08Pi'&<  'idP''`'&. &.i'&P@@<@T 08Pi'&<  'idP''`'&. &.i'&P@@<@TU i`'&.yAiiiQ$f iiiRAiiieAiiifAiiigAiiiAiiiAiiiAiiiAiiimKZ%iiiX`hpx$iii (08@HPX`S$=iiihpxP${iiicQ$iii (08@HdIAiiiCiiiAiiiAiiim<iiiPX`hpx\$iii$iii$>iii$iii$siii$iiiAiiim iii$iii $iiiAiiiAiiiAiiiAiii$Qiii (08@HP$iii $iii$iii$iii$iii$iii$iiiAiiiAiiiAiiiAiiiAiiiAiii{NIL5,5mz3 ެNIcaA6KgZS5ViYu2w_ifu1p9%5!}{u$"Zp aIDVKUlb&b/jU Y }'3&. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF@4V%4 (@@::""Z]Z]n$n-n-T ,,n$n-n-NetBSDKwGPaXUYSRHffffffffffffUVS( o-9s 9r[^]UWVSuZ(]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*th]9nUWVS(E@@9s{*3;9r[^_]UWVSrW(E u S.M <(9ME @E -t/tuEUEt E$BWl$4W o-9s 9r0"$ WED$E D$E @$膃$@Qn-9h9rX-4D$ D$ D$$1ɉL$V$MB$SW(5u1ƃ5$tЃt^$k_[SWÉ(4uYƃ4t|$^<$^kt(?t<$AktЃ_[UWVSh"h"hJ.K] A&1t:PYxOvhJ.j BXZ3hϏ%hJ. ] hJ.j AjOUEU MsMU HE]陁UVS1ۋݠC&tVPlZYu ݤC&C܍e[^]US脨Ph"hJ.x\hJ.h"蜩C& CtsPhב"hJ.D\jNUWVSE tuhޑ"P=URhc@5 T.諈¡$T. t Ph"j苪u#~b#]]ܻ#}~b#U#~b#WVSuQRPh"WE t#~b#RPh/"W u5$T.h="W1e[^_]U5 T. OXUjhc 5 T.؇ t5$T.hV"j躩1USRj EPS xU:t Shd"j\]UPEU Ph}" JtPh";EEEPhc5 T.= t5$T.h"j1UWVSSuE H1ۃv>PW ZYtC݀C&uދ݄C&Eh"WZY1tFEEPhc5 T.諆 t5$T.h"j荨1e[^_]USu ShΒ"j<]UVS1`D&tSP\ZYtFSh"jdD&e[^]UWVS ]u} Sh}" } ~Sh"}:}1{EFE} t!v"R1UWVS`] u~ uh"Uȹ1Rhc@5 T.E 5$T.h"jʤR.DPEU ЋU Шu>M9Mt65EE1EEEK>tt,uh"61}}}}}E뺉t9Wuh"jU9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4`D&5$T.hē"-Q }t*}uuuuM9~VQuhؓ"j1ۉ]Ek]lS\EYu h"j1}E1҉Uuĉu܋uu}}UUMMPh c5 T.ۀ u EX@1}Wud5$T.h"j訢EuPE4`D&h#"DPCE rh+"V^ElU9U|S.<ES.]"rt9U}I}s}u,@)1ɉMMf>hS.h$OXZCtCPh"$O_Xj N^CtCPCPh@"pO CtC"PSha"WO Cts؋C4`D&h"7O C$Ph"OZYuGcXEw1e[^_]UEDU.]UEU.]Uh"jUh-"jUhD"jѠUhZ"j UE E EE]Uhjjjuho"RnXT.\T.Uhjjjuh"'n U.U.Uhjjjuh"mLU.PU.Uhjjjuh"mpT.tT.Ujjjjuh"m`T.dT.UjjjjuhJ$mT.T.8U.WXuWh"j=SaY_u Sh"j衞xxuSh("]hjjhD&EPCuu뺋hT.#H t uhB" PhT.WPZ_hT.t(#=t hT.t hr"0XhT.ƒtuh"<t?%t4!t$t hT. hT.h"j譝&xT.e[^_]UVSPT.uX$U.T.(U.,U.T.T.;T.T.rgjT.$U.T.T.(U.,U.X=50U.u4U.E $U.)EU}t 13A}uke[^]Ë(U.,U.ut T.T.UhE&h$j蹜UUhE&h$j蝜UUSË@4URs(PZYts$h$j蒜S4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@u8uK ]USQ09s SUZSPEP6Vƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h"jțC4WPs(Xe[^_]UWVS]uVh@T.j>C4uu s(P(98jVj>$%8؍e[^_]UWVST.}t T.T. T.T.EUEUEU}uHjT. t?11ҋ}9׋M} ytEU`U.dU.E`U.dU.ut(jRP5U.U.P Bu@u 5U.h"MuShT.Ɖ 19|8uu5U.h3"/8t5U.h$jG11`U.dU.utTU܉EE܋UT.T.5T.5T.RP1T.T.T.T.1ɉ `U. dU.5T.=T.9}u;9uu6E9T.u E9T.tT.T.|T.T.lT.T.9}u9utTU.t%=XU.uXU.5U.hE"+XZU.t5U.hi"j)u}T.T.+EUEUT.T.5T. T.9uEr uM}u}tURT.)P5T.4 T.T.T. XT.\T.ut5T.5T.hT. ;T.C;T.7벍e[^_]UVSˋ |U.yQj h#RPVuVV7VShV^$?(e[^]UWVSljӃ=U.t%tPhЙ"h V7>h PV芞 =U.wwVPhؙ"F?w$w wwwwh"*?0wxw(wlwhw\wXh">ރ } tU.@tU.HU.pU.=ta=t=t+e=@u^lU."FlU.ݚ"hU. {ƙ"=U.t"lU.P~ZhU.UlU."hU. ?=U.t lU.R$hU.4-hpU.hhU.oolU.Y[pU.~4-?4-hU.94-}4-=U.t.t h"j諏5lU.h)"=XZd=U.u[4-h"Ph"P5lU.Ph["VVhf"I=(=U.th"j h"j h"%=h"CXGWO_)Ӊ+G(W,ȉ=U.!=U.th"hF&hC=pU.hț"hF&hDh":uDžF&t1jj@P%wpU.tM9މDžs,11RP*L1󋍤tM9މDžs,11RPd*L1󋍜t;9މDžs11RPww)1ƋG_RPPh֛":(=U.=U.t w[}ƅu+荃0/NPhh$hJ.6h<"&5A'? tG+]uh;"AV}FXZ1=V.tYjj5V. y#0MPhh$hJ.5h"q5V.V.V.1ɉ V.X5V.SjuH9uyHV.V.袂0DMPhh$hJ.(5hI"J@VE3^V.V.FV EUVwEUV.V.GZe[^_]UVS1ɉ >1V.V.tPϴ5V.D1҉V.YX1V.V.V.1UV.t*PNV.ZtP胴5V.C1V.ZYu%UjhhY.h@J.g2 tjV.V.V.V.U.@=uUSUE V.U.V.MU.Ћ] Ӊ)~U.@[]Ã06$F&1ølbXND: 0 &    t øUWVSӃu]1W.2W.W.@ujjhW.hW.thɞ"h$<Y^W.W.W.W.`W.)W. W.1W.2W.W.@ujjhW.hW.Pthɞ"h$1<XZSjjhW.Ce[^_]UWVSƉ׀:0BtjDW.u DY.C1 mCE @W.98Y.؁}ULQM5DW.3ZYMUuXs0>Phh$hJ.x&h<"&18Y.H8Y.t $Y./t1 @W.DW. 8Y.u$Y. u DW. KF @t.\s0=Phh$hJ.%h"1ttDW. !uh^$FPHY_Vu P"ƒ u$n09PVh[<&hJ.!h6"RuSRUǃ Uyl>!u7RYZy4n0K9PVh[<&hJ..!hN"P,R;ǃ=,Y.uWh"hJ.  tE)؍X؍e[^_]UWVSW11 DJ.yh@J.*=^u@J.P@J.s=TY.9 XY.8Y.؁}U|WQ-ZYUu[m0g8Phh$hJ.K h<"&m+8Y.H8Y.$Y.tjJ j! =TY.XY. 8Y.u $Y.uΨu١XY.uDY.1ۉ߉ uW.XY.0XY.PY.uLJ.@t?m07Phg"hJ.hr"*f%LJ.1PY.-fLJ.9t{t XY.XY.PY.މe[^_]UWVSWPY.C{ u)ÃEPY.<TRP Y^tELW.9HW.8Y.ށ}VR ,_ZuZl06Phh$hJ.h<"&)8Y.H8Y.t1$Y.tjtjk 5LW.HW. 8Y.u $Y.uҨu١HW.5PY.ljD s} us*ExtXY.M| thr")[oELW.9~VHW.8Y.߁}WR +ZY=LW.HW. 8Y.u$Y."%HW.25XY.NjM}t1s2PRd¡HW._YtD } )s!LW.9|X HW.8Y.؁}tVQZ*ZYK5LW.HW. 8Y.u$Y.svHW.Me[^_]UWVSQ]utuh"XZ} 9EueF95<-}hJ.hC%i^XP^w<\u7\>t.ˆUPh"-ZYUtF-"" /B000CL 1e[^_]UEH!$Y.EPhht@jSH x$Efv@-Efv<-U=W.uEW.E W.W.W.~9 1;X.~h%]&XUWVSX.}t~} t 9X.~[C ~KX.tIS P>ZYtF=DY.tj jvPjjjWutu19X.uh"%X؍e[^_]UWVSP]U u h%%XU19X.~BPSYX%KMX.uSwPux?]9tWsZu̸1e[^_]UE R.DBuh"%XPt[jX.t P&FXPPj/ƃ t9u =@Y.u5!5W. Z PY.뛃=@Y.u 5W.5W.WZYu5X.릡X.PP_XuPY.Hnt*ptlt PY.8 tK PY.̃=@Y.uu 5W.5W.Y[9X.;X.@X.=X.PRPY[1PY.Hnt*ptlt PY.8 t PY.̃=@Y.uW.W.9 RP>_ZBPY.Z=W.1Hnt@pt)lt1 PY.8 YWiSP+ h PY.뻃X.PP[^CPY. Znt1ptlt"PY.: PY.ăX.PP6ZYW.U=W.Uƅ=W.Uu h"W.;X.W.=W.9|9}h"pu PY.PY.Hnult PY.8 tσʃ=@Y.uPS?X.PP]^_PY. Znt-ptltPY.: t\PY.ȃX.PPY[PY. Znt>pt)lt/PY.: ^P5W.5W.1 PY.뷃1=W.\Pnt,ptltPY.8 tPY.σ1=W.u7uD-W.=W.H0V PY.wr 8 t ك=S<[t<\t.RfZÅu!h$ { uh"*[1C뵉) [.9=[.8Y.Ё}UtVW ZYUu[ A0 Phh$hJ.h<"&8Y.H8Y.t$Y.tj\jg5 [.[. 8Y.u $Y.uΨu١[.5PY.ljPY.=DY.tj jRP9e[^_]USPY.< u h" XH< u=[.u$h3"XJ PY.R8tڀ u ӡ[.PKXu1[.t=W.u P~X9j[.Yu(?0_ Phh$hJ.Ch<"&eK1҉W.50Y.S5[.)'¡[. t+h'hY.PR015[.1[.R]UWVSVPY.PPY.M1ۀx%u8HuzPY.=$[.h¡"[s9}ePY.PPY.$[.PY. \PPY.$[.2<  [.PY.M8 u$[.8Y.ف}|WRVZY= [.$[. 8Y.T$Y.tj8Y.H8Y.j$Y.U5 [.$[. 8Y.u$Y.[.$[.$[.e[^_]UVSVu] 1PY. u 1ۉ[.UPY. Uu 1q8u@PY.JπwE<1ɉj hPY.5PY. Z vm<8"uh"'1Zgu@PY.됸e[^]UWVS 5$[.][.=[.}+$[.;[._&M 9}y;M)9 ڋEE8Y.}RUuZYUu];0HPhh$hJ.,h<"&N8Y.H8Y.t %$Y.tj%tj[.[. 8Y.U$Y.uΨDϋ [.M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEW8Y.}RUuoZYU[.[. 8Y.u$Y.t [.M9u}EMELE B19uu)d9|T8Y.ځ}tVuZY65[.[. 8Y.u$Y.ad[.Cw9|T8Y.ځ}tVuqZY5[.[. 8Y.u$Y.[.؍e[^_]UWVS] SZ=DY.tj jsPӸCjPju5Wt 1E1 [.}t9U3 98Y.ށ}V5[.Y_u[80Phh$hJ.h<"&8Y.H8Y.i$Y.tjQjz5[.[. 8Y.u $Y.uΨuك=DY.tjj ] [.NjEpSP  9~U8Y.΁}V5[._Z5[.[. 8Y.u$Y.=DY.tjj S舶 [.Nj󤋅  ?u9Ћ)ȉË ؍x[.9<t ttjPjucTo8Y.=}tV5[.ZY5[.[. 8Y.u$Y.~2 u)u thG"HXDžS=DY.tjj S, [.Nj󤋅 [.f Qe[^_]UWVSX.W.HX.1ۉ]1W.+W.9UX.@X.P藯uu PuƃUX.PP[Z[.3E8Y.1SȰYu' 8Y.$Y.tjtsjX.t PFZPPjƃ t9]u 8Y.u $Y.uuEX.GX.E  Euh"XE tu RR x1e[^_]UWVSX.EX.E=L-t =H-uhb"FZo=([.t e[^_])e[^_]UPEEjEP54[. U:.h"Ph"hJ.)jUWVSf@8uVu1Q`/1҉hW3à ;/8#)tSWV? e[^_]UWVS} 54[.ifDž<Y.1҉uJhPj u.8.8th$-ÍjjP @ub.8thϤ"j/f8utSVWY y..8#Qh[%)AjWj9fDž=8[.t fDž9DžjRjI fDž9fDž94[.jSV @u-8tfu ftR.@ufDž=8[.uK"4[.@uσfDžftv@u KfDžMe[^_]UWVSQ}u VWd[ZÅuzjjXZu h "j-;s jEPWJƃ ?tE8thh"j-l,8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19}9xu90u,]9Xu]9XtyB݋EEEE19}9xu90uU9P uU9PtGA,Ck,QMu.ZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPY_}ËBt1UjL$qUWSQ-`[.v=@[.ڞv]=H[.]5T[.5P[.hե"j5\[.5X[.h"ju 5d[.5`[.h"jZ5t[.5p[.h"jB 5D[.5@[.h3"j'5L[.5H[.hI"jE$h_"jEPP$hx"j =x[.tJ=u@[.1 ujeY[_]aÃ=x[.tUE Puj( UWVS}u _Ph"jc3H[.B9tT[.e[^_]UWVS$ ]5[.t(V*$Vn0Y^ugh" j0Pu M& yWp4$M0ZtWVP u WhΦ"O5M&jj0։( y0h" jju ։ƃ A Wh VM&ƒ jjWM&‰ VM&h _Xuh"j[^jh h R(M&y RY߉RZ=t*w=bt%1=bt" =tu h>"11 Њ Јt u hJ"jYu Vƅ/ t jZV8 jZVPX fjjP% [.2tS SQPR(c%,9kPƉ4W8t t10hb"jE ^9s1BFu h"j 1e[^_]UWVS\]ƍ}ZE5M&(,%%048EPSUe[^_]UWVSĀ]p$tV9V/9Y^㋃p tVf9V9XZ㍅xP1RPuut5-9ΉЋt}"Q75-VPh"1e[^_]UWVS] }AƉI1RPuu2t C|WjVȃRP<tCuPhħ"jD71RPuu荺‹N tvkk ыEe[^_]UWVSTERELIu EEE EE؉1 t1҉Ƌ] ڋUӉe ƉߋEE$EȋEt\EU 1 t1҉E܉UEU}9}}}sE܋UẺU1}}t 9u9uEUẺUF uuuE,P# E =[.E ‹EJu EDEO1 t1M ϋEe ʋ}t}\SQE,#h#5[.Ãt#EhSjPVHt h"^SY`[.d[.E0P[.T[.E<1҉UEt E\]̋u)։]uEEIu E E1 t1WVuu诸9E #E1҉ t1EUWVRPz9E EEEEuűE,|"Eԃ Et8"EL0wEԋPatELhaRuuPh"3CPEԃP2‹EԋXX9t"ERQuuPh<"jE؉EEEE̋UЃE܉U1ɉMMMċEE}$tWW}9t }O]K}9:t ] [}19]9Muu܋E,!EujP1Eă1EEËEt@d9s+tNjuE‹Euu}OEJUEMQRPuEPE]tXpXjuL5XZ9u9]EE@]k,PuËEY^k,tԋUEVFF E܋UFVEEtP4@0P,@(FVEƒEt@P@ltȉF Ek,Dԋup(ut H}P$]GVEXE`1 t1u}tE]9tE}?Et\]̋u)։]uE‹EyJu EE1 t1WVuu[Puuh"jEtP @@1ҍMQRPuEPE0ju231ۋE;pEE9shI9uEtpp Euu܋E,ujP-EċE1 t1u}C놨u  EE]k,PuRXZu E}ȉ81EEE9k,]Kt[ 1ۉX]]u LL\HX M܋]HX]]tK0[4K([,HX]KH B9EutC E@ b]k,D$uu܋E,{ujP`,EċEk,Z(EiB$ t1EUFЋ]EEt  E}U}ԄtOO9M}1ۄt_9]u 9MGEt\ű})׋E?E9Iu EvEEÉ1 t1RPWVPuuSh|"jkE]ȉKEԋP9Ut,E:uRuuPh"j4E}8E}ȉ8}u}up[.t[.EE܋UẺUQEe[^_]UWVSuEP0F VM]_9EEr )ӉM؉]܋Fƒu]uFt 11ENjE9sPu h"jVN͉1+MF@UtR UR)M]E9s )E]1]9؋]sU܋EЋEÍEeM1SQRPpFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW#}EEPhEM&ƒyERPh"jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QYRPh/"1ɉM؉M܉<EPURvSOE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]P<E1Em}@[.@[.H[.H[.EЋUX[.\[.ẺEMEPhM&ǃ yNTQWPh@"0FPhM&ǃ yN"QWPhf"j$1eY[^_]aÍL$qUWVSQ9q[.[.,[.[.?1|[.[.1[.[.1h"VW ta#DtNJC7[.뷃b$$M&[.[.Cx[.C[.u57[.e57)[.R57[.@[./57|[.[.57{[.X7[.hJ.h"YXpC.)lj80hJ.h"XZ=[.x8th"5[.t hQ"jtjj)h "h+jj[_@u h"jj h "zhj00h"@P@ uh"t|j/SoZYÅu@i@[.׉hjXhjLj`$8[.P[.1urh "j/j [.؉8hDj803PtP3h("jW5[.HOG9=[.=[.tf95[.~W[.4!F_烽(ta1ۉ(,,9[. |[.d=[.tj6[.xrP[.0j[.dh1҉ldPh [.M&à t$8: ha"j1 1ۃ=[.*;,[.,@XRjPjj(($tLPhI"DXP 28rt)rz rz04z('JJ 04zh P&UP[.T[.f8ZY9tFS‰Yt"Ph^"j jPh"9 Phw"j` ‰Ju tH‰R840Ph"1 tH89s`u[1 t1+049Ɖы0|9Ɖ4}LV 9Ɖ4|9ء[.40[.<0X108014߭0ݝ0y11WVRP艪߭ M&ܝ0W=[.pݝta\P$V  ݅y؉RPh"M\`+EU5[.9Ɖ# >jVZY@݅u؉Ph̫"j[.ܝp pN&ܝ0 YLRjP011RPJ$01tZL9rKjQ#^X090Q_|OlaGl막9skQ k4 JHJZH XH J HPW4 |0u|0tGlDhjP8F8xuxuDPh"Y[, 1҉D<5[.[.8Hȉ9r09rÉ014840Ph"840Ph"j04 41119q09Ћ4N8JZ8<<u 8^9 +4i۷m۶R<8SPh_"DPh[.SW(~JFD\`HP\Ph[.W\DH[, X049Ѹ4}u01480Ph"1ۉ8Y98r;D\`j\Ph[.W\D𙋍09ΉЋ4}88SKut+4i۷m۶QRSPhɬ"kDPh[.SW$~FJ,TY8$D8t[.11҉VPh"B98~k,D$Aۉ<014߭0߭@[.@[.H[.H[.X[.\[.1XT011198t)k,ȋ0I9Hu0;0Putvt_|TRXR81RP褝؃RP10P @ 9|0,PQpQRPjW'k,Љ1;P}0PTQXQ8)Q t p룋Tșڋቅ}؋ቅ  =[.t 1P[.k,80$98p09~Љt$DPSh"pPhM&ÃQSPh'"j#tV:t&PhL"j,.gPh^"j,G$)08<11ۅt;k8tGpBu莮E[.-Xe[^_]ÍL$qUQ [.[.5[.5-M&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s ZSܭ [.X]USEPsH) [.[. [.H1҅u0[.Z[9t [.u[.u h%"jQX4CXtYZ@]UWVSu EEE#-[.[. [.M11ɅtJA9~ʳ9M}#t[.h9"hM&hhH"^}9x4u }9x(u9p$t버t[.e[^_]UWVS]uuu SO trNj@thj"hM&h1GGWX9w(~6Gth"hM&hhH"wVw G [^WY[.-;[.X=[.u =[.uBGWu[.GWtP[.WGtG4WPZWX[.j@jVjG _4E UG$W(G,W0wE #-G8[.tz8GC GtWP { _ Ge[^_]USEM Puh"hM&h4hH"P ʉPHPPP s E]XPs2H [.[.[.1ɉH [.H[..1ۉXt [.H[. [.H[.P4JH8[.9t!tXYX tAP]UWVSUu }uWVRcËECUt[.R[.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQM& RPWVQM&e[^_]US]C%CSjSZ1]UE UMQ1]Uj_UU P \.PYtHJ \.@ \.UWVS] \.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd誧C蜧${s舧 ]e[^_]vUWVS uE EEEE% \.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP^YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8j,wËEEC1CC]C'^C :f1C C$hjvEhjvM쉁jhjvMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jREښEpdϚuǚSIE싀}@u jR]^_}E UG(W,}x0xdEtFVtRP>\YY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u\.EE % \.S0tK0J4 \. \.C4 l.C(tS(P, l.C, l.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hM&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hM&h)h"@륋B 뵋EEP sEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"L}t/EEtP1uuRPh"]9]tSuuuh"uuk} WY[9t$PRuuhO"̨uW1҉U uEXEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPhe؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"֥C(S,C S$]9UrSPWVh"訥nWVh "蔥 Z}t5EtC(S,C S$9Uu9EtPuh0"T EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPReEuuWV?e9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWVd9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi"ۢ.uH‰?9u*_YӉ9u9u :9r 9r}thz"yhJ.VZYtFpVtFHuRPuWEU}t h"XtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"象$l./t `d)RPh"z tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jhE1ɉHEMAYA1ZA XZ1ۉY Y$XZ}th4jgËE쉃\XZu u =-ƉE} t h"~X-EPjh WVuh4jUgËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4jfEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS")}X@Et} t#h" }Xu uuS9u u茊X S胊X]tSn_13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhySXZ؍e[^_]UE Puj- UWVS]FHE1RPuu ~^t C|}WjuȃRPVetPu h"\ u~ 1RPuu \tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu/]€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh׶" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuQt C|}WjuȃRPV~tPuh"u Ep 1RPuuOtփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSX$l.t C0S4C(jj\0uu Se[^_]UVSUE 9| 19[^]USPPhF"hJ.ihJ.h}"5-CtsPhS#hJ.hjg[USSE] t$uhq#sqZY¸tr1EEPhvd5Dp.6 @u35@p.hfU#j]UWVSPu }t}~^hx2#SY_DžtFh!Q#S_Zt)h^$SڦZYth"Sɦ[_t뫿}}uh y$v蚦ZYuUEPhud5Dp.e @u65@p.hfU#jFe[^_]US}tQ,Shzd@5Dp. @u5@p.h"jƉ׃ 8t sh"C8"u:9shл"ryh"g1ɉj Ps q 8t s h"=豪8"u!Ѓu h"j誫uĉ}ȉM̉UЍ$Vhyd5Dp.跉 @u35@p.hfU#j蘫Vh6"FYXZe[^_]UWVSlj֋ 1҉-tUPQMkZYtUBMQh"jjhh@l.-s 5@p.YDp.@u5@p.h$j@p.@l.VWS5Dp.P e[^_]U05@p.hfU#jUSS}tE Xh#S赚ZYthۼ"S褚ZYuEEPhwd5Dp.p @uE ]UQ}tqEPhd@5Dp.: @uE O5@p.hP"WXZUS ..t .ȉ[]UWVSu.uӍ.u'B%zBB?R+B%zBB?zzJ}  ;u9tHk?9[^_]1.x@uUWVS։ˋ=. .11~B? ыE[^_]U.?.jh>RPbE=vu.UWVSQ5.At t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$R.1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉M..ÉEE1RPWV0DE)Ɖ1UQhX%UXZ}Ut.H9u.H99stBRWh"T e[^_]U塨-=.tvPh""T5ĕ.5.5̕.5ȕ.5Е.h+"T 5.5.5.5.5.hT"eT5.h{"UT Ph"BTh"Zȕ.̕.5-5ĕ.5.QRP5Е.h"T,h"Z..5.5.QRP5.h2"S 5.5.h"S UWVSQƉ薤1ۉjEPV >u#ËE8uj8"u w܉1e[^_]USޢP蜓$#Ph#Ph#Ph#PSh¾"hJ.V,j9IUWVS ÉM衔-uhU"5- hk"j׉ljEU}jؙ#E#URPQ BuAtV--=PuRH 3P5t.RH 9-uNE!5t.}e[^_]UWVSEUσ}u "}t"EU@uSh"MXZff=Ut+=\.t fuuSh"6ff=u%Sth"]6fLJ_f=Ut1=dp.u Sh"06Y^dp.tSh7"6XZj(VP? x0XŃ~X .t\fLJᵃVe[^_]UWVS9.u.5.d1Xƃ.e[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEa"E$EtEu"11}=-E..U1҉U܉E1ɉMĹEEUԉӋERPSQ>PE؋UEUuuRP>RPuuЋE؋UEUuuRP>RPE؋UEUuuRPr>RPuhi"fO,"uuuuuuuh"BO h@J.jdh.4 u h"j7h`#h.QY[.]슀.< <$u { Ћ R.DQu<-"j EPh.3Ɖ׋]h?&S臬E؃}Ph"S脰 tuhJ#So t I =-Ήʋ .1WQRP#=Ɖuh"S u` .ω%.ƉuuEt5.1Et 5.Et +5.Et +5.EÉ]h`#S\PYZ؉E8 t,h.Zƀ.uh.h"pM 59uE|E9Ɖ]}.uuuuWVh"8MuЋ}u}e[^_]g_USE Puh"LDJ.HDJ. yh@J.lY@J.P@J.؃ t7@t( DJ.y h@J.lZ@J.P@J.h"j褞1Y]UWVS M -u h"jqƉ׋-ؙljEU}ؙ#E#UƉjRPQ|Bu @u--uhuPA mR5t.P0B 9-uUjWV5-&|Bu@tt.KE!ÍNju5-R5-@ 9-ue[^_]UWVSRá.u ƀA Mz΍. S}8PR9 . e[^_]UWVSEыEU u1#ˀ Ɖ+5.u}};=.}=.&"EUEUE9 ..}=.Euy.KlE9t 5.tމnʅu+.9UE}M1E܋E9E܋U}t+}t}u w{ƆoK"v"ȃ[^_]UWVS EӋEEh.@Ph.E 5.t h"j轛E9E|E9u|.] }) VRP75.31fǂU }u@.5.֋M)}CsKSCPKSs FS.Ee[^_]UWVSEU} u }7M] M]9 .ĕ..19UtWtN}1E9ϋE}79}E }&"=.}u1BuEP.]Ã}!؉˃u=.u =.t=.Y}t. }mhjW.[^u hN"jlfǀUE.EU ..EU ...t_}t E .Hu.=.hk"YS".=.;..EEU EUEUMxa] .tEV1;uE |9EE}=.}tEt뚃}.E 9.u;]t~.H.1+]9~ Fu%uF PPR3 . *.1RPEU .+E.XZEU ..EU ..>"" -""e[^_]UWVSË@SuHt+5.=ĕ.9u9t h"})Y^sǹ󥉍1󫍍@u({u "{t"Ph"詭XZߋe[^_]Ã=|.u x t!1UWVS|Éסԕ.tP1XYj/S Y^ZuS5-hљ%hԕ.2J S0ԕ.Yԕ.u hN"jjPB:XZy5ԕ.h$^XxPSNlZY@tϋuи 9E} 5ԕ.h"V 5ԕ.h"Ah ht.S9 9t5ԕ.h$jY^4f=v.Ut5ԕ.h'"'Se:ZSN:Xtj8e[^_]UWVSát.u1Ҹ#V$t.f=.uf=\v.ut#t..t.\v.f.fޗ.U.1tޗ.