q g+Ztϴj9"VkwkPvt]t(σR-ׁ)~VY-V-``:6,`{2HYy;ya>u l6瑿 ߯3=1,}OZ2R"qDz7zg+k߬z̳Ѕ=v^CY|244sG{L8KU9嘭C@Ip~GI ,hAo7 wx 4KD{^(xeR&@y BZ+ޜ{ljfA'#rn@< K\V%޵Z@oтhk3r&s/:Y%Rw'AeBf{̓ ۧi}ZgؖuזwgGB3Y&,uK;9VN-߮9A7M/!S??Il9TlۚnE=B]g΄^{14R+OOu*,꒦ztf>s𼇰k1k"~/d?c8]6Z$6~!?1|ͧIpN$xD4M^v'|k8?{O+L1Qi5uQ ^MߛW9aV;a XapWf_1*rs|'w|ٌӗ=:k;ly/>Ԛ> ly-Y'VyJ 6\13L==MTݾs`ܟ#=}. ltN]SG;|7vDm|njSF~cyu۔9vtǙռ{јcLM|>+}i'ɷʋ?ͫH?42> 69:hr,2HLn}'^3 8&NcnOI8dLc -d>5>;.4Uy=Rǖўj_Ml彚IxYTﻋ@9-h|Җx:᜝^) {ՒC@u@.aˉ_5W aZ.kݲ6~Sl|/g }#7E!4yȗlEK=&>8zVd,+?6k\Aڧ;*0/a u'<SnFDl*O:PFQ&&wS$|4o8lmCNa5g>uJ NĀ6$!;(K_زR?ck}d8~Jb4w}\ /.8*FE鋉?j*#w6,:LRFۮYgcO /F>q_@hU@Zk GE:}|ŁEn~±tz=,}fDԘ߭-cmg;ZIݲ6ɫL!\UC+ L?ܳףdF^u7T@,/2^yy;խySLY\G}Y/Bt8jߤy۰sYwi?ƋS큲)|ϒ+1ޥ%$ͽ!k?~R>ifzlr_k3/rMtK^zS+˝Ư ņ%L*a\.y #?/gpiY*57"w5;v9%,v:GmxxB۶5};~C^z+Wucch>~W g&[u; &<0*м`0&Svu Z73̸fo6g<8Qr)KfzoV2K<ծÉh>)O86zфM@7x5Ae=3G'`GKE+Xdk}Wcx٬~V1M;_,-}m*}[^ב 5kԺo(@'w^0Swқ?rh+I{xF]}d:lpo[u9?P2Z]sV3f_[ր=3?B.cHu&Db? zZ&rN`ƯKIm>i36dQ[Nʳ=Q0칾#8_7{[ rhv-25Y!KfZ?.YrZ^+Tιj[~]1'~=L{ SⳌtj\KϦt٫ 6l*bMyIm~E\0'drYi~3#i^ʭÞ\~lNYsJ>6֓leE=7`myo--F@vŰyqza-I}XCm]|{F"u35@~ƎP3ɗT kO6\㪢[瘙hʧa0S:@^P+-KVR:Sw+Oxr^|u-Or={'~=#~@Nj3Psfq{@ԗQ.c\Ct}GdyӳysHA|1Coo4yfj9.^U~Pb|`5?{hR97Ya,_7B{`ÌJRA;n}k{ jIZ|㼥/㺐*5{[{6M?{O;Th_)W. La/?]1$IS1*;)/>ܺo݆ , J΋*y褴oh>;W3B /v]ܲ ;z\,ܓm'xF: w3^#<~Ut/ɿKpK=Nwv=[{{0s6(lw v)=h_?6P'rNdLY.Zn͚VwdCVgؾOZg 7Սd>L*%y l1˿$g"C= |Wgnn +:Stͱ| U1㸙R}i3]QoEa Wd[s_G/c$/C3K ߯f["zHڭM{<2Eڏ-ηOm>jF?^};Hxjw*;ϤnW;lyl4?) ;v|Lz|]mgEh'LjӼzge|=?9Ͻ޻RY*P?o1y_Zs̘l͇!خ^Wȴw2S%Is9PѴIH =8nӲu139z;^g9sߎǺ`ꥊ2Sޯ?KޯMr8:/|/yu];e%lPǎmo[҇le{0n] zye3>_RAps0ڶV\ W[fmŌ]v>i]:;G7}ny-ֈk-sW>o֑Ɵ ucQz~sarWך8}cUU۷ȏqYQzwm3ys gzvާC#0.S8F;q5gsC!a?]"W01µzK=q!TGmCUv3Au" oo86{L3Oz@Ot 3vŭcHme| q3PU_1 L+q'r+<g/K/D-Oʞv|mIՙ㙅6mn5#X)ILcubN`xO붓K=wlaI.u\s*bڱ[*S's]FT8:|$'L}x&)C+ɻz7uP똓MC6\h&sp`cBnנ뵃f螞3*۫Օs'c=nO79y0?Tf~W֯'m '^/< I4kKAXl#+4۩o'\կm ޮvSv}\O]ԏ~ 'hmuDt$eƗauƣ >yU6q-ڰ Z_q&p)տTj6c,W}&zf g_\Z 9}c;2 Y^}wehV>sg!@k1/ns/AcV%.09pLS:i^1G " ʉ˲@ǂo2dzKWRgO5y뵊s{v + 67-0<܇o MZSY A\0.xD};Ъ$]kSͮ|cz0^5/~Uެ_yk\C52a{ѫ'qЌxeDf^w0f͵$]Wԙlӂ g,I?&yQ᫝wM:GdLg{ZˀQ@8Z9/~DUi-HҐ;_=R{v+=K}>1W paOSvo$2Ww]o(sKL/撟t3MO2.S։g=-.]n: ]Me2guu%7禂M//01I˦ך939y0ⷁBzy?/ #͂< S!>'wmag`c ׭3yxo_clč?pg&ĚUIҋy1 [8=覙jî xaICpTi#v<ӸuhC9\i!׌24~xꙴN!$X@O rZ6ڗ_&Z!㺢lja8/T't_e {)'!.q`%qwվy[äiQow=:U#XZ_'s%ϟLaj r=$GZe `?)#qdVbY`d߹ !jρcZˌ:p ̢`|q&=s?6hm=_ 2OC&lH2;IϮef|v~ >ZEt4ƿ;c?c3 !#ъ>c?I7 H ?X ?>VygLY84s&ua3\r[xF{N}Ƀ*4Z$]_Dv4q_[pC=21}:#A\(٢Ƒ%`ԓ(h]Fa_Oz-i?9-S ~`_+`9}S;W/K{c>&pƮj F̛̀ܗxelUȣC?C pw ְĉސh!Iy+Ck`n"crl %siK2edgMK\n3mX ]7C/K+')ݫ1K(w;KޫBmX~H ݋ESor?mc|,gɁ}aXSxU" g?zgg>M׀'9e;L܄<<;.>"vh⌺HR Qcy֞gz43d?ֽ$ӓ9B`FErh,oԑG^jh!D]n]z`\>^1[s&,r(#Y+a"6EGAoyʫ´$r_h0_$zg2doT爷?)p9_gΖQzknL'xhHӺ-Dg  S& ۤ[Lx2Ȟ ,+ur\ 2RgaNe߭(ex7D>m%q!) ~b\A] &gp`b>,_(1NX>*˘%i^!E#LZs@&2_e:li=jlnSD&.܈RnߎC1y߄ZN;KP#澾oW+طbl&aߗ|S-xð)sɩ~җ \o^`;/=}8a{v-=㛍1\l?}廴,K ɥs<3&ArcS=gh)o̯% q>s_ AZfBkt!PFCKNw G~$L q:_wh=\gLgb=cLg&&н!-ӫsڏ% |@oAFW6RIy~]JlPT 'u]olR l,|mAӧ-]#O7e ov'LW'BtFҺ|gZ2Mωw@m]>;4T0exN_ 6}Y}\, x%\ }Eߞ{*;91:Ul_ 6+# såܪ-ˍG qHڂR˅v.lۘX:HzW `? hA~Ϲ ̩}mֱ;538IzgnOef@1)E3VlN$}wȷYlYo7,wcy=S ƫ$lFw]9WeA_]vp}Ő}uYHhd5 /8Ϯ4 ?縉O88˾Y {!@9-^GUz2R->fPײ? 3SOt{Fq?a#BFK0g~0&,v|UM)(Y}묹*h'cPw~j ~f(Lj\WU0̧ ?+}qTȥ>jrL)e,2AӗA޷UYDSM8uk+CTGh7V ɵbz}f!g:#lk`r>E]噩Sat?Y^QC '굽noiJGdJwrieBK^Gb"keD')a}6F>E]R0e/}'+ CqlZh2(D776fxG/kb Jf\Rl}^Y#< GpuySv47o7h?z=q b$k OƔ<6豐OCma=Kxd<)7ά~2p.kAY(~J; ߭( M=+i3r}K?|o*YS:+2)_GyO7E};ǿv,;B |/T&-q'Cv 3$nι8Oco3,UQBdy8Wx}L eh3!HS0{a8m6l?tZ%?;I8w'gg &,z4}vȌ V.N(cҳL9"M>§ᰵ[<z9 MzKh8z{ E0a˳Te!$֟K&BhPHIä)ſq)~9iC^0.>k[żp̽y ˦훲k-r̂V*ũ5ϡ;x5Пޔ6;:A'ee!Vx6,{,j߆]7{㗾ٟq3 ̏cýIRQ~ Mug{56=)9؀:9U6nwduwZ7S}3Nv~𩭗?`'/iS}l_a~qɵ q|++N~MoWL:-s0q&x}i['ޤAs>¡wg6lf'}Hy0-km±v6m#f[]=m#a 4yZvۦ̙-.l}a: _3!~~ 7xR/eGsWbk<?CZ!D<(eu1 ¨ۆ58<òW|g>7N?ۄ?F_i Lx3gW YsH)OZQCp\'ř~.|IOlWTt˯ :6hKOv|i5xUy5[Ӳ)._Gݧ󳊧˳WBeG޴/k6}m7HxG kRAvty/(i+\ۺ!VZu6j:S*} "ͱ>2 %8&||YS,D9+ccᷧ򍦗<w4۪ϔu7}L鿃^L@{kO=WMC|ø:Nl^p!}ѻYH >=%Ky؊[_^I<7Ȥ6j#i4핂 zj> ?1q?O+7/Va5aAŔu>{JvknHO#o"y^g &^+pD,cLEwaغ P=cWsF׳DnD+NwZ\e_+;N&~D3 `CƷvӸ6@}V !+Az/e+(urj+6JCA-kvyi\<3/ScO~_ GE\خ q3JUL HWA=.}q[Y0Bz)gI9>W&=}Xǜs|ؖRg/&<ό=]j=꺟cq}vRɾ}zB+\7:JcX q7 mI>ŻRwpΈi#FV {Zg;o*e! yO52س}< ^6KBu`=!օscc?>o)MyewJ9o9?ϛ9Mp4h;y?94col^ڿ=3y=VM5˰Ȧz6:o˚:ӞVںK엵Y|yGDzOtI׀.AIa`4>_`Bچ{BSv`Y~ .?gz1͗bzmc>EC}s}{{Hzh\$C?4](e`c_ke"K?_Ynl'-k'cO xmx>\5}~ls? ',2wz9ţ5}/+th6:tضI8K_lZ8%z_#=>ծ_3^S(.5 5|&܈t;YOJJsT9$m]T?MUKl')[p:0Fҗ)7tAƱCưWHIAYyAC5UJ_j_(=֕?MX8[7_+.9ϣxӥi>#}֔q]$M 9-j쿘gx,[ijmRJkF /`Ĕ/ؽhQ}k?0Mc-CHi>Z NK blSס[ zzҿ[UHӦ {gE|!%:Se6W|UC-w归;:͛M;Nh=)et4#q)52{d:%e7y-NB6~* }:V=5'_Ky>S{/E4)m9mz{yHۤv1 }*(/M@RPqo(~4o)p_|%˘g~O^>^w}=R\3U)|c1B 3\R,S:;NT~/<Ԛio|T=ەt[@^{-wѸk}w|ɟA:F`C(~i4}!/EE>IҤIFL$mqxGA=5=woآNw:>п\`Lke5v+%C\!`}ܢTgA0am^Δ,ڃ 'uLp~.r#(mC:ό9'cYe xJǂ}uݥRܠt'@~uoC۶_ʏ 3%ݎ#b.qe^ND}}쯠uh$|f 4(ڭ{5CIW1i)}BN3\_KOf^jvjF˸\yZf~02"jSO<ǥ,HfU5EK(w ɢ g=eq>G{/$ZRŴ56b6Ld{; 7\Kƀ.u)|?oE.69b7ďRr#-0&EWt s`ѣ :uY'D}i\҆1Jq _CY]M6t_~!=d+\4iy)~1Pwie'tczE|D[{%=4smdCӐ1Z^=՜ _>hS!GC4Ӿg5s|}|-b,C&-fFz誰o{ K}^Wgk mG-Ky(Eճ"*n6.)|yrgQ?(lW a6hr=gM ?K~:ϖseJo>ϽltoX Lvk=˵uRȘ Re֡Xhd7 ^]62Ha@- #?{ٍ%kd?|J:SPԴ'=oA#mb){N}jo{~yr?,\Ej?q`ӊ+xmL?}A6T cOzi_hW8öh-6~5lז~ U(iy};O"|Ĵ?.ĜO>=B-ӏ8Z*e zX6 cɘ8<_q'dOuae3xEѣobrƀޯh*N_L!hmHdL rHwnu]KXP63; .B7W&Oms0G;H;)Ƞ_p;Z` +y6<~9SrDuT6v8yvR>/M: |%c.֒r+=Kܡݏ ̞#f:/3಩/VL^Wza~=u8 &=kYmҘXY&ؗ@GmgN7 x`)vw$qO Mطtiqo_{ .h#cZ &0~8tn" (zfc^ rv>16jvT: f⸲ߒ ^? v&SKabzc]oڊs\N׿5_Wɐ.X=%w>ݬpNjbovSSg]8z(>ЯQ:z #iG<֑d4gAW?G*Ʒgx8d%DgѯiIzIJN't 蝰.fgT]ր~Z9V=/rLra;s<^u|!1aB1˂o+cmrp$d 1-{y?+"'u !ہ8kJמے7]m3'^܆vRM/@Dr*Q}v}^ᡴ7b9zKk_K}}阹 ӯ2}ܫP0/̏T#[Ӻ1§%̼ |?*~dž?BOkTZ%b{y㷤hviǛj8UWjFH6Y!B 2#,y=v"⁳V)c|??bM=a>Q\1G/yc:T0}p+G{? E̜5ͽqeMrLݥ) Woѿ̫.R/9^~Q,WF>Sg~ynOo)5}>8kEA:vè%"!`TX්qm|v(.>gu|Wڴm}|S犾>FAe.ocƚXQ-q16&!SiSEpL Ӷ);IoM҂Q~,ti*u`q~oaQ~1&m~9/+I.{&Gq){#9H[}7Xm4_K|E=ZL ~i 8wN3x{l_.hQ9E7}6XE@Sgw9m~|8w3rn_.tQ͓վIwQ΂?:.3.Bg_-Xçs觊m b~e?Xx 祥zV@Ɣ-iƸ3鏆U?Mo\`$?xD|u8hƯxH+Yڒ2=@UD;׮XO ʞF%H2+HK|s;7X\LҒfiGgnSY[aD>jD#\^xnꩣ$!;-蕥N2B"l߽֩I<&u.)/_POǴ cO2#41<s쪂I>mZ;x#F&ڟm4  1px!l1͙sc|yu=! :~462cCMשjtI䗣X3xo 4/ԓǰayG:_=~˚{<# K2HlQ4y{ltRN3~=nŊ|sZZYm \Qߴ3ͻ3i]~sKJF+\XӃ˅͹ˮ&?.x98``h+vc+&CO!i}՜|\Яܗ^^[u\W7:x="3>#DHތ?co9Ճv?M!#>C3'_vgm;FF[#PqodzH\!|ЅJ9-6KaQ xiu P뻮j=0~2~o.}}؂4e8LZF/i٩{0wdsia=XSƾ@}Sy^: /mWʌl0>PP+Ks9&dXR{aO C#.Pf-eͲ\ kCoM#IM˃uE.L߷^b& ??ZWjZGSƨ}{ݾ2_; ] )z56 a uSG.]ЈU"żcހ!Ni:wvE!C\Q6eY n]>/>9xܥ&l 'en)zieieqȔ[m:_ ~ī?HYۋ[i"Fe=H6جGp}.Θqcl>g.rF˃\Dl_=nīڅ|k~=?`}DJZ xb듖T]-|S hޖv*$<썤 xt]˧x3 [Jr8an\)ڼhǟ YǝtobK8G;B.FLTlEF[=k{{<ü>;^{e_mQNʘ3Q!T+7dθtv)&НCyG[9%zΚ2e )O鏟uo#~SV߃7*=:6:Ș_`#qj{E|vLZV:-{[?'jCA2l'^B 'z^p]ߖ땍3ݔO 'Zk|ht7TJMʫ7;gev#V L&]î[s LA9Ir8\()=QYQB^21v$pC-^scWcwրs}@l?tq-'qD^6a;ݱ5s}tfѯ{+:1\;v}LC_U/MVFvcV0ݟ`[ gTc̳Ԑg\k:*fc~MDmtԚ;a)usZ:KKԯ6$yQ/e>$wye#T'GTk'7ctuiz^w8E1'vn \bkcܞ[~tߌ?DD䀐hR2=+qE?" Ju ]UPLaytq+WsFyfׇY:&wN"oc5UDt +;'\PU-i qcK\CD{rg~rBnt~ߒK m<'a|6;OYj~}5[e&_eqjWf^qm&O;BtDt\lRNNt?]JlQ"|P(X{@.mXMP|jZV19'TϵY`^hm~&z_R7 s/UwV7e4'1`)3ve>=AIUp3vlt`u1:D%ʼn|;6O23/Xzϥϙ8wۻ1LlP#Of{1(ޕrvsv{̭:v?N˴Ht|CWR0ׄH[^h\ánZ8 z݅B4!oe\WHRL#KKU͍S|Qij?n8Z6X6q4m^t:}g57ulK5ȋwD n_Ƕs'̍QYK Gɶq>ܙ?Ϲ)=1K3+YnY!ۀQ\K'=Q٘JʭVB63qC+37֝[}8ȸN+EkTwݿP|7߻&u|~z1L}0&OzCY8ށ.t6: ^n3s~Y^{ }0ds4<eݙ5܅H^)/3yNns_Wuc]=(pr|nLF-gNiuuMgY[d}BǑ):s/~W}ulrcEOfu{12\YÓ.N'j|/mm&}z߇\ИC]F͵sfok $_-m'Q/sBQpB7֗rIm{䴴ߞݜ+9;?Z-w9v#uc@ٝU~7QSf'Т>J65#AV|.%R_>:foثPbLbgbfsOMsE=cY܅Xwɧ6D;^_\&tӨefdn cQӑ{(O*!栒yF3#|ִjFb6Ž=*b~iz~:!ǯ=S[]2m]@`epؙUtyL."ςP:B ȋWoQ{wO}uj{Еʮ?U{`#cp{:Lů`ٟ*~{iY2-鰫9&{? U6U[z?3>$#ض|;l79A}zXެej{䆂-*?zW ϦZvj/-ߐ<}ҶNNܹ>GMyfQhI؟^).Jfgڌ2bDk:eFO:@`[K}귧5>&Q󙎵O|:n\]tuc΃x@lfsO9bL̇LJu湦3 ٻѥhg$붝Lou6\.3+,=N?LKo']ݓIdIy ux?v4GרyOnh*>>cz Jwx[zcFXK_+)+^sr͚5JBKLRrb'7Hȉ}n/*eɃ3E]ştl '~-;BFPk>p0e>[ҍL؞-߿{' ہ|1fjK:۬ :l ά(l\:0frisl[G1K+8 əxx/+*c(@b9f\oZ`;A>Z֮sz]3heGC|4&Y:̉r3Ǖߎ QkJ֣s=)vvGo O31'/'STߐ᳴_lsM'&&뗧"9!/rm㊯B c1s>]@߲>aުQ_'Aψ9 9rM Rz{{OF#_=j>rr{/(6F͵e~Jh|C#P'ҀڏL/5L/r]"*$11^gs.] L[n %tc~>${Fsrר΋WiI甬kd>JL<ǿf|׍xO4/EX s9t q5sdY2bFն?:Lni=DMd[i6+ɋ3(_dvnÃb7cʼn(U:=~DU͎_ã|Gԕ;ћww*hKUP\]m<ﳚr e314_=44b#K$w]XX!'4JA 5P8~Zh;1҂bܐcm /\ԟoM<vgF ΍9 6,+'G`"߼2yYmk1A,>WIѼ >"(.ʿQP꣋3&va6a4!ףZǛY{A@D];w:'o%0BDńm04x`_t9_X`Y?_LnP]D2#1.!<+Ԝ)Nއ=s-UUJ|z$PվW4Z:_}jh…)X婸р;Gk8 Qź3ZiwG3-Þ?s,r|`|!ohGceVr-T^]N :4>k%EN_M~[琙@+sbr4~;C񀮾 ]Pbl?а~y=g;9YOǰ11Ǵ/&t} ˅cIhT6F/;; ?FXM[;ҝO'6=XϷ7c:i?43R2VqzZEmX^SX||XG~?5M,Ix%?76$a~ޓ/wG_WRbj?j?wW퐵* Q8w֍su˳>黨_cy̴KM;/d=⫶:?TE38L7&_v}cOӖ_:En(*`cE 3Zqu2f9EpOY,l0ݡltl|YN%2V8q&,ٍ nr3a~{dJ'Uzd}̝cCJ!g݅Lτgl }Eީ~=C)ߎCfǚ+_!CW) 9=Gd"[k ߽8ɼUSgUi$SHQsOT\>B受ſ!0Z7W٫\ˎ8d~ 3;N!OV"-5>%[jXZch_c~niʆPDsMPg%_:qt kVg;-]✑YgݗnlMљRtXWAtg_獑?O 'Bl! _tO(`wO W:wX -7v=~OUU.]QG-LGؒM~{w0]_uiZVZvC8' ʷ IiQ9 Bq5=gr=cޤ<ꉾ2-T*9y\jm ۼps8>4&tQAOy7b"{ d:v=~YzՒCUk~.K|t|sm,H wˠ|'|]Sk#cO^n d9Wu~ó׍ /ozwrz9=L(`*u6OUS˯)}fJBSoN?:#. նbo(̵o[P:ɴQ'V{)~$UYmFOo6(vpBk".;諱!8+ۯ_.7l<߾r0ɑX 86UԱsW8zasNS{?93#ISlݽsqtz/8:jD?FWQAُ8܅0T.c^LRt#Oj1"ʗ6G|A_J}кtM9C$?8hY:I*Z)w{yYy(2܃N.w%lֲP8n Wac|g 'Kts{h-絶2 ոqV{|YߞĄ{Cb)w|r]֩9 |ņV}6|y?_w4@ooq%Us=Ko;WYy\n|1qtPt7xtImMy #G ͕+os?#łS*OGgTovh osqO9] s9I еar:沊C-设oε D4%vkg--k(7!O`ab,J S@k#S XƦ>ϱ7'5x5jwuA;-kmL}i:stH?ceϮ/31ݺ߬Acv|:'*SuzWȹkR]+/D?[إU,uu:^fR÷Sft'VJq=ɐ??9y?LWekƦu s-L'[*WC%=~;tg7bPz|+APq!>ljY+?4$"F:'$m. 6 q6e?GC~xs, Q1*6-3.Y,Eq 4ߕCĵU|4XwH 7{p&*ňʽP/ 2\scub\q:ln^.%I0ϜUN<$mX.6AQo,Y:e, |ا;D8͋b'ٜ,_qs^Y>&}rlr\eSz _$ƀ^s6\ZXkMycҡQ;b^oSߞ%_xUC7&_ƾ:*pl P}ڳf|+1MV _L1~F89덭TKyt4c~:&r+^"KFך#V1j4J"8BxI$BU^Gqdk ϕC=Ktks|'!au~.w_GЮ|A~n<ӊuUnJׯDVL 9:zړﯰN^wq5qX-%>vyoY2>)( =Vg%22g928~MwdA:o>#+D_O",t@d{r'4@n@nL }%|XXא :L\ͫɓ^"~ҰQLiS W n5 B<1Wf)yUpsA?o ~!L/aWFeq@ef .೼W󆼰K[qnƴ3-#|OO'meL{3OY9Sיg#Pmo季ջNV2mжͪmY;_fbd^4c{5aSvS꿃pWn==T{zH{HIq ?*C.g%6!GTpY('h3\"ka }71ٺ+ #%q .MeW:\}g#C|g|ؘH|؛Fo;ʢ,CpqQo `=FmFc|1e͞ Yk< 5Nn9cW~T&Q> {=}a!2Džc?YGvZkfWWzfDŽWg&ӥSCЮf1ϦW<gv̮1g* =~4'`=)U{NIbx}ַo>_h,_gw {x=O^sLR>?6߯SB/(sg;;iRy|߷iN|9E1Z0ƭ?~2u_|@{jęF{np@m.R_rlv"IB ,`&BwAN"|WȄ]L,Au19z8eJu٫)ƫC}ģ7W(Izg8/'fw-mrZU$H[q!b̵IuOwTj߂7JS|K)+5X/㩹?͘/}.~v!)y_XgDmeO t?& |]Am&\zBԃK^2Eu/x;Fn- t4y/!/G='zS6dסGJ}g ^!|m߽Ax#Ƈi|YAxG7~5iVӘN4NI퍛P'b·|1}~eT|A'vo[s9){tK9\aAߏ=T0Κ3Y*ݞ5kYU_wh}ϖto xR"t@ݞHlu%E.htK@v:w9rA(}x\(ǰYV=[NKͫa|Uc\o z6Vcyh)h)IY!q~_Ja?.zfv'=[;UoӘjV4|C-=#s`Ńg>K|mV/z?߂ Xc]7ʰe]]2% gk/3x~1[f>ʰgGHd$9ڹ)w9_ νr\E5rL ;OzW3gww"f28F3V`neXk7w>]Zκ6JDMެY!dL7dMd=fr9em$Ьo1Vs;U=ovlf)=ArK2/zͶ L&3]]@N ˳cld5q]3l7$f4PeP<%/9vwІ&9mC7+?c4Ũc;^sf$\9>F&E<~c62)qL4~JwUo߀Ϫd<%:^< |}~Ÿ ^Ak(xfvn\sO.ɵp3?ɺj~XW7J^NZ\ &2J̵wL枊n-Dܹ\9; o*?{) Ʀ|?zpߪ|*ua =6`.?7|7[%֋wqyNz&Ga(3CUş0g1w}–O;i˜_~G3/|8w~=Y0΢ O%S,Br 5w] c~oMHm5X3y;LI9͸yz/?Ie:ןW+<21_ldGKoj-#d]3ZEG&b~t |^0넆- D):V't`N2 |O ]϶ճ &M=-"S?ϛM[ !Fj2^9)W@w d!St=?LcF0[ 1s,( .U+&|} F M0t qiw NmUO}e"|2w) 2ZlpZlW V§a^t!CxZLDZײz<: S`sR\se<Wv.e_СZl_ ӵ_>Զ62IuQmNͶKk3z]mٻ6gkڞGڼ/2ۚ6v]/<vapE8\u؆:0 (`Wqa b!-mo.`· nsWi~D!WAxuyfKW%@ݨxsjDIf~n*۝:  \&ȣ,О7DW C巾"D.~:ZsZ _d 'OŖ"c\lM; gIo?Z#uA`#o 3ѭ.g !g8)z[|V/tuL>6..m aU}~.}i_q@S=U](k au5_JgU=+KL~|P‰vُ_hνRf=@hz|vbN [Rz.?ھ@0xKsZېc^♂zegbK=Kg110xsAn7gmrg)%_.@0ƤTgwQb.sg\ /;3JxCD}`?.xBKV%rOARM%{%|ل ^Ae]"#UI! F.q0K߻oN}9+o-o=곳7ĸu\N&in4"#h'1: ?U_ B1|x?g}W'N{{p~nCY'g$ ;kaW/x xo'`ӎ_sy`jkwo(v:m񿅨_'k2"W>k҆ Ro,B>n] M#ߖO5T mԹ[iڐ&^mCI ʼ+kdicq#K5M#kֵ5v:Fv] oc3f ]:q7qM#@#_ ^^lIJVW=~?idyCRm{Ҧu]iSVcYj$Ŏ{q_@}ѯfcDޅI#= fR\cudRzk:6zW\lK! ׻ N'lbmG :HwY3!EMMOIMOYMM=X7&V{cbnn~XӶ&/}sH.Ml<^P^ihn!o?[L_7awV[+u=oj`֮=C&7v͂aWۭ=O5v|C+M>].+l3a;T瓛Z\RߑMY >Ԧ.֦Xkju9Z}턫Ex,63>6k ]/3٦d&T_l ?{Qc}1TTaڔv_z_S ]}٧h\#\qJ3"^S#x23j; D, 3]jcDaFD36DB}^޺ph3]Veq2GI DλQpA3xq3kue3hGiƲn /k>{׎|0p|pa}o6B7N}L 7tch2O-mk$mk!mk+m,`Ў~>A/L}0OL;OGS?ئ~k4?ڮ(Yd>Z~n΀+Vqws{x<66o6As~7$|*=I7KKwվ3}|yvљE8/dcC'vb/Mҗd_5w|\t8c[Xڕ#k`&KcMv5G0x`q~L54>O4S?ᕦ~kZ0]\ڋ*x#+X|&B@ {|zcjaoos`O[6u_+{%/vzPiV}~NF[Z:)giMxn-m -oiے})Qgז/ٿ_:>G1% -U/6I@WoFG vr3"2ÝX{wͥڙ.$XSeGϒ3 s_Ox7IymX<--XKVnrǷVm >Z2@wde'<_YK{Nޅ֒ Q-9{=xjkűx=q{+ܻZ+ZqhIV_mߊ>ʾ4mL+^ChD\+!}׊cY$y"|؊ΐS[1scgNC'~`״5Z8[hz[-੍-b}:= OqxԊG[}v͠Pge_++\[Y/2>])ּf km~7FV_pG'FX[0LJX*?BꄮDS?cC\(BGSMӂ"~swnz[^hmRT{^A{)lk}iBkn7-ZŒ!|Щx+_d/Sμ6׭S 4Oش3j(sN W>/S63i=1FlWjD|o?wqx\U W*>цSm/y4w61BW>W h꽏ڡy'_uN>&^"~4^$#q;D,g8Ⓥy:j!7y[[ܶܞKA2>1KL)d;Rχ\Oh+4gU4`O*4z~$+e]:-^pK$^i^碑fmF{޿өSU6-kkg[j>$|Ђڸ9v;o|vlߏ|vg;+v,:߉0gGf>^YvVr~;_@ Yxjv57|\܎yѵ,`Y-۱vӶ1JYǎv|t;,7D{(wob?[#>ۜ{'OugJ^xoR}t;9$1ǔɝnhRLՉ*hoM{A^>8lC{57`ܫֈSsB2}aڣ!blvsjV=%[14>v/,hxy4s]{x# /?RcϾƛ/wvuЯm$PmZ3w%1yֹ tI?l:;ܫ*[z+ۈH<왈?V5HH:p V_W#X'RuAd"7B;gwƼΘ _[$%X]kLk ݷ:pLY:0mh#] 2ukϲF#qϪA،g`97k1Męhe]Ac}qaLH%Q.m̕QYw1߳;3fv>tAS^.htMG{hun>򀢕e o7;;2?2wd|##zgT%3vDZL׭Y򕗜̞}Tke턗)ʴIӟNԼt473c[3۔b.;s ʖ?޼{gqO7›:i~ &rG{c^ޙl"Ǽ/e |3ks|9@87s}7! Ռy_p/HKD۝Q{nՋ&3 0_MؘX8:ds&t.VQ֕Sfcg=ϚF~l#glS%`+gI"LB-cszYozJٕK Ȼaܥ'm2X[z{VMlo} lO.~;/3?w{]tdu;K=u m,$"jW^ZYar`WE_]Kx } cse O>Ƙ=]'Z+2-G_6teM:qsW,vϽ=w2'?)}|poY'oww&ڲ8y( mʢ~_Hڀp?)cW˧Y@/%D t A+&jݍ}mQOn,3A=c!gH½DUN ݍu8v*8#|~X΀;%3`C7_>>э4؛w}X=i7.n"Ǚ*5g7![w~=ݝb$!>#LK[ݭ`N./: Ns`.-Du`6w=9t\}Az[f\^αz;{/KCw!`mH!{{XȢ<'l܃7HQK9P99 FII{}9E|]Cx§eǕ=8q&K_Ao\CnD n!GݾG#$sRO7B CdY4OPٖ%%]e ڵWچ*uUͼ|ȸQs0 GF ]v>³ևi>9r*xl}6I}dq:_Wa>c :)\7\ta*'V ظ1t>n't>|g[Fi}匫AV_YW GU_Au׾r. efW)}t; SD"MugrrWOܗe}ke7e Ϸ3郄 O$)r<7'ۧ߾VV񁴧,/e_ GQzQx[e~dٴ:[qaѩ;ބgD}o _Y|+*۔џWd;3VԿ2̾{fK,)gIقq]Lx^Ͽk|h; 8oC،>Ej >.qGDH5xqX9?٘ݱ~6V`M0*n)fʃYObӋ' .S2SdF*ѱ\29ZsS޻,ET'Jٻfy?\'ȞR&_߀t=vfI.Or8WjM#1Wo4BN+ %WDtّC?4s^[1>7{K {c ,yV0:EQNx#y~grR\*?%u—EKl+rGgbJUwwUjcx@Sh1О Z[cZZ{rM8t{Z;`s6ntx=껛 ZG|S@|[ԯ߽#g&Ϩ1ȭ}k@ Pƍa}_҆WMԧymc0ҁ6P _'߹BQӇ ,ᙁ׳Xw]hG`LҟAR]LxA ~/hC# m eЕB~Php mHBكؗ ٹ8fQA_)<%8#N&d08=+!gc^쪲Wz=_kO{ha (eq Оw1/bI8u0%E`E-xy`EsyNw :O0x1m)_Ͻ'ꏏb♨ \P4]=hT~gSB4O|Y=sD%y~`'rT0ڵ-V3]` __d[|[]͎~u>#3MACB7.d * be%Cl q q8LF!oȃ Bb;jtcss~y/WsQ7 䛇XC/B"4.KIw ^zSBޓwaFp~ ( 2ʾJ J{PY;7 Ecbˆڸ#B8IC8Q=.!Me㊡i^D(/@oeQ= 56Uw.ߧ^O 彈5~{X+s0Мaiʮsz$X֑왝2wfl'[=$0L8e߫yAclUmIXy S{۪ /Yz0>V2<QUp?6ៅ^ gW֧pEz~)eОYVLξh6ΫWPbE=[yx8wV??],pC: ya"/? f?k`sG0ٍd=2BRƎMacNacaGӴg*b|Tb1}"Rn')ʤ0/={YOlt! kP8ANK|w|7O.a -<~GXuny{R0917c 987Ώ)I؋ 2/ >`/`c ㌛>`}H9l我bKd1+9Sh'umͻлƍ|}]G>ɉuL_I_G3x Pxh,`_$r^K؇/[rk-1>w& k]12 lXbڤgHqV݀yޚ" /Fg15u[1`[Ǎc~qo9 1u83֏$7ۖqlqq^_88?ׯ8?Wx^xkvvVW`uYB 7`r b }PGȺ5nu#c[N`cIN/E~zl/ cx'obOP:>m20Nj| : ߽qB3I]&p\[6P"byvB1c(:<t='// 2§;L1LuOqGM~u^.gWD+9~6/1sDk;~%A4xr>%Xω%Q2L$?hs}vok6:ȱ?pNs[J4rV`avwϋQ_g8vI Oud$m(>7v$շ ȲWg7ObYw^*zxǧ'KچIV$fumĈEbwIiSKN漕0c WtLdP %Ηk1ښlslslsB>",6hVRddW6Odޓ-O1?]d+e Mb Kb|L.&|& +bPiۤ'kum?WI;OK:wc=2/N{物G䈙jώS}{2v恨MDx-IqiO42 ?&cXJ  5bMOc8b3Yۘ, <:Yo?%klGe= kiL0 m4)M} 4e>GޝIYC-~LҟS${x6>ϕ.Bd<:8qA)-L;Rl# ]J%Yog~!7^=s^>ԳZڦL]{ݏ~F1{}:г2 }6 }5 rsgͺt>GT<̃j=nmПVdB6.穊V`|jtRw>qwc?C jhbG8.$}^`dЊs<$c:|!<hb{ADh`; 襛KLU̐8a"t9.!f(uAgEvı'|EtXy;_cIeR ]cC; hվU<Ֆљv|2 wG7y^BZ F `f&;m&x49rir,\y/xkfI]߶s, ?=!_/C!_ӴplO!3['DlUDl!KT%2xn3ֻޫ66,OP'0sP!Ҹ쇆e3,K;wkkfgx,ζgN 8=xblc¯ ƽ]|Ȍ7}xH e\a?r8 c,\pC¹Kk~οF?(7P(57ڊ/0n]ŪA)㴭㟄2:Zq@3qXhJgߑ^=|)Mw/˄kT0huLKg.3-]@(δHuę.' δt%Fqk73-]OYi魇[-~ȱw.i?B#;y1?ٱcI6wsR5ոw!vReZ:މ'v23Z]gjvK)rw1dαh,!菦;wKq/=(*'XY3J{tݤ{lp7]-dαs9lǏcs-/^HFsֈ>k5W&e\ۆsBعbkW屽S_j΂U˯ |sOJ!_4rW gp||:`RworS|Is7ߒ>[jϓ3By6`C `Mg/h[2G8ǷJGMIjYT*~,^zqgH?;g}#*S-SCY'[9k΍]bOaOQΙy~@̅^EX{vYٚy9'.<l-`;~쥎 @boZ>jԃ=nlCohv9}<>q>'|I SCvp#{6nR瞳Ac.K}9ws~y's;9E|&N߳9۾g0.o_5wnzcX 82˛~B #N]l^~&Į`Fþ&r$y瓬ԹKIʷ{γi}<~tiGnŜ[?WF~/|bK~DO1O, Hx7 w6oP>aȔٻ|X3Owo We/к!#=$g׬#q :\0|;=&ڦc0o Z:y9R0)K%<&*oI.%|:rݲA[X2,m]b>Ge#=,MJ/J@E+P ) %tB $@轷{ 3f"sOuvvvvf1S|-кN`MdMIw^]y 'Ӓ>)/)c/f|q ࢌ1pfl k91=n>;Q|>OC;٩s_f·7r{3^9׋9lfnZs fDŽfoL^ϛP ;Nw-ߤ% sr🢌qemҊڇr6f>Z |w!{ngWUgA+:nl%z];iM)|qL2g[w+Mdﶢs.)bΓ5s+5 د_36mMs=ƸJeu]>enc'`7S gej9Zyi>-\N$7 n-Q?Okz[ 󻵀1 }ip\NN=NcpQ<ic*JiS6⇗p.63c[3{mdKl#?ݨ؄j#mD߆fh>6PXmy`A}݆heXІp1}V[med#mM[Y?8Vxնیo.v1k(?b~,cqomG}/oNߩ;ivZs8:3pԘ&3)jՆ\fwr?ʼ߾SN" n_A}k W{?:S^RIo˷^_1O[6|[1i/yo]<{+F'>b"%^pQWv2O\No:spY'N~oȵ}n7~I ͦ\HûҌ.cԝU@Uq$ x= Am;] =B+;mo@TQ҇p|Ou7:up%Y-i;^Gv7Mck4iUNAo?vz|M|?o_(t<U@'fe'j#򴍀cg ?7Ae(|*y)𤹀[;/k63m1?wu#NKҳ;,K̍YkiIo':{((w8hG|ǭowȕvMOM/B}U9y(hf]d/Et ș\*v..tۿ]Ė;Gp\q;vzɂ<Zs807Co Wߌpu=9(wKn!Ǫ|q *DUQd <|<2Py#=Ķt||3Q*ܙ/ULWwe^Yȯ_w%^t#,5ܛ–1 x ƵSqY9!O)<%'=%@O q>4} ~\<û!^sxUy/ѓ|\Oy+bO%~UO?Fyh+8#mC[Y&zIѤà4透t#M:ۀ8ɿܬSZ}$^~%>3M^2{/C^2z ^d#J^cW1y/}u%z21^W7M%z^|ԋo-~K^WzzI$S>`woXҌ'oP7&8_wgi^VoW '2>$XΏxGr:S?7$o֯4mE[ݽs7p;}75x[qoG23G=q}&xEmE.Z~#F~>jY/Wܔ4C+vccZPQ u.o _ׇl}䝬}䝬U}H>=(>.~ M.rzUeKW7K:}io/ٗl}%[!} uܓ2v(өsDOL_ }YObs{+%yi?A L,48n`1 82[7ߟ?\>W*;OrǷ~q8?K&ޕ5Pz*if _Zeql6PƱ@Zo Xq 0Ƙg2c(8q&?|{d/u7M~|o`2Q1 ~61xxɏ>҃ ̓ &?+&?spƿ9?ŒW`'Q7L~)&?&?xqKݹ3wjz_d ןc ۜ7mNYx~?e4P1[Cڔ1I[x x|j/wL90}`Lk9k(Jwvd0wW8!pjy!B"t2DC;:0D|CΣo"t~|!BIC:3TP 'o}( \PovW1ؾy< e嫬_239NPB e l;TȞ s-}.&ǘ<یJICm<JwlBhruy(U*>qgMnj#u>Lto ~ƾx]]?FeB.c [iDh=Lwa̹adleU[ΌqV 16 1v2q8 ]K}DS7L0ٳ_ =x+Iےm|L:Tb2'OF:oC߿c[{ Hm_ÄF L q'LFS,;0qGoe5&UeFtq&a-o<y#u8.r[p[g gpÉiOBˍ坈N:q #|g#Q7cO>?tZ  RKA2"Cif۪ 6Q!dlώw :7t{O ?ǵIuYOsO`Hj7i &GRV1ƹ>8y87G~0Rh (wh+}ԫφF3OQy(zײEg;D>-5 h^(ړ럣(..ޠ-1#;ޣ>`(oGku(2ܸVǏ:ux(ǩG㕜t7Jqv{|Q[OgԻ7hh/|444I_M$hWgM*ͼixԭ44dw{J1M7crE`WUF:c59?qqտ&E1OʎrșF,iϸgql[cr#F9wWXQnghSem<9Z/)|w3 -/7̀q]beY0^| GP~Vfl ;nOGEpĎ[Bc:Pz"T2cWywTQdm{@: #gc,5pweZ9CȺ9F1nMT}gƈn9g;FցX{Joqda;=ecV壱bZ}XiOcVƸ+fX9m+CcIu]+}z' c@OqG->Ʊ.t[`U[ƽzj5N Ouvc>d^4ni$/>[HUh8d.3qrFN=wF8p7ѲwOh}Ƙ)ft,ɏ܍evg{1~v uExxSZ1^ax-eq8<^v>zQ7Q0OH;?^tw ;&Oo]X*m=]u Lsr '>4e <*[>^Ql7MC0.ck# 2FfILL~u˷Lho4A:oڏO({"$=t SA p"Y^D? ?,X.o_+!Ϛrkq%s 18x1O3 }1˘wyGW1juetk <>=r}m+bX6I_6v1wLI?1IlLuW?Il _Z]etݓQ؜M;~.,V dګp|,vk'/_&>:Y5|)g)Lo;c9'ZMlghDOM9~^,EI;f /v)b ]j3>;?B.QL:SfMY'NYbFu:O!gyCn8N9Me}j}D~2oOS6~1lv\gM!|mлepg=yxƔWggvN%m$?XwSIJwRSb:Ut;f"5T}K<؆Se?e^g]w`aC-y1eLO( "vͧ꾿o*ШVї[G~kuJkYr$BlG^c;"$a.y*|[Ǥ/R/2_sy-f7/h_'u9"ie"o ScG O&R_E\XYUHoHOGXmG~:!Rt "E6R-HyKxܕ|sS>{ܜ3qO*6C|gߙ3w 2C|gϐ=g8CfȞtδ!3g}gg3w)M@8|;gaS>S|Mo?2N1IcgqE1F\ɕ)cɵLjG+S>֦||}MLhG9ys)BS>||Ӕ8ޔc13a|ߔ)s&8=c|'L3=evrݔ+3lٙ9D,h8di\|hڀ6+mWNTKi==L9O)3|4mE)u3|d|rزۛ)zs,ћggYii,;H7?f|ێ[/}ug;(svs&ǹ,,fI,3_NWm>sx|?Μ%vg]Ybk~d6]ct;G|8glYM9fSݦM;a^25nd 8n'bqWan#xp eo cxg_1GsO#4syNbk܎*BsoaCnevm} +[s^{WpfZ}osŮ),.oo;6\M04|;99c\7K1ws:1{H}=\{">(颱]5׮ 5oov vyǘp)T>1zy1) ϜKyp~.5y\|9p'1~]Gcp>kIj)}B,[Yͣ= LEɼ'o@Tb.m wXQ[$3nq֧0zM%E}=d'Ln1Rgg3'K(v/Kpiݷx<ǛqqIBzޒʺ0*WN{yDC8Ϳ_\iNų|9/oO<=?t|=j(/ o{ݼ^ 7̸"mOԾQ d)# .y 4LGr^]yL>߆cx|}E~lmʪxezPtyǖhM2c /p~S-p8- OXpSOkUٛofSj}[@f;e]6Q& mpc8ո7jqnRe/2 Ǥك-3j-3/ 8'kl6/yQo@MCs՗G$33 c~n(?M;k+Zm_M?|79L|Xnld- Ǐ\@}hК|_@k<.r\l^ j]ryp]ޯ.0^\"#i_(H1Fy:+cs3N^qoqYr';P2^泅P2[4fzĂWY.dݮoV?{}](vJܫq.c>H h*BѻqsI9MBM0CM$ ۀEoEbQ\$&.{7|z'/rHGG ۔C x^~P];3!5qSoeB}q0ߴ*7uJG3=(@v/>Kl@5>Lx]<؇ &Ä0 t{VʪetQbn~%_D^D^rzr{0M)0f0p9ɠ8^*h*Lj?쉢;?Qnys(8L7ɓJc=M{bKQ-Q ǽ]fvN/ c|۪bҳTW@O'K}5]Xd[,}*ٶeI OuQ';ށm狪f 0^o,srb=6.=EwvmNcD4㾳K u\^L븵XެӀߐ>%G~#?)ov7td+ZΑye F.h唌][rM>[+FZ;\W[ޔup;lg] :Cu@v}q=7PC[hԽ.mk.S]|KXWh ;]0MqJi.8ޙFS XWG~eiWVG~%.Z+;Er1WNE}hѯ܉ʓhѯY-j{ɲZ^fwHRf5Pf)xl]>Ef~+o!~5{8pݶX-wX-s5 bk4Aki V=ƃ]޽0ռ+S$%qR}er 9dZ<锇#&Jwz;Z W^ zH\-`5 cpi-F8x<8y~^Pא-FB_dRsY#wJ.ub _8PVA554XhxOX#25"3.Z#2cEزFl[3fp2FC;ƩZ1Ngb2H>ƸK0X6[\k彮/n-qgk A֦^]MO1"4#O7! 6FcD#r֕ic׋X~v1#V T ,$߫BAa& al:ۺC*.?*o{t޺23c(6dÏ+F|D~-ce9=PF9e(硼 0lE&;lW T>Q|nϽrzd$ql=zn"]χĆt|߹PQhg^'W,O>SlI-7Ѻ<=cÆt?@L`Ibd)kg&:P21EWndnf|7g7]ɇFVItBGO7ѽ;[I,g tٓrcep|czc_)Ŷb}۽jj(V>kʾ-]Y#VZ~/>/xIJ`Y[z{}+oY4(&FH݇i1lV q3 q|<ƒϯx~G> &_T_j,Hʋu#>1> x|zϞu JL#>4p>-gT=c8fgL=t+X/$72+Wnw+o~Uco7c;fpL>21g,}oop'+<Gr3fY>%ooXO6 KV- q#7Y-D"{[]|q}ϼ-r]o wޯbgz ٲ|oe cO)]p-""r-v9ESZy^&G4SrDssC;mw-y],"*8O |޲Tۓ>wgC*γ.M-2i^Vx+댲e;ϗܑ]i+0P/>]mwg+kV[P͒e_SF^B#ve5l+XlԭrW:{M1M.*<'vʚZxV{=~,w\n9/b0Sf*/Fx259xO_fd\wX %5洎Me~G>/瞹\/k]C;- b7^Gr*^]{SN1?x$G ?s 2ȼM_&E"ĬoE6kjM6#MOm+o_ۄfmMb/qi?۸ivN$tf<&#tnQf!7.|Sǀvkmg^'S.vf}OvoP]q Jj;SyL (Mۉ_#Zx,{A2<<·|R'T牪oS Yd<9_X5k cbpL&qJ\nzc1O%؆q3|C7;xMϹJ-9qAko性gl;ƖܶH)1;r7k),dt9ck2eSe{0S V֋SP*_m)m? ?<ٜO8vq"_g_Ώ9uv'$1Ɗ <֛ZNDNN~'x(uvJ<;%J8FUGxVx(vL67c08G`<vDxH/xu;޴G w0c{`]p4Kmq2=p]|NQ89׺IõG2t.]U.jԒl ]aƏ6 .Wx5-lV]6?kZ&Խs#vI9-wxY Cv >#wɸF"2Mp Y m>º]|y]tD^y?ۭ]tNŵM}^k%T,Ar=vӝ^@}rnj'6I=c\CvspT[%KĘ5Wxem+DZ߮xƎoCݳdvy/ǀW=>`uۭx{w;9U Le28>j3N,Y\@B}r.ǐ}rOt !zKn4cgA'5q_ތq_ g T6K2}g[l>q> 8g0|1}/1>ZaNMgetއ~o%OPv#3>wz4sknWZ>Tg:'ӞP՞ [ SYn7޺Gj%t<z{Gd^~$I`*z>D13Ty|cg?$x݄QM܉YKs8Focdm@}_52g\o1?~cl@UwXvHg{c#]RO_w՞s_; AOa:le:J(ߚNG4/#h6Ϻv˃җg8F7x W6l[;86˸nE\A~n&oL*|i!2a78N OsNQVKJvG ?9 8m_AnD{rt8}@'&_ %)|8 8UÃ;A: 6^A\#-\0V\WȓMvG֓㻵)pa7fnF7Krm-)߷787SM^ЗyP0pvN 8cMdnrTG--?Hkۇ1b Nb(cymogW& liץrvM<(r}ʃ!`Bn QX"n;Ƕ4l-SxjVuAem{m,\ ~|HE+$nЛnoYO6jER`U-{}aPxG?V;ľhh{xMCy;AC$wg;L2Lô'W=Lׇ4gm;L:qsad'r0Z&?;Bz ͏i=\b/c0G>#59#BSCyFq{4MUцTLH<ŸY>GqBKJ~>"-Gw{〫&=4\'>2aljn{\դ9xDdZaZ&.;tWNm'_x&ܿ?+>VW>h}=QoUYvP^(M,= Z\{9zTlD:J(lSI?zkC-Շ:\oQSqTc8ܶ GHGE3nKzmEfz䩥%=lqp]sp=7:w䦻Kc/p1U%]ؤ!J~@7p~*M:OMT}/ jCCn7>F'p#$fl=;ko6]^MW8XQ!UN;F{JGv1ړ#|BiOz8/Ӟ8IS[V'=rxWNО Z7[c|W.{WWw{˴m9 Z؆qzY7y]{B+vj'D/SejsUVni[_4񟶪PƬ z tBy<ᑢ#N?w;J^4پGw'gщ9!{4ƨ^qBɺ\fwm 9:!e?!e9a7hO rY}@}pdL;I) ]ct{(Y$$ŬwٰI;_N;MOsϏw$]/=@S+]1u$m1G>XWwTus]A6̓Gp|Gy?IL7 EPGrPXSO)o?EqWpl?9Ew'(/|e0pJ8%6-{(>1gSDqO},SdqJlr͒S֜SD=ړ<:~6J<|@vOr}n3|g' Ю(~ڊ?u8/%^Wzy-d|m9f Z:Mciy+i;- O4%Cq sXnyۮ1XT!t煴nj8Nl$5ӑy|4Y,C2Ʊ||w^Ⱥ{{14?y9ʟKgFxCί _Ci{~GQ|w/85G0ƳSC+Ґ  ?CqЏny{"3r:#p9n>#{3bgvؙ]9#oOΈڋ3/.As$^i "#O >e& Ҟ Ҟ "22NƞM{& 4Hm;%HH) 8i`QD;>=>A|7vLvO~lpAz4ӵe^e : y\M\M6YwsMփsh?ܗ= mut nkF75ruXs%vUb3x9>Xyom@(jAaٕm*g]FbTgRg-z/oCb~X,VoWbκgݖgi<Nfpex7Q1\/K;R<:ܗqF9Y?QNu(+n{!EPYƸ+c'ɛqߜc+ڟc !Mv#M:LlFcvǹa:7Z;':Zz{'9'k٬w?apwɏwV Ωm ?4~s;G8VOX9Op2rX-1~y;NAg󙻡hp{dW.; ~lH~yrl;6d9c|><<%ڛO9 5;)cG\ ?)>tƒ;t1/X8׻0Ayy-|"> $>uz9sM|Cˑ,$p wA_ : o0S8VrtZ<֢H/?^ C޹zg ._}_v~N좺/8EU;])xu6\c\ǀq:]w}s;b Y/x]R=T{eW?Gb+0"R?K.o6]?XNݫT؋cb{R ")saw?j.Nv1u|C.L >9="Tv=_\|I kZw.|ptu\"=`KtGuhuU} ~Ѝ/ct]{,%sf 8=$'ӧY<L\qZRO߀<=Ew. ?S} , }S|_Lޖ3l\ۗU2Uohו.Z66eo.m+NVSl%{\&^xY2}p$=\y/<>HIv\}';c}o?{}|y^ ]˲o\.{YbABӖ Wh}pdZWhNq"}+"\ "}+B/ï_~\y-io}D ƲDmkJ,8BM h#Pc, T&g[bҭqS 8ne.# V -eo; @ r,x;i wOƓ}*|e*aWރ\WG|%~N;mQS #s>66zɓ~5m ǚ>Wvf֪t7=ЯT=|>~UF 0ih= EWUUI|$[Q?k{stx9Aoڌ~~}&6^z5{]1=O"ɝ"?qewڦ 7l 9WzWen!7$X,s5q ]Wo]w]uuy{&亼=Se}w]ޏz溼C=ta&jiM'B~QϚm9cILuf4c *P156!ݐX=ƨ{uQ7|ߐ7_o$$qb'=r~\D 8woO&*+=cm+r034N|ܖ3Q8=/}ߖæž=>6zܖx:ߖ{[S LsP?