[^_]UWVS á.fE򡴕....11t;f}t.E .16t.t9r $uf:t@9Ezti 9tܻՋ p.t.u$f}u=q.ׅu q.4=.t u)h9"%Y t.uh9"h+%AXZ=t.t]f=\v.u1v.Ѕԕ.=.tPhn"%_XPh"ZYt 1=t. =t.uLV%tz%1gt.tp1v.҅tSP5ԕ.h"!%=.t!1f=.u1 1v.q."5ԕ.hK"ZYu #V$ve[^_]UWVS ˃uu Dž" Dž"@uhh"ZYߍ1jh"S` t 1/9Cu苅9Cus PjXA ;Cuă=.t.{ t(s$s sh">e[^_]UVSPE-;-u*=\.u!URhmdPn y h$X.11@uh"B=t.u111Ht.~ فt.@uh"虧^E.01C;.}. ...@uSh"SY[1҉U-;-u*=\.u!URhmdPn y h$Xe[^]UWVS(ÉEU EUE؉u=.EA"e[^_]C11ɉt<u ȉh%jhh`P&P4$&tPQRhJ"< fu1k t Ph#hY"c<WVh#hn"=<u =-RPSQ*Ph";Y[=.u! .9u )ȃ11ɉ=j-:j):XZt1.f}Ut24"J "Ph#Sh1"r9EPh{"c9~uh#Sh"F9 =.x@9uHh;&jjPR=PRh"h#Sh"8(R MZ)uh#Sh"8 6)uh#Sh"8 ƒ< h=.[`p.Mh#h"B8 @ tSh#h3"7WVC$u`p.vj!RCXUhN"j詉 "CQh#Sh1"=7RhY"+7=.xx4"붍e[^_]UWVS=.ujjju u.B=.t+5. $ֿ#uVWh;"6 PVWhK"6VWhZ"v6 EU RPVWhk"V6PVWh"B6$%PVWh"6PVWh"6 ?PVWh"5%PVWh"5 PVWh"5?PVWh"5 e[^_]UWVShEUȉM]t'BuUE$1ɉM$1uuuuE.E̋EȉEE #1҉UUE.fE9.~5 .EE̋E,EUE$1}$&E$1ɉM$1uuuuE=.u(}t"uPh"4uuUEtuS&}t.Efu ukE }PEPk Ex.}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u.E1E EU EU}}E̋@ E1E}.ĕ.+EU EUE}5.=..E.1҉EUġ.19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡 ..)9E]| h"u}ĉu} 1E} lj}.1҉EUE9EE |K} u}t?1@.t&.19M} |.9M} |1EEUEU U.t4.1ۉΉ.9u} }9M} |1}E}u.9EE ĕ.|=.uh:"/8^1>E.E }uEEjhjjjщ¸H"E .EuE1ۉ]]]] }t# ..EU...ĕ.EU11ҹuuRPQUM %FEU+EU ;E}EE}]u)։]u}tq=..E9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령.19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu hN"}u}tEEM9Ɖ}uM..1RPuuҋMu 9tۃ}u E9uWVjjRUK$EUEPuhm"hv".h@J.jdh.Xu h"jh.+oYvEHƀ.t'. t9EEHPh.h". uh.EPCD EUĉEU EE}tjuuu uUEKjuuu uUE.tuk=.t Ph$jSPouN}tjuuu uUEjuuu uUEYt Ph$j}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE .. .;] u1;MtuuEU G_Z .UׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }PB 2=.t h" YuEft=.|=.h"Z\E̊@EȋE̊XEȍE@‰.p1WVjjj" E1ɡ.p1WVjjj2"Ã(Uȃ?1ɋ5.1WVjjjA"}̊MO_U? ˆWGEȊ_EȍG‰.p1WVjjjR"xE(1ɡ.p1WVjjjb"QËUȃ?1ɋ5.1WVjjjn"-}̊MO_U? ˆW(}t/=..t Kx .u}ˍe[^_]UVSá.u h|"0X1ۃ=.u Sho#*Y^jjڸ.CXZu҃=.u=.th"q0X1L=.th"u Sh")Y^ .RP1҉XZ=.tC.9.A=.~h"i)5.j5.5.RP믅<f=.t3h"/^h")[q.t=h~#(r.Y=uh""k Ph"(XZ hv"(Xh%%9/X=.nPh#"(Y[=..PPh?"f( j=l.t>u Sha"I(XZ9.} hz".X;_ .RP1҉u Sh" (Y^jjڸ.XZe[^]ËU{wPh"hJ.o+jUWVSĀ|xtH.wSh@"hJ./+jSa3EZuhX"+xƉjRP|W9u9thj"L?jrSu| 9t"xthu"h"?Xj:1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4 V&h"G&.fEEE . .19E~[tP9}u1M;u&}_PaR.4 V&h"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaR.4 V&h "^% }9sf}wfE@f.u4 V&h<"%Y[|}tFaP4 V&hh"$ ttt111E}.}....fš.E]9]E@ƒt<u.E}tхtu|EZE]9]uun8XEe[^_] J.yUhJ.j )XZáJ.PJ. UEU 19s f3P]UERPZYUSBHBy;B| X RQ)XZ]UWVSQ]u uh'"S'F fw4W&h"Ph."S& FPjh8"S&FPjhD"S& Sh9%&sXZFXt ShQ"sY_FXt Sh\"sXZFXt Sha"sY_Sj Z v(hj"Sf&v,h|"SX& v0h"SG&v8h"S9&v4h"S+&$vS6EXZEE FEe[^_]UVSSPPVu ujVSh%$,@uLznt"t"dn09Z"t"PSh"jRoj_UVS]u VS9YZu Sh|"jQo;/t"Sh"XZu E"e[^]e[^]UjlPh"hJ.^ jUVSPh!Q#P [^t,PjPuVV?t jP]ZYS:Xe[^]UWVS EEu EE}]EEE1҉.2&1ɉ ..h"VuL NtJb$Y&1=..ě...뗡7.jWh Z&57u h"jmPYYț.JpC.4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP>HXZt1h$9}P\ZY uċ2jWSh%~@uLQkt"t";k05^"t"PSh"j)lt@t.Z=.HDž"=.tDž".t 2$P=ț.t %=ě.t "=.t $1ۉXPih"hB&jykSh"h'"Vyu h "jJkj/G P.ZYt|# -Sh"h?"V"tj/C P-ZYt|,X1e[^_]UVS]u VSYZu Sh|"jj;/t"Sh"XZu E"e[^]e[^]UgPhW"hJ.j@=UWVS]E1҉ 11ɉtp1h"u u@H athg$`[&57ECpXDžp57CtX57=CxXDžt뀃K|wK|njuh[&57u h"jiiP:_:pC.P;UtM |u4uWEp ЋttKxPWZY@u Wh$jGhptECpNtECttt E%Cxe[^_]UWVS SVpPtWu u1hWpSh"z,@uSVh"jGZhr@t@1RPh[&hS@Sh"(j USP]jEPS5U :9uySu h"jg]US]SAZt@ h4#SZY]US]S Zt@ h@%SsZY]USP]jEPS衃U 9t :uy Sh"jg]UVS]u VSYZu Sh|"jg;/t"Sh"XZu E"e[^]ye[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RPY^CSt RPY^CS e[^]UWVSӋEU ΃tt RPEY^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]UWVSEUˋuE $EE tH$HD11E ~E}ufCRVڋE E lWVڋE E }t}t#RP7_Y`}tDɉ"%XZ"t9t h\"$X9}+uh"$^_ދ9|<t h"$Yh5.h";Džx ;rh"%$XZu8u t h9"X 11  ˆK1<1P1HL@DK@#_tM⋅9t Phl"#Y^Ht2{{ @D0{{@D}"Zt⋅9t Ph"Z"_XzG1t{${Q!^t&XZ$t CpStCH\Ɖ)ULƒu 1Ҋ t1҉RP0@ȋ+tC@SDC,M)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t Ph".^_@ tFC8S8tGpBu Ex.-Xe[^_]ÍL$qUQ p.l.5h.5-M&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s ZS t.X]USEPsH) `.d. X.H1҅u0|.Z[9t .u.u h%"j[0X4CXtYZ@]UWVSu EEE#-x.h. t.M11ɅtJA9~ʳ9M}#th.h9"hc&hhH"h(}9x4u }9x(u9p$t버th.e[^_]UWVS]uuu SO trNj@thj"hc&h1GGWX9w(~6Gth"hc&hhH"'wVw G [^WYX.-;t.X=.u =.uBGWu.GWtP.WGtG4WPZWXt.j@jVjG _4E UG$W(G,W0wE #-G8x.tz8GC GtWP { _ Ge[^_]USEM Puh"hc&h4hH"&P ʉPHPPP s E]XPs2H `.d.X.1ɉH .H..1ۉXt .H. .H.P4JH8x.9t!tXYX tAP]UWVSUu }uWVRcËECUtp.Rl.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQd& RPWVQd&e[^_]US]C%CSjSZ1]UE UMQ1]UjiUU P.PYtHJ .@ .UWVS] .C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${s ]e[^_] UWVS uE EEEE%.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8j6ËEEC1CC}CC 0!1C C$hjEhjM쉁jhjڻMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE Epd u S IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPHYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u.EE %.S0tK0J4..C4.C(tS(P,.C,.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hc&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hc&h)h"@륋B 뵋EEPEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"/}t/EEtP1uuRPh"]9]tSuuuh"uu } WY[9t$PRuuhO"ua 1҉U uO XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPe؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"nWVh "w Z}t5EtC(S,C S$9Uu9EtPuh0"7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRP\EuuWVI9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi".uH‰?9u*_YӉ9u9u :9r 9r}thz"վhJ.`ZYtFpVtFHuRPuWEU}t h""XtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"İ./t `d)RPh"] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jE1ɉHEMAA'A N1ۉY Y$XZ}th4jѬËE쉃\XZu u =-ƉE} t h"X-EPjh WVuh4j_ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4j荫EEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"3X@Et} t#h"Xu uuS9u u X S X]tSx _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWh4SXZ؍e[^_]UE Puj- UWVS]FHE1RPuu 舣t C|}WjuȃRPVetPu h"\ u~ 1RPuu tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu9€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh׶" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuu螖t C|}WjuȃRPV~tPuh"u Ep 1RPuutփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXİ.t C0S4C(jj\0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRPҖ e[^]UWtBRBR t RPY_}ÊtBRtUWRPWY_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRP苕 e[^]UVSuE H$X(1y9)tNp1SQRP4 e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDž Ep 19}5uWSh"N EzBD1H)CNjE_dE@ EDžpđ-pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G``E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hdd&h("jEÃd$S\DpTtt RPzY[B^UEMhSQEjXZSbdtuuzY[EUEUDpTtM]19 }9Erp@dxÉ1 t1RPuu蚇1E URjW1RPVEEtH`Xd EH@E_Ή)׋EzEtIu EEu1 t1RPWV1RPh"E‹EE@ EEEJEtp`xd @@ƉEӋE‹E"EE.E؋EE)߉ЊM1ҊM t1RPWV7]K!E؉wEtp`xd @@ƉEӋEB‹EE܋EcE)߉1ҊM t1RPWV軅1uk]ӃK 1;{E@ r EFE@4uPEBHEMQjPjjRqt Ph"k[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋E1MIdQ}u}u E M̉H}tZCr{<uX.C`.d.C@CC sh'"hd&hCh"jS1[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋENUr,z0 t1EtpHxLp4İ.6AM̃HEEЋE1RPuu sƉ׋EƃEۋMtEPjuރWVQtPuh" EEЃE̋]s E1RPuuWq€}trzuЉ}#Evkk BEEԋEMq,y0 t1}trzrC4SPZ}u }u1dE ]Ћu)։]ЉuԋE‹EJu EjEu1 t1WVuuqEЉUԋ}ЋEFHEËE1EURjS1SQV]tPE1RPh"PEf‹Mq EJu P! 1k}t)؉}u"}uA1 rEF1ۋA r EFA4QPX؍e[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVoFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh@"hd&hhe"MЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuha"htd&hh"qGuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQQmӋEE}tEEPjuȉERPu"tOPQh" EE@ EEH1ۋEtGW SQRPk*EEG1SQRPlk}vkk ]Gju蕦hDuVuhDuVuy(hmFuVuehFuVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jLpƉ<WpFYZuWhx"1= .PE fF81FF&YtOZ]hhB"Pƃa#lao1ɋu1҉ijh$Pʲ cj2WV62 9uE1ɋtWuhG"U PPh"VuP Z;v.Phh"`UaPWh"MU@Aƃaa9tRPPh"Uƃa'YB#a^u 1ɉ]uh#"KVhVV uVh"T ^"j2P2 9~#1ɋKthP"YXN#Zt1CZ9{~`1ɋtWh"oVhPÃ=P.thJ.h#近XZCtSPNfc_X[u릾1;5(.,.WV ZYuыXtCtNPPi% xu SbjSXjPPiPfc[룍e[^_]UWVS=P.thJ.h#ِXZ1;5(.,.sJWVKYXt3fSЃfC{u ЃfCft h#SPXZ[Ƀ릍e[^_]UVS]S^uSh#hJ.C 1Ouu Y[19Åt 9t@uu hC#$O ~u}t h/#V!PXZ؍e[^]UWVƉjhRP'.t9xu9pte^_]UPhX#1ϏZY8u"h|#h#5.h#hJ.FBj4UVS@fC5.=~D.)fļ.5.jhh.THt -X1.1CPS.P,5.C𣤼. e[^]USjjj0`n+CC]UWVSƉӉ9tR)ySh#hJ.ZA j%RP6n^thF P63F e[^_]á.t#UPju uSHt -kUWVS =X.uu 9uEfftcB1=.tf҉jEPWRW4}Yf E1;] }߃=.tȉGffG=.t?t=.uGGG%)ƋOu9rG9=P.thJ.h#XZGt=P.thJ.h%#ɌYXGW9s=P.t+PRh?#hJ.e?=P.thJ.j 3$XZ?te[^_]USjh -2Y[th 9G Zu S2Y11҉P]UWVSX=P.thJ.hg#^_5.5.5.h#hh -9@.߃Y[.uh -h#j趌}5.5.5.h#hh -8@.߃uFhг%PxZYt1;=(.,.r%=T.@ mVZX=D.E}tPuPuS+ uS+EZY~/9jPuSjSh#h#hJ.3EPSEPSE=.tPuuuhet%S#E PS*Y[ff~ uC Z5.MXe[^_]UWVS}E U9ÅuWuu h#!?hhW%ƃ y@Wh!#hJ.2hJ.M0J Ph(#hJ.2 1S ѡ..0f)Nj[Yځ~RQW$ @u55е.5.5.h#hJ.2^0J Ph#J=D.uURQV]# @uG5е.5.5.h#hJ.10I Ph- #hJ.1$j$$%W_%VY%XZe[^_]UEU ]U:= -#tjjh -(h -y= -#tjjh -(h -UUWVSƉ׉˅ut;5(.,.rWVh #= .RPWV.s{ S$=T.t [$t9{ u9suh'#S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh6#P=XZUWVu} u1tC;5(.,.s..RPWV.t;x u;pt@$e^_]UWVu} ut;5(.,.rWVhW#; .RPWV.t H$9x u9pu 1pp P$WVht#; e^_]UWVSujj[_ÅtJNJ/t tF@PW3mZYt [u Ft[ 1ۉ؍e[^_]UWVVj/PϿ_Zu1,VeY/txtEVh#:XZEe^_]UVSu~.F.9s%)P6SLjj&9tC/vKSh#:XZ؍e[^]UWVS}u h#j:[ujYƉ<.uE5.=6 Zu h#3:X). .9r ...uS ؍e[^_]UWVSu.uE5.5 Xu h#9X.Lء.19r _$(uËC$. 1ECIDžuQ}u} ujjY_t Vh#@9XZVVi_C[ٸ1Xj/Vɽ^Z@PPxiC{G C_ Y^Et5uu YZYƅu h#8_E UCS FC^5}u} t)uu ZYt h7#8XًE U7؍e[^_]US]ShZ..]UWVS]f{t hH#SG9XZ{u&{t h[#S.9_X{ t hx#S9Y^CS utcRPl_Zuh#S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h#S8ZY3.C$.Xe[^_]UWVS]E 8ƅu h#Sa8_X9stsF C^ j/u ZYx3WƉWgC$19VPtifSЃ߅uЃ fCe[^_]UWVS`=P.thJ.h#wXZ=D.(h^$u*^_u,w0JB Ph#hJ..*uh#g6fc 195(.,.rIMWVZY‹Mt,AEJSBPj2Uf<UR̓1E1}E9(.,.EuuJZYDžttj$GPEPPuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP;눃EUU1 .9~(.1tBESjjEPl;G΋E E̡(.,.EUMԉuС .$.E؉Uܡ..EU8.ESjj(EP;C @t,u0j@ Ph #hJ.N(uh#4S CXe[^_]UWVS=P.thJ.hG#>uY[}uXjj5,.5(.1.jP4 ._Zu ha#4^jjjh%%fHwjjuƃ y,t0? Ph#hJ.z'uh|#3xPVLY[y,t0W? Ph#hJ.;'uh#t3EЍXjS^3 XZu h#Q3YSWV y.Yt0> Ph#hJ.&uh#3j(PPV xV@.Zo`0+ PhX%#hJ.jjؙRS58-?Bu@t…=P.thJ.hq%#_[_=.u <.@1҉<..PYct8. PVh$# +hh.5.V0 .h5.u..@ .e[^_]UWVS8Ã=X.FC=TtP=ltIʁlt=Tt1#=.u$=P.thJ.h%#^_X.t=.WȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPZYChs,s(^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉChJ./ .HQPy P{Y J t .Hy PXZ J: t .@ t1yt nw1y]UE PuhJ.k =L.u(h"#{u2$Phd,#hJ.sht,#hJ.S8E E,#]UVS]s s:Y^1t 9tF@h,#SXZs sVh,#h,#hh.N.e[^]UVS]C t h,#ShXZfK SnPVS3S\PP-C$;PV$e[^]UVSu~t h,#VXZV X=D.u8hStZYy'fN@=0w PSh,#hJ.Z=P.tSh,#hJ.< e[^]UWVSuj/VZYDžtDt>hJ.hH/#b4- CtsPhS#hJ. hJ.hq/#)4@-XZ CtsPhS#hJ.hJ.h/#3jMUWVS]} t~C7hx2#VO%YZt:h!Q#V>%YZt-h^$V-%YZt#h"V%^Zt1 @uh y$w$ZYt|1j}Wjj5 .e?E? EEEPWS5 .5$e[^_]US}thjEPjj5 .].?wPh/#XZ@ڷ"@t#RPh/# ڷ"y#P5.h0# ڷ"}y#P5.hH0# ]UWVS(}tE 0iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5 .e[^_]UWS}t&]U1E5jh'jjjS5 .e[_]UWVS ]} t~7hx2#V"YZt:h!Q#V"YZt0h^$V"YZt#h"V"^Zt뮾 1uh y$w{"ZYt|1j}Wjj5 .e?E EfEEEPWS5 .$e[^_]U }tjEPjj5 .7M.ʃuPhu0#zXZB#tڷ"RPh0#[ ڷ"Et#P5.h0#7 ڷ"}y#P5.h0# UW}t?U1jh'jjjR5 .}UWS}t]U1Ejh0ujjjS5 .Ve[_]UWS}t]U1EEjh0ujjjS5 .e[_]UWS}tc]U1Ejh'jjjS5 .e[_]UWS}t]U1EEjh'jjjS5 .me[_]UWS}t]U1Ejh'jjjS5 ."e[_]UWS}t~]U1Ejh'jjjS5 .e[_]UWVSEEu +EBU܉EP XۋUu h0#j.1ߋMEfEfS1j EP6 U:t6h1#j.TTdDG9}ujh0uuSjEP5 .]e[^_]Y UWVSEu h Zu h*1#j.1 1ۋ9}J jQh"@ ujQhI1#! uCu 9}OjSh% ƅtIjShO1# u'jShT1# u4ƅ7fDžjh0uhj P5 .ƅx9t h]1#V脿YX$t h"V;XZt#t h1#VYXhI1#VXZh1#VYXu h1#VXZV5.5 .5.5.h1#@t6t`f@fÆh1#V跾Y_ \f@fÆh1#V舾XZ6-f@fÆhE2#VYY_u hv2#ZESh#:Vh$/pރV׃X9uEe[^_]8 e[^_]UVS ] }t%3hb#V1ZYtḣ%V ZYu E'j EPV/GE U:uy 3h}2#Tshb#VZYtḣ%VZYu E-j EPVFE U:uysh2#jO*EPhU5 .k t h2#jS*e[^]UVS ] }t23hb#V>ZYtḣ%V-ZYu E'j EPV1ʍu1ɉMfEEE'E0VhQ`5 . @u h3#j$E<u 5.h3#<u5.h3#hJ. ~<tP5.h3#hJ._Pu󥀽_y-`9j&CSh4#hJ. j RZ<h4#Xe[^_]USUBBPJ R Ph.4# uE74#]ShN4#uXZ]USUBBPJ R Ph.4#8 uE74#]ShN4#XZ]UWVS } 11;]}#j4hT4# uCPQ1󪍕JƅPƅTJjh'jJRjS5 .QjPj!gW,jPjAPjRjVR VRPW5.5 .5.5.hX4#  oQƅRjh'hVjS5 .ffЃf=v1RLhW* HLRhW LHtmQƅRjh'hVjS5 .ffЃf=v1RWhWh4#Whg$LgQƅRjh'hVjS5 .fff=v1h4#?X1G9 5Ct9C LHD04k&h-&h%J {y0L%`vRh4# 4k&hϏ%YXD4j&h #XZ1ҀHu6C9s!DLPh(8#LBYXj XCPShSS,e[^_]UWVSEӉʋ}EE]@k&qtE8uE8At;ˀ}@utQhT6#WR"QEPh{6#WR WVR), e[^_]UWVS@EU u}JvXuW4@q&V+ u.MP @ j@MQ4@q&h%WV;~xPw(t|f@Ph6#qf@у@t%6#tC#RPSh6#WVT6#tC#PRh6#WV3f@Ph6#WVJuP @ W.X1e[^_]UWVS]hpVjSPh7#x{vTh7#eY {yj h#7#MXZ,C@tPh87#5Y_,C t PhH7#XZCȅt Phj7#_X{w j VCȅtPPh}7# S C h@Vh7#C t Ph7#Y^hpPjSǃt Ph7#|XZj X}it;} } <;u GVh7#9YXujh8#&XZjh8#^X79tR;U }MuRlh8#ZY1ɋlhlPh$hAlBXXhO#2Xe[^_]UWVS] }uh 8#{^X1C9~D3Ph'8#_FZYj tX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u% @u h3#jEtU.<uRhN# <uRhO#hJ.3 #<u jSRPRhO#hJ.j蚾e[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt32uBIttyt ut< }]9t` y_v4m tN\ 0H2N0H2N0H\um tf\\M t@BX[^_]UVPh9O#hJ.JjټUhwO#kUWVSÉ֡.P.uhh.YY_.hO#hO#hWh^$WY_ZuhO#PhO#j] <.u O#t#h.RPhO#t1X9ډ}Hh8.]F $hO#B .Pjh.k;9}4u # }u Rh!#(XZ`.EH~}tj /Yډe[^_]0ƒtot/U׉U}u' r2s4Rh"&2U׉U}t RShLT#\ sRh9i$Rh#膼XZGU׉u}}tWVShST#^ s WVh0$WVh ]$> }uE\T#e[^_]"E e[^_]0}e[^_]Ã=l.tL.URh.4-haT#UWVS=d.uhT#jرj=PY^X d1Dž\ Dž`hj`Ph.\PdPST\@uډ7=X.jPDž`1DžNdX@DŽdj`R`PPVdP~ @u! 0C Ph.hT#Buh.hT#iXZ&l. p.uPh.h[<&I e[^_]UWVSSE}u =l.3˃=p.u=h.(=h.tBhJ.jWSu5Л-Rh%ʹ u Rh!#赹XZ`.~tj 轸X؍e[^_]u E rM19}V=`.tUPh(8#YYXUt.=`.uUPhT#5XZUBSWh"! NuE\T#e[^_]E e[^_]Ne[^_]UVS]=X.t EhT#SY^uEEY 1҉jEPSEUE 9u%SuhT#\ =X.j|8u? 8u̸]1PSEPuVuu @u1_t =l.1h. `.u}u}tPjUEPj T#UEmY^tFh. `.u}u}tMjjUEjj T#UE#XZe[^]UWVS]=X.t rEE18jjEPEPuu @uuhU#kjSzW u%Suh&U# =X.xjӬjXuVӘ|WA}8u|1PSEPxPuu @u1t =l.|t1ph. `.txpjUE1Y^ExURV艼EPVhCU#jduVjpPUEf$tkh. `.t|jjUEXZEURtEPthCU#jd]SjPًUE$e[^_]UWVS(ԛ-8.t f ./ ..SVZYuVh .论e[^_]É)@E̍EӉljDPh .腺hг%h .vuUWVS`Eh .ZE`t&1]M;>r2jPRU Utj@uVRP V3hMU#[GjEPjh .RUs# Uu}u7}u1}u+E9Eu#/tj@uVRPV3h]U#jGM1EEe[^_]UWVSVUu=l.ˋh. `.u'. T.h.hmU#hY[=p.u %tDhJ.jSupu5Л-Ph% u Ph!#XZ=`.~tj XڋEe[^_]1vs9}E8Ph(8#踲GYXt VhU#褲XZE e[^_]鰱N@e[^_]UVS]EjjEPuVuu& @u e}t ShU#jN`. h.tjYY2=p.u Sh!#XZuuuuuhU#e[^]UWVS]uEEU E$E䡀. T.=t.J`. h.t}jjEPjuVE @tdMt]QM9 XtMMMjjEPWuV @tM;Mt We _j.`Y}e[^_]D }tuh.hV# = t)tu*ShTV# uShV#Sh(V#Sh~V#XZe[^_]UVS]E jjEPuVuuP @u} t ShU#juEUEU `. h.tj sXP p.u EP0P5Л-Sh&&IuRPh$ uRPhV#߯e[^]UVS ]EjjEPuVuu{ @u}t ShU#j`. h.tjC=p.u5Л-Sh%K =p. h uuۃ t P践XuuhV# e[^]UWVS,EE̋}uu<=.t3EjjEPEPhV#E܍Pk((U܉UȉMQMn XۋMЋUuwM1Bt(jjURPVW) @uEԋU1Ƀt();EtuhU#j9uދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhԛ-uhV#jURDUUС`. h.t6j(EYU܃(t Gt9|]e[^_]~ =p.uuh!#0XZv$v vvvvv vv6hV#,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|PhV#{|<Dž|tW9 XuCxjjxPVph @ult9xt ShU#jl%EpuEjj_X=.t=19|Whԛ-ShV#jURH EjjUG ŋ=`. =h.t jL=p.u4Sh!#OY[%t h#=Zt4Wh.W#*G9|j 8Xue[^_]? e[^_]ÍL$qUVSQ$EjjEPuVqq @u}t ShU#j`. h.tjYd=p.u Sh!#pXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h8W##eY[^]aUWVS@]=X.t /Dž S@nXuh4t&h$j1h%RY^t{18jPSƃ t 9u g8"uShHW#8uv ShYW#j_ h%jx 1PSPVuu @u1;t =l.1ǡh. `.tW EZ)P<$PUEIV蹼 tRh. `.tj ‹EX+aP$PًUESc e[^_]UWVStx|h.Tp.$.7Yl.l)ȉp)ȉt lt|uH1ۋx9t担t#t%%RPhj%PPCC뿃} t~|P#xvԛ-RPh%PP|P#xv%%RPhj%PP Dž|-|-Ã=t.=p.th.h!#臦XZh.h.hoW#o EPR|$w t&PhyW#J_X}uC|@0|9hsPhW#Y^P|p4hW# |p@hW#|0.XZpu hh#h.hhW#0pt #6hh#h.hhW#h.v%ƀt2hWh.PhhW#h.<%s2hWh.hhW#h.% s2hWh.hhW#h.% s2hWh.hhW#h.% s2hWh.phhW#h.\% s2hWh.8hhW#h.$% s2hWh.hh#h.%s2hWh.hhW#h.%s2hWh.hhW#h.|%s2hWh.Xhhw%h.D%t7Vh#j VԡhWh.hVh.(h.|h%PhX#ܢ|@H t PhX#_X|p(hX#謢j ơ } =x.=.u }y|xXDž1DžtxThj`SPPQtú @hu\t|@9uߋ|@(9uΉdQh} ^dtNjh󤋅|@XPwP蠵 Y|XX=.uE t|@XhHw9=p.uh.h!#"XZ|@XPvh$X#P藧X}|@t E iUE/Ã}tP@uj-Y Ph.h5X#j̖s u|xtjh.h.|x@u^jjPjxt @u<. T.=t.h.hLX#|@@EHs$ s&|xtk|@8dx. dul-t.s j|xtjh.h.S . T.=t.h.hgX#Ftx \b|@4hϪ _)jjPRhx@Pt蕷 @ht*|h`t5|@4`$R² ^Kz8 ]kЉX1ɉh`9htkh`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQTȩ ZPtރ NjTCXhsR X1T.d1ۋ|;X4,F\s. T.t%xQuujPtAC`jjPSxt @jjjjPSxtε @UjjDžjjVSxt莵 @uI8 u3} XjjVSxtQ @u jٺ.|^_9Sx [DžjjPSxtܴ @tgjjٺ.|8u轧 Yuh.hxX#5؛-b KjjPSxtu @u jڸ.S貯 XZlƀ.pƀ.e[^_]UWVSƉLHT.j=PFY[ƅPt9sx?u @ƅPGh#Vs[Z.tԛ-՛-8 8V tG=^jhq$SS T F<=t:ԛ-  ƃ=d.u hX# 41Dž81ۉh 1tpƅY1j,V1ZYDžtG1ɉLPDžH1ۉ<1ۅJj=WZYÅu 1l@llh#WZYDtj,S訮ZYDt @Dh%WZYLt6X#Lu%PVhX#2 =X.8jR18jlPSu&SY_uDžhDžPht$S_ZuDžhDžPmh#S`ZYBhY#SKY_uDžhDžP.hX#S!_ZSVhY#qhK$WZYuT18jlPS thl 9u SVh5Y#!8uR8h2&WZY%18jlPS]{48l 9u SVhSY#8u8u勅48,0,90r48hi$WZYtVhX# TBlHwR$8s&TЁTāT븁T묁T렁TPVhwY#1H{DžHplWVhY#DžPDžP DžPDߋPDu DžD<t VhY# D$s&>1҉jlPWvy<@l 9u SVhY#8u<@4849Ǹ8r9u-u F0j PV" x;3ue[^]UVS@Ë5/=X-tjtSvZYuFl6j j5SHFSg$PFSh%P/5/F PhOa#j@]SxSgee[^]USQtP蹩=/uS Z]UVSÉu=/u VSYZYe[^]UWVS׉΋]Uu E E!UuUg%t#[^_]USt<0„!1=/uS Z]UWVSLEӋu>h_a#V-QZY)ƒ?EljDUhTSPCEUDEj URPEU:*u%jjWSRPEP{'tEuj>u& E9hTSV e[^_]9`-t3UVSRPjuVu`-e[^]#/t ú( /=.u, /UWVSƉӊ>uuV.HtB1/hg5<.V =/1҉/hg5<.S9=/~؍e[^_]UWVS,E9/L.];S5$E/ĬY^y#P.H.D.=/u/ /S膈Z=X=&wAKw2ifƞ7[nRfƞ7D=,w$==!fƞ7=Xfƞ7=KwJ=w$==` fƞ7 =%fƞ7 ===fƞ7wfƞ7lfƞ7afƞ7Vfƞ7Kfƞ7@fƞ7 5fƞ7 *fƞ7 fƞ7fƞ7 fƞ7EۣP.EݣH.EܣD.eẼEfE1E/ 5$E/|xSj5$E/JE/e[^_]USEPhht@j蔱 1ۅu E]u+hga#_ZtP6<.X%V~<.hba#_YtPZy<.<.1ɉ \-=<. <.t@.0hra#T_ZtP躣@.[!$~@.hma#$_YtP芣Zy@.@.=@. @.P]UPUE`/1J$ w&(f`/ Uza#U}a#g{Ua#Ua#Ua#ۍUa#эUa#ǍUa#뽍Ua#u.f`/Ua#uf`/`/1UWVSVha#^PL^_ZX-h%]Yu$&1҉/Ph`/Y[Ht /a#t /G#X.a#T.a#.> &.3# .a#/"…y11(.$.4.8.,.0.. .t1 7/E`.]ڸ%tĞ7ڸ#u#/ڸ#u#/ڸa#g.ڸa#Vua#/ڸa#u L/e[^_]Ë<./}<./m=/tg=7/t =.uMU=`7/t=7/u<./(=7/u<./1҉/]1/á.t 1=/úD /<.@ /< /8 /US=7/t =.ul=7/u<<./u/8t/8t=/u.=7/u<./0=`7/t/=7/t9<.~j CX]6]Uuj54 /[ =7/u /8t <.Ã=7/uUjXË<.0 /, /qUWVSu }1+uG}-*u:Vt3st!dt1k1uUE 0e[^]UVS h#j_} hcc#Ch /h /h /h / / / / / / / / / / / / / / / / /h>c#C1[<=:tjhrc#jq FWZPÃ$w&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=` /tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=` /u~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US] /1u7 /u'-zu=7/t-[]_[]US] /I1u7 /5u'0-%u=7/u-[] []UE=` /tE] /]USS]uhc#h /vAzw2SYt'؃@PZu@Shc#S5 /S-YtS5 /j h /Z"E /ySEPEXZ /]US] /-uH-[][]UU 1}DuЃ=%" ]UWVSSEIuRP؛^X[RVZY1uEVLXt S詛Y-h /jEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhh#9hzh#9Shh#P&Nucjhh#VNǃ u.hh#P9Shh#PMu0Shh#VM Shh#PMEWn Ete[^_]UVShh#8P99ZYu3h#V萜ZY1t=hvx%V{Y[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPVY[{%=eh!Q#V]Vm GShV> #jhh#Vۚ  1҉p1ShW> t t u@hh#W>YZhh#W)YZhh#WYZt<"u5vptp~HpSPV O tu QM誒ZYMuGCQod Wid _Xu s |ZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á4 /t);4-t!Ujh /P4 /@ UWVS]=` /u( /$ /uD /( /Àu$ /Шu[ШtSS$ /%uF /A /( /9~1Ph( /ZYu'1$ /P1$ /:Y=$ /1$ /=T /t 15T /s-f]4 /9L-  PS.Y[@$w&e21҉P /51P / 1P /\ /t \ /8 1P /\ /= /vx ugx V\ /= /w1P /X /+5\ /X{1=P /\ /8eu15P /Q1ۉP /e[^_]1ɉ P /e[^_]a1҉P /T1P /\ /= /v6x u0\ /= /x ߀x z\ /= /w1P /1P /\ /8 u\ /8 \ /sT /]1P / 4 /h-y\ / /h-Y[ t9ىM{ RUWh /膍 UMuʉY15X /zWh /0\ / /_X\ /8=P /t L /tP_ 1ɉ L /[V<EPZE\ /t\ /tp / /<9s; u Ce-Ed-E11E쿀 /9stub}t6E9s-M܉UuuWv UMuE|1}t8EE18Et < u_ 1EG눅D /H /tP^ Xj\ /)@PvH /\ /)RSP`\ /Me-8uCS;XuS%AL /_WAL /W:^ Y[\ /ML /txt/P /Ph8 /-1҉_Z @ /@ /\ /9D /si@ /u,15P /H /1ۉP /pu5@ /CYd\ /= /v d-8Huhh#'Zuг%1P /( /e[^_]e[^_]UVSQM1uu /EQЀ w[jjjj uuuVtjhh#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1$ /9 /| /á4 /t @@@ Ã=.uUj11ҸÞXUWVS.t`- 0- @1/1bDž{P @$j辿WP,VDQ8QuZh^$V|KXZ$fSftxRP,pZYx,E%=ufSfthP|AYXh i#%Zud PjX~P-1Ƀx tA -x t tlphh#hh$SRJ|1ɉx =.u:pl)ыt)PxjjxPohh#SSdWV(?V{Z WuZ XZe[^_]ú9P.t9L.t 19H.‰USR/t>BE/R%Z XE=@u$/t t7tut g ]UVS=\-u=7/t =.u$t/..u ujjj5.RP*V PT/u =\-u>57/H /7/1҉H /u 4YX57/H /e[^]UU]飪UWVSt eYƉׅt‰//H /=E/u0t;5//}jjjG 1H /E/ld2t8e[^_]UWVSVEj)ơ/u/ǁt#tj11u|%/Su5/á/ƒ// t?x1 rjhi#FY[t j0j1ZtՅtVk1V(Xe[^_]USTá/$N   tw #5/jCP7tW6%I/f5/S5/5/ߟ1/?E4/؋]a//PSy<+u C< u.tPV Z;u 1.Se.X5/jPCP9=.S0X]q;!t/tPV XS5/Y=.ui/uh(i#h#ȀXZMh(i#P=.ui#wX/t hIi#cX/t hUi#OX/t hai#;^/t hki#'[/t hvi#YC/sSh|i#juVg>VCuҡ/ shi#thг%h#X1҉H/e[^]Uj5L-XZá/i…!UEҀu]UE-EPhi#ͪZYUjjUP//XZUWVS@5.t>>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉/YYu/ ыuUS]t CPX]UPGPEEUWVS@/<.@.e=/t1//1///=E/t[=.tj3_/t x@j荭//苝Yu*P:t!u5.BZujǴ_=7/t*p:t!ku5.AYuj蔴Z17/=H/un1H/=/tjhi#訣[1/:at h#耣Xt?uhj:Ģ_X WrY.=E/weu:{1/1/&\P菕Zze=E/+ej//t.7iCЃ .jSP_Zdteh///^=/t1ɉ /_=//uy/u_uh/ƒ@+t t;!tA-Ҹu u ‰/@@/3=//  =trSZH?E|a</1EЍEPEPEP/ tD,EĉE-=/u Pw P_ E@Ƀ}}uEЅEPhi#x 15/Y=/S/YuS艒EЍEPhi#6C//Ht!5/h#5/5/s 5/MZt5/Tj1ɸ/&C$4x&*t@tS; u݃=\-u ̾J5h-j+Y =/t)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=/i j1ɺ%i0S{ aFcx $x&j1ɺ$n /19/}7/1;//|//=7/t5/5/LF^_j/19/}7/1;//|莍//j1;//|/1ɉ /=7/u+;//}5/5/EXZjj5/1;//|/1/ jjjj5\7/Vjj5\7/v1;//|/1/=7/;//}ze1;//|/1/|jj5/1;//|//F=7/u5/5/yD_Xjj=7/t5/5/TDY^1 /19/}.=7/u5/5/DXZjj5.6 /19/}.jj5.7tköUGA57/1;//|/1/7/5/5/E57/f//y 1/,d9ѹ|u$du=/t/d1//5/5/G_X//19|,fFhm//19| SGFRP0EB//y15/5/1157/RPFg8EȍEPh$=.uEtEP1Z9t䡐///7//7/j(Y{j8(7/(7//1;//|/1/ / ///1;//|/1/s/15/Ѓt+Ѓ$5/ t /1;//|/1/e/1.5/C1FP踳X/b"'//15/7//1=7/7//17/h`#맃=.qj 4-i# =.M5.6h#Pq u jhj#5.6Ytjh2j#XZj -of%@5.ѣjP/19/|/1ɉ /PZ jhj#45.V1_PrYt VV1jPb1//j1ɺ" =.u) -#uof%j}=.jhj# @j1ɺj#;_ ƒ 1?PSmp?Zj1ɺj#>^ ƒ Sp`?lj1ɺj#5LY ƒp glSp"j1ɺj#%RZ/ t u.S}o_/j -of%% j1ɺj#^/ /19}7/(7/ @.‰/ //EƉ9Љ}5/=/E)`//19}7/"7/ @.///T/1ɉ /`/XZ=7/t/_UE=` /t@]US]SjšZY19} B]UWVSu}t UE  u iZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:=` /HE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt Q Zt W`@ YWEP`XZ}tE)}+} UZt:`xxPhim#сVWhڋ`t 5.ViX=.SWh5.5.h.5.n.\dJ1ۉ8/$1HPTH; 7/E/xPlPTP0IPTTu PlLX-?txLRDSrZYƅtVDR.U$ߋX9Lt~ ujhm#SFV u C: X-t 1҉@H\.t=.tPXh#XV^_t@xPXvY[u(EU0/4/x|8/</.tPh@WXZy=.tu荄 L:1ۉ/h`#`V^_t:h%m#`UZYt$`$jP54-S' =D7/tuQ`' Qe[^_]UEu1E5.PZYEU5@/;Ztjhm#~jr h#UWVSSÉ։M}uSSYNxuSLZuE/uƸe[^_]UU.]UuQ1.jZUU.]aU1.jUVSu1SYtPZ9u]e[^]e[^]UWVS}WhWWWmtAuu$1҉u#1҉tEe[^_]e[^_]UWVSËu t׉SW W% ucS% ZY9uuj輈XV@e[^_]UWVS]vESEPG[^11VEPZYƅtcVEPEP 1WEPZYDžt.WEPyZY u5.'Xu$ Xu$ _닅uu_;5.SY^9.u uZ1u[X]e[^_]e[^_]USÃ=.tS$X]1Ҋt%uH%u@suB@áD/u*Uhm#|ZtD/D/m#m#UWVS jjd輇ZYEdNy V/X P tStN)EH9|=MMMjuiWPEBWx# UROU׋M Ce[^_]Uhm#Zu"UWVS]SHO$@P_Xe-8u"CtZ d-8uC8uICCBBPNZ;t*tUQMWS"P MUuBBCe[^_]UWVSu9EPN[E11EtSC8e-t18d- MUURP#ZYMt}tEEG맃}t1ۉ]utV#NYXjSԅE_Zǃ}tKd-PVe-Ph n#SWC 3SP"Y[tuWmEXZFFGuEe[^_]UWVSRh#P'Y[unVXtaWvMƉ$lMT$RUShn#Wh%URP  S! h!Q#VEV E h!Q#VZYe[^_]UWVSuu1k>tVL_u L|$WM XZtu hг%Vh&WS }tjSY^y Sp ZPX؍e[^_]Uhh#juPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'.<%t.tRFPLY^CGjCSȃXZutKH݀u=9us8Ft38Ft1 .<%t .tQPSdSKÃCFe[^_]UWVS]S臡^u1jjjS;Bu@thVS\ ~ˍ19=` /t)RPZYu FSWk_XSjWƒ =7/u9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=.!8u#P^hn#PEZYUtn#RU3JƉ$)JYPJkL$QMWd-Pe-PURh%n#MQV4$W XUVIZUtRhu VD Z S; X؍e[^_]UWVS}1ۃ=.u\W8IX$SWhDn#SPoVuPǃ VPJZYu S Y1W V XZ؍e[^_]UVS]h#SJ^Zt(h`#SJZYth%m#SJZYƉe[^]UVS]SYuVS#YZu]e[^]'V!Ze[^]UWVS u=7/h.Zj!hTj#TY_?|uC؉E-uEh#VI_ZEXHtjhHn#s[^VuGƉ<$GT$RUAWuURPWJ V8 YtsfGftjEPV3 Ht-WnZKtcu_E18E h%m#~XBEPE8E 0h#~Y^WZ;u S X1ۉ؍e[^_]UWVS}u =.j蟒hwn#ZY~1E En#e[^_]qVWSCFE4$8FE<$-FUMT$RU}EWVSURPW$W V E@u t]e[^_]e[^_]U|EPuXY1xE%=@UVS|u=7/u1V[t&VlE$P}VPh-\|PV/ZYy VhXG1ۃ=7/uu!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+= 7/u=H /u 7/u$Pk/RPWVWVځƉ׃WVʼnZYuu؉}ܡE/Eut u EU<uu uuqE؋U܉EU9uE}}E/!nEuuP)&ÃEU ~'=7/t(} t} uEU' t tؙ)]Ur'   EE/Em tuTi'}Ɖׅ}t(/EtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉUE/ t uΆƉ1ɉ 7/E7/Eu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI=7/t' t u}tƉECuЉ}E}t =7/tƅRPj # j}]!Su%uuwW=7/t&WVuuRPE؋U2=7/tH}tBy uE/t t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1=/jjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%= 7/uk/9EE}11S 7/uEU)juuRPQEURP[^y=7/tL,'83 t u, uE/< u@)E/ u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@E/Ey} u#"Å>H /-CMڂRPu à Hu =/~17/u}E=7/u~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ=7/t!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU=7/tWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5H-=L-4@w Hr5P-=T-e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S=7/Ee[^_] pWV9EZYt1E En#e[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuE<.)HP6WVƉXZutE21ɉ P/ T/E)SjjWV<.HPx<.H9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2=7/uts1T/WV]jjWV<.HP e[^_]UWVEU EURP)ƉYXBut1WVYZu$=7/t WV XZ57/WV hM9ȸ}|6Du-57/(~VRP[ 1ɉM En#e^_]"XEUEUEPho#XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjh%o#W^_~}Ɖס<.HP[Y9u9u e^_]d0o\WV <.IuuQjjf *QRPY<.HPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃=7/t WVmXZ]u} e[^_]|USZtjh@o#VXZ%q|9} <.IQRPa ]UWVSSEE] wBu@ujh^o#V~ZYwƉ׃uu1E Eyo#e[^_]VSuWVO9| 57/RP e[^_]Ê t u@UWVSƉ5x/5l/ho#hS=wWV)RPqt/SXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPho#jRo#"j PRM 9u#p#; p/<=t#; p/|:j; p/; p/9 p/ 9 p/҅5-,1 v#u t|\u@r;yj=SZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=t#Bp#;8F1< t#uً1V‰8u$#cp# t tu䋅t3RP$YZűPrp#Pd(8u‰2ʀ‰w8t1lߋ1MWUt/Ze[^_]Ë/;/~~/ l/ /‰/US/X/p//[]É19-t @uUP?kYt,.t4.t.t$.UWVS/UjS EjS }tUuu. YXtP5`/} ljE5d/5d/ 5`/ E`/Ed//XZ1e[^_]UWVSÉ։9/~`/d/< +t[^_]UWVS׉ˋ5l/Vl/Љ[^_]M=H7/tt*ttt t XÃ=7/u[USjm5/ZYa#t:t1ɺNC=/t]s#t1ɺ*C]Uhes#/PUYZt /"hvs#/P0YZt /s#jh9W`/jh(Wd//hP/hD/h /h,/ h8/1/ZU1}]á//Uh/1/1l/9h/~"`/l/d/1ɉ l/@1//////////// ///hP/ hD/h /~h,/~h8/~1҉/UWVS=7/uu uqƉ[X117/ @7/u=7/u u$ZYt  /@;P- T-9U] |%!ʃtM9 H-L-U |  /@=7/t /u aP7/9/h1Ҹ WVY[u1ۅtj ]SRPlDS+Ã1T7/)9~1Ҹ F19tD5ݺF1Ҹ //e[^_]á7/tP7/=7/u T7/DUSh/9l/~$d/<u`/PhP/}XZCԡh/l///]UWVS]u }Eu@0tj$zYEe[^_]1=` /tWZ=` /tw/Py_uS[ۃl/~K1S ~YuSW_ZVd/t-fZYul/d/DVe_tWl/uVd^ƒt 0.Vd/teZYt t8.t .t(.Ӊ؍e[^_]UWVSEUMЃt/} u}u=/tG}EPjEU RPu ueu=@7/tV /tM E졀//U#U ;E} „t!؃tEU ///]=/tT1ۉ/1/1k /9{~%8u u1ɺZYGFu1ۃ}tO`/ l/ E1~RjEP{ l/1҅~ d/TRPuuCÃ=7/u}u9EEEE55/+5/E;5@.'EPw_/9/uY=/u=/uEU //1=T/~+9=T/~P/81ɺ>GhP/yY19}E81ɋUG衠/9/|1}uEPhP/yXZh/9l/~Չ19h/~=`/   d/<<@B)5l///9/}1ɋh7/ Kݸe[^_]UWVSƉ׃=7/tCP[/+/-;@.~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ19/~ /t /)C1[^_]UWVu} =7/uщu} 1^_]^_]nl////á/l///UU1wR5/ZYUS]1w%SZ1uS5/vZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;&9tu&ـuH &uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} /E=7/u#=/uS/Zt /1//_SPEZYtIWVM^_t R/xt /ShD/%vWVMZYu5/ 1/ShD/uhD/k/  /PvhD/Uu/@}/$`//9/}%hP/PuXT/T/=/9=/| l/l/؉ESjEPuU$ t9r)ډhD/t5/ 1=/[^7/t 7/uuu} Ul/~7;h/ `/|t d/D0te[^_]uuu} 1ɸJt1tq`/ЉERj]Suƃ `/E9s=)Уl/RjStNjd/l/?4WtV)/~뫣/z}l/`/=` /u/P8rYl/ d/ M9u3_u(t M./t EMMb_uM`/UL_uGMAt?S~tZt /E*l/`/PqSPuE u1ɉ / 7/t =7/uuu} U e[^_]g/+/4- /~9|0-)ș);/}s/)WV%U KYZK=` /tv =7/tT)PoZtu} UK=` /t+SsYtStZu} e[^_]u} MU؍e[^_]e[^_] UWVS]u }/t4 u t`5/5/1ZYt 1/ ud7/t 7/uR=// 5/=/1^//@/1ɉ /4뷃=` /t/ub//ÀuWV1҉"[^Шu%ШtS'n/5/=/Yf%ul /A//90Ph/Ln5/=/[Zth/nWV/ /1ɉ /<//vP/1҉//=` /u]ue[^_]Ã=/~U塰//1҉/]1UWVSQu} EE/tt t5/5/1XZ/tl=l7/tc@.;////l/h7/@.D;/~ Zl7/G=@7/u@.;/~1N= /t/@@.9}Թ ۃ=X.tt =T.u =7/u 11Ҹ *=T.t&}t 1Ҹ 1Ҹ11ҡl/e[^_]TUVS]h/ d/ށ9l/~tu ډ@[^]UEp/E /]USEM =/t)=7/tu ~JH1҉ ;/9~/p/h/)Ћd/`/[]/1/UWVSQSMQyq uu RPy^ZYu]ƒt1ۃ tt E/tI]8/H9U_Ut )]`/@]C뮋 `/t `/teY[^_]UWVSQMQyq 19| RP]ZYu㡤/X`/D_E t$E/u}tjU/Et d\L`/UL/T1;`/r H/E)K`/Uz11҅t `/ىt /eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQ-lPUt!SMQPEgEP& E1jRjV)E뜉+E)Ѝe[^_]UVS/1/utFjjP$ t硠/@11ҡl//e[^]UWVS5@.@.jM9Y119=<.~"!уtRP /9}G։5@.19|)e[^_]UVSu Eu=V: Y@ w>uV-S辭XZ1jjVsP u뾍e[^]UEo1҃t -]= 1/t& 1/tUSJZ P+JZ HX[]Ã=/y-U=7/u T/17/jhs#3ZYá/xW@d/UWV1ɉ /5/=/+9Ɖ}jhs#=4/XZe^_]ø/ @=0/u10/1///0/$1/ 1/ 1/ 1/1҉01/41/(1/,1/81/1ɉ <1/UWVSEEE E}M 1/ 1/t"C 9{}E9Cu E9C֋s1/t 1/ /1҉/pxH }xUPC=6//ub 1/xHE0u 1/t,puX9} E}EE}ًEǀ}t E/‹ BA[^_]ÍL$qUWVSQ QEU=7/t E]!؃u 111}9Uй5 1/FV 1/t]9؉׋]}69Uu9Eu N^})//1=/~GW 1/tBN^ M]M])ӉM؉]܋M]+M]MЉ]ԋ]9]؋]܋MRPW[^$O_w E9ƉU}XM]jjWVƉ׃E/M]t u M]M]WVSQM]]9uEM]uu#WZYlN^~ v9uE}RM]jjWVƉ׃E/NM]u M]M]WVSQM]M]1/ȉڍeY[^_]aÍL$qUWVSQQEU}9} 1/,s{ 1/tE9ƉU}9}u9uu CS K 1/tEU+AQ+u}9}cq qMU[^Mt qyAQ ]9މM}jjRPE/uʼn!уts sqUZYus{CS 9u]}0jjRP\E/r!уeRPEUWV#EUeY[^_]aUWVSQMSN2ƉOEUXu$ux9<.~ CS!2Ɖ܋u}WVY[M9u M9ueY[^_]UWVSjj{T^_uxjh^o#1./ZY1111҉1ۅuuRPEUWV;EUjjRPpE/u uu1/e[^_]UVSEU =47/t5<7/9|)11[^]USZKJy ;J|< t Y RPZY]UWVSuE E>-uF"4Khof%'V'hO#z' Ej5YFR&jh"~:t>u R^8_UV輱Xt̋URUfÉ<$\L$QM8*WPURh%MQS肾 W _usV7YSS ju5u jTj;}t&uA&hs#7&*j %% ET/uGX1҉Ue[^_]SUWVS]EEEEuu QZYt jhs#h^$SYXujht#*XZ8Ihof%%S%hO#~%oDh$j:jSjj }u}uCPÃtNO@u,E UM;M MM|E UƉ!@tt t OÃuV迲jj G jSj:DT/j`Re[^_]UWVSu6EU_}u }tcj-Ɖ[u u11j-Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k`1/GPw'k`1/1X6/'t'@6/#tUEEPht#(YX1ÉUS.w$tXX6/'^.H1/1P1/T1/X1/L1/tP X1L1/D1/Pt jh%o#g<.N . H1/P1/T1/X1/jhP1/-.H1/L1/Y[뉉txux ujh*t#'XZ1]UVS`1/1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP,UEY^u uB2M5.sS CKCtP` Z1C@1/e[^]UEt*xu x u]zB@ @@1/]U Su]jEP>,UEYYut@ . \6/d6/h6/El6/`6/tP Z1`6/@1/UWVSPEf=X6/uJ=h6/uA=d6/u8.\6/1d6/h6/7/l6/`6/tP? _15`6/{u#j;PsiCs 1ɉKs {SC;.u RWV UPGZUte[^_]UQMt.9Ptjh7t#.