%˚A/+G ʑ3)Ϥ@ 3b2N7J7=qz8<}cm3\rr% /%c<6y޶LP/{*}E&9sw+͓~OR}hs:TvTnt0t]^$jN`pLp{pNs9-ypN>=i>g"|Sq%WDkEj"Y@66,(?eN=H_>RU{'㍆hytjgb}`k"COIf&ʛQ"۬f\_ݩTTo[`[1?tCgj]]JzM:s\"-!G6L!J,ft@~Zw\+Є{Gws= 5W>Pc6alOf0ƶ'!25-c\Sq/6ÿLo)b1)c2bhS>XS>M_0k̔yȘo\& _f q:dD.cŵ>_G xC %3B:MG6=2C! O@ } xS }Tp,LM-6\N n}A6 5 p:7Hq_`SK8Ay]YVSNwj2woj3Ʒnoe/!8~X {^/-M/98O~~ʸ>Mrge(2CpQWdg+{ȱaz-;}}!i .s7 xﳟkXGSy|+==M?r[{Sr?\'9'ڿ<9sC_ԍH|u>H| Or9/1F~x1$]`G_#)H|g>bz@]G Cģr@쑒yi{~y蚏\t~$dHG-x$ݪGvPH؏娳Ⱦ_c>>VǢ}{,~=o=>2mcyNآߟ~<;c>aC}g%V_qˡұȢO%r/7676rOx:Myl+q\`GO8cg\ 1|'"w1D>y?Ԍ9ODj Z u:pnacrʾ馒߯W9m0[Gxm+V]$\<\!qlw>!4y |c_x0?%=ᘌ>Hc a)8|29S>s`(K>s4緟̈́)mU;S!kq:ʐ?0F'S&F/ )`(Cv )a0xScU}3"2|<pMz#_z>C|I>dyh:(+u>G{WzB2/\e~º݀>p o<{O줧t|Lx:-[اi}BO_R1.L~=}ئ gd8ݥa;?=gb7S)3<y 1d2{R`\;nDۦt7EeNJD߃zM tGmR;J3ߺ#MܷSEne#HpX,f4aqҶY9:cBZE3`SOKiҳ9}H~sѯ|Nn/9R~3=37x'>-)ssXغ|Nqm[c>2ۀ_ "Bxps \ٍŤ3|1;oc,6_9M/hL%-=V`~Լm8A:|:"A6zkHc<1;d:q5/(e/ Ńo#@ }{Kq]I;y~Ko$M5VeΠ>yWSzwԷIpJ';Iϫ$I /|3cIǡ`gOGNG٬g9  F߼$/d2*Ɩ2;{A zy^V X_p{[?OA TT+W#ڐrP'cP6Prc[fT6?h ^0 7ц~_[F-Kk/Ռ#Pp6ĕ{֝/*@K+zsz ?WiH7g7lSyUN%v'eXie~Jlo]1oq~։ſnfN+_12W?n'.aN` d~/|)tWKdL)+FT]_RWҤ@WՏ |srOY(/q26py"c,&=k>c,/ܞۤy1Ί?=`I&+e^7޼ue's뒂}K j1/t^pXwcvfUw{!2c5([?~3O1&_~v3qm8-}n[dY~|m=m<"ou_)4.?G l'2q%5qh|q";\ܛ&˒W-?.@'Xg/X`q.L; ~ErVESCڛڛh/j/;d&>z%4|%ru{0晩Kuq X, 79ec`G4&@ iz|;)il6my^6/`%@ 녜^:^~uV*.r) G_z[4R}{_}K{؋Try q. K#6=@fGmWKkyPiy w-Ը_^_3-E.gJߨ1+ Q/N^-Xeo FlrJ/zjU*hrjVϴ*ܮtm{Hwuh?qxgB}GcwDq]|k$wnGwGY<.B!TC%tBPj! 5NB 6nWP,("(X?;w?pr;nwt*y 9U/d;|좣v-BB :] ?-:T{fnb!ϴ>/n]]l<r׼QbˑϿU~-3|emMS 1ʎ$`G>o9}ܿ|ÛFY m-.M _bbKA3.豮eIwt*!c-i s+o4^CmN)/@sALZmRk:M<o~줷*o'=`}L\i'= v߱;;mu |t >MĻBrS1J>C3>V{=|ݴ'_g)"@Ђq~ q> Q%9ͨ23|V1(W>fW &i_y]K/{s@'e;0Y+g1`H@9inšƛ`sڄ3tk7=&Cgisog?:G7ط5'.k1}me9΁o|g~2Q;*i',u`3W.tܛp:9mq:~MgS8T8;l'c%{1N@oCƨ2\azmq:vx$caQı1Ώoe7F3&×05a9yR`9s8^%8CzI^}vfϔ+jci -*cIpy=ڜJ (J}U^=з8eȟZ6fXTjcq_<2iCkgrnS"Gj}5/*zk\wW|(tpLV6yٜ1y-fs(fsޱHƸXi6Wty.>_Kv PnŲ8oI4[@碘sNqEԟ۹@1Y' ߡx}b sZ>Z1W*[7y񝸷-xN>ovxK_͏R Q\Aq-c9c9=㜋fp8mQ\ֆŅv'\ug[q3ˋť_..zq'NM¿ۭ\Y;ښq&v 5-6MnMtPs 6羀Tt3l7ܟehrb2G=Ǖ=cJ .7+UN/٬b:6]"Kgct>F}55w︿.{_p{p? 8xӒ܁u~a dԻwk? 롌Nzq5k] aaCҹ g;lqF~}t ɉȣ(Tml³.YeaeU`km=˵HqݖR-(.!5#ew?E栕w4@7 ܎@S4cuU:Hz{=^e ?e?QxdI׃}(cH=7`EɬĂbRIS\77K z_3%l~Ii gU\hGvW0$4cm}W~.fg?G˺γ[8P(>0<7rfAr$4e_ |N$Sl{ T~o?Zڭaʧ y+ +%W][#r+ANԇ~Cu6^OEK^X)ҋV,eLRY/utim1Y%'s[^8<*; xhO\)aZkx-x*QE { F=gc_^)E'ƾퟸXycyk0 F9pa~ ArX.t?z3ײ~0Ѡ,1ޭёA{L~ 98#M?N?Hecb`Nݵ?cz1 & YLȢ,z9Xxk6']:Xv6<'J1ЧW~.XߌYR?Xى? Mn}Bǰ ـ1-U:̕΀!>`C)9ʼn/m<4tuJC~f1y+FjrNS~*nծ^uT~{@퀇.mkcr#٣{mH|xr  ;NXNs%1Vp WNrp0Fyi1c7+Uu[2+.cswTz&\ \75:q_ׯeh]\g$e_ߖ8 'XG}y˝W~Զ,,~Nt/ -K Yė}' 𔲤hNYUqc]=W6'h~,r{>%).ts^1y[̗emε}Y5*\锥.ڭTmb9ubNroNs|HGZ/?xVll?/壪B9V+'rl^N_6F#N-PH#_H;bh[/yzU[O_rY o Xʷ~?i%u?iVh7IkzSz.~_uK. 6=ɛ\lG{(c#o!žcly3H.j3Gާs:3 =y'M^QcAyyQv./z?mUf\63BifsRsNosNPAJ 6'?SGV}:|rxRAv?UNO~ZsoUyF?VɓPV Gy`x9*yC SCTľNWĨ}d[[Gk7[E +Sd{;O\x3s]Q|r|*E~'ӿOR/S{W7/Cl:T4SVF]E 6%2&U>jTƦ`/.B\aP<\_G˼s+(qH9-?V4̶o⶟_1W$IDae*mXJDa=*8V"۰J4&*mJtfنRlީDkJ6E7*ɘc[d+>>>],ԯ <]y{VGKGLeWi޶22L:Kce`Dl 9e!"O?"z!wF0vgrUwt pEяŅ؜ !Zf}UJڥ 6fz Ú0jj9 uDG* |UIToXU|$@F*c%||\]U>OUoa*؏1c33L c<ӈd|p4cd8U>E|T*| Tx~؟q Ɖbg#awd$1$1.yd*!U>3|WTxƢ*pj\>0^E>c[R1-i㖴eqKz0F?яgt;>w=}F_k5/;ڤc:[3pיyUƐN3^Fj^Fj6~Yg.zN!m]˙skize3~~H҃KUi[дsp]m:ֹatxNGWX;o&`5nX ;>:nPLm/Ws3#86 Nuzh[P-.JsB(͕Z4WZ\**Lgs $%9tȕ9m~֨A!y֠<5(O_ΣS_~q˘hG [?k^Cb; oe| qLO0vyʇԾ@kڻntڊ_Ô/Q_Sx[V)mÚFդw<xx&v! ~:C}6zWז@Ŧtom+!f*' b^5ޥo\[aLJa\W/lv)/gWu puH.pp#,7q99S-t]38!*׵-_ Lڲu&tI0oe#satun73ѧ.Ӏ1N_)+ x9nXg#i4pw#>:'=٦q7}f\oC۞1}] $>tp8`)7 I1?cD^8N~o 8:Ӏ{_c#0.3p00\q<)k0N܄q:$/Nc\FKh#23x?|0*oo]IzUV巆 8g< :ٌ؟ &؟/uvzl{CC:Mn[r:MtA|%KdT:ꛇrCD=\! ?TOE?PO}?}9cX}Q/}7π>gMwZ_Otgz;__tgL}*vU^m}ыu/zE/P_b3^li}ыm/zE/vު/zE/}}ыݫ/z^@ыi D@ta Dֵ4] @ta .l]хl .  D6pG/=f,=@C3ycgJ* cJƸ6f"a8=ߐ30^<(m( JXV W~u36$s UGuFlkDQq R@#u*و*Jكk0~pA=W3N3㫀1=< p_ccua>x5ZՖ X^7U0zZ]Ȩh䬽L2HV#\jD:oF|Hlnga*sԱPc3F {Xilsƃ m,#X|7_|xfc\ +M;SU>૪|ߩU>tV&\>[Pu\7? * 6s蘮S4aB&$xx̻3.ۘo8A4-'g|pƸIȱ];/)h0DIاihWDt&H̜ 3gAR\ M$*?ep^G]lu톻 oq-=KL4!9&?h"&?h"g/4>A}rPt#\qݽe/:pk~3 ?_Qupڤ;4A;7군MFDk4- -~GKGMZz[--}WKﮥWҋh_jc;Z-}TKok-#Zzo-}so'ht-=JK/^IK?kj%3\ k&qZMĶ >y>(;&b&ն U~WU-}V. 9|Zz>zҽ]TcPXKWsexMj9B'́@7pS?abWO(*~=\#5O-,~]NV/E'4bH`džS Y0'T~V893/O \ m[06;+6Y Z8|?iv^/yɆMхSb#N8&jp|ڇgk4ϭůgq9͈ok\ߦ³j*zʀz|a)>\f-{Y=}Pz -&Ss]rs~eN]x穐ާҰq?7j*Wm9>TV4AMu:~w< CbSO6dNSw*XTlsݦ6%ⶁbr4Ļߔ&Lko^|?S<[N{YGuq8'^x~}OǫGc3'.mEXs7Yc=|s)Hw< 8߭P/\V`o%fe|dup9͛gt1_\ơCsn}|h0j<ӽ:ќxzô5c@r"c3\YET*/2^Rd֯28e05 ;>˛ӜGzo3PǦ@㱍ӵ9 Ǟ.^乍ew9"UM^Tqܴ6uߥP^#^ik׳zTty Ep,ùLJmn6Zss6whk!A-$SP fl(ڕuXa-wo!p+񌏕_sh}\ Z9O1Ū9+hp(m!^ʴRŜ,SˬcMc?/h(/h>aa+(mAUtS-}i1&|&y \[+rFK6gl_7w x>|}xm'pLS6QAze`z8-eh m) R:5ua *FEp<3nPIZ(/-\ ݟyBu<7SGUiFt)p7v0#^e=8Wۇ]xioc1qm ǏU?Gg8?Ƅ`4Mar.8?1F=kl}x?g&0 cӡ%돽s^9NdzgMސX${m0F{Ah/:Zz%q 9O^Âܬާ>>þ]#AkHknrr?@B0egvњ$BB\k0i>s^E7[ۜ{d;k&`\Zֵ&hMNH2[3πQ#M;!bދZ]V=' o{~܆akO\Qŀ4ڈ}_^m } ^ETp+恫nWd\*XI|ΰv{zL{k+/+]rk{A.w pS֑ ܀b#> xI2 dce-׎@pc}rhUW8>G\I {Xa;9*^͆jVB:X=͟ZqZ?i/UcBۓ9Q5? Vr60=OV%qx_X2c;_&XκuspnSGy"i>ǫaݣR=jN{٣ggXZz" #kU{qn/>QGڋ]bWw}x/rqJ.ی=ŲϿf10=Od{ށcE;Hܬ`ƸN+1uZ.w1@|\b~m#nSw}N{N@gY=OVtvV=>Xμ ?w_']קp7y4&>nM|}t_n==8 $0>x-㓀w2(O1(/{\2A{y8=_Ez 8O:18}#eQ8)G2N<( s6_J 8C /p~'I9K)Њ9 kU&U7f|e_"> cE1uNzیJQ'EScc82bX_7 hd\(ϋ"7VԦ(n 4]9IhE[sQ_az< |rw%2πߢh/lYN,܋#SF^"=K0iZ;Z<ǝ ߋ}Uc~]EZZo~ \eܳ=+Yzɞfo}ޑKx4JcAa:%n@oEV/}~E)oחh⽅ Mz& h1;{= aI2[Ǫz+5{p“GZ&?$-A~NxVNrljˁ'%/Kz\ {T2xy|,7vzӼ)/rEnP}5W7^7|?w[ig/t﷢98)3o?|kƇZL>}D+Gu>2>+UDevgu_r~<>-+gЎODX[f\i~V+rX!zOm9%9G_.sd/ 3~* 8__韠6gtnJ_Su~yZ7rJ9xoe!` ] 3=z>s!޴!{sU1y>j WsM⾞u8Zi_dnAAR&nGWcNyjMW`>i,5:^Hn=~_aֈG~G(4'g$z{;9G~| e^ '՞,wfDL61G#>ˊn-'tk(uبߡ~ߊr#]2Z?3,l?~g?p}۟|qӟ|K]t^tJN벩?[p_N/kiE`__ۿ /Z[ht U2ڴ=6uAenUnn n-nnQѢ+nΌ`7%|ƨZ-h틶ꎰ-Mᙣ2f̝wWjqxC^{e-*Bk]3Gt?G_bhc\t2)xvdrȞ夽i1rS;\McD#:wUNxO1dac91b'1;F$36ng Xcc{.>sݶN[AہCyxBSV_pGW ! +f~~T& 02 Dѝ 9>6@h)H ٫D7O.c8Nc { ж@O@Tu (Z0ƻ: Nb:8O56ẕj2=Yԩ֞-{QΈWB ~r3ԽP?,Vφ1^3P"?x8B߉uf 8H&[bQtmG{oXnk6FkVg<6lܱ]Cz Lk|ekaB}io.[y|?OU x~!htA6'= d;HXcЃdUޣ7c#m5sU*Rymks7Ab;Џa{e i—,+ J:XlCozC9^)~P[ C |(s]yWy2R˟O,sȗ:8k6 9y ~`ӟ`v|O{{_L``+|{|Ճr6l"gÅpOφtsw1Db6v"1]&C.iC$~!q߸ȧA)Don_ Έ!B BC~Pe ^6l؏D rX.mȣ{i3%1%'P=Tˇ {qCeL*g狆?wP҇idž]絶scmQgVuȿ 77JZ2V+Z=0X7\ cEO,V Y8cF b5 j_ZSH'B?_@^'Vokbeݱ6W㾎鋺x3p (RwnA7\Xy;Mz5w&"yG'ژ|mmLi@$78'+iO0c=#X ܴWr~C|F8\s!c q_b 5{n Q1r1&{}oE#uچM#1BcƐI^4u|ƹ:u AxW<:mS}}$614.k8+h1yScd>|̰j|/k}:@1|P fQ^:>OTh7[14gQj󨟈(}ēꍊx/(N~y$3{kƋmS]mN{ Jm~#^@t9sp/C"ciQ檸ci M0V3?Vx!c徇c徇c徨c_yXY#vl4KB,Bu4{'_+j\u6gQ.&HL B'm~Z$yZv"ô2$Ⱦ<3A Khw&̹u 4oIAx? i> p,AdЋ8H.Gy?AQeGf=2?'Q8ɘg.x4,TC['5C0׎$wӜODٟ& t#QhDZH~Oq]b .VgcOmOź~/٭3ۦVC?Sw=A1_9W;?!ㅎ܀ڸЏ*R?^Gv-(;o|gx_?/bsbQ_xLZOuJj}uMGRgƸh4;&Gk?R6O=w{H81[qqWC: pCc܎Fmgz+  }.?tgJ&_ |15:}JL|I?ىkp"ID6zSe]:tIceJ Dno28⏯1?5B'!_,sxߜy̯Bz??w=Eqc"eg]Ş䗉bOD#8OmI'^S|6}v`I⽨7IBC7$s|[YyPyPyC'',4I6c($¦oc5I$V5_j. A[-õ`>IB֖%?gG^J"eS<|$2gI"LI&YcÌY(]=O;}/f<%We]]ǧ~xpPsGoDm|wMl :ғ߆% ۂ*xx23& %OM\,:-ɢSۗ,:ſR~,w$Lҝ䧣'`T>!<Fϐ5 Y#f G3D^rKwf`WLߏ3LI5ӳ=)]GL#gJ<}OldzΤ9[)13E=|}m;2ߘI6期)W yA+S?;cܜ.ҟgZuM*&jkg ^x,A%:YPcfl-Y=׿kiiաVY$͒}Dq-s,_˕z.vg/8n|N(W|UY+{Ot"85KB@yxPUVxn Sy՘-m4kMafKT= Ut zdd4 oҰnz\M |Na T%cwdlFhu<ԾeS29j̘[3a36.q8`G< a L4|}9}u/1f_W;bmx&59QT -!?S &s> m0=CO[9rV[#c=m(3y{NO<]컅Yqtot{1L~sLrUk>T~=5oq\A!s%U¯|ߏhk4xVg_3Ĺ98Oz4YoƋ fH|d\*tsks=Ǩ'Uh'a{s<:CJΐ뙷}~+۝1oWl3=c8ߌytjI,Œ㵱C^/x>qKk`rԘ5bIDj)Zz{v{~O-?֠94"5E/;m!wo=]\b)z\'HLrۯof%K%^3得PXQXT?mNcdt1 IO||:98f?:=եҟlʼ 2/huݗ^]gol}z?e,.[D^ µKt]bL vY-|!<nPP|/..z/]к=6 ,|B9/~Οy_(hU =۰L>xEb{(8^}]?~Z{,z l 3$>Og9_DŋhB~"ޛay1F}+Q>Hl^$6e}ھH}5; "7Y,|BϩU7i~ުƯ1Sūġ00v[/&%wb-bYC\X3KL>e=6 { m6-2{K=D=-}yӋŏ7yb3D q|Q],~,?z%GD+0F.ck"r% u!i& 39j4ܰ7vwAiiOouF:menH3ی4uߗ&Gd/MZ_NYl+uL{jr99c58};M ֳ;L{}˄g~{,'29 w@]:S1F\Jr>'qej~5YϋYEne3"Yjʾo~o6+Ɣ20Nq .i}s>+@mY㐟Z.k[rs EwwEK]e=Z.NBtd٠ *b^X[\b\V Os+yogwZ}V2Bf%+HwH?AV\z) W,vpfІ+6|Bh+6B^+)21_Jɕ~Jlx?[Vpʧ]u S[1^-W=b4nVK\=ۚkKr몷ڸ\I9jL^0Wovvi%zcS?}jUg5OQb AƳ}U5}ZrTbPrF+M{xyg'|e:\kl?qX t.6 ϓM~15F܇k$e6Ӷ _hT1Fb6Yq/nִW7n}yZ~/tDƸw` b1 Z ?;9Oq_g5WzsÔz5w 8a\fnH 9㑀`<53Kx5oYOou(__/ `^~ /#4[~׼^~/{FZ)qxC*.X_-з1A{GXh6 ,AY]]kor~?˚-\@zs 'o8oX[}q~#mDIflZm~63w9s_4Nl>VjywF6}kYʦM4gٯG n ۛd~e7LXi8秪c^MDh]+@| M_ r)+/&]~T{cHp g] pk|ߔ6;mUDw=h/Se4Lc|o3mYnS;= 7ۜr8(&qB:2S;}ܻ`a7<dž|k6˞? |/,skff+L"+ea.,{E- Ǽ'r:^1s2K@[Hٛo>8ХJz[dOo-;n;[߫==;Q{vc,,:cKXmԜ0-#U9GKX`߈>r&0e 3QP0vr,?nAw2Ὓ=2H&=y@A!4^X6neYAv]-mGn۟A^ʠ;d^ˠ;de2dj!ung~eTv|\)3l> nin']jF&cNݼs賝=ty1>K" N|T,Dwۉ_8v%g9ۭʽBu4er 4vs`3rqN`s'Ʀv̵C-}bkYjaxPk\$9kܕ:1ޕ:U }lswǶu}w(Z^$s_<,v gvY컀[lxyغ! zFGq^)y(sVd <ء3'|W%HcZPM8=]Eva&Xj'E{z'u>k Z@N.p=O.qrN0ݛ1.ᢋ\q'Xx'qaxNժ*{9;x i\/sl)s@=!1H\ 3 R؝;MUs{Nɀ{Op:߷;evw~ݥw.u]DwQ̄w%{|: Du6<9G>c.v͖ ]s~V{Ox,\|7[򬿆eF;XSx1n9 mMi7o_^%5ZZ=sEWp>F i<^Ƽ .Y 2@.u{3XWqp7ZiFwq^-v;^~ ]t/]J׬ ׭o6!9 ڰY [,v|,Unې-kƾfdpA{O5ZU y~j=_܁_Qhhy0qYw A½ :CPm܃y^mStuc5~fLz{)_^G/@{%fؽr;vСdاc߭+t9iYN7 E:4YG{v\y'{C7/XWlxMse1t"˾^.:.|'\\I!izt&z򞇼c-n6)C٧qWxM7/ eauxqP>t3+Mͳ9γh|[.{$ګ+z69tuΗ)gj>!YŶ i]Kk wAB2_^ g w?w _RӱΘRFm/(skYʙB;f lN;?nҪnTLAs,c3W-vhm8t2RS>ɔyow3LW'zSQW](X~j_ԾԾ^sm]}<^2]{E߿˼K{:\c6|%/5ƺkwkT|~AwhKT> c =+Uw6= w}cUrJ&LU(~l,W*9(W$%ijU:bM*cXEǾ8cwYReO-{Xq>=&u ,%qoQ瑩*?&~&|x|3;FfLhXF˧{ʽ[#w;kI~݄T^,=Q*T9w>M<7Mx a&U|W-ǨQ-~#'zSoX]X;?FAl tks=cUq)(ηI^kg^ q+۝ĔȠ[>5ʿ1i3Sɞx4(̫a4eӄ62iЧ?+>1A_qm>Z;И?W[׾6X}4Y&r ({:sag z#{Mjߛϧ7U^.k:hQg?b샒P?1ߤk?7x{$pʭf.7;t\.> %_^⫊_ nҼgt='^?Q p<י7CK aD(~'bOkO8|7Δfy3ԚCҀPΩД1bH^)1$ϔyU ɇ_T|3Hx*Ï0Szqq)nX od]䒆 L5f6Kͷj|+>8[Y 8>cbi7Kr<Wm>|oڐReP>p܏J9K#bC̒9p a¥ Wbv{R`ҳe=>[Ώ<4[δ>=[ļ|a;̖yub~8[b1͖Xᱳ%Vxn2oVU&pf7g+_qOpc\u9b+=GraT"' -~1Gc9j<\Qs2GgGQٱsv'+wg73Ί9~>csԷb չm 1|Ky _UL5a;rG[m>6sO͵ySgCg{CM,;[^CXӰA÷;EO {V"Y$^EV\/{3_gھL3Ӷ;.^!.# we=g.#Lgf܍͡RӇZuBȰ5:鋔z"ѡv,"M?{{b-V|{ c|oQ=*-8z%'3%6E~3 i/j J;'K],i1]>he\ĻV.q>1a[^8ިObenpo%# ?R*Nt}H9JV6}owuL*^{~|;Ixu'z.gwq-pP=F_?;meLPG'j1}K SXh,JW{r6Ӟe|JHW^Eƒ}%۵D,j;H8Ÿ,H!M]0u&{]R]<.Q]aȽ!t35iy2ߵo;xOer29G|uʳKx6#=X;9$+b3ۀ0}hpXŗ=`1k<sxWS< <マ].1]/1Ƽ\xr9 =gd)"4a]DQ5l,趕1rK#5V2YpzLFW W "|iXyа '{}BCsc}cN7FB|~cUܸ{~7{:.{z{nյ'yb_By_kaw}` /w"J]hs /X! XظBt+n+${2#|xǸ{. ?iOހ"gگdo_J}W^MUVJ&? J쓎gu iS+y[_u ޸گRb:{Hpp''JA 263{#X.JG{7k;D/mW*ƞRͫT]{V*ʟJ͹UjnvJKm71J<mqV*s|`W{l3hJfurӆ=Y<3Rc?VIl1>"Ӫ =י$^[Yk6cMوymjDIO*Ϟqq/>mzi|@ӶcжjշVcdz4&|br^j чeӁ܇+F] gaoZɡK:< ]bET;Ւ~j6±V9V8gWqvZwռC6ƽz_8LZw%~D$YL[# ˈ{5JQzxΚF 3.VŰ}`-˲*G$HZku ^2u"~$Okŏ(b̝nkV̵Akc{vyoc>sOqKĵǏ3fY:}u|%:s;>l>\6MMiNcYa3c-1u)a3:~dsa@8ur/}ub N4 Y'gmqƙbF<,̱Mv&>Xruw m^'|ơdNC,zFm'g!8œZ/6JչUܿ^=Js9^%\8Y/c韮Wyjx"7N8z;z'c⇺_Xk'Χ)r-aЫ$9R!v}s1mPNݠڴbM6(AŨSpd,~K3zOlݱ A~{lsC7`2tygS9v.)J0OڠD}S6Ha#~*ȋ$/c؀37 E`NUgud?8q~D8q&ᴍ,G|Bj"!rՠ:6*@"uUC*wEWبxcvo퍱{ͰΠξQazϰk+jiM}rs \X~c6N^Qmg6ls[o5b.}>,ǻtmCoRzl$'!WRtRMyz`l&CMr.&^{xp6;:ϡ^Ip$>?a9 ov0nұ~<'lh.os702?>{:.a.{NTor.~&wG88ی]iN8c۷xZJ/$ 7 /c^vs݇ 56KN6+jei8]{d.mjq?p Jp~U[6L\jBWX.UYU}f爹O–8W6˝t˯bc](7Ql)20yS[-mEbro3m8϶mg _|ưآ:\V Ur+;^f _E#K"`*nQWqAl`СVε%ȲBnenUHl2c|[|kr v e;{Cwߧn͙"]Vm5|[A^޷Ubl=Z v[o^g'puCKi/ls3' ܋3T>3 UV+%˟!נx+!wSq⍹fwW؆P?l pfo/, [^̻ѡ6d(9ۆP~O ʐ\V]3$D fH/2dO6mѻG's&eHUһy dxz`Z^vu]f~8*ەlwI&\i˺u+c7÷)N8˵&Az?BX'\+r:6_oE c|6?-{TހK>vGx 2R˚nS'agxu#O`<6X>kmrm &'#yxyyzb@~gaKB`&S*?Omq6wm* 8;LqFvv%KS9Ȝ1k*7)ɥ ݞ3U3|+w坟`m?lK6 @n)+xR9ǠG#c7փUFiK}0y^{Ls 4~CěZzaE~y$6v5\,ul r#(6꽺"ۄKmwsA"Xe!~GvL4ۡΡ3ۈon;/Tq9hN4qG[f41[ÿ5qf=S7;|U}Yo6:~l_;Vldwgs;ճ 仲ӏt">:Zz-~cc{m쁾K? NsB놟y=~^`q`Τz=v*`]c瓝KN%n:q'S[pނT~0Yuf4CFɒS.v\"Z.$K͎b_Exa{p4&%{w2 Kt@|7c_*>dCH Sµ \3Fe}n x"'DOqg /gLtS=#|K\{s3n%MCuRA|ɱ]uL+s.+n~9 ~/k>suDI5|HGW>?˸JեM/{/SX_N8X0^#Q+(G.5 ^LS*+^n{ ?{\S?4$z gx.r{M]v͉r\:kSVTv_ :wPϸƌ \qg]µG{~~_|#z8[~@bpm+OGu68_ဲ9@;t@ӄ^wĚɔ{a^"SHU'D}>뙢[شe(C:nO3eJRQ1"w&e )13U VSy85S%{/#![St0&{ $һNcXrzwojg}F.Ѐ<J qR3U]U>E%cndlŧ3 a>$5EΊausc}]eyP:ςa#6[/09d탲9vuwzH֪CR!{/{>1:FsC֙+eNV>$~u$z8~K0\NI[wH:Ĺfr&u@Q>䵜|HrN?$9w> mF n ~/b`3I]S!u Yƿ|H|'v@|-u)L!ˇ{#d.!l W[&c{p7!ayÚ3]#؛7=n?9>ьqD'wA/}#Y^>c}—5=GT'.tD:ŏHA#^d#“uOjYӝCGGD.c.kYSrxשL^ܽف)b,xH+6}rDpLf99X)|DӎH]MYNCNx$Z׺wO#o{u$9D!aw,ؽ%vnݫXACQ+|T'lM1b#8Nl\]v^Pal_? ;3L=Qѯ4Q93qmQ9;]({|J~o;r4=>C1{ƀ %e.!uqWngcNuvOG%VzQ?k9po>O1U{LlXÆ5똊+j1ɵ?^?2eycF.{D#O篓mY.?/<3'qyDŽocYo{G`^wrw^qY _>.r.~ՇC_ҿ3:7=~X/zrFNDۼf5q>w ,~BvV咻,{(cw6֎*T^zh a;8ز}b O}&fƚp9\z`_4!RN'CtǞTCC!k! G`93/ N˺郎?M5;7۟9 +IS5䝓 &|e!|7Ø5z&Yf9KS.49bIŏ^$X{Rn@?/OK^C'U>|JBO;.1O:cL'BĈDG:eN8tmy&{A2駕LþxiixWT{4nKѿ?u۱9<-g:I8pZgN!⟋QtK*zWuY?N>F&Ƿ޻\'>}FuǷ5];֒Rmyݠ;x?u[or}«Tޖ ?{ۋ*Ȝm0$U1SToG̋tc^/] JuOΈmjwpa?; }Nz6V]])F3*YzF 3*B@nƠ[ g Z= *1Tϒ>E61h1gqS"$npj; uju* YUgEN;+rYq\1Y [nBw$\$U*7);gLgENw?ΪE3Y{Vj gUX{F1kYC` ]%\y dEgH2B yNaޕb>rNDK3 y«q牮{&W2 r<~b^Df#`c_Է(C(KWd f@G}lK}>b>k!~ӒW$N7\#x?"U " HҸ+;ПnҟxtgkZxcrw<7ǹR%~#/՝xEIϿ"9^kcxe_kVS}76|]mۿ_Nޙ_2ߋVw`ۈk,bڣk b2&{uxcF5YJOd ɒx )QJ<ZOUzk:#^۰Eކ]w͑t| .k)QZ^}^Bׅn t2Iú vyc5.vvZ+׳U&tz9`m;&r=p쬐ytN5L4~vQY|/ULe c;f^Wq-%<. 97Pi]>3ƞmo:c:L}ׅ!h1Fs^Ϊ߽.`}>g9]U m o>_L!2/*ܐ;5 ָ! wО e1=n1Q~s |8)ٺHF0T"&ۜ[ސXY\tPV|Rc. 1q_cSw'\;s  XNI?hW ď::_`Mܽc7sn)YקUf wk ot(6t37{ a ɗw [YwSbbo\6.#ڽ/V.ێ>S?K){Zg|W[S͛n3__wsF8y y3~)1Ks?@~Nfj>itRPé*??>xMoq\^^7ȎFg)ȳqTqV?W+ܼ.s3_in O޽)<҅-g*c-2$~-SK^%TON>DpLO zCg.m5byzb!˭loS}s\"< &}vK{/W:_流ܮ]=Hp{k1.ta-YC;Ω[/tKe7nwYy|e~JDXݖsѷAn/pϰVVdg+q}Vkip[b&܍Xkyb]ro.:gu|u ]]"m%78d.tEgoܵDm-/^_V|?O-yW3gܖom}[1q)FRO5糭Pmyh<O}kJܑآ wy>B;Ljá;J^O' G\pIsU{'"kϾ5Dߵ xq~ĞU&\ܧdL)I؝*.S:Sq S6vw^pMbS1WY 0olO} 8۾`/u gUhqwK~7| /:1F ?m}'EYT}Eo3o0&qŠ6Դ܈ooBȽfks{5oOSߊߦ9cS?@Ka_ϥڎv>'6c E;Ghw-|,NϮKm$­ꯖ3qCv'#ĹZ;n҄}zCCXM2^m֘/ >bc2uCjcmj߫u^s'._FV׶u"{k?ouE0־n\nu̥rs{X:qV2/>1|$4+V~3}=_~a>q>#_So{c%6_w>ۍd޳%.}ߝ ;؊:**8 b m&r9)HdK_Nr ʄ- {1o&܄0sdngr_f Dң ]w[" ʱ} #yh~|QsC}~~X?391錱~&l /q BUOxn>>ᣌwa]8pXG5 SEh 4X.'\0ֿk3^~2L+sac;QѸA]<,aJn!ܗqŸ37gGx㶄1Ox9yܟhWd>OMڌ SYpDxppū1063 eŪ4u wF;3nK= =6p{{2 1N#>@EгM@¯pjB^}K6D8?"a_cK#=A_b}`^@ُuFҀcUGH#{=k~'h]C~5}}Y,QMHpEGV/#պ=XC?1O`}bsk8oFqX5 ~QlFF70pCS(y}QQg]/r;S/< >:#rGuVOugl):?mѻ1;ݠ'-"%(Op>}:j,Q֚8ሓBu8eᇘFN0b2 /=d)?_.ug{52cbpD^0OVU :XLSB^HX?b%cc|3/e{q9A\urcY}Ktkq:5@%N>EHxO8؟]P8CJ^'9qf? GS⵳I|`c06zyZZkأí%/Kn},r>gK8btyxǪm~-1u :Ibb e+; Mx[upMx>aީqqw{C591Ck;3tLC[v$w1 7Z;#r :'ޒYUO\13ţ=qؒwC™>qDSЂ1ZF][OZ#_qC;a×"uWzWdIheC<̇qJ{!3>˸3F*`lY]OlC wi){G?z%nG- Tg(vT3.d)hy94wgg!bYRcB1\*tD{mY~vf2FN0F.5 5 ޛxן&`I1gq-ZpqV }Jz8G cEƠC-N֛}-L0Xo~$Wd&uy9GnX{?Heb3')5V<0S\54e0~O0Xj~x6@bW?D߈g?ρC`}p;1%|tg11GyطƷ -o)߲1]wcKbk4YfO0'I:O(,EŴJc?9cG{;oYAlt1Fj:{b2*ijO1#k=JG۴6e~1.eCKYc\kEYLNy13<٧Xg~~Oل)qP Jwk4g߸ɉvgNd%x9$*it@w9­ju:[: ʟ /i7qݦv. $I>w \[{uiF}frsmo勌Ei]ۼor(og5: I J3 1._&Ycɱ=qMC" <:xL@ a@" +=+Iɥ!~=`#>0I{*vr D M_$^JW.VwW"l0ķXͿIj/֐0G8 N80I Bq]?ᶄDhA+8ʫm fܑ X1̫@ܝ5m2-<&<~'y&_O'A_bx}pCn鰯uIh^q~= ^U7n?o Uǵ׫C]iǦV0O ]ٙ7͗,{q]m3NdKۜQ' R <]]r\܇z.{> >E9Rԟz6YGc|Nwt«F?%{2WZ/c*YgC̱5wƐq%1t,tB|;ѱWFF'=%֍x,S[:!W^dt;r'{r{u9})~܃T"d\,gxg6Q/Il-"2)bvE4McinfRyYxw'7Luw[mSw쒢k88gSKmKh guJsT!Eu%9c2Ma ]O`a+c1}t/cAq"q#.<(gmvq\?Kl:t8=B<^q1G?raWزQ}^BWp}-s9 >Ӂ1&ݮ?dԣE}+k&S4?Ĥc zL~}+xkC|*d r;醬o>sj ۘ)?yD&kN~{cn' q9tWC.MUXg1NuJ7ڔ~4zϴ)~9)d)x]v |3J!TY`]y\57yry#|,Χ>"է4Z˩rk[wKo_sYhbY>1F|>Gsoɳ1.+'ߑ/o)A1oӸ^W, .eo0#>k μr)1֍(X7׳_M,*W|/~n'ׯ֍F~_9ƐuַC}nc0׌!3?۔/a Y1d`|I.>W o~Tq_ Y#"|s0aFxgk2YMZw]u&cI1j. QyfKj{kGswO+6''x҅ 7 բM:`3';N=~?{n#J vsJr2ڐ9R~ e/T~ G"_9# q^+7};cw۱fk{]3䴮]6ֵ+DOWz.[@l_:#vygP¼vիTi؉q]pOPiu@ڧ (T@~R~Wx 6%#xAHٱ2lǝP@ufvަa 仧N^@b7=sሀ}ND;b$a'x\Nw7- xϕIB;'6!L A/r1{ZAEO]'6`wK0AbAgG[W- ޑҀp7]<$){Qy|>Ә S %cQ ]`,B_fO:X73e^m / i΂)(|tdT~w“i[{$~M+ =2~_pWg1 Ykܞ1l]q@EZ'3X+x-O:.jO:vSu.4pIWsoV!Zܮb9TTGF{D Wî鿱t<^uq#B9\'ޡF#]-~&.U}t@װŠg?4R4Y+,4I) NYxW5ƠI¸5=FnPX3E59XCҌ_iZ,qZasUX+2U( ʧDhJWó-~2c莇V)~p y` q,uơtSwAO:]* s#maaO߅%.naѫRDt4[E۽Ed.ZOd賩:m< _!Ҕcݐ_7o8).ܛN^@1ب]֤A5 #-Or7MdKtQ .@Hbg2Ƴ3ƳOmEA@}+W Or#z(>+ "_Wf:,Dƛ e8+a@i_G;?>iń~Nrx|S1~m"k˷&c?W[VF\C+(-q=rW)U\xJq:Ņg-.<ӴL3 ϼ[\M).< N71xƐ?-.goq9t+[qgcN_'VQ NW!*1m6cf Sa{^Ix1lsu4uIOxn>5τ1gg _/!"K*udI[UʇI O אEgKJ#VKI"G?~1Fn5fnspms3 _+|` kl0/^TM As #2#ȕ]Rxx~֣Ń[aj^qOa2/aOy,ja%y.<μyg{sq]?γkyv|Us4#w?,F\?$iG$p hF$=/' sX hG$ȁ94#e@@re7 ' gRJ]ϯKdl [p X]=] W0jGpy~uWP/a y~w '\<s 1:p}]!|*Z͋h5\T~&ZLa?^RK{Q0Zsbrt4nd i:@4q  CcXX"x f1ŷ1Ś2N){3/0πZ;lAh)Qm\J^)%S)%z])ѯrk'юr}/}nRJGmgW1Պ `˵_<Q- cw1<Je~O03Kd]XZEV=J)%0wrEѥY6ye_+ l9;؟-ѡxA:r44\VuJ=8l[ӥy-1m,-er(MضߖCZq6lŸJ Vg0_m--Xb;9zчw:r y|]hR;Y=]Faw<6 {%j@+SF7E^eQqOa20p2EN;~qARI{nq6<<Ƹqnp3ajiw3.C0*ϖaaM8OY]鄓ʲp.eτ.>xM%܆T?N^m#?,hPV|{,{ wAw.'rϸSO*?:)Re\./EzNhU&V]m 7*cD.O'*7oHt֏qtmPDž,ɤ[^\NٟфYUNKz浉_Ty:c3 _bzd 4%8p-m ?ź -\H'Yyr2,Z1c3,Iby5iS=A[M-ᗸ~o~K}]QY&Ex~eWq2+ˆNm yOCn |y%oK^b PA[c4 D6VLkCo_>Qq۱F>F߼:祖q϶t & d8l)O~L GTAo#:֗*(XX_>6m~Egp%gk aߖA.\VP f| Um.J 0*|y]kٟmԈ/1ϼZFe**wGHlX}(zemmV`+nVE٧w7hObd? ~θC^+r2=1Bhc11E'H yf2QFn(#L[&-e䖉2rDe2QFnFnFnhycF獹^Q|su{ |$81b5xዼy0Jw1+)>|qJ 3t"R+)c[U~1(c+1yc/.bQmeᶆ+Fc6lޕ*ɺU%snwZLcB%O' 3ǖVvF=^W)u7ۆc}p;ܾɤ6{3/֓Nn%[$U_VrFq9MySX<+VL 'Kҟe\V3F:WVֈy|oc٭(3ό!~WnT^+qgq.Az\~#g1QO"<0گdT@ ,_Y,wpSSԪ%*g;nx1Z{ҬêW \ a0r{"\Wq#n *c*ysCz*j,̼/|kqH4ȥךK"j2Ζ*j=춟 WC(>&Ut[A8ʹPg(1v32L𙡼Ui|qPՊ`I8Sx,U%^tU'>r Ơg Ɛor;u^%6? C;~R;7>Vu-[Q.mԇ UΈoo{K֚kڡqiە#9Cn5TUc*uTp(FR5OnVĔc_6uNWE9ΥuA+D ΅=ԘoVSz`z{yFՔd9x$־}5u&vˆ-gmp;vKk(81g~]I$ U9I\MVͮ&2la5笨q@/TM0eG5eT89O2+2n5',u(n^'OuZ]K9k}.EC5֬saUMk`cA.Xjmy`qVw@mu.9>$g()]]lTgV=eIuE.vu%.Q;ʈo Uj8YC5f%jHjȾv kW 3Fքog]L` >a`Ox `J p70pxO)q#kך41dCzMm)9Ք 5%8X/.UKb~ՒkI|Z1C-OPRK΋%߀ZP$ #s&<+cnZ«kT.Qubf-{ΩD=kgʭ|S2pa5>&'3݊0P1}uƈqz1bHc<++os2)As~]o]] w{\+h3h=Bwscm;3;:s1wnfՠt$tDRiJJ*&-Jr䠣DzZ`}콞^k.uYX. utNeQ u3jwӝ+=\Tӕ &Z@Mmijր}9>}i|j۵F)>%L}e2>2F#7\ri .~(}.v'h@%pYsn[.v2Z~2#Oר,Re#{o[]G(ӌ?z}AEۤ{ ~QomM} ht>FϿQ!_Di3.K!ɧ+][!S8)o]O1^j5CQ;/CGCC 26Xawzc =L4zK =:C戡o7úLup[ ޙ10 4z]l\if6 3z3 =Uja=BCx5#Cx?d72f~b7k.dzACY=uZrZ{ǼS/_L&q m|#%w?ƈ.nxLOAE*Vjٷcl`lTW+gQޥ1F]* Mɖ+}LsPQ=|/v%ԑx u|xTja@yyF>}J,T`dgb]ݡsb0Vx~fezŲ>gW5 CK`ɡP,Q;MkrO88>s_F`k}rIM>mb\sq>QwqY%sC.űH]q>53Nbsf><<߲et#:׼7]ӇRxCq3Խp.@t\ ԫu@$tw!N׆8pGj`C'>}qӍ9x+~#lbs i0ƹwc7x^<ЬxxSjh)ug<Ż]4.^$5 $!dlKlڧMs]AfN3Ч?i9ܞip\鲖8i*>SA~qh8kZsWl2iGjo`LT<4cdcC84hg<\e̹g(߆wOYx@ k T\Gڲd|&nzܲ3xy/࣌;?ߋdg$PMk/`Ow<| ?ܓQ1&dLRB0i~5+| HaJ3U"x*{d*`sc_6f]@b1 9Ykq_!M~s_Ovx+W2V$Yw} {nI.$y: xNEg\`#~;Wg?1ؙ;Kl3w"Y|zc (.eKmOyi Q/{DmnNw> }&|{ ͉(q&ʽDSNLƸ-g]uя#2~R L 3 -QI$,ϓ$.qKt:y8OMYjuʡhUwu8kKAJv@{MS8{Ș)"c0Q}YNzS.Vry){?S^%o1W)w<Ӏ/h\Q精aƓ}.j]8=Ew}!榈aHZ"oHԇ<]jVxԑ=>۫~"sѬSO;7x}20>nPgAɖ^&A7/ջuޟ=!++:B|Eu;KJ}ɌQ=Zl^Ѿ+5zFFKoʙW^9+gl[PN,(}L{-~e~W)jK}0y6-?q0JQzW˿pf{>8*h[lQA|j_Ͻgk c˝/Ri{:Ur;*>LΜT(F;Ox.4wTS1^Zj'o4G|嬗]`sk\ ӹ.o +Ah09Gs.sivxHjG&8Gn'ES<[X+Ŏ{3]&œNsDžƷ-a畊+}w­AUtRK/)i]Hk+X;\"M3d!Ÿ2Ư}޸u#Ǟr'#RRw>[}[18cgzOzs =W2=Q8T)5NzzCc3.dNԅ̐^x $Cj꽓!5vzu:N;պ{Le /W˶|:C҅d Z.9|Y&=mL`яʔLrƺi~Ik&LZ3iMϴ״0m티9d֭l{zt廽6ȶ;O ~Uq|gJVB  1L";_"u]ļcirہpc{1y(K.1glJfq}2gqg53ƵԒ1qWeK]RW?3F?d"FZrIB;̺s^^8lFe8pɀgͶ/<+}>ckG]M~zᷛӧw2F9?k>eLF9km5]9f|pcdV^&QkNJڴwW%-a |eT!R9ßrh-qVb(͟> 1wo'' }ŸA vuךNU>؜~oJ;9㻛 S}/>8ug|G\:O:y4H':>9ȷ>sϩs^$8m_2=\˖_]`<TXiWP{\gL[z[rInz\?Î]ɵ7LȥO!ZkzIk8H>lm{=j>}dzgk 6:G?}:˕X3ơ}7?f vF<+O/EI7O $<'V'/I>< OI>< rB[:oE]D:xq~?6|E>EjM.jh6vwRuHfq7)vk[ ^,^yxe3/|6"OО;=Hx\X|:F񸲟?Q3s Z!ϩ^).swb:X'exX\ \Rx.bBbu2:/^NP} T֩wJr?0^Xo. q9֤/5Ljp-u| ?д)%b#)!DlKʽ\+;[.6qM\F|[> 6qbLP4)K{泀+eȫ?JhBy1ʓq݌Sq<_q 7W)=G=y)  Pf4^c-%YP ՞fƵ.1߱~0Ɣ<_ :K/,xTJyp̀5\RT2yrTJ^ ,s[yt(ׯt+#$t2Mn2te`Zw]c}^%~$rI]]&oI,{mQ\;h;ceN_ 29s9M| nP{Og5?z(`-XOYu(_ܷi% ^ߛZʩoWAc 䇊oW.ys.rK\x_._2ryako&MHN%uMbhum}4%H=$d~ʋ}.x>98X b1wk!̺nWq^Rw.n?%K7SӼ+DZW4+r$m1Dfh2 ɌV,*"hH<$ӛAʗ,j^,<ғ2`Kw{Qz:T]WT%H/gy0%C;urO~ ̇nE ⧓jkImea e/F`Mm7Z/CW M;^0k'/ov'6Zq;C&S>X Z4vCa2! ?IJB滲X]ORt4VFNڜa|%nCYXR;fIU]G56IB= dZ!vSo'F&GWJ)[o~l|]bL^(LC%=kG@bklޣ=.4l[S]z6YӲP͎CB,Sfg5mYqcpړ gT[uo'M#joQ4Rǁ*ZI4l./ەOe2* vبUa>aW(}hA0eڅRۚEK%I!AttњFLUAt9Zљ)H"oiW"!뀖&Xcy?73~eI m:H6Y}VV sֆ ?3׹vv,6CRG倗twmhd5 jåI_{i" a2du!+󤓋rM% MŤ&%ȌYY$28Py669(JH| 4bmS|lGi2 `8:t l,i=4`a>XK`i,탥}=yg;{Ξw3 44 ahóָqt:4W%*?ZUg}w,c0Gic7fdĞ.C"FFi a.@l᪜w1J^ieh=Lq 7{yFS{{o3cOR4{l$NB5>w+O ł-zQ[r.-_]2e Tm%̚]̈[:dhY6ȠbaG;aHm{Y1[pIp!,+ߪ\*;io~9g]/I؍ͱ!rqϲ8:4ء!%m ˪#ꐌ %%)Y@*PZb&ۢ oqxn0 v6r([E]$_s1!`goW+ߣNksYE yG՚.gt]b^9'uZ+whU4, Eֳt[tUA6|xZyxq˩l$rj( !у/Sb>'÷p#|Y/'OHt[==/~xqe|JzZ=?!*' utqwnW zv vuqJyz>*ǧA=}ӧW^] ſW >/8>f,4*p\X鎊D!'@FV9Nq7 ?Nl Vzg2(ʫ}xU>6 gY6aDv#Y aZu{vQ>˔}2~;im#k~C.i1ަՆ'=DV9IogfrPz3ZgZ}zDN]F!`׌0+Ǎ<*ؒ=sZJڋ|lb?*)S&KD'G]$\j"'tZ(pFPi-˟|l|1OGe&uVOnFbgZuȘy4yc,BV8Oƴ tE򮁴B߄S</4㱔 p!hw3#>eg||r25|gFRZE(QTㄷ74.ˤ>ENYX.Qԡ'8Ld,irSz1Ժp Lq7ظ @IGMLg@PUe5( }Ix7t:S%$$((]O\]BAU>Ma&V28%׀&r̩}mi8&!Âϛޙ-u:å#K +D)a\bHU1?C:I"%AMoEMCL|v&%(e Ŗ7&vy5$4[OxcȐZ2#3DO ) xVj%o L,2FFzPVӞe*Pٺ&*,xj2C1E_̍MwAEw|A:vo!K6P0\ scl,mSF ƓrB* B$pp*A {pe d)^_Hu5/$c :f@su>F2'KwɈN§X| X]a~'m¥Gd-|PX6b %e@I>~Dy6vac=wB"Rdm7tWuF@ 6w%$FS)Hb1[ ŋt9R_E9  @a;~^GFȐG+F~e$*HGTpmU:Q2~dA ֈ$\`1Ls!Nj @<9l$G{J2 28l^⺐`FI;;,e".CʆB#õc4;ƎBIM(z,- f s9vN>iM ;LS&fRhD:)%  GTk@"J {LI QP-> O Mc[aَw`|'(ϩbһPmsP'IA6E\P>%cn-kV h qnfd@Zta}.gT H /V@€ͻ(Jt Xإ~\piE>Kݖ6 cM#mm q]QE82d_}1g,2S,!]!;qة^gS>>\olC+Y#`oLv`^] 1ޓQVq!}w6̫ξWNa )6z7Er>[@+C|&cF߷oyNnRΚXŽebQ|z0yI8mسC},S6:r/H;aϪAwG@ICjB)ܩ'c*+OO"L: X<s,rk/Ei"1˜&e yHcMJF 6zaZ }f:+d-+ v;qC"np(ӛX7*݃=QE89vSn-`_t;&(nϏmUasi3,LJ4to`⻙2|QMU8a9}yԾ"{5꠶/_rNgWx{ ӭֽzHq + Pύ<~j?JEڷڷzTصюjS$ SSA )(^Ls LC@>3Cl8`UwaA*K''?YdR_>biߜjO0S W3}>[ ՘"-jp1R7[z߾DMwZiI_D.!B*NW!=y1`,0nA Sj;pACM !V)$#jsZOsCbhRgsĨgyBV]t>i^;B6tIi2g8ŏ F@Ô yjahol;>WS_;=%[\x]:ĒieYRDYI Z.'FKoE.7AYFs1u2d-҆:2<8SQ|W)p^<\XX)կlwD51ᴼhi}>Y8E-וn$KsU[P@5{t#xu@O,Fc><2L .C dH_ AH8CF@oQ̸iG.9հI&{vP}y}*^R~o$JjtKV&e(v]q-.`NgW*O'VIi%C`yH"OU=Ifun<G=c6h3?~S1FH3&Ql"5Bacc}NciX4,Qѥ  TNmXZ578a^a۱KHo+HaȆkm#eȕjax XQz)^U"tBEp=$SXBW"H\ɗxJ8u%??&/bQnF#ZZ $x^?.u RB6yb~a5 y&fdaDg"ޥrOݶ*EFɀ ٳ |,ӕAGdNHqVP@1mՕUcaa^-l1zM:w欯 oyPjx|xz/t_O)Փ&KKEܬ-}Ex...@B)/yְ<|_=^ lo{Sݣ1\q^|<ܱ7VYgĎE8xb.ަ 4,D.t qnH{l:dVXLs1 go,h{ʛמ>{}Q7thع_ZQuLQu&_"4EA^V)}s/>ĥNL >EVZ`6 &tS&r8n\Z'uU*|"sD゙}q#KU,h PE[LVy;4M 'XT՛VW>YĔIK>yc~%wrtv C@ljfbcΠD)aʣlPgJaYGa&Ceu^ JPV,Qf3n#I;Ȼ~pȬuJFQ d4v}t`DdZGSc <:;ҏ(Xݐ8mhX̃ v\oNG//jK⭵̖Z5$ EB"vSV©L  BmM5D%<.1/˴ײʝA5 Oj;2N. -e/Qy7%48b4Sv٦u}ucNY%ؘ.#>zjYk̾&GmL V&ush4j]HSi 6 2(* c.q&@YLDd67r(w9E0M'a)hQNh-`9_Nv4d@`F(xmXx9YX[?FA[kMB3P 8 ndM>[6!~K1houiwzWӐ%B_(x1'OH[NYja:߭ 03ڐ0lxpaL ޜ!;#TXԈq>󺴅$0'3èSÛ44YVd%Fa4lK|^H;YG (d&5S/Kq2.m-|aRZM W0!~n▥*xZ1s ʶ{.v-ű@{}ت\qLR ?[zB>r4hM8IPPI |124dRR)6mvCsxCr)aLmY R]fp&Uɷ4޷x-2㵊S=3\WpeE>Jy0& 'X k aN BtL aa{%hyX;OFo(?`, :S~4vY+FiKGD/gʦ9zf?D5;h1g>eS:*{乛p*%]:iεBX]GV߇hi~ޟT @N*GC:~ed?h-'@(@VuϩǁE6ƀjti> pvOtF0Gc̦.̃_68st!e"V̝y\@v7+rl "T@Q})>k仍[<`-6FHWs' ?vu'\کlWELx\̉1ݝ:H[J@E]jop:RXL0kמh-`b|A>f6=dڶD ^’ =u\gTzS DI6o&PwPO}ҼڴpGi!