%XZP@ UVS]u .1k9d1/u$9p1/u9l1/uPa~#4t P'@5u1҉[^]UU19d1/uǀl1/ǀp1/=u]UWVSu`[1h1/t:P葰PV uEd1/h1/ 1҉h1/YS Xue[^_]Ã=X7/UWVSu hh$u`1/ C Suup6/ue[^_]j }WRPsu s蔾Xh#VUZYtVWsPhPt#uwUWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=<.E8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtPP Y1Cu>/CZe[^_]USE] =.t1E E_t#tS..XNt1ۉ] Et#u=@-x1ɉM Et#^S-á.ZtP XS!P].S 5.]B=@-y1ɉM Et#]!.EEPht#!XZ].-x$Ujh@BRP<.RP?7/USEtzE 8.MU u4@E Qhj&R%- }t jht#}Qhj&R }t jht#k7/-a-y7/EEPht#>Phu#j ]S轳Sa~P|0uD]EPhu# XZ]á-x$Ujh@BRP@.RP"7/USEtzE 8.MU u4@E Qh#R- }t jhCu#}Qh#R }t jh[u#k7/-a-y7/EEPhqu#>Phu#j ]S蠲SD~P|0uD]EPhu#xXZ]US] }u!jS萏YZt]EPhu#BXZ]US] }u!jSXYZt]EPhu# XZ]UWVSUE t tP]+p6/^w=.t1ۉ] Eu#e[^_]P*PzPMRZYt]e[^_]ݠPƉ׃utS;57/WVe[^_]USEU tXtugR*-YYR)á-Z=-t tP XSPM-YX]]p -EEPhv#XZ]US] }uC=7/tS3*.Y,6/hг%sSsXZE@]?s]UVSE] YE ]e[^]h+x#S軒XZ=4-~R954-~3t h%ShYXSZ4/h#PUF S$6x#P`Y^SZ50-hAx#PPh$e[^]U EU tSuxud-e-bJtzt1ɉM EQx#e-d-7e- d-*e-Ed-EEEEEPhux#WXZUS Et_Ejh`}$EPEPu F]h#Su l7/Du>l7/Eh7/*l7/#tRRJYEEPhx#XZ]UEtHw1E Ex#].]U}u=`7/u]i1]S1]UEu=\7/ K\7/]UEu*=T7/~!EEPhx#T7/XZUEu*=P7/~!EEPhx#P7/XZUEu#=D7/t=.tL8Bu @u]]UUE t#u?-^u2@t+-!-PHEEPhy#N US E1ɉ <7/ 87/E 8,t)EPhl$E P }t jhy#3<7/E 8,uf@E EPhl$E P }tjh6y#XZ787/0587/5<7/h$j]S芨]܍EPhPy#]UVSE] F1 RD+~vQQ r/Qd~ wG$X&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhmy#1CSPi(7/Y(7/E sEEE sF@tK@sN@ sR@sW@sY @AuU9uE-EUEPhy#XZe[^]ø=7/u=87/ 1=<7/á7/ <.+<7/UWVS }8uMEPhy#Y[1kÉUPA$@PƋUXZt@=p7/t\u Ct C$t!tˆUPW贼ZYUtFVC؍e[^_]U@u0hy#j*h6/ 0Rhy#j*h6/6/ÅtÅt%UEy#ty#URPXZUu6EPhy#h6/6/UU1t 1BS]UU#t B tB]U}ou>¸t#u1]1=7/U7/EEPhy#ZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM7/tFPtu)QjP_XA7/ZjPEPH 157/1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr6/j+UjEEZY];+u$.tP _CP.YSJfh@ fXZEn=7/tz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPhy#@EɅu&M}EuPh%z#}XZPh^z#1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u7/9{jQEP C]tSjZYPS XDe[^_]UWVS ]u }翅u jhz#Cu@t:EEPhz#lusEEPhz#JƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjhz#5t)u9EPjEP }uSjhz# Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjh#{#X Y^jCtF XZtC tT/te[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á7/=7/tUSh>{#n~P~Y[u 7/@-;t CtS C t jjSXZ$ۋ]UM@-t9tBt 9t$1҉]UWVSEE1EE111E@->~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7 Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uhz#|YtP2Z~-øUS =8/u[h 8/sZtL18/E܉EEEjEPjE E9$E/uE/ۃ`[8/$E/;EMMEEE=8/t=/t=x7/u-=T8/ttPjEP譓 EufE=H /u);P=-9u E/&Pi^Xʃ=$7/t ƒftըu18/uu uà 1ɉ 8/=H /tx*It 1҉8/8/@8/~+jX!o8ha8#ZE9$E/tt T8/؋]Ujh 8/#rUQEPEUUWVS0裷 uOÉ4$E|$WVuhfU#WPx؍e[^_]US]Sr ZuSh#h 8/p  8/]ÍL$qUWVSQYq AQEU}WRPq1VӉщE؉UM܋EuƉeWuuRPu؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEPXZUS-8/t,-8/Sh8/5-, 9t T/]UE-]Ã=h8/t 1h8/B$U=-<%!hWVSjubu Z Dh8/e[^_]U4tPw @rP:UXUWVSu} l8/cuWV3XZE e[^_];=t7/uldh(.WVh-T$.\S%g9@. T/e[^_]WUEU E #E##]UVS]u Tuu ]e[^]-P1ZE č#E#؍e[^]\USQtu u>31YZt[=@. T/j ZQujA X؋]UWVS]uE %=7/u>t>S$PhPj jjjSPh$9t|V蚦 Xsuojjk 1=D/1҃=. PSW t"WW _}u)jh܍#[^tP!6( ZY>1e[^_]US]tP!3 ZY1]U1}]UWVS|}ue( u ZE E7/x9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWu" ƒ1Eun؍[|yu19E E H]9}/3{yMu$#[<:N<%<.uFu!1E1ۡ<.H9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v V ZY1CCC E/E/E/ E/e[^_]UhD/XUS]D/-t-=D/ujh#XZ]1=E/E/E]UhD/'XUVSu] <t1ٸD/t;pX[^]UWVSEUE|E x@.p+l<.h57/ duu8EU =07/t4 <7/ș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1tE/ixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x=7/t )ؙ1)=~WVuuuu [Zt}뚃=07/tEPEP587/轮t D/t ] 7/t 7/u=7/t =7/tu=7/uSuNPEjEURNESEPuuuND/(Eu0E/ E/9EM|!ЃtE;E/EE/|lUsjjEPEPR`us3^$`t2EUEUu}9uEbUD/P[uC<ujj]SMQuu5D/5D/$ EMt%tEUSQuuMM}= 7/u(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ /M1ɉ /M)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E//T/}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xuۉ uӉ [^}t}EUW1ɉMu讉 u覉 XZuD/tWsS Zjj1CCCj @u]e[^_]鶇 D/CD/T/e[^_]U €u1=D/1]UWVS4u}E/ E/EUE/E/EԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUCE/Eȡ E/E@u}t0E9ƉU} !uE/E/]9؉ӋM},#u k/׋E܋Uuu  9}%k/]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}k/9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU D/>MjMQjujuWVY 7E/ E/EUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEKE/ E/!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEUE/ E/EԋUأE/E/]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU1E/= 7/u]]USj5L-@'YZt4jٸD/Zt = 7/u=E/uW1]U=D/u 7/D/D/D/]|UWVSU EEt :DM@RtE3D/ s,jh#E"u jh#Ht= 7/=7/= 7/1ɉ E/E]3Ɖ׃u}57/P"ÉXZe _= 7/=7/jh0#_XE+j,^@=E/@1ۉE/.EPMD/Z@t 7/ 7/j1E/X= 7/t =7/U.}Ɖ7/u1Ʌt1<.H'uM@uu57/cX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; <.| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujjj苹 E/XZ=8/t UE]UhwjM E/jj=8/tU}tOhwjYX=.u>Pjhjjjhgjָ 2jjȸjj迸jj趸jj譸 jj衸XZUWVSE/1҉E/tkjjsj(jjTjjK/jP`$h>j/jxT/ tD=@.5<.X<.9=@.u9t@.贳̴T/t=|7/tjXe[^_]UWVS E։ϋE/SRU谩$EuURު u.{tUM tuWVޢC SXZ1e[^_]UWVSSE։jju>$@PCuPMs {E C}u1C%u$@PCuPM؍e[^_]US--t%CBs| s| S| 1E/E/ E/]UWVS5-Yh!Q#Pl)| Z1ɉ E/ [ÍhV M R!tSV uNJ< t< uvZ8tPt t=_8dPjP u1wHx^u Hȋt.8t&\uG@P9tWPΉ1Ҁx$‰uH11WQщ‹d--P- E/ZY襄X= E/t-E/E/1e[^_]UWVS ÉJtu i1ɉ E/u--@J.&hB#bDPD^Zul&S5WYuޥZ̥lj4$¥$L9QfVhQ#P 9tV^y Xh!Q#W?UWJy f;?SYSjjщ‰--P- E/ VhPI th=E/t@J.tVYXDP贤_t u Ƅ@t V[ uR. u@J.DH@ZutfLH@tCu) ʍLHt@u C@tC fLHuDPttDP@yumDP@tG VDH@dBVXZt1E/E/ E/P--tE/E/1e[^_]US-h\#S_ZYuwhb#SGZY¸t_hi#S/ZY¸tGho#SZY¸t/h#SZY¸tjS*YZYxPYX1]UZu E6 ‹ENt Hujhu#jh#XZÍL$qUWVSQ E/"p xutWV ƉY[jj講EUXZE/uFEPEPWVĕE؉U܃}u}tEU}u}ujh#QY[=7/tuuuu =7/tEUju{7P7ESjQjEPuuS7(EuCu S=u XZEЅu u؋}eY[^_]aUWVSE/ E/]11~1t2-t AFKމt E/ E/[^_]UWVSE/ E/]11~1tr-t IFK݉t E/ E/[^_]á E/áE/ËE/tUrLZøUjR;Zujh_ #VZYyjP~VZYxU$E/]øUR~jEP5$E/U ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tP& HP5-P^ZtbShV @ Nh?&P#^Zu @׀8 uSxY#h`#P#ZYt @׀8 u SxX8t%8,t8 t@Ћ8tH5K/RxE/PY^tE/t SxZ@xE/P #uv#e[^]UL/jj臧XZUhUjtL/XZU!L/jhI// J.QJ.y ;J.| tJ.J J.UhJ.P^XZUWVSREƈEj}W5L/ $ f=-tk1L/5-jW5L/Nj=L/t.VV"Ph#UX KtjhE/5L/# 럍e[^_]USQh.#^jjLjjCu >Åt4EP.Z9u5 h4#k^jjjj]jjjj-j/S;څtPjRSX(hJ.h $Hh9#j趩hJ.h $-hE#j蛩USQjhkh$5L/YL f=\-t#<-;tS{$S5L/,L jhO#5L/LjEP5L/FM}nu5<-hP#VXZ]USPjP]Shb#4 t=L/u)-S3Zy Shh#VZYh6#]X]US]j5L/=MSZ t Sh|#IVXZh#\jaLUS-t$;tSt$S5L/%KjpjUS-j/SZYPujuhn#RS&]UVSUu 1ۊt< uB< tЊt( t t@9tCt@8ủ[^]9uW|$wUWVS$}EԋO_,-uVRPSQ@M؉M 0-VSQRP?Ɖ׋]؉]4-RPWV8BƉEuh$TXZDu&tO t E4#e[^_]g_D[1҃tsR4 -Ph#TOuUWVS]S$S5L/ 1ۉL/jh"5L/TI jhK/5L/J ƅ jP5L/^ jP5L/JJ =L/t!Ѓ uh M/jj hI/)$rjաXZjY1=L/u=jP5L/I =L/t"=L/u)uR~Y_uՊt< tJ< uf=|-tFVh#RXZ)9=-:WPu G 9th#;Y_L/VPu G 9t h#Y^f=|-t$j+$Ph# hM/jj  jhK/5L/9G SjFXZu IYe[^_]UVS hVh#_ Pø[th͏#7Åyh#;XYhVh# ‹ tPHHj S>H}PHhrj 5|-Vjj d P(Z9t<6j腷zHjkVh#|WjGe[^]UWVS]ujh"5L/E1L/h;jٞEh M/jjl jhK/5L/F t@t PFXL/f=-tjURPF PSSjj_Xj赹EU^111ɉMKy SpZ PE=L/@7uf= -tq`ƃY - u fuDE 6 u, fu'f=l-tj ^EEu ft PY} tf= -;f=|-tGWh#FOXZf=-1L/5-蛭XjEP5L/nEL/ L/tt h#UXja_.=L/t#E -9uj6Y< tf= -uj Z} u*jƉSluj贜f=|-u>E tPE X+u}f= -t WVh3#WVh# jhK/5L/=ChM/jje[^_]UWVSEhVh#^ 'jh"5L/Bjjjjh M/jjx(jhK/5L/C3à yh#TX11ft#jƉXP2$Y9tGAj5L/足j觪jj^jjUV# VhJ# Mj6Cf=|-tjy)RPh\#}jhK/5L/AhM/jjjj jjXZe[^_]UWVSEzhVh# 4jh"5L/wAjj膚jj}h M/jj(jhK/5L/B/2à yh#RX11st#j肵ƉXP"Y9tTNj5L/Qj5L/Dj5jjjj$VVhJ#KjAf=|-tj)RPh\# jhK/5L/z@hM/jj(jj{ jjoXZe[^_]US,]S5L/th"ujUСM/uUУM/Sj5L/hM/jj]US,]S5L/sh"uU؃%u ESj5L/M ]UShShf# S:E-[tE-jhx$5L/4? U-tU-5-t5-5-t5-f=\-tz-t$-f=-th"hs#qY%-t%-,-K/5-t5-jZE-t$E-f=L-th"hs#|X]Ujh{t 5L/pyjcjhzt 5L/WyUS]e1u jP?XZ]0US]CCtu P$ZYt1]UVSEhm#PZYtPs^yht#±[Phx#hPFSƅul-uu5%?$?XBZo?$c?1ɉ $Phn#SSjqu*hkQ#X&?X?X1?$hE/=à >XP7Y9ut thJ.h#XZ댅yh$uxuPh#uPh#hJ.J CƃE/E/8 u =E/vH@E/e[^]USEjPhL/h# uxhL/hhP =L/yhL/hѐ#TFZY?hSh# t hL/X5|-5L/S ]UVSjPhL/h#q hI/hL/Y[uE#e[^]NLHu I/I/5I/hhP-<Ãy5I/hѐ#xEXZ+5I/h#hV Dh#SVe[^]UE"jPh`L/h# uXh`L/fh!Q#P I uh`L/h#DXZ)j5-P f=-uL/EGUVSjPhL/h(#) hI/hL/Y[uE/#e[^]KI/HuI/Rh!Q#PRHà uVh#;DXZ@I/f=-tPhG#PhO#hVBVhl#S! e[^]UhJ.h#諔j:UWVS}<1ۉK/K/K/%1u~11Ejh -h*#u uTj=J/uhJ.h#*j9t&`'FtrE96/ kU DЉE죸K/뉃a$&nEtPt=7WBYvht#Z?957jh#VZ jh#VB hx2#V^Zƅh#j蔔7hz%SÄZYkh$S讄ZYLhx2#S虄Y[Åh#뫡7K/7K/Em=K/t h#s7j/RUVYZUt K/5Rh\%hK/H EPjhjjjj57HmK/U P57hו#R!K/teh #tMK/K/K/=J/1vldZRpC.E)t8HuR}t hK#KE het%RUYZUtK/"K/K/K/hFj諎hFj蟎hFj蓎hFj臎 5K/hp#j hJ/>hJ/u hu#@u h#jhJ.LyVXZtKthz% h$hx2#& Xt 1N11҃=J/1-L-=-1ۉ|-=K/t ,-=K/t5K/9 Yu.t h#j=K/u"5K/ Zt5K/h#jXe[^_]U J/jh@J/U4hpj=EXZu5EZt1 J/=K/u!ujYX= J/h@J/Zu+j $X=K/tPu,5ZYL/jYL/yuh$ŧXZ J/V= J/IjP1XYL/tP5YL/URPgXZ=K/uM@EPj5L/; jh t 5L/,n jjYX1}UWVS]=xJ/uh˖#[Yu hЖ#j訏h#>Zt8/t P ^x-|-#Sht-EP=% ƃ 1҅=K/t7K/K/K/K/1ۉK/=K/u'K/%;/u%K/jS諣ZYtK/t t u!h&#Sh#!^_ h#x![j2->uUVQP)' U-Euԃ=K/u hK/h$V$PI) @u K/%hK/h!7%u') @u K/=K/xj:hW#u? lj=K/K/uShZ#!t$=K/uK/=K/u Shr#jj:hl%u K/=K/u3K/tK/tR5K/}ZYK/K/j:hQ%&u t -j:h4&uc t -j:h[#uC t L-j:h$u# t1L-j:hr$u t \-j:ho#u t l-j:h#u t |-j:ho#u t1|-j:h%u t -j:hy%ui t1-j:h"uL t  -j:hl%u, t -j:h#u  tK/j:h$u t L-=K/u K/h-=K/u K/`-K/t Ph#^_K/t PhD"|Y[K/t Phv4&fXZK/t Ph%P_XhK/h &u& @u15K/hK/hB#u% @u1ۉK/hK/hM#u% @u K/ K/tJ/xJ/tJ/tj,SMZYt@K/tJ/؍e[^_]USPh#hJ.<Sh#hJ.;j.U=K/thK/htjh j DJ.y1Uh@J.XZuj=L/t!á@J.P@J.=L/t!UjjL/hQ#L>jh`O/UhM/jjr Uh`M/jj\ U E E1ɉ L/hͶj蓅EXZjj腅EYXuh$:7XZh`O/Z YtnE sujHYXuj<XZ=L/uXE M9Hh@J.VZtU < tU EE9sE @E DJ.xˡ@J.P@J.UE Mtt @8u1]UWVSuM/N/FVtI)~@ߗ#t8u\Q ^@P u f^?봈@M/[^_]UEP^vM/^?<tP@M/M/ M/M/M/]UVSEPh#5XZ@-;t[Ct =L/uG-PPh#5s Ct*PZVQPh#W5 렍e[^]UVS,u]S5L/*^VS9VSb9EԀ€Uԃ=K/t̃Ef=L-tMẼeewfEf=-t %‰USj5L/膵e[^]UVSuU ]=L/tSRV) y@19t N/ @_8u h#E[%e[^]雝e[^]UVSP-EÉL/@-t68u-Fu#EPPh$3SV1%tك 8]tjEP5L/ Íe[^]UVS<-t;u%M/tPG [uãM/<-Yhx2#Su^ZuL/1L/h$SuZY…t[h#SuY^tVhya%Su^ZtNhz%SuuZYtSh#hJ.6hJ.Q1Ҿ11Ҿ 1Ɋ-1 !N/Aue[^]Uf=\-tM/tPPXj(UjhK/5L/'jhK/5L/(UWVSjW5L/( ފ< uf=\-u"0U)څ~CCjW5L/U( ǡM/tPQP_9u1ۉ\-ƅy0h%V5M/ZYu ƅnƅy\-jP5L/& e[^_]1f=L-L-UWVSjjjjhjwhjkL/fDžL/fDž 1ۉjjPp' ~Ft=jhK/5L/.' ~$K/!S 9X<uY8C L{ t VWqZYtAEPuWB YVC Zu h#5Xc9s ts tC Ke[^_]UWVSƋO/C!wKO/XO/"8J.HJ.y;J.|J.PJ. hJ.j 3Y[뵋>WPnZÉO/F<w <tj<t<f~ u=CO/J.HJ.y;J.|J.PJ.!hJ.j!k3Y[6h$q-XZ|Whs#b-O/F ^_tbP<O/v Wh#4->Whs#'-O/F Y[t'PPcmO/$h$, =O/"~1O/hQ#l3Ze[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@#t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]ḣ%SIn^_ug@-; CtcE.ƅUB@tj5L/( jhۚ#5L/`Q#Q#jh#5L/:؊t =u,@S^f$S5L/jhQ#5L/Q#2#؀1uj5L/)([_=P/thahN#%YC<w3$Ժ&hV%hW\#h# h#h#Y%ZSSh#J% hN#=%X1e[^_]UjhQ#5L/7 KUVSh6# &X-&1tlRPh%hJ.y(CttHu)hJ.hI#hJ.hQ# hJ.hW#ruYX#u2#FhJ.j XZe[^]UWVSfJ.fuURhht@PT Pu fEfth_#&[ -&tIt>UQMVdY9MU~ 2#QRh%hJ.l'Ã#hJ.j 7 XZe[^_]U;sPPPhw#hJ.-'w$P/t@th P/XjUWVSSt Éֺ&"hw#h|&hh#mu :u!USPyeZYUu=$P/e[^_]VSh#jUEuh#hp&hh#m@0h#1UEuh#h`&hh#Km@0h#U1UEuh#hT&hh#m@0h#1UMuhr#hܼ&jTh#l11f3A@=uUVSEu ]uh#hм&j`uhr#hм&jah#lt0ffPh#!fPhƢ#!fe[^]Åt$1ɀ8u"UJRPRPx 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4 &cZYtdG (uh#rh%h$hJ.)$4 &h!#hJ. $C uhJ.j _XF$&EsR@8t54VX@W~`$WVVEPMU1e#sj@HEP~ susuh#uh#uh #uh#uh"#}U$19$&t@ uRhz# 4 &h#MXZ}tEPh.#7[^h0)uuhN#Y,01e[^_]UWVS]uh#h&h{uh#h&hh#ci11{ u.h#h&hۋ=߶xtgtEWVhPsu s h#n=ts h#ZY1uhy#X䍕uu-WVhPsdus h7#4럸"=thPs hD#xe[^_]UWVSSljUQl) ^t#u uSuWÃu V1 ZHW\u uSVW9uSuV= u Vl1 XVc1 #n벉؍e[^_]UWVS@]uh#h&h8C@uh#h&h9h#g{ uh#h&h:߃uh#h&h;ŋuh#h&h<몋1 9Ɖ} PQhǤ#9|(Ɓ tPQh# 1jjh V= tS h fUtts hd#_X1jjPc9u 9t-uRh#跄yPRh0#u to@u h#qmu hƥ#S󥍵Ѷx Զx9t PRh#\)@h#.Dh#HhΪ# e[_]UVSh#[1H9~D^Ph-&CZYj]Xe[^]UVSh#Y1H9~)D3Ph(8#YZ9~j:ZFh#sXe[^]UWVS ΍1VSYv h#j>effDžVhSf4$YSZڋe[^_]UWVS։ˍ1ffDžfCf+[^_]UVSfxjRhV(VhiSB@u h#jde[^]UWVSDjjj2H @uhk&0jDS'ShiH*B@u h#jdt <ɋDH$1ɉ<1DžDž?ڋD1DžL`jDV&\h##hJ./ Vh:iHLA @uKu8a8tTe[^_]Ë J.QJ.y ;J.|< tJ.J J.UhJ.PZYUXPPh#hJ.u jV/W|$wUWSˉ1҉V/M]m M&h}fU fUm]mURp pSQh-0hr#hJ. $e[_]g_UWVS]E }܍p(}p4EPSuY^tSh#iqXZe[^_]UWVSP]} CM% CSCt RPW RPh-9 1t)X18th-h#p^XcCt2PWZYh-h#pY^}uzPh-YZu΁}ti=V/u\SlUX1҉UtRWZY@u\X8-tRh- ZY@u"{lth-h#/pY^uSh-l XZ }ye[^_]UWVSV/Xt.h-ih-Epƃ \h-!jjEp\ @Euph$o[^xP=(V/t,V/ 0V/t1=$V/ƃ}  =V/h-hƴ#hJ.e DJ.HDJ. yh@J.%Y@J.P@J.؃ t+@t( DJ.y h@J.y%Z@J.P@J.Ѓ߃Yt\^jxt6Ph-Y[@u8h-h$n\ E *Ph-R[Z@uȋE%=t[jhu GPhh-eà uT 5 V/u"h-h$n\ ih-wGPhh-ÃtOGXW\`dt;`dE@hDžl-`dpt`d T`9иdT`Pjj\jjPj}TjwXP`f `1ɉ`dvRLP)TPSL L9th-h$nlXZDžX7)`d=V/th`d rPT*Y^1`dhh`f/\ƃ ~aVh`f/S 9th-h$kXZDžX;`d=V/th`dOtEp뭃=V/t#S\:QY^th-hմ#@kXZ\U^Xu SEY5V/t SWXZ=V/uh} tbG tY4V/9GuOxPS[*ZYth-h$jY^$E9GuV/#G%PSYZuSZth-h$}jY[=V/tWh- XZe[^_]UVS]hVs u sh#'Ƅ} t'h-蚅Zth-h#i[^.h-VZYtVh#١V/t jsPeZYe[^]US]} th-1Zt h-h#sh-CZYth-h#liZYV/t1E ]]]US]} th-迄Zt h-h#$s$s sh-kdth-h*#hZYV/t1E ]]v]UNPPh4#hJ.jUNPPh#hJ.jaUWVS|Ӊ΃=lf0u\=pf0tpR|Y_u%=@u"O|h$hXZOt#h|V] =vQZVSNY_u%=@t=xf0u^VS覻_ZuQ%=@u?V[^u-O?XPShљ%hS=΃=lf0=df0|8/uVPZYti|ht#UhSW\WXt=|Phљ%hW4VWǺt|h#f_XVS'pY^ lf0uS|?_ZuS|h# j/|諑Y^|tpj/S蔑_Zxt@xxV5?ZY|)x)؉t=9|u fDž.Nj|ƄPR謹^_x9Íu fDž.׉ދt󤋅tƄxPR`ZYu<|9u(;xu 9 u ;p=f0t=tf0hJ.-Sh#hJ."DJ.HDJ.yh@J.hX@J.P@J.0t- t( DJ.y h@J.4_@J.P@J.΃߃YthJ.hͶ#KI=|f0t%=@uSA_S^u@=lf0tS|ZY#1=pf0 PSj|jtS=hf0u1#|`f0PSh۶#l޸e[^_]UE TET]<UE MQTU TE]<UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]<[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_];[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_];[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]:[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_] :[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]9[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_],9Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]8Z[^_]USU EAHtRSHtG t uF u:] M[]9t=f0uyDutJt] M[]%g01 []UWVS(Uf0 f0 f001d@DHLP4TX\x|hlEE8jj h# SQj]Sz@u h~#j39Sh#XZ=5g0FډWVRPr#=f0te#RPQ e[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.PCXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPf0tvv Rh#Ã=f0=f0tBjj h#v\vXjUR@Uu h~#j7RWh$^à L g0AF`VdEUQRuu)#=f0t#RPWQÃf0 f0Et*=f0tU]Ã=f0u=f0tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP$eEZuE䧷#EC u=f0tECu}EUE؉U܋=g0} g0ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut({u{ tNV [[^]UWVS(]jLg0g0X=f0uEԃ}Eԃxu x EԋpP=f0tvv s h#=f0F`VdẺUЃ=f0tBjj h# RPj}W<@u h~#j4Wsh$ K g0AEUЉMMuuRPo{#=f0t#RPWQSEPvEԋxvs$EPh#*=f0u7s,hɷ# wshɷ# =f0twsh# F%= u9N % 1RPs4%1RPs0hз#dVXN\=f0t3jj h#QRj}W@Ws(h$X "{(#=f0t#QRWP4=f0tF(V,=f0tF@VDF4V8\f0 f0Et#=f0tNVF=f0u=f0t@u[F%=uEA Eԋ@>e[^_]UWVS]C=f0tS D=f0t=f0tS(SDf0 f0lj?;-(C ;-~:P5g0 ^ZujJIY]e[^_]1S -g0g01txux tF@-E-}E}E1҉U}9}~j}1EM9M},=f0tK(KS g0k‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=f0tS D=f0t=f0tS(SDf0 f0Ɖa -69~] [^_]șEș}E31tZ~u~ tIE9| 1=f0tK(KS c9U~U UBGv뢸 [^_]{UWVSP}f0tG X=f0t=f0tG(G\=f071Etn~u~ t]}~9,EEF,;-| 1ɉM =f0tO(OW Ev뎸 Z[^_]UVS RPuV u1XZV\u󥍽hu󥍅\P@L t Sh#>_Xuu@g t!&8t Sh#i>Y^||@N_Zt Sh0#;>Y^u@M_Zt%8-tuSh=# > @!^tSh$=ZYDoYXt Dh#Ճ=0g0t%SDh1"U ڋDSƉe[^_]g_UWVSÉ։ύEP;Zyh# -y h#j<&t)tSuSu\:XZuRuJY[etju8:jS0:n#ju:jS:#uujSVV$y h#ie[^_]UWVS ~1ɉ=(-u,h~P50- ~fDžDžVhm50-6 y#hй#0jR 7fDžDžVhm50- y #h#h~W50-à  f#h"#h~W50- t@#h#`fDžDžVhm50-a '(-tithK#jgXZ fDžVhm50- y""Sh{#0j؍e[^_]HyUPj `XZËJ UWVSL]0-tP_0-15`g05h05h05\g05h05Ԍ0- yB9Tg04-u1ɉ 0-Tg0<-0hjSU0- y!Sh#0j0-Pg01Ʌuwu0-Tg0D-?hhS0- y9!Shº#0j询 \g00-t`Pg0tVJu0-Tg0D-0hjSs0- y Shݺ#0j9=0-1uUhg050-j_ZyNTg0z Sh#0j50-0-1ۉ\g0yP:^@ujg0@u75Tg0h#j蝠50-0-1ɉ \g0 u)EPhm8@50-ƒ tA:`t-jjj50- Bu@u¸:t1h0 -uD=g0=g0 ~-a1҉\g0u 00T-(-17u0~~u 0ug0S}wt 0Huzg0g0EUu30t)MؙRSuu誺ҋMu u0z0~~11ۅtFMEUWVuu[ҋMuu t 50u}붅u0(0T-e[^_]Ã=h0u =(-U~h~P50- (-1$-=h0uNUjjj50-yQh@#0jȞ RP50-C x11U=h0uh`#j蔝XZ$`g0t5D150h#joUWVS] }1WSu" ~ )ƅte[^_]UWVS] }1WSu ~ )ƅte[^_]UVSUM (-0-=h0u;QRPà ~Gh090tn0tb`g0VQRPbà ~ h09(-5,-tVhл#0jOVh#jD ؍e[^]UVS] 5(-Su50-ƃ 9u$-h0~1(-h0tH~Wjjj50-)RP50-  1(-1t8u 1(-1 8t8EuL8 uh#j(1ɉ (-[^18t|8tr8u%{xv$-h0=$-u Ch<#_u5,-h#j誚 y,- Shq#0j肛,1Ht u h#jhʼ#jZXZe[^]Ã=g0:=(--UWV-wh#j_Xh0t h0h0 yPt 15h0(fEEEPhm50-n xr(-yh05g0ujjj50-Ox3jWVRP )WV50-$1ɉ h0=(- h+#h[#jXZ1e^_]ÃUWVSPE1҉P1;EE (-h0jjj50-Ɖ׋ h0xoEU ug0] g09É}EjRP50-Sy%h#0jO(- )}Wt1e[^_]ÍL$qUWVQ1y(-rh0u9Dh#90jjj50-y($h#0j蛘(- )y11҃=,-~h#ojRP50-Eh@#` (-롣019MQRPWVqU}uthK#j(-XZUfEEEPhm50- y)u2Vha#0j託(-(-1eY^_]aUWVSJ.=-tJ.PV.+5Hg0=Lg0Xu u1=1=-Oh#WV5050fRPVh#hW5050h#hV0WVh#hV}}t^=$h0tU5050h#hVVh$h0hʾ#hVl(V $Vj¸ =-ubh{$Ԍ01WVRPsRPVh#hVV5Ԍ0h#hP0h#0000WVRPRPVh#hR5050h#htW{05050h#hVVRWV5Ԍ0,-HP10h#hP#8}uV5D1hfU#S%V$VjV }*e[^_]Ã=0-y1Ԍ0h0h0UP1 |1t@=h0u7=l1t 01R5D1h"#501Z501J=\g0tLhg050-uZYu6g0%=u%=g0u=g0u5Tg0QF1\g0X=-w=1t -~ jPYX50-詸 -Z~jURPL 1 |1t.=h0u%501h'4#1l1501q 0-h0 h0u 1Ԍ01h0h0=1t,-1 |1t̃=l1t011l1=1ti5D1hR#ZYuS00utjhRP.jh5050RPhW#501j5011Ԍ0ZYUVS Sh41jC yhd#0j/ jSj yh~#0j 5g0=$-B 5@g06=1u5D1h#R[XTg0hD-SZYjh<-SzZYUh0C,-uPSh̿#h#PSh#h8#ۏ-whb#hO#躏[5D1h#詏h#蟏h#蕏h#苏h S褏xh%%SZYu5g0(-5D1h #>1l1[^|tFu=#YoSZuLXg0tP% YSMXg0Zu%g0(-h]#jETg0 Shw#e[^]U5-XYtuwZ@UWVSQ-BxkL-9~'x=101PRYZ~9$9|1muh#j荍XZ3xu=-th#ja[_01ۿ뒉UkLSh0-ZYUyB-y#k-L-1Sh0}Y[1Mu=-dh#jXZKySh0h0軩)؍0 `e[^_]UWVS 1ۉ]1pFE1۸0RUPZYU9tZtuuh#jTY[xu=-uh#h+#j!XZ1h0h h01P$¡1Httt*IURSh0P8 u wHuى9=-u hQ#Qhw#j蠋Y[uh0h0E0 tUh h0P0t5=~~ h~Ph#thPh#jYw@5Tg0XZx%0 0001001 y 0 0T-~0~UWVSX1t hH#jp0=0T-u0yS0+0EU EUT-EEuuuu'u})׋E9ƉM}u}WV!ZY+u} 0T- M19}k0U0;0s#50PY_00+ 0RP_Zxk 010T-щ 0}=000EU)001ɉ 0 0o-hy#j\uXZ؍e[^_]Ã=P-US=-uh#j%uXZyx1ۉ0015T-5 0ZY~% 00‰0001+P-~C9}Ph#jt Iu뙋]ÃUWVuM 0)ȣ0^_]UWVS$]CDž$$ x$|$x $=1u15xPu 5^_y狳EVh#0jtPuZYud%h#0jvtۉ15T-5 0u #ƒ  09|Ru -WQQRuk9uUy%Vh.#0js79|$u9x$t hS#j\rZPu ZYyVhz#0jsNjE49}u;0th#뗋9}3t)1;x$|$}Ru ye[^_]Ã=0t1US5T-5 0ZY~' 00‰000=u.=1u01$x100X1]ÍL$qUWVSQ Q1ɉMMu u150=0)9}Ή50)څutċ0]؉}܍MQWSRPƉ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u}001970+0щ9|`tt%u؉}9}M؉]܋E0+u}럸eY[^_]aUWVS] ~E0+0 U )څ~'#9~؋50}50)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu gY[uEl*Džldhh#0jo֋ltE1҉Pd19} 0+ 0 } yjș9Ή}hlpPtPQ50u ƒ2E0x} yE} Gpu5X0=T1 td@9u 0Й).1];x$|$}Rhu  19x=T1t, u&Ed9$thh#jm 1e[^_]UWVSV 0019|1`; 00}h#jAmZY1ۉ00T- 0‰0;E~ 1}}])1u5T-5 0ZY9T-uG00E 0~$50lj=0T-90~?E00 0E)։׉=01Jt[tTA100x,T- 0‰0;E"])X1EEe[^_]Ë09 0s.UWS0)105T-EXe[_]UWVSu] ~;0+05T-Zx 9~‹=0=0)1e[^_]UWVS1;EE }P0+05T-Zx5É9EE }]u 1=0=0)]u 1e[^_]UWVS]x$|$ $=1Pu _ZyzVh#0jok[0+0~b9}P50u  )019|5T-|^yt7h #0}94tVhA#ji 1YuxPu ZYySh#0jij;EutSh#֋U Ze[^_]UVS]E xz$usPZy{Vhm#0ji$tAPHYy$IVh#0ji$g 1$ 1Ze[^]UVS|]s|PVTXYxS=1t1F $M9$$u0;|u(,$U90$u;EuVh#j2h 뻸e[^]US|]EPSPTZYy1=1uOE%=@uEh%%SZYu\SYy} t.Sh#0jh/SZy501虴Sh#0jrh̋]UVS]EUdh1ɉlE Upt1x}=-t =-|PSCS^ZuZ=-u#EUdhEl=-u#ja KjAZe[^_]UE$tH $E] ]UWVS]E 9$usP2YyVhm#0jb`1t<$8$V d1t u($L($($u=,1uj(1P,1XZ(1!%PVY_- -t%jjL$H$X$T$V$tG{WV詇YZyWVhm#0j4aV$֢ 1$ 1Ze[^_]UWVS]Ct($$t!Njt1lp$H $@&5D1h#vZY=1xPVKZYum%=u[hRV u/tVh#0j&`pƄWVZYpte `D$@$WV:WV[Vh#V P脅ZYVh#j^ lt lt(w$VGpZY@tDžl=h1tVh#Rj._듉l<$8$Vr @ltDžl3`1t<$8$V d1tu($tYX$u!($u΃$5D1hR#UYZjVYZxPVIYZy+th#0j3^WVD>$u! PVXZ=d1u ($jd1 - -t[j $P3V%A=-u =-t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSu޺_u h#E18}t}t:11E16SVu{ 9u h;#i11E1ҍCtPR՚ XY P賕 Yuh-#jP[XZ>CPVЉUPEU 0j\̍<+E e[^_]UVSu] }u1NjjjVŹy JShS#jh$1VT~ y)Sh;#0j[e[^]UVS]u x@PuX=1t*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu ~ ~ pt1@9uNjt9|$up9x$thj#jY xPu װZYySh#OT$9X$u;t h#jjju y$Sh#0j Zp1$1e[^_]UST1tP61ۉT181XD1um1 DJ.yh@J.-Yu9@J.P@J.9-uu%1S H1 t뭅u oډӡH1<<1u<1 B<1tϋxyRZV붉H1j5P1hH1踱T1 ,1]U=1uP1=1tP1=x1t P1@=D1u'h H1Yuh#jWXZ1Bt1t9UVSut>uh#j 袑 Xuh#j?WY[FVZH~ 8/u3E ؉C1C=D1uD1@1X@11e[^]á<1t@=1t 41=1u4=1t+UE$u81tjP5T1莺 US=1t8D11t6{u+uh+#jVVXZ3hh$hJ.T [Ƌ]UWVS]=41u =T1<1541 @u=1u95T1葴81Yu @uЋHHQf $\&@PURURpp p0]9xjjuuuu81p phX#jfUphv#h#p jDV Qph#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=1L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPx y$81p?Vh#0jTƄ  ǃ$h 81pCPh 81rP5D1hR#% t1<1@=e[^_]W|$wUWVS<ÉUMMQEP&mu}j 9ƉЍM}Qh#Qh#j@Sxue[^_]g_UWVS\]u=1CEuPhh$V蚄 ue[^_]郟}W($蛇ET$X$(j8$: Ej<$"Uu#u#PjRj4$Wh#V$ w'@$  R%Ph#|$x$h#VɃuEPh%V贃$Pw Sh#u Sh3"V~ Vj WhZYVdXe[^_]UWVST]}T$X$uV($QSWVh#Pe[^_]UWVS]u fVfuPZt%t0SRjP}WVWCۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=1!u%U1h'#jLXZ1ø1UWVSSu] E}MM1҉7=\1u)S\1:-uX1 pC.=X1uA \1Q\1u \1X1UWPȏZYtAU:uC7tMM}E] ue[^_]ME] ue[^_]٪W3hb#(x:u9pC.9}7@pC.W3hy#hJ.}?e[^_]1UE E EE]RW|$wUWVSjEPSƉ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uh#PC=_DžuBh#jPJY[8zx1҉P= 1uf 11tc߀?t\j,W蠍[ZÅtj=W荍ZYuh#Ej 3 YUuh#jIVx 1B1e[^_]UWVSQÍEPSp^_uC 1%Ƌ]| tC]S躃 Zu11 KDe[^_]UhJ.h#ujm-9t BtU-UhJ.hm#AhJ.h#2hJ.h##hJ.h# jmmUWVSPuhг%SyZYhг%S_ZÊEhV(YXuVh#0jeI }t/1e[^_]UWVSlj/E 0N _ZD1t@E D1h#PB[^bD1#\111҉U11ɉM11Ejh`-h#u uKzX$&7!057h#f 0렸1P-덡78-uxu1Tg0EjTg0[1QPg0#B13x1$1-=-u#`@}1`11=1u `1d1-c1T57;_11p1a -HPg0n%9`171$1Ex9~/pPu; EZYuh#jEj`jEMȋ71P}Pg0$1\11|157,DPg0$#gTg0-XTg0-ITg0-:Tg0-+Tg0-Tg0- -7Pg0$11=x-1ɉ 1575CZ411pC.E 4-umu}t 01J.01J.Hw49Uu }uj5 CL-11t HuP11E`h)#jC$hp#P肴[_h#SkZYF1`1}tE8MMYEh#WZYE@J.t&h!Q#WuEZYuWhs#jC1E1EEYE}tES艅 [h#u蚳ZYu`1ub XEjh#u譲 u@`1t EtS, [EPN5u XZ1ɉMEHjSu E&EE]}t EtS踄 [h#WвZYt uҎ[=1lW5E.j51Ss ^E6~t1C}11ExM}h#S0ZYLFLjP[_}u'hp#P[_u^ h#S̱ZYE@J.ur1҉UE5DžUuzuh#S薱ZYt u蘍_=1tSh#{E@u}jPZYy!h!Q#SrEY_vS6tj.h#WYZt2jh#WI ujjW_Z*jS1ɉ P-}CTg0t 81h#Tg0Zt 8Tg0"D1"11jh`-h}#u uєz$&1-ă뿃7057h#11x7Tg0f1 TPg0#E1@31΀1 7@7tjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh#j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 5D1h#5[_Vh#5h#5h<#5h W5hS#W详ZYuhE#W蜤[= u hg#:5Y덊uh##5ZX<.uuh#5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDh#j2|tHL@t<uDh%#hJ.d WDh;#hJ.dt@th WDۿ0 1e[^_]UWVS]t K΄u hE#R<\u FFu8uSh^#j1 Dž~jl Xuh|#j1[^GjQP蹘 t5hVP躢SVh#ji1 Wt YpV֊t\uF8tFWs Sh^#yR#ZV1u,uWs h|#j0GBGtVuh#jj Xuh#j0[^C31CVܞZC 1ɉKECE C= 1u 11X11e[^]US 11t6Cu+uh=#j/XZ3hh$hJ.a [Ƌ]UWVSu 1t$tS=1u S1u=1uSu $uoFP!Yuhg#j /C_Zt/1s\Ct/1ɉK;W趝ZC Hǀ?/uC C$l 19tP@uh#j.Y[CS=q 1$Z-e[^_]UVSu1ۉ$ 1u,=1u1=1wC |/t[t0CuPFP30 KVPYuɡ1u #$tV^Zt 1$e[^]UWVS]=x-tes{.u{.u Ct:DXt+UV苙Yu@F0k NDоU11USZZ) w U$&0k KDЃD=d80k KDkd-lBK0k sL1ȉBB0k KDωB0k KDЉB 0k KDЉB0k KDЉBRjEӉ‰_Y!1؍e[^_]UWVSM51t!8$=1t4;t@51t+<$=1t ;t@11҅Pփ Ӄt] t)8pX$9T$}d$9`$XP ;T$X$}s;`$(td$89`$X|ItOP `$9xd$.tX$89T$X|tP T$9pX$} @&1҅‰[^_]UWVSQ]t:t4=1u3Ujh=Zf 1_ZUuh#j'[^#t.\u{#uCS K YuSh#j' ʋXj jCS2à [J =11<7t 9t&@uja Zt p h#b1e[^_]UWVSQ]t:t4=1u3Ujh=se 1_ZUuh#j'[^#t.\u{#uCS*E YuShE#j& ʋXj jCS1à D =11<7t 9t&@uj` Zt p hm#b1e[^_]UWVSut>u h#j/VR[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh#j% RE@j` Xuh#j%Y[.t;u GM1GtAt+@uVh#%O}tgE8t_W@uuh3#j$Wg bGƒWt+G 9OG}VuhO#j$Wkg 1G=1u=11x=11 hr#e[^_]UWVSM=1tPÉֹ=1:t9pt@9u9U}tjz^ ZUuh#j$[^1p1ɉH xe[^_]Ã=1u1Ujh 3b 1YZt1h#j#XZ1UWVS}1$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujn] YtGGPZt0 $$$CSEC ECECEC1~Se Yh#j"XZdUh 3 P: $Uu-$CHCwC3e Se [^̍e[^_]UWVSM14$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3id X]e[^_]Yd e[^_]UWVSS=1t51ۋ4t#1ɉ v0E#d EPd XZuC u͍e[^_]Ã=1UWVjhG_ 1_Zuh#j!Y^C<#=(15,1-5,1Z@u^VhJ#0j! V0X1e^_]1Ã=1u1Ujh^ 1YZt1hn#j XZ1Ã=1u1Ujh=^ 1YZt1h#jP XZ1UE$$ $]UWVS(}u=10 $$$EUE 1҉ẺUЋ,$0$1!!ډEԉU؋E9uE9t1!!ډEU 1EE11ɋEUƅt6@ ]9Xu]9t@P @ $$$NEU#E#UЉE܉UEu1Uu1  O $$$ƅE] tYE]1؋U]1 uEj1Y X1ۉY $$$AQ F AN tX1-t"1111uϡ11M̋]!!9ur9unt`11utLUjX Zt=UMHUPX N HF $$$EԋU؉,$0$Wh#jh #j1e[^_]Ã=1u1Ujh=\ 1YZt1hC#jXZ1Ã=1tDUVS110tjjs sss3[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ 1=1Et#؋M9Hu9p u M9Hu9xt@$uj( W X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R_ XE y#Ee[^_]Ie[^_]UWVSEEE EM}1tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3a^ S[^ XZ1e[^_]1UWVS]}E=`1t,;/t'PS^ZuSh#jT |j$U Yu#Sh#j2 tXue[^_]] S ZtGFG4W8F VG(W,FVGlFF 1F51e[^_]US1tvC1=d1u{ t s3賴XZ- -tjjssss 3=|-t s3YX3] S] 1XZ놋]UWVSE @~}DE@Eu119}1Ҋ LBuEC}t#]1ۉ]Mэu9s F^BE1uZY[^_]UWVS u=1FhGSPG <9tjww 5-5x;Wu;G t 贘h#*SR5-{ 9؍t舘h #0j SR yT$X$G9__W1jS Xjjj5-|wG WxNS5-J{ 9u)T$X$GW1W8蹗h%# 譗hE#0j$ WZ Xhd#jZYe[^_]UWVSQ1uh#jXZohu u Eޅt6u胈Y_tcvj Q ^t;uk ƉYt#uZ GZt _E81QVZ XW Z _h#jN[^0^SuZYtSY u F_Zuh#e[^_]UWVSu} 1t=h7V t&3V譇ZYuusV[ [֍e[^_]UWVS1ۉ]U]u tu} 1҉EU]t} t} u^ <^4^F (Ku0CEUEU}t9s}u9rKC0E}1 ۉZY[^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=R.ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh#h SBSyEVh#h SASy=Vh#h SASzyVh#h SASZe[^_]USSˋ t%RQPE3W 1U1ɉ EeveRu P̡ ]URPh!#j Ujh豨ø1҃=1t1UMU111<u @=u3} u( A=1t1AH]UVS]} ~;uqjh#P{ u%=-u -hK#j@ZY1-jjPƺ 9؍e[^]UVSZÅ3h#V赃ZY[uh#S衃ZYt)SVh#jh#h#h#j -vSVh#j1o1e[^]UWVS]u hV_Z@ub- 1{ǃ4$K<vCVh11 | Rh11 Y jjFdP(%($jjFlP8$jjFtP<$$jj F|PdEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1҉$$$$ 2t8,1ǃ$ǃ4$($Qv`ǃ$($ Kt $x$|$ށ1$$$$w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%1҉$$$$1|/uDe[^_]UWVS u$Hwv$&=1t_h#j h7#h\#h{#Ń d~ Ph#뮋XcV~Rh#땹1jdRP襜1$$$ u#EƄ/ojj 11#Y[1u9E2jd PEPKojj 11wE1Ex$|$ƅz ӍynHʃ0Pu uo9uh#9rH@0%1҉$$=1u =1t 11 T$X$W($1jj_Z_8$1jjZYg<$1jjY_{jj _Zud2M1jjhZYuDhSV[_y>jh虡ZYx鋖$  Ѓh#'e[^_]11UWVS}} ?jh#V| Åulh#VA}Y^¡1 1 u1h#jE XZjjP虻ƺ- 9tPVhn#j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPW.z/@E K<vM E)Vh11Mȉ Rh11  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)PFyjjFtP<$ Ɔ(8$P PZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2h!Q#V3_Xu$q0K PVh#j[@J.1EPS((ZYt/G}vEVWh2#jEUt@J.u1 SnMXe[^_]á1t UU RuP荪51eMUVS]u F51tRPS  tD3j SCZYu1e[^]US]}t X1|1 1t=l1thJ.j 1l1ZY5D1h!#hJ.1Su hJ.ĩhJ.j  ]USjh_ #$Y[xEh^$PiH1YZt&h!Q#SSH1YZt1351LZS %X=1th_ #hS#j ]UVS] u}t X1|1 1t=l1thJ.j 1ɉ l1XZ5D1h!#hJ.0VuhJ.ƨ~SH Ph"$hJ.0hJ.j hXZe[^]Um|Pho#hJ.a0j" 1UG|Ph#hJ.;0j"UWVSƋ=81tPh#hJ.0 =01u ЉˋQtjPYZt/}8tɍEPs2XZ=41tVh#^Xjs[jsj%} u#VWPREPh#hJ.^/hJ.LJDJ.HDJ.[yh@J.KY@J.P@J.؃t- t( DJ.y h@J.eKZ@J.P@J.΃1Ylje[^_]UWVSAօu"VP_ZtDžF%=t1jhv! @txPSY[x^9|u,;u(^9u;F u%=tm{WO!Z<jjjZ  ׉NX^\19ȉ}{ 9}Dž 1P 9+{av ZcjjjYG? NX^\19ȉ}{ 9}Dž 1P 9+{ZjjjXnfNX^\19ȉ}{ 9}Dž 1P$ 9+{ZjjjXNX^\19ȉ 9}Dž 1W 9PPW  +^_jjj(W~\vX19}p1҉ u݉19} 1QP` 9u#)[@ @1h$NZYuSXe[^_]UE @E E@E] hUVSutYS} u C tC01@01R9 s9 S9 01H01 u,1te[^]UVSu01@01`1؃8t VPjZY1u 01u,1t e[^]e[^]UVS`11؋tJ9tFjPZY1uԉe[^]UWVS01@01ƍPxY11ɋ`1tx?tBA'u9t h[# 01u,1th jVS119}Vphm#p-HQP yP-H Z J GSjXe[^_]UMtA'1`1]UWVSu^Nj7t#vueY[Åu jWXZ ׻؍e[^_]USh%JZtaujY1"41tP{ Ã1X؋]UWVSP}U UWRW"ơ01@01$TW舩C1҉S URwC01H01u,1t e[^_]Le[^_]UVSuV[t#sVdZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY118u&S;u0hw#5-qXZ1P1uj=CP6Y_uyjS5_ZDžuSh#5- Shm#&w%-xWP yPl -H YlJ ]@PS3XZKe[^_]UWVS5 1R.DCtVjEPVY11] &8KȉMA&uV)PRh#&tK11C&u)BUPg1NjU1Xu,Ƹ^ À~|tH;= ÊVθ(,)%%#$Ƹ Ƹ^ 1e[^_]U51Ph#UWVSQ5"11"1PIÉ5"1^=F-t 6#uKt;u,5&o1҉jEPS6VƉn 8uE8t+n8tG#`& tBUUue[^_]W|$wUWVS ÉUM7Hw$&k# uu w#!uME5 #tރ uWVuu  WVuu.  MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=1%1  UU6EU=1&t #2E11MQ  mWUEaYutu]ƉӉڍe[^_]g_UWVS(Ɖӡ11EЉUtUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh"j]S_jSuA e[^_]US7=1)u c[]W|$wUWVS4É։MЋ?E1EăH311V]ЉE뭃$" "tCك<E4EȉU̸#=1# wEУ1tV!EȉŰEЃ'wF^1ƒ}'u1EURPh"j}WjW6 EУ1 11V]U]11VWEnY1 M1ۉ]11VWE7҉EȉUX}t # n1t VEȉUU1Ɖ׃ƒ'u1EȉURPh"juVjV51 #닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sá11EUUV01Kw\L&8L&}GVQ1YYuRPUMY_Kw#L&9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ 1AZwSjƉYX=1uRE11MQ  SUEZ  !1e[^_]UWVS}USFƉX=1uQBE11MQ  SUE щX 1e[^_]ÍL$qUWVSQ q}W軝51XjLP*ZYt5xIu,xNu&1҉Uj P*ZYUtB@)։51@뽉1 1k1=1t #EЉUWԝEЋUԍeY[^_]aUWVSRE} #_--11HO;t(1sx&軞P ωʋ71tx BM菞P M҅xJ sH+ -Q舛X5"1SƉRPh$ e[^_]Ë1Ѕt /tt@11 @1US]u1Z;/uPh%%MZY@tEPS>ZY@tҋM9u;Eu3E3U ]UWVS}V蚚VP tS[ 1Y]e[^_] ShdZ8"u뺅uUd0. Ph# e[^_]UVSu= 1uE=-t.1҉-h#{PYZtSΙ 1Xue[^]3e[^]UVSu3t = 11tP& Y01@01 111 1jR01H01Zu,1tG = 1t,j51h#j5 1h#jh#m[^1V~R@$1VP --1 >/t[5 1>t'1H1FxFC蟛XVԀ~/u#1KhS#VTZYu$-9r :ƅuh1K;/u>th%%VSZYt 1x/4)X/ XV>t1H1FxފFC9-u 1x/C ܚX/=1uȚ101@011tP% X 115-舗 1j51h#@j5 1h#.01H01u ,1u@e[^]UWVS} u01@01uvYy 01u,1ttj;á01H01Zu,1ttt h# Y0t$=-u =V-t5 1hh$gXZ1ue[^_]UWVS-hƅdh?#葮Yt EZÀ{0u K{.te[^_]g_1l1\1h1d1US]tvUUt[F~Xj Rs 1UE@C ?Ct8j RPUjEpSus IVCX C @C[놋]áx1USQjj]Sjjh$- @tBEPyx1Zt,jjSPjh$- @tx1PATH@=5x1 x1-X-]US ]t6;u1Ct*p試ZtH#1PjEPCp`']UWVS }W1t@01B01PWpE_XZsnEX;t-E@u"xVVXS0s Phy#1Psue uK 01u,1te~ jVYX}xuju js_XZxV^uuY1u u zZ unX1P1 01u,1te[^_]UWVS}] -tuu15P1EnރUR蘉ЃEYE$&VwXZ=-=l1%jwmYX=-P1 l1jw=XZ=-=l1=P1=1tSWSWY_e=1tSW=1tsjwXZ=->=l11=P1u 1P1=1tVW=1tVW_X=1tVW8=1twww*1ɉ P1zjwXZ1=P1P1fjw_X=P1tQP1E=1tgWfY(jSW Rh#:h-V EވE1UR脇ZEPՇX1t=-tP1t }tPtje[^_]UWVS} E E܍uV׆5"1ju\1jY=-tKt>=-u5tUVUt E PuRXZ=l1u V袆X\VZu1P1tje[^_]UWVSWE} _--11HO;t(1sx&ևP ωʋ71tx BM誇P M҅xJ 莇H+ -Q裄^`1PS|ZY1P1P1e[^_]UVS]h11jshXZ=-l1tKup1Hp1t1l1up1Hp1W1ۉl1MwE5P1=P1; ut-t)E Ps5P1l1ZY[x h15P1e[^]UWVSu=P1=-u1EPiE؉E܋^Yt$hPS.M =l1b[E؋E1҉h1]؅6F"1=-P #1PP[h#Qv I-xWPyP-H =_ J=s--xWPYyP-H X J 5-W_jsv E Pvk=P1=-uJl1t:up1Hp1-1ɉ l1Hu p1Hp11҉l1 h1=P1EPpXe[^_]UWVS]uV趂E؉E܋S "1jPs{K[tt=l1uk{t_G"1EpWPZYt@1=l1uA=-u81; u{C"1u s ]P1ZYt‹띋[1P1V譂Xe[^_]UWVS]} 3EsdX=-{5"1 #1P褠Ph#Stj RU5-UR h#Xu h#X-HyP-H X J 5-(Y01@01u"jS*fEPSRUztUt,uveuu 01u,1tjsKWs$UuR\e1҉P1 RpP1X 01u,1tjtJ=-tA{t;5"1 #1P1Ph#-Ee[^_]e[^_]USD81EE1EEppX=-tlExtc5"1 #1P赞ZYEP($#[EXtj S5- [h#[5-tXjEPZYtlE8141j7XEuKt&:EP$#X5-XԋEtP1j58101@01Eģ81j EppXZ1ɉM 01t5u EpY[01@01E81jX 01t,1t뻡,1txEt"EP$#X5-LZ]UWVS}] 1CCC =-EP~01@01E^@u h#VjWbjWPwu31ɉ 01,1tuZju(jWu=E؉s 01H01Zu,1tpEP ~Xe[^_]UWVSE ,1@H#1X"1("1$1`H1EP}X1L1E@"1ptEXt7u!C"1hpPSE 1 sB_tҋ[ŋt1ۉEp ^x|EXtC"1sYu|1҉4pjxPS E [븅t4B4닅4P.