&B!"h^wnz s=v7ʠi Cߴa2"BsgN_kȍ*~ul9Wo#&6v8q7lyòN[Z+r%C'JR=Vx6TDžC>5d,dSxFb`dіd5z3 > `CkǾ&~~裡I2\hf{T[]1]F,yƣ̣N@;M+ ynQ23h( C8<郭QhI[|, :%aK@iOhXj*̊O )5,T#J,,\_imNj^~*~,Qݼ{۱9c<{Η 1PpMZd(8}ºL.o .L9[mW# a(N*T"!h n#i x}͔TS<p`^ &6 ^$>b`Yop.pk!=fJrktʪR8h}5v&$}x#P_RBBm1Kā+;yxdJ.Y @<)O^ KoAZ<8dP .- <L.ŐJjMjf_v-纝~T/W2䎜䆂i2n٫QE#xzԻcy/3"]Iv#e*Y@dtFZ ";7m21JTMRZz.8pF 3nn}R k+W}3M17Zvw^6V?S#=]UI< R0FWG|zyIz)OSmF-'f\Q?SvuixW2$nwDJxvKOB}sÝz)i ~Lڷf5 1$Qߔ0]sqf1`s_p|q6KJh;J3w TaRg=an)H5±OON؏[[x:LoVzD\Lf|( :C<<ЖˆRmwFFI2]S07C܅߶07]XИBh޶aQ8=\~r^ (o$W(c[%ϳ ZU y&qmt K6=k~w Q ~hA-Pg~}Dcum^E!TH [- 7ؚļ(T:UٵT3q6z*+F>4$'%*mn͇N  X kiG<:ދW&5-Y8/>uxU +{NG-27'L2~*2-iS0öΒ:8:yQy1n%{@O*UH6ԿfmN fYkJLgr/>2үwfw9}p^C{^T&Q.Gl7=:- %DR„֯ *+x15.#Hy3 @$<qձؼ"\z rߴVGo#^4Jf[3+(j'Ԯwt 7 w]ZBJD2lr}kkX kkZj`QM^g[oF0W4 .4c>ݙޖ\D5:Al /P7q؈-H+rH@5dk R.|()`>A˸le5Dm5滛a?vuXfZzj0͙"ϼH ̩5xlL|X{޶MX\NHMH޴B#J!7Gj vzůI Ԙg =ic} r)S*f 'C[ONj}?WZbƻ)6Ont4ܫ~aHxs/lvҬoy<{ E ɜlbBq/xG/^&ol2fqIӭ:KoTe./4!_v5{mr؆tZh`-X#QJAC(jq܌J#Mu 4-R?9`J07;D\L!!=[$wЩb3 䓝_|^cڼoj_#J{X THB9g1\[$ GKYC#p-VͧN`U섮4h 9MkcDJ:ٝ|[_k2`*bXu$hlr:89]??D Z%$†,efW>3\!%dxRH5;cM|.nK{tL|Ry=!ڂڍ*3E B6ů* *`[P]n&w=4q/_Y{s}zxx\}}|-rG&\U P"vcn|/܁ n?$&PUqDFꈣB"p<)Fϛdz>7TnK/A8p<_cB&{;nSH+g&jih݈ltG8bXP|tN;poeٽrN~U68ZC=ziOõv!J<:]˲P&,I ΂F$舨I3+z^f0Fz,[ bwPRچ`y('4 >Do)&_+ڕQ_F>4oetI_ >!n%?.g'OxiOf,11[*_\F2E0zx^U,ȍ&5DzD'qy:c1}YkѧM2lp깾X8$^UDi5z|4J,]aiJCj<2y/~Pd "̂xP'/ǴWai/kHg2n B4ʆb;5u[{]靭i!v;2b`$7%?g  _&u;g]ap]Q% !/6gQ1n1'xѪy5=*5G:ix&`+C~Td2wa9l$\͈xZ$Ix4Ն$'j\j^v df3B3ũFj}Uł.243?u}xy ,87|^ŗ_`/+?ZzrY=*~ǯ^2ꧯ|!/?_"iDV秇? g~v],e_'5zUK|(_/?o!DoIBzw-dQk 8w/&Iq$J;g ~nσ>]<"hrye?_^_?Θ_]\nk7>t"tΡGM=UѾi '?ݥs{aI`nZUߥTEl_h:e쐙Ómg"tU F^& P'f>Z)z:Q!WH쀲׮+CDx,I꭪qag t['lm^1+B*[589&JQhOSɌh#T&(\5?i~Ss^lQTlC ~]:nl, py$,#ѯJXFVM}#_-pEbaWZ:|J(pD=:T䞒{J9Olpa#QNT>k'kE%1;J=Mg!0"ۜNO9Ēd۪Ũ+)֔q- F]@:a4@ Gݛ4$Z@6 p e}ezh(,~j8yOYsecaԀFY2^v&nmnc%ܺpRX?筯 wE_JŅaWu$K[FX0޻U{ᲒmDS{)+e4fkF.1֛dyoK2^^!#n|)3I!Pфw0%;Wz3Mw,<>nҸsyztl+Q$"(߇!QVql$CFo`l &q{;&a~/53?.ޖ[7Kƹf "x}ϜaȜf4c 4`Ǟ\+iMY]/((DCD؎T?vOJw4s \$ |Ej*QHO 0TdcfZZdu?O\|ӓfji}2,-_a\ݮU ;[Bh[.E7 aDu-at?3\ia}ŞfO]*G7 \UgqJvT]v肂gaX| 9}xVZ ~- G+I&^ӿ`cZįPY1 `Gg̀iTA6!a(p!] Ltqe&hܪY246mPe3I7>Eq Łf w fjƟ"(F1,<8Wtp'qmRR 2B#D7x] ǓO.i@y4,ޫ[LjaٶxcW6.XW^*~??^.WIz<2W[#^ۗUx_0΀˯fXǷ7W'dԧ pP2mލjzX]>=_ \?r]f~j"Q{d ~ & D} WǧHb:juJ|xpwJ~xvBl'aOi@{>%᧥,'/03?A&V*#xtqi))Q&ۋ/NYo+%{CP_PL^ ϓ`C}M\.NIMT,qЕT^b vxuk R$E m>3BﶺTV}EyznM`EAcIs,z|E]^#`E陁:3mk2mta*n0\ MO:7ZœwnJ@>&D:ow8M-+;EfHByD+6+ <(/G%+rg[Ocv Ქ.VNe$ 8bE`A)c -=nj}{9*-WoվOG_L8P4~Ð)^'<:lD~^Ib((VSS= b(qcKsS g0鲣Har2in;>)Ʃ2X&V0P6hS\xW;UT:lP!fv˪+_R=.ⲭIAF닕.^ t_+ *]+rdCCYE*}9pNH;fos~{/" id"$C QyE=q1;ƫ"τi 㲀fta:ۢ0M%-E mRͧE]~-ZmMIs[`5 /:~cY}y6L]]|_zi|:$l`<-=\;T0CIX鷀7# =rSPoȳ9+bs*PFY-BNWC5-㹯gj&WpG@S5jwm/ҐO4+}T9!ЈdSޭ1joMD{k6MEi@Xo8\<퉸+{(I2y (ԇ#>j'jl Lmw2%v{j{f5Gď xsUe1`?4$^M֌Zg" T\TΒdЛku8 YBZ_%$6iií~# ~KH774*}khƞX:0_1J[}$CGsY/U{z_pҧyu+~uݛ+hsGUna(Vd.afXI׋~,ZUV4@SRpc K&VTIAp`% pM&=7wr1|GAJLV Jm80^hMY)%\j9ۣscSc_0Z迠A-`*zlNp"U7kYyǖҨ {z.%{ke.Y@5) r~^f~[?Y'MW @6HHetDȺU?uOx.-٘3\A}+k F ʴ5vWvM_Z%Y="`1rG<-T}=u@qE+G$ԛNuWE.vTJLʸQg! 6ۜf>3&G^nk*;5st{Sne\5TTMT Y 9u*+ܺZa$xz,*(+{op}-i)++:"m6X+eh"jf4-_jN1aҼdUIl&$V:MT^"_thc $ ݝĶbAuj0?xCd.#{H?f=G\‚&cL #Nka!rbmy5L6G6P,&28xV3|l_C'{ LGP,LY%u60w}*ue[T7o40 Z&eWLW)ja";6^AGS7:XC \ֽ5 TM?jU@`&1Ϙ]/m _%۾}꯭+*{L;Vz)7wD;ٓe?)JL2GZ6|Rw5IooԸ.=r뇻??4ڪU0^|X\UFM_1F~Z|uܨ~ۇ;X7<&]@^csIFH 3 Ty Gһu8?n*~>F2?A.& E xhiSŏ:Ńpd_::j07UV0=;Rs=*gv@gYWJQ[˘ꙧ(}nN'9\jX%I`f&4R!R`7P xmt[`~"p :)kZKY딢J( re`0bB㖔 ́[S~^[ 0MѕHnF ;ZF8>*4zŭz_=g#됦 LjpPO5𑆠n_3 `=sbh@9Uj,Jj]09k,k_ 4V ןn__$7d" V"GhNA:"vX aA@ UY+6'N1{ oC:w$>.|ˮD:y%C9b0& @rIeBSJxo56^YoK~ެG1| @ZbMy2bKaz̘pP>gQHnۂhUd/Q (ٕҶ> LFfgZc lX4&S3}F(Uاcz^߫,-pcsВM eVuiƪ;4s)_" A!dИ6-"ȢGu՘Hf8cn B<09s7#^Y^;|,,j~R ^󶠌m%ښY&6 SCDFЭ29QqGN5 esp2\[>+eU'Щ%H'aTB]=XUM \^!<av$P]/~]=Ozy9;ig?O]\CV Vwv7vu-.~zg~|~B 7w?=vwO[8J?go| XX̗oMk:Zǵa q^ C/GErvqA~0K7PP1zs鯯o>Tǧˋ/nE!no ,n7Wgލn8ȶkE^a|E8*OϟTo$g}v<ݿ%H1FFJa7MR.Ag 7 MmJi Ub)B 1PeݾPaa7G<kFuN6շ\7`CGo2~}o 5d#p@gVdn.{qpWJɁAvmZ.nn2BGGA{2vN@Eb1O'xEв[FJ+AW! 4xr.LV~Ǩ+j=#x(=c᱄tR!uO#o;^GLT WrYҕMIVq),rv#SqKe K@~Gtd?ʰ6tb:$kM rۡo!Dv{4R>qՅfo`cj* ,޻}(-F!xiF3JFr,ßaѬBMDgI/}A`O1mHWb`;^KH];.U"R56Xq)M"| zJTEiqK-[I]}MEj6Q;%R)tjP. %VgJΕX]Pb0zom|A]Z+z}–tLs*0&jSJcֈt2qkqXsX VOZr'q#˴ǠP[>:eۤPIB-Hȶs(t|V)B4zi۴]$jhۚq `J-kOeHxhT,4r6?ɸIQu=ۮUL C0 S5-"^FK(5)#[.HCڠ6:k8mFh2s#zaT_\Æfm{5;qo~ov 3m#Dpt$9"0VkYh]DsL~ yJz|=S~O>[d= }^|C".gwqZYSqj3+fevsL:)bRrSc'?%"mV udU3`db4d>Ɣae1~zBTuAWdmiD:y"Fm6v7!wחV4Gb3.etKu[n z#)|*] rFt+l}I.!WeLl 0+ ]?|y*2g r󇛻8#QP_@j>!ΡG0gwNسy9qz>\|g6g=9yx($??:>?>D(>-Պޞ%뇒 ~:䳈 7UeY䄟}5fN|*'$ ;֫ %8{HA=fO ek,#|3Ȣe ɏMK;P0f}e Ng~z=8hf@/<9Xb֕fp'q<6dVՇ__HшG;*bۆѓkD5ˬ N/Cy4fU5-̛>3h!TaZ0( x ot݄&a3%4l`|8/b} Y ׳ lY3og9.©Uf]n| a`ld_6ɻT#KՎ׆TzRwذMTԨRe@ R9 $~pWCVu|6x~&rR|z_~e}X|e}O,ۍtvnnTn>;8^ĝc2U{wsŠ~}@:ή]%.F6Z:?`#䵑wѕmv2.*Y[dx btRCh+2 W+Sm} `qsYΧ?U~:Nm:+3XLER)2 iKSUFTOc+Kb U).(OCЗ!3*>:O+k0oCѦ@#W3Z쉸 \7:l=Xb7]]YL xlfE!.NTFZZ2ı $.J0Ӑzyr4 $ \)֚6J/q|&~"w ƛC^NH .Мƨ =!N*\9!r,.i^Cl xq?gY"$t/n,i~RLgR7.d1Z6y9t[#y9/ |4&X o9ҋ43-+}DZMoMn^)b.;衇衇衇O66kIuVՓu@xSA"70je9QDYMAT\gTtZil|E;|` N?[|[8C%Rs=.QT +zV_fb"k,ʆ\% fV!mtQJOGVPnJm wU*li6lpVGj(o׻%4asp@# )~i:cR'Hps\0ʺtW~i`e;L"@ ^L5n]!UiϞӽ+.0eX GOFJ"_^$ WeB?lD~Fe-bw֋0 H\͎u 7; #"3/iJUv1Isqy\_XM >,Uwߓsqc%1!{ ט* ~Gleg/~/x |;=xzA }K^1b>-;_mް!9v./C^VDWnFʊf->HyBULNP l,D\ʞ;<[wxpyzܪxD?.j8Uy]gҢi^P"m" Qvp]:dy#J޵߲B]S2IU,elqܿiԌ[*i '~8x( :Y~ 0. t.FVTȯ}m V}2 GoYvE4H>S+ ZimV^NҔ޽cښh!ҏy rgaXY&ѴfSZa (PTwieQh %NpX`8ӯ%}6;w*ס k`ÔpIĻM>!ջ~NSӤMW G֞@UݩūjI=Oc*D(6B*s=* H$W9)|ǵ%LZ惯.)cO:DF rZi\ۋR[k̠JHYL5 >1=1c(gFW"$vg=1M@$1=Ðŕۍ1W)&VC}oڠlk 5¦OֹمBV"~`)KnoG $#NA $j4T {.+6$I#f'=J*ԻH4Gș!銖|-w{>=q"ʉ\4eN*;+*m' ~@5Vm'^HqJ>a`qگMRt5a+B\hLY81ݡX5;5TPy`ttb@ OhuHO7gm (xmbբi)eaaE%1j3,} IGg*LʨopӨJz(f( $ @6Ч,!!B5rX=q.g5ܵaeBvb驥@/}Z?|Q L!%Q fU\m>+Vd |Rb;TnU #,bzq#c͜D1GpKFl#aF-hu18}IB췰sKmL䤋zu4 y'->DhܮUu'Ikf)i *gjܺ"EAֻEK,S2e54wC,|/$BgktXYWVs픉NڻܐLEvuo{#0r!sHtDBBOԷA޷2Rz ӽ:!DUtdPT9;|#\OB]a*1a Fs[*r'PjԳ;MQHMnEu;鵃sKU'+|>P}7ȣ+":PtT%)mIԤn`EZ]U(w!" q:eƾl'[A@64ގJt3p\kR`znLӺMH H3;^n._q&T]`+ޜ$Eӻük0q^x ΋%UȄ hl to=FctGѽۏssC ߜI}f,ne mߺkaY3'Qk1ZOA/t<8upHMx NK2zR v _f]f~=RNRQ0 觍G%/9V]}jk\Ily0gt6:Aq˩tJ. F=oznGmY\S*iw`Ue/ġf"k N;/ 9v  SK Bג* }WudfaG,{X) KciNO^O-q/hOcPNAg:wNd<9J<;MW 'miP&pI#VELW/t( ,tS4Cų1t`Y^$Qb~ք$4IY;4" Z9Cz.Ґ.m;c9qz]bT åVof,:AgrO>ɮE_8> U1#"V||lpION)\ Y>qOoH5DYC{$2:d 읃o >w3CYR1 agzG`0pZE^yNSiNY% ^嗖P/дLZtT'O܇*-q`>@d:ƾ]aR}J)<1TevQ+N g/P?QNhnUZTsg,|LѵkGYxegs_b| !ߚӋ)(Qg>g8tƆf㙤jm?bkff%ׇEɺ6S/嘯=xz(t~,tq42NʯCՁ<Ɵ2}cnp XH<Z@n᥍ED-~ΗsQ;|ʙ@Kcv7rN5Y-m Ҩ H"tCGfiac'mF| fZ7$c Yl0cٶqAA~\NtAI;vt%F<;j 3C*~M@}t}%k%$s]-/="uy81 ĐQiTK|ds[f$?lhRȫR!(q5jiKIX2IT/J TeK Dh6D uwFsH߲[fI2V$fm}Fk FA!y!Ҵ9 y]8yjn6~r"mψJFb7[٦jĵ\e*5]hr x'ZQl#mlPå=U[!#2rwK0]3mPSj^T++B^$ &Q*1::'! P`caл.:J]xٳDV숮K^aw F@0u侊~dVsWW43tO/3ьkCO]ޗ>dq 0Ki1)Sh/u+a[DKuK靇 wx4ԥQ{Bb;BL=ơ .(-i)rB80$&!W?zMԺ1] IIzV?"\Lfl7hy$/E7☥J>2%yG'J0 -5(J8#NG-&H54{ZG]-/eLZ[摏GqsCٲ_>kaq1$vgc ɪzd3K*+ &Ǵ 6^%\e>L#4DJ4DJT.?@^973K9 C1!aF5ZՕw>mҺ` 2ɫ ) 7c9ӑ10H[$RJwѹ(IvxR& !1D1}JJFDfl2}%ngHSm.42{nZ9ҕ4LVji!CIV "[[mi5EҔ% ^C>lTe%9 )'rD.m@[4B4V20f g27U '5S{U Q/M=)[10]SU \e%˨oғG*8 H5a X(V(sj͖䇑p MU1_Zq!oi;7.,\ t+0ldy:$*)~^K  M];&3MӦHQʬ"<~{1mgnVY؅-Rns/4X lf#V[@թT ;/f4Z9Ⴙ^w:{8J;dHۍ,xMvXn^ `oc9G4Y2 R^p]ޮ*Z+N ۖ[Jm=q\:;LE,i!195ڕ۳<0Z*7%$;o !W\-X <ѠTj,az`ylӱ8=5r`ɏo9~w@̤>0tRrЖ˙sFxNSSf2zsIKR D(44$e`J\t~na4bwyo&8)$FPd2tH*Op2DF![k}:jHhƎ%x0H+\/eV 7|'.ZiK'2ŖovM5ͼܧMӑVɝH-Jw}BS%hr»9uu*,RZ $ KQl3pjuK,RAlY;ٱ<ʵjtQUaEDk.ƅ}#5|F3FyeI;iچ?mZgMceB82G9ڌe4#4*1QcF]8hy?nϬۯ7y$qly9q2󈼥:4RO#݈M,pK]QMu"WSVhWMd[R)\* ӼͳϠom @bэFNhDY[u8T#X.Ϥr~(&e폶_ZUL'J{*LJVok~lNs]!܁# P3lW4FAj~ r {_2҉@j{XvM|Uc.ǹ̐{Ǵ\K7]鍽yh%x}9~ojծfLyj8iI#73jMz.Y~FvI?e..$ qDp"֚=`uuEO5ؐ9~R?nw%4ǩ̓sY21 p}n[dB(2X 1ä뤐SgxCwϛfQ߰C VÀV9[5#Vڭ nJkä *NDl{)}Šiq@r|0aLI3Շ 2gz䯝h ?;"Gΐ=߁H㓎e9]DptRKQ.l"C oXa+HDY<V X#8 -w3DPuM32ﺵii7jRik3-T_ wBC딲ڸpi]2y:L5#MdYR,tznkw^MA; N˛ۻEQΧ.@l/QYĞݝ<>;L_u7]c {J.AKo'DvIPG@ e7)rGaI륕+ M=k 7`cL>I63" T}IWO!IJ;6+,aL6R&4ۭ*ؽXK,L͖۬s|k~] VMe:#ZgVvvBF|7SX'jۡV(aFdd˃^Oְ8y?=/UQ޶jXAWv;/ (4&',=i2vLZ116;P8H1ww uH )Z^p= >mU3&L5ٻ)^5$q^G9YpZw{,R+ڲ.0SmC-("ֿ8=Q܁"[)Hc#C(ŀpkt1IHj?#Y|>V *l)DZM^wdy뻗~|ׇH2Dӥ?q#>b1$p|SqM9%OTI {ի˞_OiZ&v1e}4:˰?JMo׌Hߘ Ǝd*DDua֓>"(iYc!<(yw@rNZz9AX8uemq3!|XuOO@B^ U<BDS?}NeJ1e?ɬ#td)p:2SӨ&S˄%AslV`\ u_ʎEJfmrY)UXO`B$IwcT-`1gxs]?*)_Ƃ2H6gC! L~ Q*G}Y]65ev Z7:&'!x ~oX_:ITYth竷. F5!Tg>9P!mծU&Qtz x&D=YXٞG~rAեڲ-v7M"0I3'=kϩ]GovuCb|Y,IҶ}Z cFcוDoseYVWTΠG!g캊,V^W33j-1)GsB/)xe񦙈4}0 i ס~?Qp,V@&dp@oYMCNG,s;xo=D ;op>FT~B 'XFX`\o{I|\gjl@ j?d :')K/hPxB$H!䡯ic7xIJdSnZ)=~q61-Izܵ6΃x8H3A a.*3Ra$6"F)n0 Tʲ=FvU"Rtwۑ/eKJN_nOs!}Љ&VfvzU«n{d«avx'MwSm|D?z,DCEkƋ p|sbqݭ5@Qr?%su WW1ː-PYXb|O1IѰ7G8q\ixބ%@śc6쵣n͊00Md*h]F/'CO=vJNk=N'zs1L, dc0m"|O_Wz+CߙO?߃vqsoYWQz7K< =jϗWşy%o?ߟ۫w-o|~ן*;Z]^_=_oV9Ķ}K˥/ ':D7STߪ4&*xѩES#ҎX4Ȟs"?ӣR18M!͢4Lp[m*Eԉkvh',Yǜo/AelOab4yP)ƛ FXh{4'/4dY&秿|Ld*D-QѱIԟ.>_Հ{՘FߙIozS=h rr!u%HSk.;sCKox8 G8jq~>OB-J(`zi44r-@vu2kqX:-ZPzC< 'z0xcu1U$$A z{{5}H// 4n*"w3VOŨP?rAjSY ^&9+`Zˢ*}iwԳ@6fhQ^ 9yӳJ:wS]DE:ˉO}a)jZKU<=}q멳ūK#zDŽ:oBJ*o5Eu;2hh3}Oe*Y*!9oB{nԮee`3&'㡵J<U4nr|&ș Le9 -y=T{9yrX D+Wg z/Tuq/ӳ|!,rlzwwosɻ9ǀ7TCJz>JD"Yycn8]o4 ![˻zJƈLVo`P%%/拰WWK}ԡOR Rؠ*jt6H*Bg"nU;} SDsN9K)YM? q^gq  i$ޯⵗCp K?&@5}+}BV?Mg~I˲ZE Ϯ<*?$y/ݭ*8i5'`'}5Z OOˑ!tSCzUѽ7i': l]6 yYכ]]!oÜ<'-.-n?OJlI!(SbQ>S"H(v '`eӉPt% ڜ&p 30nqMlV%yxD]aB[[FzSܱܾ ;P)+r Fg+ @(D,_! colܶ2+`&R Jض^S*0ǘNgHZ* ]b3._m\ +@DY.FO=/G u[5Ifw:qX:s4f (3~㫷їbjY[Ӭdj_? |:1aV>|K?JV_tCftVOfW7q b&XeA}0 ׳=3O܎XjJ׃%ú%H]t w9>i4S#Iz þUth&tͦQHr!#4 &fZ\klX focʚ YUr8֬)T5JL^h D+a~ƤjÔCs'ߺp &I<Rjlrs 7YXSL}le5[;ƴ8)4Ʈ`=K*p@̰*nX<!(dRZ8|%zs󻢣rWgşWEMXyT%)̽6 Ė/:<;\u9\# ]H3.bϯ(jS@SbRvbX&*Ȥq\@m>a1dP{ ; 0tEB7!l6065 ðQ/# ;C*ƕ6]h%/.^)0wxŸg+#zҘ,:q쑚*eh hxH$ϰ- f0ůs^D\ ]_sB*Jږm~N K0G'*|#b,&{,0(u(iT.to 0?ZfP$~w盻k[`9g߿|}Уa;1u ߫T&şVw@Nq.S%=2=Ǘy|CrnZpLKIfa9 uȇ(7Muy&#O+;u'o'sVȸYtt50eF 8=jDaՊĕb4Ќ|AF53KOk3$w.N>'ZT ʰѤ+~u>1b_tr0.]RnEsQ'3%jOwA51&[=Jɮir8˹*² ^蠮br(vk;T߉JyQ*9sAVfsPXnOȐMm~ 'Qz6qMq5첇r="?%~/3)0JWe~$dϱӧ8|+!=hVtZddh{jۖ?R;Dj 4F*TD7b~ )k__;{c]iSN|]o7׋zxi:f ')jF3{x &NoΠ\֣<Ȍ.p4EY_KՏBs"sd%*F)5f]ka:_-^.p3{Suqv!ݛR+ [r/\/3#ELj(No)zݎ9?9 +Bp6U\ڲyV52܆)l^$7"搯̅\-b$):wn .}]BGb #XP<}J=s/kUɁjȧ}8%'L>hk"jG#5h6OaF޼.`Y/*EjvP|EN[#>{nx{&/fFL([^I݈MeROy,UkbgsJ%s\eY׹^C SlI]9EORjZZn9YxSzvHN %mW) ٳ-/lWRF^tn\*D:9.xL p=mձ)xû\p;GX]L*La-4ajS`ʢzޫxM7 zIB aF{Lmio Lli_cpj陭يx. ~x=2Vr`zu< W']Vz):Sx%ֵ˒1a58HXO"nQU5of#bF77=`M_sSYn]W[]`E:)˪9ҠQ` ]y>e,E 8Xnn)uVq3l;zBoeq:AɾL:nz,F4WԿvEF|;AX/eg>$0<@/N" UV#PeS[*2{u5`E.62J8n9"5DHEl4tarNw'\7%܄ g}`lLgah5w@$8V(NyҨ?ର=*X5LU*K񦘪fUOk]xo.8o O+b3EŠT/N,. 'ں@7杬sB ӗ/$c.HGjSkE%V BXniQD0 '&EHRXKwaD3|xeAIY~H8q"i'>eI6M נZ7!BR>Q6H J-&2~̝8ywt/_k_oM "Rb˅Ce]1FٷD U&ۆ;}OJ{ f~Ċis+=S]6.SA f j::`&e+ 6鐖vgkMfM@,wf|V=ոv4(jk fڡ>]v<4XGV ^5MZ2ҪSC EReQFTe/Ur0US c$\bUN(Vc%5jdZFcZΚqWbKuo[ NWf k% ;MlcZdF7U jaM4"we,:VKXSUTO2-wbۧy`ڏ.ο}puscvfxU(B>hJeL@1=HV:f~4(w&2(S)Y]m_HBe@L-xP4J<8ڝS Zb>=uj9$L$5m,]u4ՄྱWg"tMsv.=wR-`F’de{J+@o4j,dc|Ye儼"hmKyA,~JDxĶyU}C>#-D0aޡhj>3&.