{_0pt0J0H 䋅010T=-t"=d1u4~0@T40)Љ0=-u 4}fEED 5"1 #1PAZYP[x1ۅt--HyPd_-H J ~j=WDY[Åt?v{Z-HyPX-H = J={=WAX6 ept@t--HyPX-H J vX6 뼋Ep -tRVPK t vHyPhX-H J 5-_uxsjh@&V3 u Xԁ}D ``041 Huw)4)400toX4t-X`0QRUR0of}Zf}tJXZ:-{z-uzu apu CSu>E `tfE=1u Ext,AEftfwE= t=D tgˋE@ft501@01juo][^28t428t*28 uxPW ZY@t 2WPiX뀃 h u tCƒv~ 1PSP6hfU#jUWVS]} Cfsftf$ftgSH#1$jV$PN P|hJyӅtshv#`XZ Xth#_t h#YVh$"XZt h#XVh$Y^tq01@01sP$P`01H01 u,1th#3,P'h# PVh#{ t--HyP-H *Z J*-HyP-H X J e[^_]UVSu`&t"8u%uCVP!ZYt؍e[^]UVSu&t8uVPw!ZYuCݍe[^]US,-1ҋ1tHft fux@ |u[]UWVS}01@011t,Pfu9x fu9=,-| P X҉΍^1t 01u,1t e[^_]%e[^_]UWVSuH#1XE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVh#qZYUtU~:uBC렡,-U҅y E,- !WE,-Xe[^_]UWVS01@011t!f{usS XZٍ݉w1t 01u,1t e[^_]e[^_]UWVSutA%<11tCVP3ZYtdߋ} tX01@01V$=cÉ1fCC VCP01H01 u,1tB=1؍e[^_]US&tjP)f@SPXZߋ]U01@011 PF 01H01Zu,1tUWVS] j/u^_t[EtFxPuZYy ,8t,8t,ffCf1CrƋMH#19tMEth#QצY_tM ju_Zt@HftftfuEu6Eu E u=,-yƀx u1E\tE Dž\u =,-yuGYDž5DžXt,-f~tFXDžTDž`juEP` Wa1Zu?/ugX9`Y@Ph#KnZYtuYDžt51h#!nYZuzX9`hxPWYZy.*8B*84*T"E%==1tlEWLȉ`+-$Q`WU_ju+ƃt fx`tWuh#dQWBcXZ01@01d\ujuY_f~udfF`FDžT BtEt$jTPuh[<&5-"f`z01@01d\uju=XZf~udfF~ 01u,1tF FfF CfF fCFCe[^_]UWVS(EE1E11E111Eh#vEZtPE܃bw$H&1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEE1: E؈E11tIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5-s^-@h#[EjWVZYtY@ft8*fuu<1P18ufHu("fu}}t̓=,-x tH#1fMfMPu̍EPW EfEփ}t f@ E܃}xf}tjWY_t jPlXZ(OE܍e[^_]UVSu 01@01jucË@ZYft&fHu sXfCFC fFC FC 01u,1t e[^]e[^]US ]01@01fEEE-fEu EEPSL01H01 u,1t ]]UjuZYtfxup)kX1UWVS(1E11hN#s_t'ptvtV EѾʋE ct ]tPhR#nt hd#^1ۉ]ԋ 19#cu+#QPh#/uSY@&uwjSbXZh#j w tmh#ſXwhh$0_XuY1P1x 8u SPYZthh#h#XX1딡18t-HyP -H YwJ h}ujSXZtGfEGE<H#1f}f}U؉UPjEPSEfEEE؃1f}f}t f}f}j/SfZYu^H#1}tEM؉MjSEPEPYMIy߅u#t9#Ph#蘾[_uljS8ZYuuYhz$u_Luu"0] Ph \#W %u%h#uh# uh#譽Shh$ZYu h$#舽XEE~Eԍe[^_]UWVSEPY@1+-P X -^_}GE܊_tqtg}tb} C<v8u1:t* t/t<EP4Y[=V-t"E u 1xA gZH}낃=1uOZ1-8u(hh#YYu2P Z1t p P EPXXuEE %E1F^t\}tÊ& <vC< w 1@1yYH @1 1@1yYH @1AE@uF9utm&t_U9UčvsՉ‹EĈ@ȉƃEM9MMP YPEP EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQ YZYx>EE1EE׉E1҉UURMQXYZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=1Uqxvtu@r t@;}u51[xP51ZYy9tt1t9s'@ZxvttE]S@ϡ1;EtP9Uu8/t]C %%г%PtX E91t@/Džp>t F1ptJxw@tu@o,1tS YpF/SZt؀x .u o.ux jWtJ tptWu 51@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu$1sk^<*P@1@1+-uuuuSuu%@1+-ʉ@1)@1uX uuuSuYeuXE)؋"1 RhL#u܊N#uNQSHPRhg##u E܃EEPSE)HPRh#ëdW@1+-Pu }tzM]u EMEtZ|wt<1<1׃uY]Qt@뿃uHus독tEe[^_]UWVS]E %E1ɉME tE-#1u #1E@1+-E;~uE t u S=XZE 1Es}B~< O$ &:=J{s{u{y{@u{=uz1D1E} t 1@1y;P@1e s 1@1y^;P@1"1 1@1y8;P@1 t=D1t"@1+-M9~xuH@1 uE uE 11 1@1y:P@1҃}u C< w 1@1y:P@1S 1x@1H @1Us:H @1U߈ ts"1E#E PVu R<1p<1<1VvXU 1x@1H @1U9H @1U߈E {~=u}1Eu V[X u"1 1x@1H @1Uu9H @1U߈EE RuZYE @1+-jPHP pމe[^_]UWVSEu ]=&-t1҉D1P <1-@1-11ɉ ,1 (1P"1Sp1_Zu#u8@11@1H1@1ys8P@1@1+-P}5$1 1XtXZEu EL}tzKyS]P _ P KyS;P|^@P|4M}tVhh$S荅 iEM0EKySP Y P EEESqEZPe[^_]UVSMt0t"119};ivuC⋉11tJiD} u&ƒu=t uă[^]UWVS utF>%~W,[tW,XY#*Ft~uH<-tB<%t<+u:-#-i1#11E1MxdtS~J~?Hu(UFPQMbYZMUt UQW"+YZUu뗅uV+ZtjV+11XJxRt~i90tM΅x291~*i1t"# ##1ۃ} uVP萎؍e[^_]UVSh#K5X=1tYh#r-HP&-H YwSs1Z8P1xj10Y^u h#BP+1i5rO@Ph#) 9DiPhh$FXZՋJ ;1e[^]UWVSQ111Uh"#-4ZUt%jtptg Ժ;ƍ7H~h&# 1tyt hN#UjPYXUt 1t+1i5rO@Phl#t"Ph,#XZ1tnHi0i0h#Հ-HQPFY_y/P#X 9~ -x99z 9~ z8 ܉e[^_]Ã=1u!UjuZYu11á1u!1 1Jxu 1øUE=-t@=1t7uR+1i5rO@Phr#5-UWVS=1t.511NxtSX1111J01B01uh<ViP)Ë11i߉_19~i9uFP膦 ^11iƄDŽIu1 01u$,1tЉt 01@01=N-1ɉfǃ14؃} ~iE PZ 01u,1t:؍e[^_]UWVSu]=1u1ɉ 1811SSrwXZu11}=-tpt u U8Wju^X}u-W5-NZY@u0Z hPh#SjpSjp*}u$Sj^wSjVwtAt8t$=-tSjpSjpSjpuI1=^uj蝇jhvx%豆 thvx%h(#?}uke[^_]US]U M=-ut u1uEM E[]ܓUWVS}tE1ɉEPu EPE t!01@011E1fJ81tt;E܋EEEEi}9r(}i1M9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉tcu tQ=1t1=-P;u uEt tEu- 01u2,1t)h"}upuEe[^_]UWVSjjjà ~ jjj=-tQCtN5-+R^9t7!RP5-蒎ZY@u0虨 hjPh##11951|btPu=1u>SKX5E t t&tt M ڋEsF떍e[^_]US1h|#h+Zt$ltptZu⻀ۻԻ͡1u t8t Ph$)l^j lYV=-u =V-u@t/jP‰١-1P1@YZuS5-DXZ1]UWVS411ɉMh#*EZt+}nt}put h#裃=1E1Eă}u18Eąt2jjW{ uWh#jWMY^t Wh#@1Eȅt}E151 1Nx.}t 9u1҉1ủu؋1MjVE^ZMu u؉}tKE؀u?MjPZYEԅtjM1Wǀ =-uXE؊uẼu؈R1M ƒ}EЃE…tEEËEȉEԡ11U1Mx3t#t uE܉kuñȄ]܅u@1E܍EPjj @u q耉E]܅i\9]t}tLjSPY^Eԋu5}t/1҅tHi4h#juVIuS#Z}u}Mt7}t1jVW~ #}SXEԍe[^_]UVSuá01@01ujVjQ 耾t-S5-gZY@u0s hPh#u%+1i5rO;-t ,jVY[=‰tut čt ujZuVX 01u,1t~؍e[^]UVS=1th#jPXZu h#Ph$rsY^9~iPhh$IsFXZ١-HyPq-H Y J u5-߇^Z@uI0 hPh#u~01@01SSË01J01XYu,1t}؍e[^]Uh#$X1US] h#$X]1 1uPUS119|:t%uh#q1X A1Ë]UWVS fE 1E1E11}uEE@<}%<a~<w=$4&)1-&F<=Pހ<'<\"FEF1FEv t!#< t#E0 wE#< u#փ8t "B;&u11}~ uxFEp"ntj@-t ɉ1:QS@-<}t!~u9SCE\U'$#"# $#1E]CMt]BBuPt}t E"M@EE1E1 [^_]UWVS]} =13v$X&I$jsZYu h$Xh%[_jsh#jssh#f[ h#T^h#I[Y1벋st7jv3XZ>t h"#X6jsjs u7{t1h#Xh0$jsh1-&1~[(h&#js u h$_h:x#js { t&u h$f^h*#[js T u h$@[h1#h$#h5#$XjsZYu h$ Xh=#js u h$Xh'{%h#s h#jswh<#js hB#Cph#zs t=jvih m#\jv U; uhH#hM#9_vhR#s!hW#s #1 #%1`a#1#1# #S9tRh#j}WlWVC [w*yh#:Ph#j]SlSvjPiZYhb#hR|$NXe[^_]UVS]u t3u h%XjSZYt{t h%X[ɍe[^]UVSEX1=-u=-u251ju XZ=1 D3...1e[^]UWVS}]51t/1}t3=-tޅttVS?YX}u-t?Hi@@} t u P XZ؍e[^_]UWVSP]u }Adtu,EjWVSE# 0诙 Phh#>vPWVSe[^_]UWVS]t P1 =P1dPXX#1u \#1 p#1`[1\\9P1~jh|&`PΙà u\P1dP_NP^؀;18t@x/t@xPSN:ZYy1EЉEԋ\1\u941E[ 1uy#e1:tt@u=1h#SL^_19-T!T-51߉Sh-xWPYyP@g-H X J EЋUԋ\11\ke[^_]UWVS}WY}E11tb=-u5}t/j5-4jh-Xf-1PaHZ=-u;1u{=-uru=-t`=-tWh#qgXF+t'=-u1҃=1‰1jPyY^1WZ*u@WTXe[^_]UVSU:01@01jRKqY^x jPXZ 01u,1t\rx=f-t01=-t -1ۀ=-t-11jjVj =f-tt-t-e[^]he[^]US]01@01jSpZYxjP01H01ZYt Sh(#q,1t~qjX]Uu}~E p P:ca1Uu: Zu h#qUu u1 ZYu h#rqUVSuV~@$VP ^؍e[^]UVSEX9-}]ށ}01@01FPb-P-5--01H01Zu,1tip01@015--)- 01u,1t4pe[^]UEuj h#jZm-)--UE--P-P1P 1P1]US]01@01-9t-P XC-C-C 1 01u,1t ]bo]UU01@01B1R~01H01Zu,1toUWVSW -\ k01@01=-5-1thG9ua-CPW¡--J -+-1-1^^t5;8u1H+pp X@MSNjM󤣐--X 01u,1t e[^_]Ine[^_]UE01B01-)- 01u,1t]n]US--1-[]US-+1-)أ1-[]UU-)---+U У1]UWVS,ME 11˅t MPZMwDGƋ܃}tE0v h#mFPKE0u _E1t0wLG V舵YMVuZMM̋3XZ̋EЍe[^_]UWVSD`111EE h#E_t/}pt}rt}duܡ1EЋ1E뿡1E؃8u h#ljE^tt S`c[Ejh<"nEZYuE?&EP5--1X1EEԉEĿEÉEjMQjij HMt EU߉Ӏ\uA}\}u:jQj/j HuE߉< uO}tj/P_[X9UtltRUu賈ZYt%URh?&蟈ZYR}] 1xF $p+-E1!=1u 1}NE-9r,>WuZYtWh?& ZYuuƃ}tjuh<"ki j5-E0Vi EE؋jh|&P݅tT}q 1)Otދ1E؃xu*EJ1xF6p'ljUh<"E0脴ZYUu.J1xV P+-RE^,u1j5-E0gh E5--11ۉ]*EP EЍe[^_]UWVS1hkh$E[t01@01jP01H01ZYu,1ti11rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPh[#]Vhk# ]Y[ ȃ0 wF1҉U1ҍpЉvShq#&T1 EGuԃ}t{Sh#Dh01@01SSXtҁRWRW 01u,1tgu0P PSh#gҁRJY5-SZZ-@th#[XEEe[^_]UWVS$f11h#QEYt(}St}at}Hu׃Ҿˋ]E&E؃8t@9tE Sh#1Mԅuxt h"fuhT#u^Z|u1ۉ]܉]k] EډӉM܉]FFHЃ w!̋U9и Esuh#ft uh#EX 1RShjWu9UrMˋEÉu&11EPC P[sCP3h"#gZtWEUE܉U}uM}uGhT#2ZY t Ph5%ZXZu ;u EUE܉U1C 1RPuuWRPh8#Y 띃URE@ PZZY@Uu0蜈 Ph>#G}t]u]u ]uuRE@ P[^y豽0S PhW#dE؀x u_jBd1*tEUEUuu hp# YY$}O 1SQRP)VRPh$X 5-WZ-@th{#[XXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPS迣M 9t#t9uƉׁvSh#Sh#ce[^_]UE0 w @8u1]UVS]1tSzZ1tpVh%S ¸tVVh#S ¸t<uh"SZ Y^¸t0 vSƍZe[^]Åt2US-t1:-u-Au-[]È-U-PPR-PXZ=`1tM=6-uDfP@kPb`1IXY&u#jPh#9a UWVS}] Fh#U_%1ۃ<-u,-R-O#RPh#8V#Cuġ-HyPT-H ^ J 1ۋ-t#s#<-t"RPh #U Cuh*#:U[1-:-t2-O#t RPhG#-RPh`#uU Cu-HyPS-H YJ vu&h{y%W۪^Zu-@uK1-tPW褪ZYuډe[^_]FuWO#Ph9#Y`e[^_]USMU 1-9u ]R@uQO#PhR#`UVS]Ct&st P{ XCEe[^]{ e[^]UWVSP]1ƍ@uPXtUP0UBX1h1r151=11҉1Ye[^_]UWVS }t151EE519N 1BE-uB<-uzu+t 511ۉ؃EEE@tcu}t11ӃouUE8t E!Pu"Ft51U!RPuSjGY[+O#Phf#W^ru"}thz#`Ph#Rjf^SPXZDu)--u~uMe[^_]e[^_]UVS] C}أ1V-1-@uV-jMX18u=1un-=-u*=n-u:j̍^tjYt - =-u=n-u-=-u --1=-ut :-u-1 -u - - -@uـ=n-uC=1t 1u<@1X1P11jPV1X1XZ=1t6뻋u h#\H 11Pt1111111ۉB9tt 51 1e[^]~U}ujjjjVE01@01jL1Z8tPX 01u ,1u1U[UU0 wj jR Hu111UWVS}uEt ]uQ t9-u Ayu+UB1ۉ1ۿE?5Y]-uyt͉:UtKu5?:u$EEEjEPh#Yà EPh#cQy:u벉뮍Py:xuWڅuU?<:u!EEEjEPh#Yà tEPh#h-Njh#Z^1H9ujRh#LYà 1Ujh#h#/Yà U+E@1?1ɉE11ҋMPh#j URgNhURh#X ÊEEEjURu X( t1E1҉PjXe[^_]UME  h#pYP u1=1u11ɉ 11h1h1RppUVSM1tuA1u1:-uztC1B<-uztBu 1˅tǍr8tuPh#9Yy:u܀y:u.zu 1J 12u Ph#{X51151e[^]UWVSj*1^Qzth,#:8-0E 111j1Yt8zt h=#W8-u @P51P)Xu n19\x9}hO#벍EPYá01@011 1)<}_߉ƋM9sω9s x19r )ЍpkME)9s 151 01u,1tVSo[PY19} hf#01B01)أ11ljNx=1tE7r ZEy1ۍ1)‰ Lu11 01u,1tU1e[^_]Ë-z8U 1x@ @-J8-z8]ÃxuUSt Pq XK]HÃ8uU1҉P8u]UVSƋXCF~h 1A1Z1f@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P-JHR P UPUSUJtXxv-u~u C $t h:#-B0+B8PCXe[^_]UWVS4-EX=uE8t h&35--1} t u Eu P9!E@EŠt 9u u4--PP GӁt uu ljE)WPk 1H}t 1R\uG1x\F p\Sà u! 1x F dp 4-> 1xF Dp u"4-@4-==O A94--PP 1xV P-)Rx-X4-M)ȍe[^_]UWVS@} -B ]urVY wVhH#Vh`# 4&h{#j"S?FS͙Z؅tWh#}xM4&h#jP FSUWVS]S5-M EZY9-ulPY_H=`19s<wDu 9rMW5\1i ZYt%\1=`1M܋=\15\1 ##S e[^_]ø#-ztLUS`1tt#u*##4#1 #154-P`1ZY]UE`1jZEODU謳\uH袳 u"4--@8xtjjXEjjh"D _UVS-Xt 1ۉXX8x tjb-1҉P Y1p84-P0 1x1P10ƃ)c t,~tŁF $& 4--PP @\ |td;Z=t g u,?&u-@1-@d|u-@Ǯ-@)&t;u,-@ -@ q-@-@r-@_a=t0 u74-@4--B0ztjj`Y-1҉PjhB&Vtà ؍e[^]UWVSSá-@tuy =-,uyGEt7@&t,O8uQPMZYu@&^_8Et2jwV2Y_t XS4$PS- Rt -1҉P؍e[^_]UVS-p$ t jj-ubX(x,u{ upVDZuh#P: uBPVg-BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um-B]US]V9tjS]UWVS3t u%j _8XpZʡ-@؍e[^_]UWVSS-@}%11EuCPw C u j X1҉PYt8uj 1~^Xj 1҉VPXFYƉ}t'}ugEwRu D}twu}um-@-@}t_&t<}t jjG-@#61ۀ& r؍e[^_]UWVShEӉM-@E1E81E誰E+-]jEP&ZYtxcTd*"t~L tgF=.H#"$& Džd't+pЃPЃv;4--Yt藧PЃw tPd@d_ƍ@;w`u h]#<\u<\uht#ރ?PDžd Džd11\PЃ \w t0)Pw t0Pw t0脣 Ad9ud(=w h#0=1 á1HCw6 1?ʀJ R 1CC@wj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1Ywj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1;wj 1?ʀJ w 1CC 1 ?ɀQ vP 1P@ 1 ?{ 1?ʀJ w 1CC 1?ʀJ vH 1H@ 1 ?ȀP vQ 1QA 1?ȀH vJ 1JB 1?ʀB< vA 1AA 1Xh#}€ u 1 e a]tW t)蔣'~ \u聣=uh:#%4--xtjjX븲Š& <w 1C 1fxt @ 1C=u 1s\谟k u%4--@8xtjj^GJtujaY>uVZ0VXs;5d1};5h1~5h1}>uIy>u |u &u y1tm&ups1ɉK-djdB(-@(X4-Pj¡-@(Y-u @ 1҉P  躚s-X$-@ 荚-`H,hP S-p9-@ Y (\u: 151VXO"D8 .lhjډU1H\^{t &1\+-X 1d\@{1#Tþ}Tty&uh R.DYu[tJ}Tu@Td1e1jjhd1 T1Tۘھ &tJ 1xd@d\Xd\ &uJЃ wK 1xd@d\Hd\ƒt:@Ѓ v0t' 1\d\P 1xdX=d6X=d%:t #u&¾Rdh&7TYZ&d1H1tx:C X:xCdXdt\dd9‹\uADdd1 u#}t 1x#C $X#踖1Gfxufxt΀Aw@ ȋ-X2dVNj@f@f@dr@B&1҉Pa'uAW|B&u11\Nj@@&f@1\$ו1HNj@@&@f@e[^_]UWVSS-1ۅtXC1-0x tj-1҉P YF8Pv vS‹FP U8tSj-p蘚7jh"&P-HUJ@ B Κ]e[^_]UHu+]UWhPT81ld-`(1\}1󫡨-X1pjEPZYE81(1E-Tjh螙 :jh"&P -B t$Pt=^- hppDžt1ɉxR|T}E-jjtP‹ -pnX-`-dڙZl81\(141u jl4Džp#u^j2Džp#X-`-dlXl81\(1pu hpp}UWVS -@1ۉ]}¡- u@$xm@4$&jj}CjjlCQu;jF Ej@UBjj,UB뻡-xu j F Y1҉V @jaj 3^ -zu jCjUjCjD-@C u-x,u p [u h#Zj诿 -PS @0C>-Yx ubx,u\h%pz^ZuIu¡- up0-pY1҉US@PvjjfHu? 8j@-1҉P P-J0HCBHYvB-@ttjjjtCV-@^Xj蓾 -B0+B8C j -p0EC 5- ~ uh%vyZYt h%CEF-xj ƋE0FEY-xu-x  jj p0‰EEU表-@^Zu UBE밡-xt jj@0Fj:F -@Yt-Pv jj u -@FEM1҉@{j jC1҉SY^tNjjX=V-tt3j"-@X&}t-@uWf^_VjjJ¡- u@$x@1ɉutt;tj aXZÉs؍e[^_]UWVSP} uE E1E1}-X- u+p0ƉxXtӡ-p^[뼋H up$E0FEE럋]K9u}} uwj- 4-H4^SZYuh%#Ssj/vI t hD# -4-+A8FF-1x4M@u} u jj\1E1҉j 1ɉHEFE F -@0F[e[^_]UWVSS-@1tu=V-tt hV#LGܡ-@nAuWj 腺1BUjnËUBpXYUjU$C^Ut1ɉ ֡-@tj")pZƉe[^_]UU-1ɉHHPtjjX-1҉P t/Ht3-@jy-Ytrrhi#*-1U11ҋE]DUU Et 9Pt]UMt1tPt9JuB]US]jθSCU PUPUP X]UWVSEP[y h#9*u;5-~5-ExW8rZ=w PWVI `jjjr uNu')jjjjjjjj$jj SEpuju(Ee[^_]1=p1UWVS}u ~}th@VW~à VW萗ZY}t9u9t:Wx(X19t-y0L PVWh=#SQ(SVWhW#)9-}-؍e[^_]UWVS]{tN7Gu p1} t} t&Wxjw PR+GxP'YWD Z1Ce[^_]USt101@01uSwt1SRD 01H01 u,1t ]']UVSt1t/}u jS$ZYstFxP8'X6͍e[^]UWVSu] -9}5-9~-9t7S&jjSV+9ta8V&WJ PShs#'؍e[^_]US - A - ~.CPjj-& x9-}-Ps&X͹ؙ } l1]UVSul1 ~;d1|p5l1j V%à x9-}-9t0tVdYwN9d1~>}u}1ɺ<ƒu,EEptVl_9h1}Vh#0sssru>t1UPjS @Uut0W? PSh#> !9t'VjS @uut0? PSh#}!ju܋MZh"#rXe[^_]UVS]u M1P1<`&t#KyS PMX P&<uFtPh#S+ S4&VZYt vVuQShS#MSh6#EF y)KyS] P-Y P-Ph#S Sv XZۍe[^]UVS]r01u!u  1u01tX=1uOTuZ 1tO 18tCt>!11@1=-tu01uO ,1fr0[^]US]SYt ]]鋵h)%S9 YZtSJZu]US]r#t%S:ZuSh#j h11]UVS]} tKyS P ^(P ?u3ShO#q ZY?tH!VmPh$S  uKvyS~ P XɋP 뽍e[^]US01@01 1t8t PY4 1҉Y!1u11 01u,1t ]]Ë1u 1t9u=!1u 1UWVS]u =1u 1t8t=1…teu`tM t$tAW؃u>=-3=-u,=1u#=n-t=-u1uYEPjSn @}t tD1:=-tt!Sv=-<uu9ujPSlZY@t^u1u jSZY1E܉EEEK>v Do DjEPj e[^_]UWVS] }uh &sT`^_t}sh$V1`ZYuhr# j5- xh#V`^_Eur 1tF01@01 1P1 1ɉ 1[t jVXZ 01u,1tF@u111Eq}sh2$Vu_Y_th&"Vd__Zt CE1#~puM} CEh &E0"_ZYƅFMEu}}(th1ۍF~u 1u6u hw#XV?PhϏ% C ~ hO#oX1ۉ@ut hO#WX11 1tB 18u6u h#-_VPhϏ%C ~ hO#[1F@ut hO#Y1ۋ 1t7 18t+h# 1PE SlPh#-C@u91tLu==1tE0Zu)E0>-u~u1}tE1 111ECh#RXECu\ 1t 1Phh$Y[E PaÃEX?vEph!#5-6 h# 1Zu h#  1P XSCPh# zCuui01@01t VX 1t 1PM. Y4 1t jSJXZ 01,1EO111Ee[^_]UWVSuu 11ǻ 1tB8t;01@01W- 1P01H01ZYu,1t!1uu e[^_]e[^_]UVS]u 1u VSQYX1<vjS%gXZuƃ1e[^]áP 1=1u t8u1UWVS11ɉ 1!1u@@u 1e[^_]1҉!1=1u‹ 1t1}W15P1S!jP+Sy, d1t }wWk15P1Xe?!1uHuUS]91t$jj1jj(jj1]US\1ɉM=1u'=1t1t EEP111P11tjEP[Zu Eģ81jEPZYt01@01jEPpY[uO8Eģ81=1uы 1tǀ;tH1 1jSXZ몍Eģ81bjcwX] Cvv1ɉMMMMEPjyXZjSdYX1EEEEK>v yg DjEPj  [SP$ XZ51eU1E1YUWVSh@&PZYj'V+_Zu <)ș19e[^_]á01@01-t,UP) 1--Z 01u ,1t 01u,1tW UWVS]~;1Wu u  ~ )Dž~E u F ~) >f8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu"1CfKS u>01@01s>C CC01H01^uV,1tMV Ffu9s01@016CPRC S)S01H01ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9-u]e[^]e[^]U5-uXZU5-u~XZUPuu EPE u h;# uPJu' UEPu u UE Pu5- UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'V'_Ztt~tnhf#VpZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h@&VZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9-u]e[^_]se[^_]U5-uXZUh-Ih-?XZU8ruPhk#Ph#UWVSSEPE X85--1j=RU/%ZYj=S#%ZYU))9~߉Ӊ 1I 1<=t$t xFU蘙p UCɅxUzU] Ue[^_]JUE1@u,"1+"1Rpp h#jh#1#1UWVSu} ]t t9u t1141&Ft9t&!@t)[^_]UWVSS11ɋ "1tZuA=u܍P訕EY1 "1t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#SlZYSvNZ9u;Sh$j'S!#Y^ƅu+Sh%XZ/<'uh#sXuS)Ph#o e[^]UWVS]} sSt"CtS҉XuEs1Et Whu$Y_}t5uhu$XZ$-Jy R[ -z9 _F>=u y:Cu}th#z#FPZY-HyP-H X J e[^_]UWVS=#1u#1 h;#1Y11 "1tJG} tE t8tEt.#19P5#1#1%#1XZ#1CFσCF CZh8#1Ph## u.E,#1,#10#114#1e[^_]e[^_]UWVS "1t?Cu  u s} YCuSp ZӨ@tsCcX뻍w"1t묍e[^_]USjju' u1+ËPu@t s SZuۋCS D]UWVSuT1t#{VWZYtj=WY[XIjjVƃ t2@u+ƒ U t!Vt s VZu FV \؍e[^_]UWVSE :rtE11ۉUhk!#EYUt*}nt}ptڅu&}u Džu뾅t18u(Iu 1ujSVRu1E1P1EPjSMM у 1Ҁ9=uBtHt !H)u*@t$USuh'#O EUu0넅u* pxtuS0ZaShF#VRSv FEe[^_]UVSQujEPV Ë@M t 01B01tCUKS |uujh|&V E ucCƒSu u sa ZESS X 01u,1t1҉Ѝe[^]UWVS#1#1su s --s  ZYVCƒJujvXZ=StuPF K DPY_F u v ZCFC FCFS Xbe[^_]UWVS111Eh\#EXt1vt%et1f EփxuѾ뾋E E=1t&}t P- Y}t V7 XZԉ؍e[^_]UUE  E UKt ha#jpp 1UWVSUUu 01@01jXU:-u0zu*5-ɇ -Ǿ-C 1s_1*jEPRU<ǃ UuSj=RZYUtR贇VPVjRe E81s C1C@C O u 0Eu 0E% uKOKE tGG <=uRUVP tjRU\ZYU w"1u"1<=u "1H"11"1{#1#1 01u,1t e[^_]e[^_]US]tu s,XZ]US1ۅuh#NtxtIuh#uYu 1P1t SPXZ]UEU )]USME )u AR)[]W|$wUWVSO1҉j EPSEUO 8t1O8"u'EU9sSh # E9u Sh#R.U8@}DW@tE9tфu͋EUe[^_]g_UWVSQƉ%ukIe9Fu[~9uJjj8Y_UPsPUR Hx N9 uW XF!؍e[^_]UŠH8-u>1tfzuhx jjh&1zuHh jj h&BR.uhx jjh&h.#P?ZY¸&t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&Pb%_7;";f xuWSt[^1WSܹZYuNf$@&)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!]]貀9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$&SVz=Y[SVj=_ZYSV]=[^SVL=ZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PVz^_xPScZY04]E9uc9u_E98PV!^_uWxPSZYuD04MU9u9uE98f9]PVʶ^_t1oxPS賶ZYu鋅|9u;xu͋3E 3U $ !~t08u9ut1u u# 9uM F8Mt#y޸4#uPhs# ECSW YZ@u';"}$#RPh% E}t jW XZMuUVS@#1111W5<(9t j=So YZt hSXZ" Ph#j@]SjSh#j h-h<"(j hmN$h#ƒ &u#j Ph#mj,h#hz#\j hmN$h#K$e[^]U=41t 111R- 1141<1 1=t1t jY-----tPg 1-ZUj1ɉ P1~>R-11-Zxt@~j01@01jXZ11uƀ1@@u 01u,1tj UEt]UVS]u tVs XZe[^]UVS]u `&$&Vs [u CEe[^]s [2VDF4$VsJVs Vs[Vs Gs2VDF[ ]VsVs C[XZD[*uFEEh@#VY[EEE8.u(px*u Eh@#V_ZEEu uh#EffEƋE@xWBtG,%A[A< $ &CCA<2hIEܡ$1tP^u&$3ǣ$1YE܋E܊@<<~8Hw0$&b~<'tz<\tv<"trflnhrdt`v\ru R.DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС $1tPwZ1 $1$1tP`X1$1$$11ɺb E5$$1FP£$1XLx׉2Es}t"tRSuuh $10RutRSuh $1Ruh $1 @ $1 $1 Ek5 $1h$`$11t$11҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPub_XMƉUйjEV}t uWVuP(hWVStWVSWVN$1th؉EM܀"t'uEЉUmЊM<41҉EP$10f}С$1P$1UY^MmЃ=$1t^}ѹLE}mt(t <$SuPX <$u t <$SP( <$]EЃ}t%tPP$Suu LPP$rt PP$SeWW$u%}Nu 1Buh#C[^E@EEf}f8$15--fBYt*fBh#jK$1}9tǃ8뼡$1h$XPeY[^_]aUE E EE]#UWVS}0uh j jh@&MQÅu$Mh j jh&QtÃHxu Vh$E$ 6$:$~$ s$ w us#0$u $$w׸$w,rs㸏$Ḗ$w, rr㸕$Ḟ$dw,r r㸝$Ḧ$@w,rr㸥$ḯ$wr|r㸮$ḷ$ r$uS*$&@&;t3C7P3h1$jd,VE 111ɾ@&$tVF8 ($h:$j ,(PFPh:$j E(P A u,PeEP\YX1Ƀ Qt,P@EP7XZe[^_]U&Ph?$hJ.jU8$1$=<$1u4#PRPh$hJ.juUWVSQÉ210;#uCj EPS說 8t Sh$jJ E8tWSh<$j e[^_]USÊt%<#u4#S茽Zt@@$1]UE E EE]UWVSÉU}utj VS @t 9E s X8"u"3O;t):EttR.fDB@fO1e[^_]UWSPh$5ZuH1.j URPwà u8"u h$j1ҍe[_]UWSPh$m5ZuH1.j URP$à u8"u h$j1ҍe[_]USÃ=H1t =H1t?H19t6t2[#u$$[#=u$$QRh$ H11H1H1]UVSƻ&t[PV>ZYuICƒH1H1CH1Cd$1C 1f‰H1te[^]% Vh$je[^]UVSÉ֋t8uVh!$MjUR1YZtVh9$ H1XZ1EEe[^]UWVS11Dž=H1~ VhO$贯XZ1 RPhS{ =t=H1Vhe$3 f}Ut=H1Vh$J[^1ۋhJ.h$Ea6Wh $hJ.VvWh $hJ.CF (twu1h,&SY_ujh$&V &t"VP_Zu&fH1&uhP11҉zY[th9$ǡvVh $訡 fH1hi$S_Z1ɉ>ÉhR"V_Zu h]"VZYu6hb"VY_u Vh $ e8I1h $SN_ZDžum>jP11҉(Y[th $uXZ uh!$`Y[&;twWZt ucPVWYt uT-&ËI1WYƀ>th`#V޸_ZƉ>1&tR.DPt7hP11҉,ZYt$h9$y[_ Dž"!y v5Vh$@h>$61ɉƇH1H1$&pI1|I1|I1H1WH116C-fCpI1|I1|I1H1te@H1t>16C‹|I1H1hH1Ze[^_]UWVSP1۾&<&tCtg1}jSEPT thm$^Y1@E h jSP`1E4FZ9uuXe[^_]UEU M= -tMU E]j]USÃ=H1=H1u1҉Dt%PhH1XZ*0 u=H1t =H1t*0 ux=H1u=H1u7j豨hH1hedAS/ tHhH1hrdAS u/h$jahH1hedAP y h$ji]USQH1WEVdI1WEVfhI1hH1:fhI1X=H1=H1u2hH1hfdS y8t8t$rE=H1u2EPhmdS? y h$sZ$-h= /X=H1t1&hH1hgdS y$W]UWVEu H1t H1e^_]UhH1hmd5$- UEU 19s f3P]UERPZYUS]EPu } h@J.hSƒt$t< tj SDZYt1]US@-tsPh$( қ `E E!$]U"=xJ1u"Ph@$P: Hu9Y[u uVh$YI][<1M9Y<}Ph$]Y[1jP8` t5h$1uhJ.=tJ1~E1]9^~ t)t;FtF5h$1WuhJ.+FGVh$謡XZe[^_]USBHBy;B| X RQcXZ]UWVSQ]u uh'"SF fw4@&h"Ph."SȤ FPjh8"S贤FPjhD"S裤 Sh9%&XZFXt ShQ"Y_FXt Sh\"XZFXt Sha"Y_Sj 8v(hj"SDv,h|"S6 v0h"S%v8h"Sv4h"S $vu8t/jk} tu Sh$ ShB&_X뿃} tu /Ph$ 벍/PhB&[^띋$t $P腩YPxZ}t E1_jPSV y hq#jX7ƒu*t=tR謰$u hfU#y e[^_]UE(P1E P1]á(P1á$P1UE PuhJ.FhJ.j }j豊UWVS]p8ށu= P1t5(P1h!#NYX=K1t"= P1u5(P1h$*1K1XZuu ZYyW谯Ph"$ t7= P1t.j X= P1toP5(P1h$ȓje[^_]UE Puj' UE Puj UE Puh UE Pujj茉UWVSt1ۉ$P1Phг%P^_y h$YKhVuL }t Ƅ1ۍPW8PYZyWh'$NXZ]%=`uz 9u;u$P1Whh L1$ à uWh7$뜍xPSO^_yS끋%= ShQ$e= u0t,WhVi à t ߻Who$+WY#0hV#x à uh L1h$BXZ멉؍e[^_]UEPTZtPRPh$ u uh$hhK19K1U塄K1tjXj USYj0h&jh K1jjm1]USj趫jjCjj:]UWVSÉ֋x CPww wwփt=@P1~j _X@P1e[^_]UWVS1=4P18P14P11,P10P1,P11 Džu/h$h$ u[^Dž SUYu\Åu@3hVJv ǃ uVh$TXZPXEtVh$ӏ Eu {u{wu"Wh$hJ.. DžQCC jhPjV Ãt'$Phzd@S舿 @uS褆 [W}YD R.9rDYt)PH,P1t4KRWQw u <tPȉj} WH} C1ɉK C C1{;0P1C0P1_=v1LABLCEȉC ffCRVCPZuuWY^S~fCe[^_]US\S1tcQRP$\S1]Ƀ=R1tf‰Ã=R1tUWVS$ƉӉMСxR1EF,E؋BEfER1KMK R1Et EEM MEE1;=R1R1>f}3EE܋Eؙ}E)9EE у}uUuG=R1=R1 }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AExR11}fG18f@@XZtA 15R1xR1C,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=xR19E9UʋMou{5xR1C,)֋C,C,)s$S(;h$SNjCSMEAE@ufFZ[tA 1R1Ee[^_]UWVSu^8C@Pvu uu uhPu uR1 )P@1ɉ5TS1NP t1҉ 91CtCS OtNCSWV\ +QCSLCS >WVy\ +CS yP @1t|u!<|uxuxx u xv8|^u |txTS1=R1XT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp xR1TS1H0|Ãx} xR1x5xR1f-sTS1B0C9sjh-V^5xR1 C =R1t@Y @[ JPdh t19}#8@#BLlp>Ãxjh-p^Ph#$j=R1t h7$vYhC$OZtWC jjTS1@0 RPJ P^_DTS1@0Ɖ =R1tL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|21R1 ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jjTS1@4 RPjjWVv f-xR1Hɉf- f-f-f-f-E-=R1tE-]E]C WV XZ=R1t CpSt C(T1ҋ TS1I4 xtWV`([^11tjupEZ xR1f-UJ TS1@4B9s$Ujh-QMZM xR1 UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_#f@t#PhJ$$\=R1t+=R1tC CC C u#hT$pYhc$ڰZu1R11nu t3f@^_`P1dP1jj ¡,-ƅDž Dž1 R1X[tBBp tBBtPR^_t`P1dP1hm$Ӄ[=R1t/5(-jjjj`P1dP1uh$蘯Yu5,-RPjjt0S1=R1toh$ob5`P1=dP1ut(jjX@[ZHfAWV$1`P1dP1XZ=R1tj *g_`P1dP1ut!jjRP!`P1dP1uu h$RPof%[^f=@h$sh$臮ZY5`P1=dP15(-jjjj`P1dP1utRP5,-jjEhjj5dP15`P1YƅDž WV}@@PP WVaf@5dP15`P15dP15`P16^_8th$x1ɉ R1[R1R1tCjj RPTP u{C9s#Qjj RPj0UWVSSƉ׉uEPQѨU 9t:tWVhR$$jJe[^_]UWVS É5R1PSXZ=R1t=R1t hi$$TXVSa^_t u=R1u1hs$$T[R1=R1u6TS1Ph$$ToSZYt h$$jTXh$$_TXr=DS1t8=R1t h$$'TX=R1t h$$TXh%$T_=R1u hB%$T^'=R1u h`%$S[/=R1u h%$SYr6=R1u h%$SZ8= S1t=R1u h%$SXPTS1 $( @8 $(RP5tR15pR15lR15hR1h%$STS1@Di($ʉ1WVRP& jj RP% RPk(dd$WVRP& RP ($h&$z7@=R1hR1lR1+R1R1 TS1hR1lR15TS1NF)ڋ~,f,pR1tR1Ӌ~4DӋF8׉֋ $(+ R1R1 pR1tR1u't2!RPh8&$v6 =R1FSQhL&$U6 =DS1t4ha&$?6DS1Xtssh&$$6 j 75X=I1S1X=R1t =R1th&$OT1X=R1=R1u h&$O_=R1t h'$O^zN0Phг%, Y[u70t-1҉,j,R Phг%h͍%t=R1u h:'$OX ) e[^_]UWVS]s{{@u(EUE9E1s WVE܃ WVh61$s sGT1T1EUT1T1 E9U}Xs shF($TN =R1th`($9^Ehl($/z[u1ɉ R1j<jT)C EE}d}uJЃ1R1r8pR1tR1jWVp tEWVh9/$s sT1T1EUT1T1 E9M}s shu($j >Zu#1ɉ R1h($Lhl($ y[^px @S1u@S1DS11҉DS19t9zu9rt9zu9rt@S1C0S4MEEe[^_]Ƀ=R1tf‰Ã=R1tÃ=R1tUWRPY_}UWVS0RPM詀R1xf%ftGWGW sft3j`hPQ1GpP umjhQ1P uS3j0hR1G(P u:j h8R1GXPu u#C uu utkh($ Kh"$wHu=#ZY=R1t P1@ Q1 h1=R1 T1T1 TS1t04A09rAA09rf@u79s#=R1 h($=R1ufuth($u^HufǡTS1@4EY[=R1tGWGW f5TS1N0ASQRPN y%=R1 RPh($ f`t f ufp=R1:9=R1h S1G(RNd1RPS5R1Awt h($DG=R1t1Sh)$*-!PG(Pz=R1t 1GG1GhX5TS1(R1xgș9rT=R1t;9ظs1ttht)t 9sw Dž1H~A^tڋNtftH붋 5R1 9ظC tIDp Dtt=R1u0D(PSh5)$+d|(븋DpTtuRPSh[)$*/ TS1119ЋAt[ C띋RPh)$** t uC~3|X=R1JuDXVPh)$)[^+W-pYhR1lR1G fFf[j k5Zu01ɉ R1h)$MDhl($ap[^u-ju~jXpHLY4DEUE9ƉU}4Ѓ1R1뾍U1E 1pR1tR1hR1lR1ETS1];X,W}}1Euu TS1U׉e^_\Ttq֋}!qSI SQhS1To5S1TS1}󤡤R1=R1ttt5TS1u5S1脜 =R1tE@x TS1E1E=`R1t7TS1p,kEd1E;SVuPhm*$hJ.$1=`R1=R1=R1ExU t1U u E#uh*$;[^ExU uۋ}G\M]ȃ}tgu EUHu}u}11ۉΉ!!u6u2EU}9}u܋}9}uԋEUEU}uE|S1ËE}uu 1ɉK<}%?}u}9t uuu+EZuuh*$:j1}MECEUEUtxu}9r WV[X M89xu9tuËEUtx5T1=T1 T1T1TS11҉EUtxEUtxt1x1 E9EEEEe9׾r 1)ӉΉߋ|S1E]3u us2S1|1҉TYm9}u9utc%?u9tWVh*$;9jSuH/YXu Suh*$9uEsE)Éٍ1EPE 1R1e[^_]UWVSEP@EUE@ E}juu艻 tT1t`}9xuPu9puHEuuh9/$Ep p T1qyEpxu}qy T19@S1u @S1u덋=T198tEUMK؍e[^_]UWVSTU1EE DS1T1111ETS1H,9M=`R1t5kEd1M6SMQuPh+$hJ.> 1ۉ`R11ɉMTS1U;9soWVtXZt`u} R1tCCpR1tEtCCttEWVkZY8tEPSZYuE_Ee[^_]UEU @,+B,]Ƀ=R1tf‰Ã=R1tÃ=R1tUWRPY_}UWVS Ep8=R1t 1Q=R1tt1;R1R1slj}1RPj@F[_DžEx48x0.Fh%%PI]ZY"}O_ u9t+$>tFPh+$s4Y_L+$Pn`ZFfSPV wh>+$>`_tr<Fo)efFYPVWGfSPV|E@0P4p pihfH DžU;B0B4wr r@Y[=R1ƅhhS#Pw R1 R1ufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFhS#PYZYucA1A =R1 ~h+$Ep pFh-$^H1R1EHX P@uuȉh,$SQRPVFD9]+$>tFPh$,$y1_Xl+$P][tguE@0P4=R1t hK,$YP1҉P FfPh]+$#]_u@@ uE@0P4=R1t hK,$[H1ɉH F>ufWV3 C+fFPVSfWVuDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uhZ,$ ~ .u)hj,$Ep p֝1>h-$[EH0P4 19R1R1s h{,$=R1tuHu<~t6h,$1RPEp p蔜=R1uHt%~u븉Fh-$&[[H1f1RPcXY,t#B<v^uM;A0A4o h-$1RPEp pЛh,$ZW1ɉ R1?M;A0A4t!=R1=R1+$~+$R1RPEp pPh,$ZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0Ph,$Ph,$-=R1t h,$Xh,$XYU;B0B4}R AAQ=R1tTVC9tHh,$1RPEp p™CFh-$~XHt 1҉R1 DžfKPRh,$>+u Dž 1 e[^_]UWVS\jj`_ZP$&h -$+h$W[^u 1ɉ R1}hjjjj8h>-$+h$W_Zt5jjhjjjjآu h#-$X*1ۉR1hl($SW^urjhejhU-$+h$,WZYuh-$W_>jj%[^@%@3fs Phn-$)=R1tjjY_fXZh j5$S154S11ƅDž 54S1$S19T=`R1tD+4S1=$S1k#)WSPh-$hJ.1`R1C$w0h-$ss xR1A 1C$h-$ xR1QC SRPRPhW^ xR1C$1҃=R1tQRPWh@$h-$a)QRPWh@$h-$b)=R1t h $_ xR1C$D1C$=R1t/ss CNjC$1~YY=R1u$GW 萷h $TZHt1R1GWڍ@1=R1@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=R1u4S1_54S11ɉ R19s؋{$@1=R1@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =R1th-$SQRPOhS#vvvv 蜓fOWh.$SQRPh-$Pu 1R1,v vOYf@fOFVFV RPhS#vv 訒4S1$S149s$;ww Y1҉WWY_8u؋=4S19s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=R1tUWVSX$S14S1D4S19=`R1tA=$S1))Kkd"VWSPh.$hJ.8 1ۉ`R1ss WZY{u { <{u{t t&5R1tC=R1t8=R1t/u*CS 9RPWf@1C SCSut+RPWW¡dR1Y_:u9|Css菰FXZ95dR1|)js s賜Y=h=.$E"hc$YN /ss^1ƅs{Dž  R1^_tBBptBBtVRPZYu hd.$x!_Pss觛tQDž ssvVPtUf@Y[5dP15`P1UfHXZ4e[^_]UWVS EP@EULS1ETS1RVuu EEƉׁ\TtCЋU!CQC RPhS1R5S1TS1}󤡤R1=R1ttt5TS1u5S1 ExU t U tuh.$ [^1}E@ EE}juu跢 pEUЃ1EUR10M;DS1Ӆt3}9{u}9{trzs{DS1RY!}tdExU uEp`ơTS1RPuun E؉U܉Ѓ1EU܉M؃3pR1tR1Ex@t+jjTS1@4 ؙRPEpHpDp p` TS1Ez89x t2}t,E@$ EL@ EEUMW}tu}toTS1E{89x u^E@EL@jRPEppO K` tPuSzch 5TS15[^5TS1BLЉ@D =R1uh-$ [Huqhu8$Y=R1th 5TS15hSP5|S15R1ƃ hS1lS1pS1|S1=LBALt[=R1h ;$`h-$tY_jjjjjSW;=|S1fGWW:fGS1CJtejPh);$ =R1uh0$ Zu9hG*$X=R1tC=|S1fGW9fGS1_fCff=v]h^;$Y=R1uh|;$Zu8h;$3X=R1tfC=|S1fGW{9fGS1_fCffuih;$AY=R1uh-$5ZuDhu8$_=R1tjjjjjS:=|S1fGW9fGS1f{f9}zD3<:uX19]~KؙEURP5S1VW蓯 S19tؙEURPh&$ S1E e[^_]e[^_]UWVSQƉӋJt,B=S1h=$9u#s sRhs=$gC 1҉Sss ssV T11E1ۋTS19)؋r09~ƋL߃=R1t VWW* TS1VEA8HLId t1RPW5R1=R1t VWWu* TS1X0Ede[^_]UEU z t]]UWVS]TS1Hdu } t1[19{ u9st7S5R1[1uWVs5R1Cs{ ECe[^_]UVS`T15TS1`T1t+NdEU  t19S u9CtCt[`T1uh=$uu uS$SPC`T1`T1X`T1K؍e[^]UWVLU1u} uĉ}ȋEERSXe^_]US]U tuwtttoPh=$ {@uRs s: Rh$XZ=R1th=$蛷Yh=$Zu 1]UWVE5LS1TS1x=R1t5TS1p5LS1e+ e^_]`R1ÍL$qUWVSQQ9R1 R1s RPh=$/5S1 TS11ۍ}WSQRP* U Ƹ8-;sAeY[^_]aUWVS\]u EUEUEUEUEM1ȋUM1 uE u uE г%)uu*_Z=[1u <vuE #]e[^_][1U1EEƃE9Eu E9EEUEUEUEUEUEUEUE ]uuOURP\S<)lj$SWNwG/ 9rbEUEU}t@EUEUE ES#RPNURP\H1҉[1#}u1ɉ [11[1}u}tF?N)Eu ]e[^_]飜UWVS]\T?2} 4E uh`跹} Zu h>$h`SP: =R1t h*>$=_=R1Lu=R1uE PP%Y^E \=R1uPPK%XZ1f Fff F@9u=R1tE PP%_XE \Ǎ=R1tE PP$Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\Pp UWVS}u=R11R1R1y R1h T1P^_=R1=S1=R1t hd>$j[h>$eY=R1u׋TS1 S1=R1ux șRQ (T1,T1h S5$1=\S1=XS1=R1TS1=R1t h>$^h>$[u 1ɉ R1=R1TS1ƀ1҉PTXh P5$ЮY=R1tsh ?$輮R1h 5TS15u6G뭉Eu蚎Ee[^_]UWVS}]O,uhB$hp&h` ؙt,h"D$hp&ha hB$U Msu)u؍e[^_]UWVS}]O,uhB$h\&hq ؙt7h"D$h\&hs hB$DUMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}[1t5R1WVSh8D$ySWVu5R101e[^_]UWVS] u}[1t5R1WVShiD$xSWVu5R11e[^_]US= S1t hD$|?j5[1{[Zt!hD$Ghl($[ZYujn5[1xX1ۡ[19XL~$[1t@Pp0hD$(x Cҋ]á[1t%Ux,tP*Y5[11[1ZË[11t z,tUu uuuRUWVu} WVZY=R1t@X@d=R1t1s&TS1f`u131 ȍe^_]UWVSR1tH [1 [1TS1!`t'RhE$ۑhl($ "jmatuhlpx1RhQE$脑hl($蘽 th6E$TS1 ǀdƀah P5~XZe[^_]UWVS]} 1uu11EhH$uWA tFft1At1PuJEЃpu~jjhJ$SjujjjjjS iytWVhJ$S~WVhJ$SjujjjWVSE ,EEEEEPHME@ uWVhJ$S`~0E1ɉM܉EuuuuRERhK$S EԋMQуt;t6juj1RPEURPS uiMPBL$S tRVQuuhZL$SWVS @u hL$S>truiu`thL$}u}uhL$SY^,(SR @u,(hL$S EjjEP11ɉ6 @SjjjS1;t-jSRYZtW@ P$@ utS9sKjRP jWVS@u/tPFN ZSjX1 $ ؍e[^_]USQ]tdҀBuCu'EPhd@ @u%hL$SXZuShM$S E]M ]US]jSZYZuhTM$jS? YZuhM$SXZ11;VF|~$u~,u;VV | F_8tZu[tuxY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ||t2@|jmURj$O8QpUR|P赓tijWRC uYjuWUu@uuZYjuPUu@v0shoN$u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0hN$S? 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uhN$SZY<$E܉E1EuuWVN= utuWVhN$SLEPuuuu: Ɖ׋EUutuuuhN$뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^h%57U _X1td1SщU&M觑YZMt/UBuSh O$u h%jU XZ뫋&&  Vۉe[^_]US1&&uh&O$N`u܋]UWVS ]} Wh#Sȭ 1&&EԉU#E#Uut7#;t#WPSnW&SaEԋU!E!U`u}u}t;uuh4O$juVL#;t#WPS WVS؍e[^_]UWVS]u tEU E Uuuh;O$SY[ SZu E@P9sPVhJO$SۍFEPS Y_EtVhiO$SV 뭋EU҉EU#G0#W4 E UG0W4SZ@tuSZYEU#A0#Q4 E UA0Q4S_@NVhO$S Ee[^_]UVSP]u >u>j EP57W)U ߃ Ku;=?v57hO$S A BEziuUŠu 57hZ"뱍e[^]USQ] ;uX=1҉j EP57( U:u1҅u.8u 57hZ"u Ћ]UEUitstau+u P uPeZYUD@RhO$P2 UE t*u 57?ZYt57hO$u@ US] ;u#57Y1҅uhO$uXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~hP$PdY[E1eRP $RPP[Z/@8Zu%S57>ZYQh P$P ֋]UWVSu }jj h#WVj]SA yEWVuh9P$J}t Sh"$IZYj IXe[^_]UWVSQ]M tu E"E𿵶"QhAP$S'M $joYXZM uWh\P$S 9jVQjjuuSU 1ɅuWh{P$SVy]‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_ZthP$6jSY^ujjjjSTEU}u&}u hP$SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt hP$PP @9E}}EUuu hP$'EUjjjS@ $uWY_u hQ$jPjuujjS8 uV[h>Q$SU p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PSg<_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS <ZY@UB߃}uujSr@jp juuuuS u h^Q$b @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9pC.tE &1҉Ue[^]Q,(hR$&$hR$dE$1RP,(C4 RPhR$ hR$KjS\ uhR$KXrX CRPhR$Ds,s(hR$s4s0hS$$C8Ph#hxV7Vh$S$DsPh6S$D 1e[^]UU E$E8E U]UWVSQEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^hS$PWE UEԉU؋E9EE]}5Eu"WVuu uuuuhT$Pz(1 AU1]1 u`U3U ]3] uPt3}ut(EuMWVuu h`T$PMEAE A E$A$tMu}t=S$}w } &S$w&QRh|T$u<1ۉYMuWVE Uà  E C E$C$E;EMu7E;E u/ACKtX EYEUQ#E9Eu0E9Eu(ACKtXYE܋U)AQ qMԋE U+EURPEU?E t]s{ px EUMԉQE܋U)AQ A}G{YK_Gtx)E}䉸hT$u"XZ؍e[^_]ÍL$qUWVSQ8EAQE؉U܋A QEUqy19WVuub, ut-E؋UWVRP- ΉE؉UMWVuu, ut-EUWVRP- ΉEUMEEă}Eăx}PEЉU1M9ˉËMY}u}tE9E؋E܋]DE؋U^9E؋U܉EU}XWVuuW+ EU}u}t6EЋUEȉUWVRP)+ Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}u}tE9EȋE̋]9uȋE}uH}uB19}FEPWVuuH( ыU}ut#ΉEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@^1EċEčeY[^_]aÍL$qUWVSQȋ]yIX P@E؉U܋w yhT$uhT$urXZ~thT$GW EUN^ }u}u O_ uuSQM؉]s) M؋])9]u 9M@E9؋U}SQuuh U$uO_ ȉ+EUEUVFV +EUFV FGFtxM]M]SQM]uu( ҋM]ut&M]uuSQM]( M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U# M]uhT$ugt tN-}uA1h 1h RXYS}uMQh!X$S jHJ8QRUP0(Ur 1B$E1r(z,ꀃEE}S_@tPS^@tFUȁ¾1uuuRuSz@uh=X$SZY1EEe[^_]UWVSSÉЋt""""Ujq Pq qu uSU uWhlX$S &PSZY@uWhX$VWhX$S|1e[^_]UWVSÉu uRP@ }}t}ME"E쵶" UMEE䵶"E"@ Ur $Ep PFVEPF V$EPFHVL1Fv VFE0S@uuhX$S uuhX$Sb1e[^_]UWVS]} tE h&1ue[^_],SEUjS thX$SjSrjSd jSVjSH u uhY$SY[z uhIY$݅t)I }9y$uu9q tGPh{Y$S 븅t*t u5Xu}+rz WV tjj _Z@ultjSY^+uu tjjr_Z@u)jjjjSuu hH$jjjS4ƃu hH$1fdžUjuu썆PjVjjjjjSC0PSY^@uhH$ShY$S0XZ1e[^_]UWVS4u ] 1E0#hY$uV^ tPSu @u95pC.th|&jZYjh Suee[^_]UWV@'}^_]UWVSH]u }1ɉM܉MMMMMMEh)Z$WV^ Eԃ @t=}buEPS^XZ׃}qtuԍEPEPEPSv@uE95pC.th&jE1;EE}1SuMu_t xuPt9pu 9uU@uuuuuSsẺUЃ}u }E܋UEĉUȋE؉ES|ZEHEPSEjh@'PuuhiO$S\ g$1RPuuO EUSXt E;AtIh3Z$S_Xqy 1U9ЋU}`9u\9uuW}u}t,1U9ЋU}=MuuWV ҋMu#u}t 1uhcZ$SY[uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,S'Z@tJup(x,S:@t$uűMq1uhZ$S>Eԍe[^_]UWVSH]u }(,EUEhZ$WV8[ t(qtsu&jsEPjjS@uzE95pC.th&jG_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuhZ$S Z$1RP,( Ɖ׃uԉ}؋M9ȉЋU}WVuuhZ$SjSEY^tPE܉U}u}t h8[$Eċ@ EjS_Zu hTM$pjSY^u hL[$Rx G EG$EjSg jSY tu hn[$SXZE9Eu"E9Eu}u h[$S_X1E̋p GPGTEE܉EME9s3Mjh@'V MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuh[$EԋU+EU9E| h[$.