\@|璑X(t,T}P>]k݈Dvmxؼ_+иv{Ej5b:1l(P^0avmvr}BaF5 j}*nQ "畤طHWaIs2API'ǯ>̷+S KI*Rc5@IMLe3XB*1֫V~UJʕ gN8b2RNǜ~iXahy#[/C^PFPu2"$ӊ v`1nĒ76} >#"<{mFIMGV<ތ=}4NKџE^HT'Bpux:D6YTr?4Pvv7dqc";%C@kG| xJj;3(~q<5ਡq+px B1jTdFOEf[e'C8m0imL"]n BHCU YٕwzG>M-ŷQ7iy/_aH`)ARazpwkΏ.Z⚤Ѕ.?./Z5;N^w.^yT+ZaZ0iprsA Myi5ᄤxRZthYp R \)8܎5+7TB3e 4ggHv~=7pqIyixׂp,:%mnNuΤ(u^.ȅom#qn7yl%R_1[z$]""xtK'ҎP"mP[P#_9fN;C:$Ӿnp`/f:V0'+W9C~!E`֒E8w1'`O?;:!?*WkSbv9ص]28y`hbF %W"dN^.S5%Fh6&nmV(;JB9hQell΀fbr(v2?-BGk!\DѿJ2vPKf#A\(Ksh Gӓ~(|J˗8#+$>ȵ!IZr#;jl&HM4yxi_KG&~pr"O&B'PE{ix6y:~x_#4qi_1~l|Q>,Da(qQ~i9֩:Iv &K6k @,O3OyfxZь{ͨr]?MN:_IؚC礅DR\/ʄ{FTgejodKv*ƒ&TLZguHT&"1Ӄ RQd ?ʀDpI8?);aFBGstظL;8ZVjwH+?:N:x0hZWUdڛ(O ' az{!〘|4"lPe[R$RP,I LjK!zAw+Y50{4m'&2)-(Hy8#Ч~bJ7PãfTNUb Cq$KMa/~y!q'ڱmPn #`ynG T~XDޥMRYNA?1S5 [WvL|Xڲ)¨en*bhq)!4p`-b˭]cP~È#'t${31lR}?b4"‡Gcʼ phC\\X E^"YxoԌ#,Hj>f>Wi4԰Zi7Ct UTW԰ҏ]˵~3Bp#NYQMA!FIw4hO46YU(:#CU]$TJX]F{t{ QAhEՠp3;ITmt 24O@"4"^ ]Fu9lvNNN)?==@&| +mdV_KzJ0v2͗g w@DEU:G*KC'<(<bjR'*VӁS屉tR#PCRhCX9 KY_ʬj #U۩n2O8=yc钮dSBMʚV8SÌϗ 3_4flBH[9mylg9F?q. OR4$S C 5'U:R-;}!yJwx2$"k`G#Ca)U |%+ƍ. c!PlF)1[ăEbcuRNc8JŇ`\cYܰ|MP8u/!Y^tnfgp6EeB̀_v;L2ˆK+2TcQi~Q [| ф*D.)pQ9^Tz70΢ rXvfԻ ' C23%iuhv:ǀG<8c˨[hJY]^ZJW _yb&TrxҕX#GIw&&v+#Y,5Zo`9.%VKJc~Nնz(ROͪPD{"؃DfH *qX %׺4fyΪ3/5B[=z ed\hW{((lr䕤 +ˡ(=k 'J?  )ML~ZIFFp7s߿_`.ŖK Tqb4eĹn0%aTO4^décA#CHwЫHw"siE̴o5vemM?ɒOQX'ђe^p@,$BԽUhr9bW5FkE{fEcfUFC|KYMuCBi40q d Mҁ#"Z_Bi)]E%85NmgWۘ3tVN}؉o+zVf$ɹ igItnSߔV>jRF*GXÚCU8o9'RǂvWR`=09UMw$5\H$ɮBِfM+̀*2dwH끱? ,~ E)#M,Y0,7+<:c5æ`t>J,D_e 1KjGue5,W&{2eu6?kEe{S KDc:؀2i΂C[}̻|WӬiH`/M'1/!$p04?Hb.)YT#oD0,.HZn樢Q 3^K<*>pyl87ylR+0~|_!=9||o t]ehbא0P7_F_ǢxFƖz 17.8]:SW/*T öxGh)/vەMU<|H7m[l)7^gs}2pk@D'2%KnD8FpXQ65P [h2(<h):Hz/]b&3YEdRe-l_*cI6!$'Y}]pWp0$i/~݁ߏd%f%ExSG^Jd6{mJ,хs mqgZ'b-^&-`#=o Hv@|ܞSoۣ(Mu o[\Vѹ:G7#i~8YŦ e=CdBP̔J=0R/B󉕬0}qUzx5'r41A#,׷$Kr T)4#4k/+RCDo`Nhu,i.<2TۈD* B\~a{ ]L+pm{F"W;  7__uuakh Ts|@˛ 4OS['e)mb_?6;=F {JYn|a?M]%i]_˧HYuç@ay‹";,˴va^Gng9XUȢO6Ra0a`MA9VP"PE$oœ`!p@7􎹢;TASԐ72[Oi-AWgAR X[<Ѧo'#"|"-,|z9ݹ'|lh;<$,E @PzYv1:_31nNuq0lj2r.>5쇁Ss гӜZv3[Dy=L }z8B w0yL999<]J5`RҥE`"kar-Dfe,}=~Km鳣k s{_kҳ%᪐B zQEWZcuk ʝq6(-F@mMJ)ʟ,)F&H2a g!Rm[oFS] ӏύ#촭,b¨_ݵ['Pc0 I6NDi4ɂWN[Z7h^]AHo?u<̳\)G3/ ڴ;`XaiU} Aed uXG\ zܡ"DQyq :-:ʹ^w35FSsF?_^tؒ0jJ\yfиWeғ 8CLq[Mw\Vx*w`̝\; HAE^~<rk؊.d軐!6)(oU$gt/ CyU gѠyc;6Bu>mz5:ܻЊxs4彏L4,7(wDmj3adKN70S&`!k hb /a| Qŧ`Xͽhebʏ[uvdD. 1©5! P0?޷l~Z~D,%;^cn2fdCs={Wiz#a(o2Y_ {| ~EYʊdlErј ?'#ݖ]齄+q*S M|y7ě#bskK0J e?-b!){s qM3Kz&Z^NBXm?amГu3OGE!Yk -Zc*;nfiYD(jUp\%OAôg ?NRu9U:SjD$KG?4 , "Vɦ04V-au-/E&q iJ-qgjt5!Voge99QB.3iIUiUu4jFRZVjpf@-HTlਧ.g0uTȟPMcqLȺʕWUq_]8BV]hܶ΋}*`UT guuBvB*&ul9sߠ܁bǺB~xxjz {%r@YFJӴ^T-5.RQP0,G7F 'CuQ1^d$jei=FaR$S?_}]aV c!la0gʀçcŦ5 "zlڏȫ52dUj 9A^)hNDB @tSںDScd$:%m[6oS_å/7(R:>C/C(n? ekْz?i)!^A#ږQO:[Cf5)޹RUŽ>}[?Jrov@z~nN*ѩ3OP0)Ջsp'90x j SJaw6,f ,f?gL]KěuU,58nRj["CZ~P!Bfa`%7,gX,x`pG>p;U缵F jL_TXk^D_R@8'@.|OWO@ʍ)A2>]i?++׷RO PLY55?|_J 50!)JR˕11W/bM7koٲ+_6\hT-iGW.dD &$heȎ&E!dJxHe?h3Kx3iĊHiqS\g7-h 4zґ3g/1԰+"$efVߜ~aꞥ:wL cBtBوhqSf0 +=`R֗<~ :wQa0xO B7K U 5#vԹٌjvȪ⋺pk}8תB-k1?(:̃ h!Go}˺CjwW<\!1LJꑁ wW]ݼzOïӫۇnne/^y~Շ )VW_n_g˟׶-no~p xmwzz_=\ezHQ:AUa @ۓ0l{ݠDNK6-ؑG\%2%EV]L8H].Gc[ib]p Р+ŭ}Gg,2@Y>Ȇ6ZN1yh#7l)S@ ddՇWE΄AAz>}6d_ETN !tFsyV [ k7 5ap ĶnX4|9mEh"=2qJҬ b:.Oi"5*QfHlv"?,vʂVnY$W+5A.::W+9 ,2C-J &x{y(i0Z u;wJS2yg 8 TAC[?I618NSu NV{vXi(qܱ/E }c\ pu :=".w h(1zGmtԸjz5-*n1О:{Yz9_X2ՙ.Te0CIdDe@"\QS(y@%=V2 uCn+2%a.f0pNtsm4BF 7UVփ˔ԻP%wX ǯW"~>"/?>~꙼L>~}7}/w/ަ2wçϿ~W{e}r`^53] ƹϲNp7Wן_ޭnVW~QGG"Gbˏ5>9:l&oC8B81OPY!9Ra$fmk()Ε|@H:+|qi"FyY4:tMS0qNo<. C;ot%G\p,WYh4[-Ayl1;!De49M4 7,܄Ygƒ=:mǻC.>WHF`(h76ÏPA6"S$w8SaO0xDShܘqt֡]!)67 a~Q}{q!ࢠBGqiKY2;: OP1}esԸÐnA-Q8Q՟WwU]~wA0[`B]EBT <߉pbҢrc ]5 RQQ/>/SwBqnYmiVJUB+T{g`Xpoಘs0^lI`QV! K)d*M\L9WU Q 2צ)X7 GtګNĈ@pG@.h yLFcO[uKCtRNQ{BTQ2滙]Mtznetbsd-INSTALL.debug7d h #` *@kd 5@[d <l Kx tnN>|c c  PcH <c c@  0   'H l8 8K ] n      @< \ 8 d4 T& ! D2c Fc X4md ed( vl( `( ) + t$, ,, $P, d , t%(- 6- K@c ``. Pl. @. / c 2 3 3 Tp3  4 t6 5 d 6 tO> O> O> O>#O>.8md :< H< ,\= j? yl@ @ $,P>Tc c( 6@ $D@ ,X(A fC uxD D $

c xc( D F G G ,G DG "\G 0tG ?G OG pfhL :L @sL `M N N N 4N 0hP>THmd P P P (P 6P LAQ `L`Q 8XT DbT nT xX dX (T W hP> P>0 Q>Q> Q>0Q>'`R> <R>QR> a T>|qc c  c  c  Lmd X X X X X 0 Y Y D8Z FZ  Z dTZ ,_] k_ 0w_ _ ` a $`  ` t`a xPc  U>U>c  c $/ c @ c L d [ d h e u e ` Lg  f  f  lf  lg  i  j  ,m @ W> c Tmd  ̄B, p L? s L s Y s \g t u 8v T v  v  v  v   X>  b>@ (c>@7 hc>@I c>^ c> y c> c> c>  d  `  c  c  c  L  T  ' $ ? < X c g B < H   p#d>d>  0d>@ o>@ 8o>@ n>@. n>@? xn>@Q 8n>@b m>@s m>@ l>@ xm>@ 8m>@ l>@ xo>@ $ |  ` o>xp>#p>  @ H @3 LD W q f @x 4H | d(   @ l < $ :!(N!d!(u!,!!P!4!!#!%!<,c0 (`c <dc Qhc$ mod ~qd sd sd sd sd sd sd td ud  wd $wd (wd "@wd( .hwd@  :p>@#p>Ic UBd d c  K!$K!L4L!\L!p!R!"$a!2h!Cd Vd gHq>qPq><}q>q>(r!H(s!d d !D!!!d!$+!(=!@L!|`l!l؉!d r>d!$!t!!@ !$L!0!H=`!hIȘ!Vș!hН!<u4!D!r>,r>` c d d ćd !~>ЄB&P! 4p!|E!Tt!0e!xs!8<>hp!$!!!$0!xȩ!h!8!h! !0P!D!@ԭ! ܭ!xT!d%!,X!l6İ!L!4T!@\!g$!<n`!!!H!!!!p !$@!@!\|!m`!z! !th!T!|>,>><0>S!$!,!!$!T x!!T!@#(!-0!|A!T!d\!c!m@!w!d!h!!LxSt>,^>hD "w " "D """$",P" p"X"D"D"dD""dt"""*<"1"?"K"W"gp "t "}T0"X0"T'"h,("l("@("<)","L-"P-"D."lc pc >҃>>> *> #T> 6`> E>,> P0"_0"n0"\z1"1"h42"p2"P;"<="8>=",=" p>"5?"C\@"dR@"| #A> P>w h" x"< xq"` `n"3@l"X Dn"?|"g (p"0Qw"|_Lx"}>@܅>>!@"" ""Ē"d ("%"="8X̕"r""l""8""7̡"`_,"Ht"D"" > ><X>`>  >@! <"d3 "HE "U "d "t "x "` h"p " "8 "8 P"P " "h !T"T2!>!ԄB"d  "tC!"O!"d[!"h!"`u!d ~!d !d !h",!"0!""$!"$!$"!"t"d d "d !T"<,""<:""8E""8P"<"Ta""Xs"""`"\"4!"4""H"pd "td ""$"""""H"d"d "t"<""T""\"T#"#c '#c 2# c( =#(#Q##c## v#######4##L##d###l$xc  $>!$#$/$#(>$8#@L$x#_$L#n$#x$8#$8##d d#t$d $(##$##$L$#0$|'#H$'#$'#$$'#( %(#%(#,% (#$C%D(# ]%P(#4t%(#%(#%T)#l%)#(%,#h%*#$% ,#t%,#0&.#&c8 #,>5& F#4I&TF#<]&F#k&H#&hI#&G#PG#d HH#t&TJ#&\J#&dJ#&hJ#`&J# 'J#'K#0'K#C'8K#S'TK#@L#d L#te'M#v'M#T'@N#'N#D'O#8'(l> (>(z#t(>`) >h)> 4)>hJ)> e)$>h~)> )>h)> )<>h)0>  *Ȏ>h"*> ?*T>hY*H> x*>h*Ԋ> *l>h*`> *؝#+t>@ +>0$+#4B+Ĩ#8d+#}+#+$#P+t#X+̪#+#d+>l+#< ,,#L,x#4-,#F,#b,\#s,#,P>#,#,,#P,8#$,\#P,#,,ع#A #0,̻#h,#-#-x#%-4#D4-#0D-X#tW-#e-#p-l?{-?-?-c -c -c -c -d( -d -d -d@ -,d .0d .#$).#89.8#F.#^.#Pp.#.#h.#d.#.c #?.#@.#`.p#8/#!/@#$2/d#P?/# \/#z/#t/#D/#P/?P#D?/4d /\?@/c /? /?  0?0?-0$ :0$M0$c ^0(c -,c l04c ~0X$0h$x0$<0$00$d0$L0$\0<$0$$1$0%1L$81\$H1d$Y1$Te1$t1$1"$1(#$\1|%$`1%$P1,&$P1ĺ?1؄B1,$( 2@,$2-$8$28-$,02d.$ =23$G2(4$S2:$\c2L;$q2;$<}2<$2<$2D$2|I$2G$2J$2H$3DJ$34K$/3C$;3lD$xQ3غ?q3y?u3?3c 3Dd 3PL$3dL$3tL$P3L$!M$<3N$D3XN$`4N$4DZ$4@O$54P$C4P$(Q4@P$]4Q$p4Q$|4V$4V$@4V$L4W$44hW$|4W$4X$p4[$@4?4(?58?5Ƚ?5Hd -5Ld 75Pd >5@\$(R5h\$0g5\$v5\$$5\$5T]$5D^$L5f$5g$h5xg$5g$6h$d$6h$76j$ G6 o$W6o$j6p$z6c 6? 6?6t$$6t$46t$ 60?H6 u$6u$6u$7u$H&7u$;7y$pP7`w$$`70w$0v7x$,7d{$0t{$<7{$P7|$\7\|$\7|$l7$}$d7}$7~$` 8p~$!8$78$K8p$U8T$`8$m8܅$8z8$8?t8?08L?8܄B8$8$x8 $8$\8$ 9`?09?B49?9BD9$LL9$Z9$di9T$`|9$89$d9P$9$9$,9؏$9$P9$$9,$:$0:? :?0::$?#:BI: $W:0$db:$u:$8:L$@:$,:$|:4$:H$:Л$:8?:?0:?:?;?%;?;B4;|$B;$8L;Ĝ$\_; $ s;,$4;`$d;ĝ$;$4;$8;$;П$(;$(< $(<H$|$<Ġ$1<̠$L<<$I<ȣ$_<$pm<?# ?v<0?0`?<x?~<B<$< $8<D$<<$8<t$d<ا$<ܨ$=|$=l$@1=$ s;̫$4>=$N=$\=T$x g=̺$Lt=?}=?0=?=B=$=($8=`$=$xs;`$4=$=L$$=p$ >x$ >$1>$0B>8$tO>$_>$Tr>$ }>$>$>$>`$`>$@>$>$>($$ ??#? ?? ??+?&?4? E?6?X?0?>????`??I?Bo?L$~?\$80$<?$?`$t?$h?<$p?$T?$P?P$L@$@4$'@$P=@$$XK@|$b@ $q@?${@?0@L?@B!$<@D$$@h$(@$,@$$@$(@$<@D$HA$A$&A$,4$LP$42A<%%mD>%`xD>%D?%DE%DF% DG%DL%`DL%xD\O%@DO%EP% E0X%LE|X%'EHY%<0E[% ??? QE? ?  ?(? #3?\ED?8jE|?zEBEt%DEu%|Exv%E w%Ew%E?@\X0&PkX&{X&X&X&(@+?1@K@>?g@X@@ @@#@X؍d X(&X0&DXt&PX&pY4& Y@&,PYl& Yx&&Y&@#@ 1Y,B^Y\&jY`&vYd&Yl&Y&Y&PY&PY<&8Yt&LY&Y& Y& Y&`Y(&Z&Z&Z&`)Z&t4Z`& @Zl&,Z& LZ&_Z0&xjZ&Zl@l@uZ@ @ # @   @ Z0BZ&Z&Y&xZ&Z&\Z&Z& Z&@[8& ZD&uZ @#@Z4B#[L&H,[&P6[&A[|&Y(&`L[&b[&d0|&<w[&@[&[&|[&[& [&T\&#X@\@1'#\<3'5\T4'T\$6'm\6'Ht\47'@\t7'\8>'X\a@ \@\@\b'\c'X],f']d'1]e' @@@#@I]T c _]d s]Cw' ]$w'H]lx']Dz']z'^{''^|'P<^}'HO^@~'c^܀'xx^T'8^'^X'h^@^@ ^ @^,@^I@^^@^s@ _@_@!_@-_@9_@?@ ? @!E_.@4@>?R@O_f@[_|@g_@@@@s_@  @##@_>@_'_'@_('_' _̮'_t@ _@O_@_@`@`@$`@ >?@4@ H@^@#u@+`'6`'8C`'V`\ c B` c d`d s`@`@+?@`@`@``d@8@"`@`@8`@8`6@8`n@8`@8a@8!a@8N@5a'Ya'#g@ ya!c a(!c ad a'$a@a8Ba'Tb'@b@c b@c (bc 7bc Gb' Sb' `b' b0' bP'bd'Hb'0b'@b( c((0cX(8%c( ;c((Rc(fc(xc8(c(c (DcP(c(<c((hd@(T d<(4 d,!c )d0!c =d0d Jd4d Yd8d fd* Sb>* `b>* b>* w>*w?* w?*<9wP?*PwX?*(hw?*w@*`wt@*hw@*8wA*0wDA*pB*dwC* 4C*twE*xhF*xH* .x[*>?@!@P!@c!@@x!@!@#!@L"@  Y"@#o"@ x"@Lx%c Vx%c Sb* _x*tpx*}x*x*x*dȠ*x̠*xР*xԠ*xؠ*yܠ*'y"@/y@BRy*hy*`xyt*Tyȸ*yt* %@  %@#%@ y*Ty*,y0*l*d *tyt*yl*y&c z'c zd zd( /z0d U8d( 4zP%@Sbl+ :z+tIz+w+ Vz+(ez +szt+#&@ SbD9+ ~zd9+zx9+z:+Dz`:+zD=+z>+`z`>+zA+\zxe {e {c { K+H.{TK+>{hK+S{xK+f{K+x{K+{K+0{L+H{$M+{M+{N+{O+{Q+0{e { e |e( |8e( &@  &@ # '@ '@ |e+@Eu8g+ -|Dg+4?|xg+ T|g+b|ht+t|t+#'@ 0'@#>'@ L'@>?Z'@ g'@|`e |he #u'@|܈+|+H|,+|4+|<+|D+T}+ *}+<}+R}+h}Ԋ+{}؊+H} +}$+}4+}<+L}+}+}++d~$+*~+<~ +P~le `~e@ l~'@'@#'@ v~(@8Sb4+ ~T+~\+~d+~l+~t+T~ȥ+ ~++*+j+=,+8Id+UP+iX+L~++d +t+ +<H+ԩ+$+0(+(P+h$h+P#@(@ 6`'c Ed'c TX>@$fD;@ L=@N;@6;@ʀ=@n܀:@:@6@5@~04@Bb/@TD/@m 8@8@-@~-@Á3@Ձ^3@7@27@7@D$7@ =8@SV7@*eF7@~2@22@1@j1@͂T1@߂.@p.@ ,@+@.+@r@N0@R+_8+Xm+0~+t4+t+dP+++` ++Ã|@@ԃ++++0+l0++|/,+T:(+pE+4O+`8+P}+H+$+x+L+Tτ4++P+(+.@@ B:+8G+(VD+|A@e$B+0A@(Bą+ׅ\+hDA@,B+ +DX+\(XA@4+pE$+Zt+$k+@+<hA@< ,$0 ,@φp ,@ކ , ,|  ,,<*<,LA,` N,tZ\, oh,X,!,",\A@ɇC@ ӇC@H݇8D@ DD@ PD@ \D@ *hD@`4D@>D@8HE@R0E@(\',$g(,t*,*,+,l\E@tE@ -,$@-,ʈ .,و.,P80,E@<E@ <1,$`1,+2,73,4C 4,QE@XE@ d5,$o45, {@6,p7,E@H@F@ 8,$8,<:,Ɖ:,ԉPF@$ۉtF@ ;,<,4=, =,TF@ $ >,$0D>,0>t?,`K@,`X4A,gF@$oF@ F@ B,$B, C,D,x`E,ϊF@H׊G@ dF,$F,4G, H,I,((G@0/XG@ AdG@ M`J,$XJ,ddK,qL,tG@`G@ M,$ N,N,O,ȋG@ЋG@ ݋P,P,lR, H@ #pS,D`k)c e @V,d V,te e [,4#[,:[, ID\,8X|\,\h\,x~P],^,H,^,T^,όh,dތ8d,Lf,e,8g,)g,>g,g,d 0h,tSj,PgXk,h}Dl,Xn,Dp,lq,T׍)c0 e e  e 0 e H$e `(e y,e 0e t*c  *c QXe ,(Ȏ(,ȉ,, ,`8L,U ,i, ,$,,ď܍,܏,,HH,,!t,(@T,\U,Di, ,,d\e #I@I@0ɐ`,ސD,0J@ K@0K@L@Qpe N@P,TN@9dN@(Fl,`ӑ̮,W,8dЯ,p,d ԰,t{H,,#N@N@*c B`,4,h, , <,1,E,PR`,_H,r,(,P@,$l,d,8, , ,tϒ,Dܒ*c *c te$ e "e 8e >,DJ,W*c k*c: wO@,@,$$,Dh,Ó,tٓx,,P,0c H0c , ,h!t,<7,LS,`o\,,,\,xϔ,xߔL,,x,x, ,`-,@,\,xT, ,,d\P@\Q@˕pQ@#Q@T@ ڕ,th-l  -x -D-@/-B-@S -g-8t-Ue@f@00c 1c 1c f@– g@ϖf@ޖg@f@ i@og@i@"Pj@3j@C`j@Tak@dpj@usk@aj@k@)j@k@2ŗj@՗/l@j@0l@P0c0 H2c( p2c X e ( e dE e 02-(@t7-S7-8f7-KN7- w7-D08-t8-`9-PT9- ՘`9-X:-0;-,<-!0>-5>-G@-ZHm@pmm@8n@Pn@@n@@38G-KN H- TL-,Ù N-ՙN-o@,o@0BBGg-hPhg-hTh-Hh-0s@t@u@s- s-0ƚt-ךv@v@ e e  e  e 0-'-04-,KN$- D- #v@ @-H-@[4-}<-D-x-0ś-@,-x -)-<D-ZЩ-Dmv@(̭-X,-p- KN- -,в-ʜ$w@4B؜B@h- Dw@@--l"8Cc (. .B .N( .@h .d  .t!.-.\-.g7.8p7. {9.|`:.;.# @@H T@DCc 0 e 4 e ŝ8 e Ν@ e >.,<>.D>. >.`#h@ x@(e C.'C.L.hC.70e( DXe  Wxe fe  se  e e @ a.a.̞$a.|ߞ@0@Xl@`@ F@$2@4&@ D@V@d@sʊ@@@t@^@Ÿ@@џ@(@"@̉@@ %@ 5@ G@ W@bf,e p,e } -e ̅..̈.,..,Ҡ@8BޠBl. .t ,.&.Pg(.8;/0ID/W / g,/Dxp/x/ȣ//`С /Pߡ\///H/ ?@ʐ@ڐ@?@>?@ @ +?@(@ 9@ #F@(/./l;d/NL0^!00f!0,]!0$e"0$p8"0z"0#0$04h@  t@@ #@ \@00A0A08B0ƢTE0բL0?x@@@c ȅBʮ52<خ6262727272@;2@Ec Ec Ec 9Ee H >20Z<>2Do>2X4?2 >2 >2P@@2,@ȯEc ܯHB l@2 @20%@2D6A2XEXA2 TdA2,0@eEc uLBA2TB2(ȰC2ܰJ2 Ee 34x3LN3@34^83r3(3H 3 3 3|ƺX 3պ3<333<2@.@=ȟ@H؟@]@@d`sc vasc ~bsc !hsc  ռsc  xsc  1sc  _sc  tc  (tc 0tc  LPtc  (He 8He HHe XHe һ\He c c #c Pc pB6tBbxB|BBBBIB{'3'3'3'3'3ǽ'3Lڽ0(3L|(3\(3)3,)3<*8*3<5t*30?*3XK*3],3@m.3X~-34,.3p.3, /3\þ|/3ӾD03,߾p03 03h42333X0434d434+43 {P534@63pL63PXt73Ti73 v83h<930:3 <:3@:3ϿD:3N3t#,@<@@|@ @@$̠@6ܠ@E@Q@^@kptc xLuc `He dHe hHe lHe pHe N3O344P4{c Ke Ke Ke Ke Ԣ@$@4(8@,8d@I@Y@ jc w@c c Dc Hc Lc Pc $Z48(Ye _4`4x8a4b4tc4 *X4<?04R,Ye a@ ؆4k0Ye x4Ye 8Ye B4 4(4L#У@L4\4  |4$#414ID4 bd4,4`>?@#!@ 9@R@f@x@v|c |c .|cx ?@@@ c /c 7c Gc Vc dc pc ąc Ņc ȅc Ѕc ؅c c \e $\e (\e( *P\e 9X\e  Eh\e Y\e v\e ]e ]e  @Jd 55`55X55H 55H&5`-,5Ic Y(]e i],]e !5<d$5s5H4P5L54555LJd 5\5d0]e 0_e Jd Jd -54A5@Q58aJd nJd y6@6|6H6L6t6J̧@&Bc86Lԧ@#@w<_e D_e H_e @#@  C6x@D6P_e X_e  Kd BBJ6<K6ZL60|x_e ,W64`W6W6h`e B\6xa6\`6c68/d6G^6|]4b6tc6cH Bf6xg6Pi6$tj68 j64!q6p5(r6TM0t6ht`e w@Kd @Ld  `Ld Lw6Pw6d x6tPc Tc x`e  `e  dLd hLd lLd ~6 '@8@(MLd XNd  gNd yNd X6d 6t06Dt6h6l646h64<60l6T66 6T46@$`e -`e 6`e @`e( Iae P ae Xae pae xae D6D6`64ؖ6d <6t686 D6X6Ȟ6(Nd Od Od ,`6@x6@U6@i6w66t6|66646d $6t606$66< 6p$6D'h6<6XM6j<6<~<60@ D@>?V@ `@ j@@ #@@c Xc ae $ae ,ae 0ae hep  ie je lke ke /le 7@Od GOd XB6X`66086p06L6tH66c *c 5le Ale Tle Zme g`@wOd Pd  B!6<46LP646`6$66,7\ 7@$7<78t7(7h' 74 7B 7HVX 78et 7xg 7HwP 7 7h@707877hue <7,7D7P 7D7(%767?\7I7W7bL7rd$7@$7<%7&7#p@c Ԉc ؈c ܈c ne ne ne .oe =oe Loe boe qoe oe( oe re BB&8-7D5|-7PL-7`/7q.70.7<27@27L37T47d 47tl77($c @Pd0 Pd0 Pd  Qd  @Qd 97D <:7x:7)t;7?4<7,`<7@T=7duhZ7?78LB`8lqL8~8x\8(8Px8P8,88h8dP8H84 8p848P+|@X9Բ@@@@ԑe N@Sd ZSd oSd Td @Td Td Td hB<8<x88848.88888,8>(8'8LSP8``8Xn8D|L8@8@8|88d x8t@8c ܑe e e e "e e e *8@;L@J`@Zt@j9898j9 j09r@#@|e e 9.9'9L9h949999:9:9.;9';9L;9@<9(<9 <<9P<9\"<98+ =9 7@=9G=9(=9V>9_?9@h?9Hu@9 A9$DA9(B9HpB9`B9@C9XjhC9C9h4D9H9 H9T9e % e 8$e F,e P0e a4e pY9Z98Z90|[9|\a9,a9a9(a9t:$ e e 4d:<0pd:X@d:@Ke:\e:4le:\(f:Hpf:f:g:XPh:Ĝe Ȝe Мe Ԝe ܜe 1e He ^e pWd }Wd `r:Xr:r:p@s:$ds:t:u:,u:Tv:v:l 4w:8x:h/x:L;x:J |:Q:`:lo:l{Ѓ:Ԃ:x:D:`X@g@ n@ x@#@e e0 $e (e0 Xe \e `e de Xd Xd )Xd 5:,J:L[h:cp:8l::$:Dh:|::$П:< :HT:(|:,:@:8:İ:8:8#4:x5:D0:|g:8L:8_d:j@~@T:@:::X:X'`:L.::L:<: :<H::j`:tN^:#:-:$: @:TK:Z@k@}:<:DT:g ;8 ;` ;d#4@h;|;\ @; ; ! P@3 d@F x@#@Y @xf $; $;t $@u lB B#8@  |1;  2; t4;h X7;x xe  e + I;P9 I;\F N;U N;4b O;H @o Dc z pB a; a;0 b; c; xd; De;  de; 0f; @f;t f;h h;" i;* @l;x3 `k;>  @,I e X ;` ĕ;i T;Xq ;0~ Yd Yd Yd h;$ ; ;d ;< 4;( \;@ ;De !;<8;(%`;2;D:0;T;Ta ;,q8;8;П;;;D;8 ;0T;l;h(;;\;;,;AP;xK;b;pn;dwP;|̬;4`;L;4Ȯ;x@;L; ;@;T;l;;L;;hx;<;8;X c (@e 0De ;He CLe MPe _Xe e\@u@@#@@ Yd tBB;~N;4;0@xB);7;G;W;e,c m؟e yܟe e ;!x;<Gb; Sb; `b; b; 4;4;$;;; ;h T;T;@/;,0(;<Dd;W<;t;(;$_8;@;D4;L;4 ;(4;;lP;;lL;*P;=< GP<|P<; #@Udc `hc llc ztc e e e e Yd Yd Yd 0<<D<@!<` !<!t#0<Q8<h@<|H<P<X<`<p<<<  <`<'</<(Fغ<(]?8@J@ V@#d@r@ @ @,c c c c< ܎c c c c c &c 7̦e GЦe |Ԧe Vܦe ce je oTB#@  =@ =c c e Zd  [d =(= =! =L@#@. !=; !=8 @%=F h'=Qe e S e ] e g e q e z e  e H@ B B )=Hn!*=\ /= !e e S e ] e g  e q $e z (e !,e >!@'!BR! B!0=!,1="1=!6=!4="5=4f"@#"0e +"4e A"8e S +<@P+\@_+@t+d@+x@ +l@+@+t@+d@P+|@+@+@ +@,@,d@),@*@2,@B,@L,@c Yt==\,@j,F=(x,G=|,G=,,G=,XH=0,I=|,Q=,@ \=\=,]=-@ -e=0%-h=<=-r=I-A c-Ah-A -A@-HA-A@-=H-= - A@{\e -=-=,.=,6.LAd=$?.=\I.=<Y. =i.An.0=D.t=.=.=.$=.=4.(=\ /к=$%/A >/AW/A/A n/c /`e /de /B /=/=8 0(=40H= 10T=J0=0\0\=x0=0=0=0A0A0 A m1$ A 1c %1xe =1|e O1B #0 A #9 A1=L1=1=|1@= 2L A`%2 =>20=Dk2t=2= 2 =82D=42x=2=3=x3=53,=8[3d=||3=<3=3=3=3=h4=*44=P4=xe4|= 4=04=(4$=4 A 4 A5 A5 A65 A 5 A 5( A 964 A |6@ A T5 c i5pe 5te 5B 5B 6B ^6ĆB 6=D6=L6<=6=<6 =7L A '7l A<7| AAl7 A N7ȆB 7>7>L74>L7><7>7 A 7 A 8 A8 A08 A98(c N8He  ^8Te  o8>8>D80>8>8>8>89>|.9 ><I9l>\a9>r9h>h9>9 >9>x9 A 98 A:H A :̆B 6:>T:>t#T An:d A: A ̄BB,B$A;03T;Q5p;"0;88`;M)X;p'`;p'(;+;8X(6,;Mn;Mn<4 <%4<x^:,<;5 Q 67<5P< c a<c y<Mn<"0<=<s-<8p< 'z/6<, =t1,m9`=46(.= 2 8==V=$d e=pH6tr=d< T=c =Mn=\5|74>T=D,=#H=P@=(@>[4l >x:5>0x>>w1lL>T1_>:dk>}>T(9 >Mn>L@>c >d@>=?t'9?6?\;L??T,V?T9j? e w?@@<?H"4|?Ĩ=(?H==$?L&=?L1?,e ?0/?z6@3 @$1@I! -@48@{9\A@d9Pu&c K@9LS@, g@Mnz@3X@3$@$L D@o1 @`Ye @X2<@H&c @1$@t-0AT8 AMn3A܃d CAԃd WA2lAx_3luA(d AR0m"c A0PA68A,TA8-$ A2XAA<$A=$BMnBHG0`$Bc, ,BMnQB=kB\c oBt5BMnB8y6pB"4B#PB@B̠5BJ9 CMnC;)h*C3 EC(TSC`8|^CD+,sC| CLh8C6C@"C,BC+$C( 6Cp9xCX1D<'Dy#x6d *Dc >D؃d NDh dDm* uDJ=Dd1Dd@$D(s%,Dtt"D14DMnD 55 D 4E2;`EKAEP3&ES,t>ED:pGEMneE>vE)@E8,E(nd E"Ed#xE6$E"EC*,E+EpY60E2\ FT0FP78*FMnCFMn\F"c qF:8FMnF0'hF>hF48FX;J9>Fk,,F0lFc, GL>G:G ,96 c 'G@c :G4FGd YG08kG8c sG;DGc, G<9G06G1G'GJ& HhD!xHk=&H T;(2H@ EHC4T=TL=L5 Lc L`8c Mc MMn0M+l>M.EG>0GMe WM1 gM =(uMc0hL2M9 M4&<M8<M:)M !DM@M=M0:LN2  N ,N0N(1Nm.CN!XYNx,.8jNPod sNLM6@NH N 4N])NX4\NX NXr%N3(N\:,N!.O@H+@OMn8Oȷ=<DO|6T]O,HkO=$OD@@OB6O5 OD6lO%c OMnOT, P:P:0.Pnd CPHW*D`Pp@mP(lyP8n*P"|PĄ:hPȵc  PI7`PM3 P;2$Ph$ 0PMn Q1QQ; Q0:P,Qض/7Q,PDQD"ZQDs#rQpd>yQR( Q.e QD=Q'c QĿ2$QT@Q<Q|0*R7"R>/}D 90RW4(;R#<PRxw8VR6 gR?R$9tRn"`R@+6R4;RMnGEc R1R;(R'|R3 SMnSp5T.S7h-T*6HG>(8Tvc HTh2QTp?#8fT rT4T\9@TJd Tpf2T2<T4`T 5hTp3Tt4 T\=, U`-d{1X<Up:)UJd 4X7UC>UUgU06vUMnU@8U,<UMnUMnU%HU(J=Uq-Vo#0'V|B<=V;LV86VV@^Vw@pvV,36 V4>6$VEc VM3pVU6V;<VČc, V(1Vc G>(W<WMn)W >W@4\Ͼc NWz6$aWMnzWh `W`8/Wt 4$vy<W@=WS5 W(\$WMnWDJd X܄6 X`:p(LX2xe c /Xk#$?X@*00QX\X< _Xԧ oXd+d|Xl & X`8X40X@,$X@Xd X8Xlo5@X&Xk0lXJ"Y3&<YL.\)Yd=(9Y+ FY'gYD0(pY)c, yYMnY4Y=hYȶc  Y%<Yx:m& Yc  Y60ZMnZ@1Z'GZX*D`4`Zp3pZ@{Z؇ Zt@Z-Z$18Z4\_9d|4Z5 Zx;Z9ZДd( [Ec [T0'[MnA[%c Y[8%xi[L3<y[1[P5u ['3XG>[P9,[h 7[@B8[84[i:[>'l\X=`\X4(\`%@/\`><=\ȃ (M\̘= i\2{\7\98\@/;L\Mn\"\'\(0 ]0-l],8']<Z_d1xk_H!$_4!_ta"_6 _;_$(c, _,@<_d-h_BQ~d `6+`Ȉ4 5`?D`w@]`!t`Tr!P`;`2` `(`9`<@<`$x`hc, `Mn[7 a!c !a/4a\81=a=$MaP46Ya={a8M)Ha)(a|8`a6a(K=a#Da)8aMnbxV"'bHc 0b*6@;bNbe VbD7@ebh8(tb2b`e ~>bЋ.bl#bHc  b(#b c b90bd2bT@c&%c0B:8c44GcMnWc@Vg2ig46vg=gt';g<gP.HH!c 30g@=g@g3gd g+gt,t h'hԃ,8)h\+Ahh+Vh\!`ih|3(th4R!Hh8h0X,hX1(h8y5$ԑ $h24h@hԽ:hj;i @/iМ7$:i" Ei,wd QiM3P\i{6 jiB+k$3LtiYe i&6i=`i'%0i?ih@ie i(8 i:i4p j 6dj c@ yG>08j|'2Ejc Qj|(aj,6|zje jl6j*5 jhmd j`W8D?(c  j.Lj [1tj#j8j4jtI&lkpM38(k86=k4<Hk"^k? sk.4k0.Llx"c k:<k=xkĬbm 6mh`.DmI+Hm,{6 md=m"mX9!mb1,md m08mMnT\=,nTc, n@Cc &n̶,|0n$=Bn#Rn2]nH+ nn0@}nLe" n4n@e n|><n (0n738n0a& nH8lnh'Dn90nc o>@op,+o8@:o.EoHc Po V*$\od3@lo0yo1g$=o@(%uc oc o3Do4o<6:do5(ol8Po6o;p6"pP&3p7@pa& SpK2xhp"c {p 6 pT5Xp pWe8 pB"lp`i | p?:hp1p><q4q\e 'qlT)9ql6(|Iq>^qt(nqMn~qx;q(c  qp84qMnq@yc q;q*Hq@/q88q$?,r860rrD>Tr4 c rMn^654r6h2@+r% r9rX2r1P sW54 spc *s545s06=sMnUs5jsp3 zsdn*LsMns@38sg<,s<40s@sV74s@c tMn&tA62t`*$ >tc Ftܽ@^tle qt60t51 tЈ t0 tc  t$ dtd  t<0t0$u6,uTo''uX?<5u\!$Lu}%[u;<pug2lzu@2u,w,duc2ud u:u (lcP"`u42{l/ @{4R{ d{z{2{-d{3{%{5{Fe {80{@|Mn|p5&|3(0|:h;|L: I|dO4T|8 = _|J=t|@+<|W+$|@:|$%|Mn|.|R( ||%8}$c, }Mn+}O =}+4Q}+|a}<:k}TM2y} 24y }X=}2T}Mn}5T}$:$}Mn}$}Pc ~ľ0D~~5(~*.`3~94H~(-<U~|c d~Ec m~4{~c  ~LC-D~X"D~Mn~ =~75d~dP& ~+~Gc #4($c :8C#(X,4rW:X}Mn4"p+|5 0$\=o:h! c  #4.%c C'@LP2\"6tk@<yIe B"8x'( π :MnMn!p"=;<4JO@T$ w=c (l 0=1C5Ծ@eX ȁ@ρ_=dՁt5|B5|5`t41t3,7t9T5 IX%TWxL0b;mc t58 nd 7( yc Ƃܲ2|ۂMn\5d, 5 (' ?pH<G8<Q#TbMnt\b2@$'c< x$4(\md 1(׃$6,`%c P#4O&  c 39<:Gt`9T`Mn{|od =<te  `G>(ń60ބ0=,L=(g!l9&L(=dl 6~Tb"P6$r.lX( %c څd\.,P@<6  (68D08%7/1PC@YT2,n`8 y|7 4"X*Tj64@džD7ֆ*7<31 4+T03},T*=C6`NMnel6|q-~8@p",e 7)c Ӈ-84݇;2Mn <0&@3=82`KMn^l@pXX" A2`."@<@p.I!= c @0/04@d L~,8bS!<wS= Mn`"c Mn^=X@(nᆳ X=3L2-,Nj`"ӋH3ߋh1Hj \1pG" 4MnJ<0YMnp0Je t @2:d(6,^,(?.@ '%DԊ0 ˌ06Ҍ'4e@MnL<ܰ9*A<>"Rnd m8#lҭPe M=dU8U1ɍp +`ڍ$84MnL5<<@0*MnH60Yd h̤5x458Dc ħ =,Mn=<Mn9#\(K:'(!9 L6\H4ґhb1 f(.9ulm:8h.$p>x4H`2R|5\,6Ó6TX=ѓ`9$4_)< c  c  Mn*lP=4=2OMnke7t(#$l#Mn=|\'8|2D#HєMn?(k@L{6`c .|ucd :l)I $R";Hd:`uO4dA<4h9p5p$6PP:˕t-0֕$96,k5( 6`!#h-0+@Ie Me$)~5lp[#0)p 1@J=ʗD#(ݗHc @5H 0+;T!*d5@C1S ;Le Ec |7x:p%((0;#tØ`)ܘ!c  $8\^; @=="\0.p58<<T_!O8;xYE>w-p9tEc ؉ 0.Xd 8d7T@6S5pj44wz#X`h ,!0y9H֠4" )!G;1z?E@d"Z;j6,w;B 6h'(ʡ9С@c@ sd 9X.e Dr,4MnP#a<h2p02-D|z5$,@ 6M6,Bۢ#܂ t=Tc {*8V:\0#N+ [MnqMnP4,8Je 3 ̣=Tԣp  7= e 0$(@6H:`.C#$TT68aS2u$x='%,e ,9̤e ۤ>\h+QJ:5K(,5=dFp @^1!Lh 6xG>0F;MnX0pͥ&c 7t5(@<`@hc  d6(0Xd @XBX4Hp6{ȋc ,e @9\=Ʀc  ̦n<0p6\=0#$"$ \P<@*MnQ9 i@=>@xMnMn Z9ȧ;<ާDN2T#\D#@ ܞ='048MnR66dMnyR4u c xl3,<:=tʨ =ԨP4x8l;@4, $=$c nd @@<G>-_@3wd > 7Pt.d8;3,pd }dld )0\$5P_885(;$9Ω=L5 H% |*8Dc 187&E&LPLQ4\|3ju y3Mn(q d @ ª\@ت$g8LU4\C!(;()5046 FHe Nb"`bc  i8u7>T)(<+<MnЫ=H:!4N3 d 4d+=0H5p\z,\M 6r=\ >\=,MnȬDFe Ӭ_-m:1`DJe  :,,D(24,h!O D< dxYe t̡e Fc ą00Xsc  6L6ŭL4ѭPe ݭ6hp}c` d&T!6R540X3 J=\(1pP64 Н&<:8d ehOh7t#(C!6hW e iT@T(|9%;o* ï4ѯd$P,-;k: {40hxw9$a+xЩ - 2$H0(Z\Z4te:$nMnMn*5$Tv3TȰآ1$ٰ8n#<6#p `[-`3ϱ7$ݱ 4"@~-\@$7|#؟#(8P4 6CH:x=:<O.\ a%4;|ZП=,zd1<H>6D&4Ʋ8|5$ֲ(@0=h/=T=Ple T4\-S99=lRQ4,]p|0g6w905PD#8D9|$@ϳ Xճܾ24)|c  |$T l>(MnB 9$Nx36`_B"4qe x@d=0H9x>>ʹ,;D۴e D P1;Xt}.hMn049D<X+,Q0bc z@v38@# Mnѵ?3 z6H5|66%@p+(3DP;H;<6Ol7_d#p@vx= 9\)@Ԍ8 'X׶94Mnp*"17@4X4;A`# `Sx;T`#<h$c sL 4`{1w7# %(շ< T26`Ԯ 0 X46&l%c 4P6H+V(=4jc  u4%$8\ (4Mn̸|.:(((c  Gc L-#7.l#,@MnSX=d`&7Tmto#$<38#=\۹0P34/4t T.H+t%[,d6' P<fMn3)o'<t7d/t7ֺ >T Xd  X=g#(& 8l9;P@`e(54u=d 2( Y10ĻT5DԻč&|߻4%c  r!(0@# 3p*0@c  K(=xh5$}L:TC!d 1MnǼ$0Cbp'c, Y!+$Լa.D޼ ;dp;'4\!3 /(l%:`.3T<MnOa+]t!q4@|? <P@"\X4\Ľ46ܽ8Fe H&=p;d@5 F 6`8$>,Y438@bc l=X')Ȣ44ɾ\c վ<:@4c0 @1Q=4=@/* 42@HMnc(k+}9$8u 0# c Ŀ|6Pۿ'= c MnMnP]+Xdg189;%Q5L9u HQ;@\F7v\:(c, 0<4h;\"4Y;H=<X">"4 tW:Tؑe )c ?#QMnp\@!} >4X:ԝ6D,\d3@#4)`6)%7D>##{c $0|MnH!82h@<B >Q/,[6 m`,8Px ,e Mn 8Ec 82!d(c, 3 )d}<4 3XV*46@1P69t*5 I6`Y':f4 9<m0Lw.e Jc p8| c 8#-G>@2Y-H $6@3 0@884= .MnEMna87 l|1(~<9Mn_)y0-6$L<0i-\731d9И/DwT3l9c (܆8Pl.3r8:.:xFq6TT:Xa  n_2@u6̧ \0d?!9;9 ܛ=%x2.3H; !(J1^"p 0{$>"8TX4H`Mn{t *Mn4"Mn), P#!h@,+(G-8:$J1(Y$mTc, {92T44#L$)%\0]-܄&:4@<&@55u*d9 0d 2+ s 0$1 @MnZ;TbL"A~Ѝ dz49 >X]'wd d 6TI"T5x M-A.P4@08 7MnMn%&4=@W4@m y%$z-7Xx@<`@! 5L%c X8@34"J=0D3=F+xJ$5Z,57q7(~.a9LDDcp 3TD,>>Mn',e ,Xl6(24O=8]<c d\7xc Y ~- ,T=r!<= (,?!9$2F-Uw@l54{=c  c  c =L c,  $D-!99̋@ Ec .x.e @MnZkȳc  s: |C9L*Mn6<8 Y6F#4g|?e xc \44 L9,&($&c *c P6sd (c 1: =J=8Uc, \85hg<u48 9Ĉ-*E-:4M5x4((**Mn@MnT )f7v8x~=ȍ40p*\k#t.`P5 H'5Mn6 $'T2=Mt%4`v,4u|:L:t}6@MnHJd t(\)2,56  .e ;0.p><0?d2Q.a,$z8XTM9,6#Z*Dc  94? x4\5@2td.$B"(!@BO& NMnm*D" A}` *`4Č(4X@e( K5xx5\Mn4 >HH:hU6@pEc XT68 .' x$8p3@PVd 4MnP(!dd D:)L'9+DD:O5`L3k40{ a8d4$;@7!$he Mn088Ԇ*h4DG'4@<P5D)|$;D;7`Qc  Y\4 861Hv=dN<`ܫ*4<=@LY8P B:4.H9P@tc, F:0LMnp`$=4|c c 70 )4< 80=:p pg9Mn0((P=yc  PH6T]6s'$8t=2TK.HL<,L̟0S.D?1P<p9,8Td H@5d-h=@81#S:$0 :=6LIt-Ve n(=HP@(6Ec Zc(,id h=@c ,e Kc  -8050<%Xo ;.0h >,`9(; ?Dc $]=X1~3?s=M,dZc  aXc sL/ T^9Lt;̡)d L>410Mn ,D<'+é+9.MnS6d60wD&H1d >H{5DWd .=`B+,,A<Bc J9`O1n̂ d9 c d413 =`T_4tdL:0 ;d &$%()L3Xv=D;UL>f8$v8,7HX':(H:4-<0c l5PMn`6`: h) М%H@:H#+H4 Hp!$T03@g# _ p&~&Dc 3022L86 2p|@Yd !>c, "9*D?e 6 2@!c Qd&L]h o&c ~,:T<49,3)+\P7 | M: 3+4340 $l7@1Mn=,P 2j<c  6 [9PD3@'л@Mn nd \{,d l dd:04x94>0$(V J(T N 6J0'6X|%l1T8P<;ij-(# (;8(  %(#9Ĩ=($=1:8?Mn_Y(\fDM/Lp3 |@i#@#p4&l 46Mn(4d !\MnG#CMnUtaS @f  *4z P9 h% @ < Z6$ Mn V4$ 71x :  1p, )B c3Q t#`c 1&p #( 6p Mn 1 |  ̼@ (, ; ܚ6@ Mn ,~3$ p1,1 tx6A y!8\ Mnu  "@~ @( X=  D @ (8| (c, ,6 X,( Y5| ) S- a: ]#h- Ec 5 ;TF 4V 2i :,v p|.l LX+(  J:  \5X  03` DA-0t)l6Dd@&S!<9,1N#;[p@i@t#w9LMn6x@:4o+\#Jm247(( 6 < D@\ (<"X8L71$Dd,=NMneH0r1k =8@35l / b"82( hw08%<@0Xe"EI(`Sc oMn)0 #Mn*9(:|<<Mn"u 3̋c ;C H\(`|S(`m(F!|}t0)6(D!0*o(\89Le ܾ5hMn6"PF dz0U<G:lЛ D75Pc  x-` x7P Mnf xc q %  Mn T x P9 < tO5| 4 1,!l;!sd )!&82!>0A!#W!o5dg!@c y!p5!80!,H!@0!d<!h0!o@!"!3p"2"%c *"|`:$8"=R"\) a"Mn}"4P6$6Ĩ=("4 nd "d0"2\"0\"( 6"h@+`"He<|"c ##'#Hc /#)Y1J)$ e [)Mnu)H7@)9)d=) 9) 5)6)T+0)0P7D)('@*N"\ *%0*4+*`]&8*d,PG*ȑ*U*d e*c, q*B:*c *`60*(t*c$ *DN3<k9*p}4@*Mn+L;+Mn/+ B+1U+Bz+F:8+{5@+`5 +tz#+,3)+Mn+W:PHc +Mn ,L"\,*P5,8:dB, c Q,$<_,Hc  f,xc0 z,#),a.,6,;,43,Ē4,Mn,,:-$2-D"0%-k-8-Cc E-28pO- =Xe-D5}-d -Mn-T!(-H;&-@-pg8D-Mn-9.0H((-0p`e =0t,O0R:D]0 e0д3q0+-08HXEc  0{#P052,0D@0.6Hs`c 0K.0@$0Ȼ:0MnG>1?> 1,<01[e A1MnW1A^1Mns1?3 {1`d 1,0p1U*H1p@\1"l1&P1X,X1 (23;T 2u#`&2;L62~9(?2'$]2m23y242:2H,P23X2,e 2\/20:T2̫72(c  2c 2`A>3 2t)3h-D=3Mnb3?3m3}"\|3Ԯ 03ȫ&x3,&c 30^9$323>,3:83L6\3l#$ 4`. 4R(:4e C4 24_4(c  h454d74;:46:l407!T4'<4140L;575`$<'5 7-T15E5t38N5('<]58hd5,c p5845d|5q;p5L!=,555# 5I@(5X=5c 5xd 5c 6H+T%6c h*c, *6x_9$=6@(H6:W6Mnp6(#t6Fe 6$,L6*c 68 69p61H6b:6|"c, 7?=7 z$&70cH ;7#dM7x58U7k:x P;xb7y@n7;Lz7Mn7=07Pmd 78@7c 7S=d7 67176 8D;X8J:@$8Mn58><8&PQ8D1b8<*v8H:T8'( 8Pv"8u#8, @L8-t80;l8$F88(22l8L0 9 '=H 96'9"419{;H94hV9Tp.h9 :ts9 e 9#(Appa& 9LZ"9tH&929@909P&9(+6:@c(#G>0 :L 6d:A</:.;\;:8TF:he U:#o:в2 :(U):X1:Mn:` >H:c0:0@:Mn:(8;P'0 ;Mn\=4; D;'( S;@(c;#\v;%D;N!h;;;X5l;+T; >\;40;@d ;o70<q.<.<#2<г,TC<-:\O<4.`<L@pv<$< "0<#<#<P* <4 X<5<Mn=61X = .01=@c :=5\O= @([=Jd d=?#x}= :=9=%8=2 =D(=~,= =$7=Mn>X=D'>l \.>+C>2 M>6$[>c k>,8z>Mn>l $>86X>(c, un >wd >c, >Mn>a7$> <?+H&?Ie 1?=Xxc K?:0X?5Xf?T#$}? 5?"@? $`?\=8?J ?ܮ-?Ie@ @Hz;rt;;L @8]78/@MnE@T6Y@e r@nd }@^5$@@@\B-@,9@@@@c @Hc  @S.@ AF1A'(!AT#|2ATN!XJAMnpA:pA @0AP%A 6A<AG6\A9@A, B% BXP.B T!B,66BKe 0Ep5 E@c  6s EH4<EMnEF9<'Fd4h(N@&c Nc NHv7hNC'NMnNH46NYd Nc OMn.O7=O+7XJOc VOxO!O0"c OMnODQ?8|Q\@QD(@QEc R|)xR"RMn6RHJe KR sc WR<7R5H A^Rd9kR#dR=0RdcD R$'9PRD&c R 6R hRMnRq"dRR!(L S4\)S '4DS8 WS?e X=fS4 qS[9|Sl(9SPP<S (S$@LS0 \SH>SMnT}4 Tz+TDc "T(4(5T(#ITy.xWTW+lbT4lT|$x3W5 tT8+<TMnT:,TP 8TL@xT XT5 V+VPCcp V (V+,V@6V5Ve V6,VP06LWMnWL"c 0Wk=AWP{<LWMnfWMn{W6WԱ2Wd=Wȷc  WW"W(c, Wt3W4"xW`9 W<X'c, X'p!Xm9@)X$=DX)=`Xc e48lqX><~Xc XMnXl@X6X,c, XT@X=(Xc, XH\9LYD0H#Y,]9 ,Y\6\9Yc GY5 hYMnY3(Y@Y@@Y7pYh4Y>=Yb,Y|-Y|6Y|#;p ZE=8Z &Zd 2Z DZ; PZ#0lZt4Zc Z<[8pZԴ4Z"ZL=ZC1LZ 6ZP6ZMn [c  [Mn0[`;`?[XA>Z[;f[/Ds[$[,&<[w.[7(\z6\2qc, '\~>8\7C\8e R\4%h\\P2lL 8_e |\"H\G]0md R]HL7`]u]@P4`]To@x]:]Lc ]3`]24]:X],q5h] 7^($^c %^\T<=^ 8K^.LX^5Db^`MnW`4g`Mnz`;`'`,`p,` 6`Mna `9ha0a 18.a-e :aPa #$ȭu9dfac {aTu6z <3;da$\a#-tap@<a$~6@a|:Da9 a7an-b'bt$,b0+b$~,`@bc, Jb Yb7kb5XbX=b$ +b7Hb hbHo7@bX%$b,-hTR"Hbc  cMnc;0c+6@\=,=ctd QcMnec(<ncP&pcpe( c$.cc@cy,4cа5Dc<\c(c dp'*d$=d#|Qd-e [d5 ydc  dHc  dL32 sX=d4Hdh9TdMnd54ds8d|J)hele er e+/e7<=e5Jea7^e?<ied.e ['8|eIe e#@e3<e`Q5eX*eN:e7e5$eĭ- fp'&fD50f4T@f0HIfX:0VfL2kfh24f&9lfMnf\2f#lf2fxd  g&Lgi,nd, Iih7[id#<xiMniH=i& i7iZ+(i5diD$ i7d jt',jMn(jLc 1jm1xFjc  Oj`jMnwj7lj"jz5 j1j?&j10jMnj k6kV; kp@;Ts'hs"Xsy60%:`e sB4s2;s>>Xtp#0t0\,t'x?tXq" Ttăd  et02,pt9`t*7 t<4tH.Dt=t9t"4@tlE=Lt"(u5( ut-4uS5 )u AuMn\uw4Iwر-Yw lw $ vwMnw(=\3c wl00w`J.Lw&Dw43,wd x2x 5`$xK7X5x8P?xl-4Px9hYx9 rx\&c x (.txYe x(2x ,`xP+Dx:x@<xX6HyD[#y'$2yT#(By`<Qy ;58[y,e08hy|=L |y:0yc JĨ=(y2Dy@y@@:8yY8,yc  y$9xy>(zd"$z4!z&P9zd Lz0c [z|n7hlzp8rz.,zP?<zY8Pz,s-Xz(e zP9zhYe zMnzMnz`:{ 4" {nd 1{)4J{@<X{Mnx{d {%{HH@{{P4{4[:,{6P{Mn{S)|Mn| 6*pkl?e -|!:| 4N|0(Z|6$h|<\:,w|Z:d|c |r9|2|Mn|7p|xc:|<$}T; }Y=g8,}P:#}Mn:}(|!\}T $l}=}} O&} 0}7d}nd }%pEܹ*}#do(+ }Mn}=3~,  ~(2~|M2?~Pi1P~\o'0j~@c E s~u8z~-,~$~ {,<~Fe ~Mn~L9D~&~̀-\~83, s6x@5(7@98I`3,U3T^"mpe |5@ +0:ll6Mnp@Mn46O/\md jȴc  rP<d $c P$8'3Bր 6=`dg#%(&Mn5.<J'b: lY4{;8!p#( (4|CLr8#p >Ё@ׁ h!5`XU8 $+;2*4=ܾ@U`J(t_Mn=h\-9ʂ{*\Hc@ ׂ)%)-DJ=Pe q'6Ze ?Pd8xJ<d30o%\"9p2%PA&Mnڃ"0@;0c j:x!0h5tN3diTt!0z`c$ h\)(<@`(9 c ҄("П3$ L&X <+d43l99,D58PX3]7! nD 04X8 qc  g<e  `х'5, ); 00Mn-DK(H=#DO=+4bp.e r:`}\6J)T /;D3Ն>5X lm -;TXld 2\c 24 G8Q-`5mp (u|8)@ 4"9, c 4 χn<݇(1$4P1* L1|c f<\'Xz6 6'(H&;U@,\X>6LiMn}<@d "<]:P,2ˈd( ֈ<P1 c, Mn &8$,&.&tB:N38aMnv+9u8<=(+`K"ĉ<#ى=\8<Pe $3d+LU8 ;83|An*QX7$[#1DnH@(~Fc  !<D=Ɋ{68؊4\Mn@j9h c 80p!P8x-2BD#pV+8fy!Px*;\c d1#Mnދo#$6PT+64 8 z.$+u=L8MnOLe Yv6Pg1 vMnĂ `"0r<ɌMn e x/tc, (3L;h(@8(/(<< 9$H<2[S0`f$=w;]!HA:G> 4"86(ύ><ٍ$x-ldc 24 4X#h0 4">Lr@V0@l^8d >$t A:~Mn6H@|+1ЎP7Mn45 :h(,e 6'c, ?+(H]e Swd a|= zMn (p::Ľ@<Ə:,ҏx5Mn3S$3,e 0%c Mn2$5Iq8lQ@<](D2nP&P</Q9Xp#0ѐM30,%7|T*_9$  -2MnR; ]|:i8|r;@` ܺ2ldG>0'`̝@,ɑ@(ԑMn =`:tS:30\:H#@5e 5|R!QMnu2}@;:`4-Q=̒Q:ڒMn 6, .t5$! 4"0$89d;`=8K$c W(m:Dd,,0v"H;Oe $'h@7Ɠ6 Փc, c, ;:hEc 1, pcT 1 (H=H24L=3\((k7huᆳq!T"8V8h{5$͔"H@0282X'(406H=A4NMneX*6@sb3h=u +6@1(RX"c ad@!iLQ!w8,P;4%c h508:ʖ$c ٖ,H@@c, D: S̐3l4 @kd W8&X D<x$;ID:dK< X_Mnwe Mn`)0[d —$d ӗ؎3#3+ \7H=<Mn(̄($`8544c >@LMni("c wMnH0;$X=D54Mn͘5ژod E-d l,c SH@x"- W><3,,t;9HF~>WXndH j+h=p 8H{4<_=4:ę02Hә\3ߙ(:34lx1,>3<h88P68_4uW*LW7t;؅ 4c, Ět,ݚ0$(c, U:Tt+<dG>0,X)c, 5#Ox8V0h_Mnyt )5|3( (8X=0<,Ǜg.@ϛ [,TpIe W+8- 4 4+@$3T8>i*M8, \Ժ@j@@~%LMn$)8854Ü(.\Мм2L744a-X7`lO1 ?Ĩ=(u!$/|O::&8Bc RMn|L0MyHI>4 6|x><p9ɝ:ҝ%c l4T/(\%c "! X6~,,9d6Kl%,[#xh̄ (~6$Mn2Ȟ2Ԟ!p!-a-,H>| 8c !!,xeL!c -#<tܼ3H?|X:P1,` 9 q,-tq9D-lC1TX"'c ǟ؉c ̟$6xӟ, e <[*x 6=T 5,&@62c ;+<H%VMno 9@@,8xo*d4< =Ҡ 2,0l,ě'8<>T3 &c 3IĨ=(Y;k9{Hk!p)!d;tP7(ơ4$ۡ;X=0Q@4 6(5L+h2<`@p0:hP90g.wP%c \-1;L%;@t Ţ82آMnY1 t $De /,:<D4W3<f@c tI$ @@%c 86p42bX=ƣ>!ңԂ"lD@H=\Ⱥc  #|"9c R@Yd \4"iL&c Ap3vN: |r'X,('ӤH=4ڤ=L@=L1_, 8)(|!6h2`+ <H6@K(XxN(8b|&$ p5,!445d<3p:1H*|.Xڥ7#4J"Mn5'L7\=`0:V6n$c |3ls"|C2dc Ħ6|զ"@"8 5l @1Mn5O44A\=)N2Vp@)Hbp 4tp-,(490d23,J.MnѧC>0Mn<"@X%,(6`68pk=Et1Y6g<<`T=H/9}.Ψ ݨMn0hc 6G>(+0s+,90#X6<@t!êL&ժ 54 Xxc 82$ c /Mn$8QԽ@m=={8($"4k=˫h,@ګ 9Xd,D9  4"(; <0@Y8 A,DO}6bHCc k0O LxMnMnr,(Mnڬ+(@$nd 5$;3P%58ؚ38B 5DQn9pZtd kx x.Mn@c 4@c ɭ$c ح e ,2L=$""1`+MnO#D_@c }c 46|5(nd MnԮ40ޮ X6|68|#<= Mn2RZ,8ix@ 0D@846x8ǯ\4Dݯ9L7 $6 Mn/0 .x c@ I*;Vm7`e" qp58,LYe  2H+ #Ű3̰\:߰Mn{: m7844_e !<1,(&c =(=JMneZ4Lnc , 8c .e @P5`˱?6 Ա~8x(s1 T1 4 -6@$5.\J ;$Fe B2(U$5\eD9s 3 , "xO1<p'(8$3вh(۲4<@>0 Mn/(9Ad:4J,WL8hMn$P& 6(;0+t5pųM-Tѳ 54g9tMnC!x(#4;hc  Fyd&c M,x;Y@.eX8tq<~M1:8c /tn Xc  Mn״"$c L:@l74 t H-h-$yc @`}%$LMnkH2x|,(;PC&P 27õ4"c ε:ص|.;Lֲ}c ؞=XD;0d+l0h @#D5T&c F-,Ufa:<p6 c l=D@@(%7pȶX};hٶtx1@0 c dS: &#@9 ; tF02XH8^H6j5$xs ^!c @<ƷD 94׷|9߷2Mn e =4 8I\6ZD >4t Xa) @9Mn˸5ݸH*c, <$45(G>(0]9TD(c, Knd a74LuMn`e  (l@DUD9;0v#ʹd ڹ' ܤ> (=4 X5"-x%X<8i5JБe R$,H]=@e-~{%H~9F!\7x k!Ec   6)(˺ܸ@ݺp#|P5 :d4|Xؙ<@O0Z0[O<\gP !dsP]2xe2d $4h O&û@ɻ(c, ׻#1Ě=0c |<7MnN0"#KPa& dD73y@Wh ~1d`.,2T+ # H28|hR:$t#<=4X =p S:P,r. 8 d Ic` TY1Pdc (;D9*c   4"36ɄB80D078 52b3x)]=H7 3Dc Y@`̣@i'( iԞ<|1#tk: e u  2(\.|-` (pb88!(<0$h:|c GMnYd954jTs%ړc, r=t"!t$(48P0=-6P,; +,1G">~,<S3 _L c o061 (,^=@;<(6$ Mn`,d  3!\Ȩ 3 k:C0HN,PX3j$.68t 8==!c 6d 3$<Mn r +@$X'c 4MnP4]1sae 9x|24 X;t=x =HpW=HMn ƅc |330TA" xU=n9ȡe 9T#D=`Q<X$d14@+  946:!500I7`HO& T0%H`D1<x4>*@4Cc  Cc !6*0du4t=(G$xT@t'(H+6D@$9Rz6_|=2xm%c |x=((T,X<1 {;h& e <.h'5@MnXe 84rW5,40e 8=Mn=4Mn]9$$1 !#t7H7TP=csc nH2zMn.;x̴&X@c 0`\;Mn 3 <4&c &,83(MMne&c r%,}Mn(G>(l!;X8pD79Y!`6Dx#`4"|.c  *$8@5@"mJd E0OV74\4g09PoT64}c  61@$>,P30X`:J(6e<8`{$( (ܫ9l/-=N6Z6)ppx*9\Ec 8!4Spp#Ld4p06,@ @h% 3L 4 5(: *t'Mn>de@ "H(C4@)L(@L95h`ld 8# $>,3(H5c 2`&c Ac MT!`^, Dw@2l5DP6lN= $ 22l̞ #(І4.608u6+.4h:4&c I$j=LW0954g14u`y9$ THr! |!Xs-4U,Xr1pMn^L:,xc ( e 8D<Kdk.\x#pl+0p0'dPy0Mn*x!@3=$P@=(m6h 5X+Xxz6  p*8 'c $sc D.P#+3 <C0O=i@<t{,Mn('6D4"0"L/l0;$49(=9MnW'mXc  S:T;uNG>( X:\7l:\ld 48  c Mn)c, 6md, $6XA?.(O8$Z; n\9LU!#h<&-:Tmd 4"/0>,ND"]61l&8A:TMnB+,T74)DX=H 5e 29<!(c  (;07$>D7\M9a$n2dq)9l[5d-Mn$_9T;<'!8;.d%c ?`30O\K (`5v$hĶ3(:{6'h@Q2=(hc  <+<06(؝''A>4C@Y+4f'c x6 d;30c 1` =e L3pJ,?Z"LN$ LfT4v=\.e h8dmd 0 (/P6 ;!x4 &T!X8%0D$.P dQ$"c b2<l<<t-4=E>`5pLc, U,`e <B6PO t4|C*t2l+-1At"DY87̝|:\j>rp%pX}8|55R7$:,|75  #)tMn%c  6,<&5lC4hVN68joe }4LW,H+r,<R Pa|:xjľ@`=@/68"@|56<I6\'c T-470D),d6?D@]x2DlL5$z787$:\M/hm96$Cc P 2<!9\p+t;!((:T2\9T9#T&Da0m (Ē@5e <9t :X #4d<<;Mn H$p؍e Mn0̉'HNMnsMn@|:,514t2c (v  9,2| 836@8t+#BȞ38XXYe bT10c Mn k.XD6|hc  4I+d}6@!5\/MnI(*Tؕ0`-*5 ] R10k)xc Mn4(8f<,P c @08 6dD2#"49̹(C]4P4Xj6z؜0d838,7` e \38@  c h%c 4=0 ;40|r6d*85Bc ~ :|V7X@g/ {8<(r@<0(4 \a5(t4D4%c MnMnM< ,+` ȑe (5@&DO!z444n74J/;xXX>t|7<x1,:9 @b7p$P- PBc V=,H@$@!4P.Ћ CW"pMĿc V$9pP>,z e =:X9c, l5 | x*H6DMn$@c :ȵ38K [Mnn0d hQ4P(,H-\4 O70tc .`@<D6 @H$s56=Q|3Tc06u,;1\܉%|$l81,<6,e $:Mn5he PR.H=(5 Mn#09 9-G$5<Y3(i J$${MnMna& ܕ7|Mnc   ~;8PW:$#`==51@K,7 W=q`[:#0o'Pc <)4<T1HA>$>dЃd c h6'$P/ "c ?6G<&@_k'twc 6)&,4}6@4@Mn%`X6 l,88'le 6,|;,C<`P;<+j#t^W#p>l32h[846,!@(Z1 s1K: 3T6,h:3t:l  40!Mn:|c M04X+d@#0|ԟ4Mn$060##)a&D51؋ |j!`T5,c ' +,=e<ND.W,;Pdč@~Mn:(0(MndE"ddK"PDX<<Mn/%=/HBcp W7e:vT+c l5G;Ԡ5P<4Ec Mn<C I"8aBe<8 4"pYe \e ,<$c ع@98(\ Mn  &c * 42 e : MnW $/a %=8y L  T-0 c   /( `(@ \6  {.X yc  c  t  >1* *\6 |5-K 07Z c b 'd w Mn 870 3.h d-:8 (Z!| @ x6  * 2L $8! ("2 4F:< 8+I T*h &` -  8 Ec @c \9 < $x h$H % " <)  !c 4 0X= \H"K <*[ ,;r `" ܁c |3 7 B-X 2 Ğ= lc, H , U+ Ą,H N6h. \-7 \9M <)d^ Mn ,9p x4 0; 8&$ 5g\=,  c W4p0$`e -L@@$WHJ$d, vN7X`5(8Q4l90c Hc  H#:z54@s6tĂ5 8#;@!e *X# GT*(Zhc  d'xE.<:\p/: d c  <4(8l6c zX29@ '2$ld ( 35MnO#`7p,L@/6,`9\0X4@ "4</6@`H(1<0z0t;).A6(9g2 J4XMns$"$;::|Mnx4 4Mnc d  9t6 *<1d$@c :;DJ(W=HP2_p;<ss-,Mn80Mn+((=4)c, Hc, H%T 5l < x9& f`S(:MnVȲ%a5w0!@Mnv9 (!DH Dc }3 6d Ь@(=P@x/6@ Mn6Mne,8YT77h 4}̏"<X68' H `x7 c Mnx#$1 -68Ĩ=(J.DSC0t_\2t {J=\d#$<,\3 |8* 3619XP5,;c  F<4UMno$6c, Mnğ&,5 8H_%t|.e  )D*|p4|##=\ T,[!/c A(0Q:4]\7<l 0lg9=:4"40 @)LCc 8 o-@05HAd W -!$dІ $tMn0l=ȍ9P/pe :,,= 0$&T#$MnN$4P`$v$ ($t,$&$@=$5 $ -$ ~6$*` %B *%C /%) B%4.8 K% x^%.l%,%t 6%Mn%~9L%l:%4%8'&? &'7&"G&L6X&5d&9$q9l& }&h D&8"c W(=4&l65P&0_:|0 6$01@0t50 c20= 1`91;41Mn51:A1H)-hO1c -"`:,c1I+,~1l2|1 2T1Mn1061= 1\11Mn2+@flmd 2H-t2@52e74C2h$ W2t[,a2=#r2Wd 28M!p2Mn2Mn280BZ:<2742,)c, 2Mn0>202 3l.3Mn43z6A3d U3Mnl3|6@z3Mn3̾@3p8*W< 3h13@#;<373([6x34045\4d )48;4|54I4,2LQ4h9PY4d1m4Mn4?34c, 4s.4l0@4xi.4?e 4Mn5L0c 5<0656,5x5:5p@xP53(\5Fe f58/w5A5 `685td 5#050`5W61 h6ܳ&{6x" 6k=D6t#<67866461\6Ĩ=(6|67X3D!7T%