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u h\$SZY^ U܋MHE܋U+EUЉQ}u h$\$SXZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uhF\$S @ r $󤋃p PF V$1~PF0V4j\V\FSv H PAQPA Q$PƉ׃q0y4AHQLS4@Eu}UԋEhg\$S[^MffuSZY@h\$Íe[^_]UWVS]1uuuuu11h\$uu U btENtoat%itClh-&UY1EPS&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9pC.uEU t th&jHZYWVRPuSwe[^_]UWVSDE։ϋ$]$ẺUMЃ}u}tE uav"]t\$WVPuu ";E] er#E \$t\$WVRP#1E%EtEE@u}wERj h#uuPu  z*E }\8Ev"EtE\$ű}E]$EBE@EtjhWV  %1ҋMIM˄t u tfRPuj MQ!ƒEE 9shEčDU)ÍMQSEʋUXY}u ED }tjhWVj Ɖ Euu EʈE}t"EˈE}t t ű}؍e[^_]UWVSXE׉M]u E]u t4jj h#EƉRPj]S^ y&E j@URPUME[ƒ u묉ډUuuuh]$!U:t Rh"$!ZYj Xe[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.P!'XZfx8tNUVStjmuVj$8Ph]$jT9jVEPu:$t Sj79XZEe[^]1UWVS΋UM x$&E']$u 1ۃt h.]$y XhH$l Xuh 󫋆Rh>]$ X&8Vh#htV=Vh8]$ÃhM]$E\]$e[^_]Ej]$~u1ۃ>t h.]$Xhx]$؉F VX1ɉ9u 9Auh]$ h]$ _t6f~8t/sDžuQzjmWj$8VҸ6tt tVh#Vh]$hWWh9]$ÍtY^99W2ChH$SZumudh]$4E E]$e[^_]X=߸]$u PPh%à #ى؍e[^_]UWVSljӉrh]$s3h]$s sh]$ tsh]$yXZ{thh]$gK Cs31| C "C 8Ph#hSsSh^$FPh#htWFWh^$Vh$hS$(Vh#hWWh^$WS_ t Shw^$YXVh]$hSWS^t Sh]$iXZF0V4ut!RPhPPh]$;ÅtPh^$ SR0 e[^_]UWVSxƉ|PE_|t 9St[Rh ^$V趸 T{ sډ5Rh#^$$1Vs3щ¸:^$A$1Vs sщ¸R$(Wh$hV Wh#htSz SVu]ZYuhh$&Vz SVh@^$GPh#hS7 Sh^$$jmSj$G8PŴSh^$h^$G0W4uu hO^$#!XRPhPP!1e[^_]UWVSxpPYps'2N xR vh%x hT^$hK$x hT^$hZ^$h x \ tDžl\$pt Džl\$p@hhh lv6x lPv vx l3 Fp `Phl^$N Fv61 f~ Wh$hS Wh#htR tRSZuhh$&Sw Ph#thr^$d~tu-h \1h#hS Sh#th^$**Sh#th^$GPh#hSU Sh#th^$h#th^$ƅhj h#FN x$$RPjS  (x Shu$|XZd#t1-&FN x$$ʹ#dt0$SRPQh^$$`t;FV hQpщ‹x t Ph^$[X ^jmSj$G8PưSh#th^$ h#th^$G0W4 uuhO^$ YhRPhPPGh7#EËN Fv61Xd `FV hQpQщ‹xǃ ted؉W0VZƒs0\1\L 9sHt)))к WRh#Ph^$ Ftw]F 8P%V 1󫋂Sh#hSxSh#th^$  ve[^_]UWVSX1ɉMMM 0\111h^$uu >E ǃ x`HttWtA}ˠ뼍Ol$&뤃럍EPu EPuE_Z@u7skc [`SKh0\1uZY4hP'jɿY_! F=0\1hra#|ZufJ.ft)$URjh jjj jP- }uEPhht@WC u E0\1u<ttu$0\1P"0\1x0\1 0\1@s tE 9pC.thP'jپZYju8^_uEu h^$zY؃tڋEn;EE}3uMuZt xuPt9pu 9uU@܋EEtى‹EniE ǃ>v> ÀtGu_1tq EVj@MQuщ‹E t P[RY9sNjFV j@MQuщ‹Ex tP,RZ9EsEv뎉}E?v? E?vE?%EuFs}sEh%WhV^$ahK$uhV^$OhZ^$uY}vv vv6h#_$ N Fv6" yv뼋VOQMQSщ‹Ej tPWhV^$ FV MAQMQSщ‹E8 tPuhV^$  FtLPh/_$_XZ N Fv6^ vXZ7 h7#Y1e[^_]UWVSD] }1@'}Em_$uhz_$uu :@ tfitJTt,Lte[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPShD`$W 4 uEyƒt tShd$  p Dž@$A 9YΩ Åu3 Ykuhd$hd'hh_$P>; tVh#htW Wh,&SbB tFPh#hWWhjd$S;B bv$v h%SaA Fv,v(h/ %SEA *v4v0hG#S)A jmWj$F8P*u$S _ZWh$SA uhd$D hd$ [D I Yu h#C t9h^$<XZu&hG$蹟SM.J.VSQ_XJ.tV`^S%Z1ɉ Xe[^_]UWVS]} U#1,hd$R$W1  @$t&Ftiu57Dž,9=pC.tE '1ۉ]e[^_](,$($jSMZYt,uhd$*jS/ZYujS!ZYt,uhX$S躜 1ɉHh#VBYZud$V虮 Zuhd$hc$ - Y^uhGd$륋$1QRPgz uhe$SC c 1 hd$ ۨ XZthad$VȨ ZYtjhPz u$h2e$SV   4PhF$V4 F41$1$8Phjd$V= TP8Y^!1RW($J $( ,10$(+hd$ 耧 _ZOhd$Pk ZY4P _u"jh@'R蓻 umV Y8Ph,&W< dR8ZYdt8hMe$S 1ۉ,DPh%W/2 LPh/ %W2 g,9DH0|;LPhpe$S莙1V $@Pd , uhe$SXZ:jjj,Bu @u he$1$ 9sP,Q= ;$u9FjRPQd,Bu @u he$-he$r$, ;$uF9$shH$ = _X h &R Y^Px ƹ,hWd$R P Z5 X+tPh_$W0 t,0Ph:#W{1 ,0Phc$WW1 ,0Phc$W31 ,0Phc$W1 a,0Ph,&W0 =,0Phc$W0 ,0Phc$W0 ,0Phd$W0 ,0Phd$W0 ,0Phd$Wp0 ,u/(~ǁ#,$ ,0Ph,d$W0 ,0Ph9d$W/  ,fǀUjjj+)Bu@uhe$SI$, ;$u ^u&H$,ȍt R _Y4t 1󫍽@Wh,&VL7 tuhGd$SՔR@ZYu(Whjd$V7 tˍEP@_ZYt@hMe$S腔 fEPh%V. tEPh/ %V. mEPhG#V. SWh$V6 tj$EP@1 sV\0ZYu+C xu"t s srEYXj ZuXe[^_]UWV։P Zt h h$j? jWMQE 0Xe^_]UWVSuE @80ƅ77Ph4#V t 7u->HVH ,Z3V _t h9h$0x jWh( Ttg81ƅ9(@󥍅8Phgh$jPSx0Phgh$jPuVw VShmh$j> S[t hw$j> T˅tdS zuW$(,s.ZY(u1$zu%B Nj] t>sV)ZYu+C xu"t s s>YXj Zu4Xe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u hL'hg$u+^uhL'hg$j18 sP3Ds WsDh#%uk t.PƝ Eha$uN E tZu褝 EYLEPh#u }Chs@Pu @qhxi$uݎ XZt V7 Yhi$u迎 XZt Q XMEPh#u^ E Mu {hE EEEM؍CU`EPu u @MuhL'hi$fEftft5fu6t2C t Whi$j6 }tC(Uhi$C0ut3hi$jR6 t C0sHtS4KL9sщ}t:s@shuG us@s`u2 @u;4481t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\hi$s8sXu @u s\h$te[^_]UWVSPu׊ Zu1du _tLVC Yt4W] EWu ' tPMQSW uS [1V ZtS觊 X؍e[^_]UPEPh$u " ƒ 1tEUWVSu\Phi$V t\Mfnj4Zu\VXtd$1jRVVhiS@tt}f1RPhi$u 1e[^_]US]uu S? @t ]]1]UWVSu ul [^u 2P葙 Y9Es2?V蛙 Ƌ}M)1Ze[^_]UWVSu u [^u R2P* Y;Er52?V4 Ƌ}M)1Ze[^_]UEPh`-#u ƒ Eu1UWVS8uEPhi$V uh%hp'hhi$R+htVh|j$^Vt j7RPhFj$hS;tShj$!Sw\ e[^_]UWVS]h2 @؍e[^_]UVSuV|ZtÍEPhӷ$V uh%h'hhj$(uS#1^Xu h=k$jt/ CPSy ZYu h'hOk$Phxi$u S uh'hik$j./ S1e[^]UVSSu] EPSV @uh<'hi$j. hk$VD ZYuhs!&h<'hhj$6'xi$Eua$PRS輆 He[^]UVSSu] EPSV @uhl'hi$jv. Eu hi$j9. hi$V跅 ZYuhs!&hl'hhj$&Phi$S; He[^]UWVS}hs$Wg [^u,P舓 pY@vhk$VfZu hk$j- VPhs$W@u hk$jw- xtdPhiW/ thk$뮉`S[X`e[^_]UWVS}hq$W袄 ZYu+rPƒ pVYXuhk$DVShq$WK@u hk$j, 1҉Uu]EPhiW#/ @u h l$j, SX1e[^_]USÉЉʅu #tb#QuRPShl$?]UWVSu1j+Vhxi PW @uh$l$ UЉUPXۋUu h=l$j, U]Vhxi W  @uhcl$ڋE9E~E19u~tj YWh$FXZj SjUVSPuVZt"ÍEPu V @u Sh|l$j+ @PTUWVS$ƉUЉhp$P讂 [ZtP ƹY1@]Shvi Vs-j S) Php$u à Vɫ HZe[^_]UWVS(uEPhl$V uh%h0'hfhj$"#MԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EPr XZtVhp$u V V He[^_]UVSuV[th#%Vj ZYuhs!&hL'hhj$\"P譏 ^fx PSr+ZYu h=k$j) PX1e[^]US]EPhl$Ss u F(&juS-,ƒ 1Buh'h$w@XZ]Uhl$1US]dPhV%S uh%h'hhj$y!d|lPhiS8+ @u hl$?X1]US]dPhC%S uh%h'hhj$!d|lPhiS* @u hl$z?X1]U1EEpPhiu* t hk$j'( 1Uhk$uq ZYuhs!&h|'hhj$c Phxi$u  HɃ0 v+BwBÍBwBUl&]UWU1ERhiu) @u h l$jn' 1}W|$wUWSÉЄtGjj h#QPj]Sk SZ z#tb#PShl$ hO1#¸#@Xe[_]g_UWVS,$.{ uh'hm$j& jLh-_Z#tl$jmh-lZY¸l$u#WPShm$hJ.=h-t VW?Xjmh-&ZY¸l$u#SSSSSPShm$hJ.|$V jUEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-YZt #=CЃ v؃߃Av #h-Z>u# -1]UE1҃t\1]UUp-t H9t@]UWVS41ۉ]܉]E䀖Db1EԅƉ@b1EPjwZY@u h>o$EU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=@b1}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EP?[@u hw$j# }‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEP Y[=Db1tSZusujEPjvZY@UEM9u]9uE9E-9ŰMh3#j" UWVSÉHP]ZtP_D 1D1V!LY@u hX'hg$&RPHSƃ uhX'hXo$jD" R1RPhfo$hW2WVho$ jVW{WhiL@u Who$8t Php$XZjVW1Wh~iL@tt Php$HY_j `pHZ@uhX'hp$uu =`-j:RPh%p$hW?tWhp$W#| j:h%p$hWv?tWhp$W| tHSW?YXjVWDž@WhiLzuhp$XZjS9#jVTW軻Džd1hlWhiL! @t|hXu hp$l@1dWhiL @@u hp$@lhq$b@R =\1t%ͱ"w'Rhq$'Y_HS XZ=\1u0=\1u'DjHSDP jV`V茺V\1-{k?PL@uu$=\1tLo$Pj h%.q$ Kb1BXuthw$#Xuthͱ"#Xuth7q$#XutRPhBq$ h%Zq$JKb1_uthw$#^uthͱ"#Yutheq$#Zj L5X-XSV65p-tjHSVv e[^_]UWVS]S^t EPu S @u Wh|l$j u Kq S+r Y9q Etuh`'hoq$j EP!EZt hw$j u1EVtRUW ZYU}tRUu} ZYURh$S tFE=Mb1tFtj=Lb1tFu[=Ib1tFtL=Jb1uE=\1u+!Hu)}tj XhJ.v]ZY U6"=\1tj XSy uq uj}UWVS,ÉUPb^uhh$@h{t$Sr ZYucU̹ Rh8i(S @u8t ht$j- jh{t$u uhl'ht$j Eܣ`b1`b1u Vht$j e[^_]UVS։PVSPht$j UWVS]U ht$Sq ^_uh_%h'h2ht$‹`b1ށ؃E u %ERU NjUR WP襋tDPEVxZYUu tK$9ERE ËE É`b1X1e[^_]UVSP]U Ch$u$S*q ZYu wWPO So VPÃt7EPS5`b1蠨ƣXb1Sm1Fu?$U`b1e[^]UVSP]U h:v$Sp ZYuh_%h`'hht$P~ S~ VPiÃt7EPS5`b1ƣ\b1S1Fu?$U`b1e[^]UWVSS]U h 7%So ^_uh_%hT'hht$Ƌ`b1%EV~ V"~ WP躉ƃt1PuZYu/u$EM É`b11e[^_]UU EkEPh7u$u uh%hD'hht$=`b1%у uсE ȣ`b11UhJ.hAu$ XZUWVS]h 7%Sn ^_u3h:v$Sn ZYu"h$u$Sn ^_uht$Sn ZYtP`b1 \b1Xb1!‰`b1d$1󫉕tVh7iS; @u hu$j e[^_]US] uYPh$tE tP֣Yt Phu$QXZEPYtPSh%5 %܋Et Phu$XZ]UWVSuV%[u hh$/VYu1P{4Z@u h4'hg$p 81jS8P`8Ph8i(4@`%1󫍅`PhiV @uh4'hu$j tWphu$,X'Ht#8tuP9u QXVhu$XuShu$詧_XjPY^u h "j \8Ph8i(4 @uht$HPhu$wh%HH9Tt$h/$Lh%Tj)Vj LP4Z,H%(hu$'_1ҋ0t``'xtO(9u 09t4#HɋL #t#QPh% ,딅u h$&r^j YjmZti 119X~M%9u>uWŸPhu$+ hv$h v$4j +F뫃 u]e[^_]e[^_]UWVSӉϋuufg 0pg Zt2tVWPj u3貓 1ɉ [u1V蝓 ZV蔓 w Xe[^_]UVSu]}t Oj} NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPuBpW v Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPƉ׉‰ 9иr E8t!8"uo;sC| C 9s} "WV00 Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtP襑 X1e[_]UWVSÉUMU1}E;E t[ztMUj8%^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(P XC$ue[^_]UWVS1ۉ@}u 'E@u E@ u*PE 02g ZYu6PE 0g ^_u獅LPh`-#E 0v u 10 L0t 1󫃽0 00_0nuT[[Hh%HP臕H,ZYu Dž,,5&EXtj/V9Q[_ÅtC`1DžT0XDž\@PTP,V荌ǃu@xuPq$ bTt/0u#xPV4ZYHufDžtt,Ttt T]1Dž,tN(j DPS*,D (t8t1ҁ,v d "1҉(VX(0tDž,1ۍ輙e[^_]j-譙XUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh{$XE1e[^_]UPEPh{$u uh%h'hhy$ME\UPEPh{$u7 uh%h'hhy$dMEUVSjjj"^ y h{$\1ɺuBhPS規 y h{$ZuufiuS萐 Xe[^]UPEPhC{$u uh%h'hAhy$MIE=@u h{$j 1UPEPh&%uJ uh%h0'h4hy$4M E@u h{$j 1UWVSƍt1fDžfDžRhiV y h|$j h'v 1l)ƍJ(R!R _9l}l' Džl h|$h%h|$h|$h|$hz$hV}$llh}$_(pp(dp@!Pd!pP Yb1t b1Eb1tI@tc@tC@tP@ tS@@tB@yA@pXx@`1ҋpv9}pL9}B\pfP@u uw%k pfx p@tp d#!= = w-g 1u=w_f?v-k 11u?1p%:=$v1"- 1p1p P hb1SW`\VPPllh*}$Np@"Xp@!dǃ0X*w'Owt4tov2tW0 Z=\1OGPySPhU}$h[}$蔔=\1|$u|$WZdPh$YXZ`a#d9s ΃#yx$VRPhV# C%Ȁ=\1XGPGPGPhq}$hz}$G1d_19d&j>ޒ^=\1GPhd}$RKStRTRPh}$}RPh}$l F뗀=\1GPh}$GY[Gd<G=PuZh}$h$XZ=\1WGPh}$GPh}$_ f`Wֹ"|$d5t-\PQh%蜒K "\`f\TddT>|$tH'|$Pt4|$Ptx$Pt#PQh%K "봊`\d<"\TL=PuEGu:h}$h$賑^X=\1GPGPh}$萑 t#=\1d~$h}$h$RY[=\1GPh}$4XZ1t D ҃L dd`#dtC|$VRP`Q4 'h}$ՐCu_h~$h$赐^X=\1GPh}$藐GPh}$脐wW ÉTӹ"|$\t-dPQh%GN "dϋ\fd`T T`>|$tH'|$t4|$tx$t#PQh%迏K "d\kT`Ph}$yZY=\1)w '$'H|$|$txQ|$un|$gV|$`[|$Yf|$Rq|$K{|$D|$=|$6|$/|$(|$!|$|$|$ Q|$|$OG)Xsj 趍pp)hXh'"e[^_]UpPhiu ulh~$Xl$Eu h1~$j6 EwE11 -USE UUXt=EEEE1҃UjURP 뺋]UE Pujym US]S=Ph~$j Sb1Pb1~ UuUE Pujjħ UE Puj Ã=b1tMUEE EjjEPEPjEP蚥ƒEBuh~$XÃUSP\ jhH'P jS( uSh~$6jPrjZ@uSh~$j]UWVSd@u~Q1}=b1tC&;Et7EE jEPjjjVԤ@uuSh$$O 1ۉ]]]]]E}W]SjVSjqÃjhZ$\ ZYuZ$g$1uuuujEPj E"1}jht$h#- EPhu5% hu5%h$jȥ ju6h$r[jjj= jWjjVj\1ɉ -jEPj u8tgh$Z(9uV,Phk$jWjjVj Pb EҀu+=t$hQ$DjS9 = -m = -tjWj4jVj* -RÄ = LEEEEEP1 Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh -@thT#u4b1Zu h "j jjSPjh -u‹Eb1]USPh$hJ.蛌hJ.hL$Sh$hJ.| jUE E ]#UWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9t''  9$t' '11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t'/ $ 9L$t' '11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]' $09tu' E'11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t' $9L$t' '11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t'9T$'uwy|$y|$L$ ˋL$ ˉ$4$19t'9L$t$$9T$t"$ '11 [^_]Uhe jjh@-u{1҅tPUWVS jEP蚱 Eu_X1E9}2uSPvZYt!SPcZY tG1EEe[^_]UVSQË0tRVh$EPtVERUrZe[^]UWVSQ1:nuzouP'rX1҉Uh%P ZYt98nuxouSPZYu}SPϛZYuE1VfEe[^_]UPPPh$hJ.裆j2yUWVSÉ} u,PQ + ZY u Qh$1t VKqXt*hk"WNZY1u"su4hг%,P^_uE"~u M }jPd ZYt1ih$Kjh$Wh uU jZP,P/ t% 9|\ 뭋QRS uc1 c1u17h $Wj Vh$Etq#Et#Et"Et6_%<'u0P,PIX ZY@tjj@p^_,t#jh$S uh5$VReY[0Z"tShA$Sh$hV~0 ,Dž@h%,PXXZ9 PWoNjXZڄtVB L<-u.1j=V菔Y^t$S@W$S4Q ,t1|=c1t}t=c1u}uD]hI$~Y19~4hϏ%~GXZj }Y=c1tc$P Z@u ht#Xdt t6hkQ#X t 臒XPz=c1tj}t0$u ju j( @u hO$R_-,W3hљ%h,R|P,R. 8tV,Rh$ ;u8uWVWho$j! t 虑[P茑Y}u, Ex](t jj I WS$as ~)t}u2hJ.,PXZj P$s ~j,PԀ @uhq#X,Ѓu ƀt&qttP"PVhfU#"aH}c1 c10SVS Y_@uVh$pXZ e[^_]UWVSj Ph${;11to@'tZD't =c1t>H'F#u/$QPh%?{ !ǃ 끍G#tb#F#u/$WRPh$ztG#u/$Ph$zp t 0h$ h#zXZF=c1KtSp#u/$QRPhÄ$ez=c1h#h$Fzsds`sTsPhՄ$0zslshs\sXh$z0=c1~chSjjhk"ju.t%j S^_tSh$y h1-&6YO#t*$Ph$yXZe[^_]US] 1t-tPu軻ZYuc11=c1]UWVSEt48nuxou c1Px=X1uh.#VX1Y,u@B uP趄_uh "&S[^ljxj,SэZYt X1e[^_]U"Ph'$hJ.|jnUWVS]!11҉tE1ɉ7pC.111plhr$u u芨 0r=dhWlSh0"8 ,@uSVh"j n@t(RPh'hSsS{jkUSP]jEPSU :9uySu h"j/ ]US]SdZt@ h4#SZY]US]SiZt@ h@%SsZY]USP]jEPS.U 9t :uy Sh"j ]UVS]u VS YZu Sh|"j ;/t"Sh"YXZu E"e[^]Ye[^]UPh"hJ.wjAjUWVS EEu EE}]EEE1҉7pC.h"Vu6 t4ouBjWh '57Wu h"j PWY붋pC.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh͍% ,@uLt"t"0Z"t"PSh"j jhUVS]u VS YZu Sh|"j ;/t"Sh"BWXZu E"e[^]+We[^]UPh‡$hJ.ujfhUWVS]E1҉#11ɉd111lhh($u u_ HuLf$M,9tQG.C|g$"'UC| C|C|C|57CpXDžlL57CtXDžh.57CxX57Xjuh@#'578Uu h"j PTX57͓YDždC|pC.P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPW[-YZ@u Wh$jD ltECphtECtNtE%CxdupV:VZ@$XZK|ǃe[^_]UWVS SVdPhWu u&hWdSh% ,@uSVh"jx f@tKRPh"'hS_mSh:$n0jeUSP]jEPSHU :9uySu h"j ]US]ST^Zt@ h4#SZY]US]S&cZt@ h@%SsZY]USP]jEPSU 9t :uy Sh"j* ]UVS]u VS YZu Sh|"j+ ;/t"Sh"RXZu E"e[^]Re[^]Uhv$jÿ U5h$h$h$h$h'$Ph]$hJ.q jcUVSQÉj EPS U:uVShw$jU e[^]UWVSuEE@t"c1 1VFe[^_]P_1_u h.#j, VP ZYujc]e[^_]UWVSQ]E10u1-hՉ$u u 2F$$'=d1td1뷃=d1ud1c뛁K뒺a7C8K t d1hK\cPD7jC@K@2K&g7@P s4K I7C(KK@KEPuh&'57Oƃu h"j耽 Et d1tctKtK@tK t=d1d1 s=d1td1c@tKt1҉,-sc sKsC  sC sh4#VMd1Y_Eth%VoMC$KXZEth$VUMC KY_Eth$V;MC$KXZEth$VMCXZu E"e[^]=e[^]UWVS]fU ffCffBCffBfCffBs s/Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss3.Y^} GWss.Y^GWs$s .Y^G W$CDȉGDs,s(-Y^G(W,C@ȉG@s4s0-YYG0W4CHȉGHs$*' t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh"j6 1ɋuЋ} t1M8"t$M tM9uM9t Suh4"맋E9ƉU}7=i1tuuWVSuhU"j3uuWVSuhU"?9u؋E}<=i1tuuWVSuh")3uuWVSuh"jY e[^_]g_UVS蹝=i1tPh$hJ.Q h&$Ph3$hJ.QhJ.h"諞XZ=i1t ,'ttshg$hJ.BQ jC=i1u UPCUWV=L-uHH׉=ti1t&ɉ HffJ=L-u f@ffB^_]UWVSƉ˃=i1t/=i1t 1}oQi1xi1Puk; Rסi1ΉRPSu5i1{H 9t 谝0RhPWVh$Lj"Be[^_]ÅtUWRP"Y_}Ã=i1UWVSƉˡi1=i1tQuxi1P: M׉ΉRPSu5i1G 9t 0gPWVh$Kj$Be[^_]Ã=i12W|$wUWVS#Å=i1ui1BB4i1i1 i1 ;i1i1ؙ=i1;|*9i1_1)։ؙ5i1pؙQ Y@-'JtRz!9t !9t ҋ1҉ؙ=i1Q ;Xe[^_]g_W|$wUWVS4EU؉M܋ i1A Id t15i1/X=ti1ti15i1PPW i1xU thٗ$PXi1H xU t@\U؋M܉M؃=ti1ti15i1PP i1A Id t15i1i1i1JH,1_9M؋}ruuh$SI i1\Eȋ1ҍMQRPuu0 Ɖ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuu{2 K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05i1#5i1Fx1҉$Puu0 ti1i1\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu%ClÅt]SuOXZ1EtttpY_DpTtF u1EY_Fu @ߋu~%CPi1H05i1EЋUXe[^_]g_UWVSQEӾ=di1t1}=L-tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='Sh$hJ.I ]W|$wUWVSC s(H1`i1t ǃ^F=i1s0Kd t1RP߭ڍN&VV$h$9( i1 ؙy8PۅI4xN&WW$q,hB$' i1A0= @ i1i1=i1u\Tu k‰i1jjjhjRj|£i1 i1ui19uh|$-j&1=i1Li1i19|RPh$0' i1i15i1 i1-'[t?  Lș)Ou뺸=di1t?jj5hi1S=i1Sb i1uPؙV jVuؙ=i1VYi1i1Xlj=ti1t PRCXZi1xi1\=i1Džh$(,X=i1~݋ i1A,XƉ׋ǁ\TtA!AƃAId t1RPh ]$jj#fJ.ftRhht@P4U DžPu fti1=i1tu 11=i11w,1i1;x,t hJ.B i11҉牅8^9؉<}Ë\TtAЋ!AAA)uhy4D1ҁTtqփq9Ћ|hۛ$)(u^i11=i15i1FU F )É^=i1$~O`^p=L-u*VtGx9sЉFx^fFxG,H9ufVNfFFTVXЉF\KN`ȃ$~:=di1uFh$\^lO`؉Fd9sh*$9(%[5i1=i1F t/)؋É1ɉ~U uF\i1H xU u@\€ 5i1N J~U uv`G`Yi1$~%i1Bl5i1F=i1=L-~&_89rOd1VT~U uVTP~U t FX1~JOd1111f# i1A8P!tm)D4A8)Љ9s?~U tv`у >5i1F$B1ҋ9r)=i1O`艅FW897~U uv`G`ai1$~%i1Bl5i1F=i1=L-Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5i1F$뵋i1$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹i1Bi1;i1u^=ti1ti1s4PPF i1@i1i1Z4Jd15i1i1i1i1H41[i1Z0 } i1؋5i1=ti1t5i1i1P5i1 i1X05i1ދvxx i1\t4Tu轵%Fl諵%CPO붡i1i1𙋝ڋËƉ߁TtAЋ!AƃAId t1Ji1Y\Tt=i1Ys8i1){0ƉK`Cx1񉅰69s)9si1k%Cl뀡i1i19rߋ i1A01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==i1j.2X܋ i1ߋƉ߁\TtAЋ!AƃA׋Id t1#t%WVRhH$r9|]=i1Di1P,t,=i1t hS##X1j $X1x~j X=i1tj;_u=i1thQ$v5i104=L-0FF4+=_w hi$j;i i1X󥋅`1=ti1tR5i1K[^i1=i1t ǃ\8 5i1x\󪡤i1RP SY=ti1ti1i1r4PPG i1X4HdLH t15i1i1Z;i1sE=ti1ti1r4PP i1@i1i1Z4Jd15i1aX5i15i14i1@4P5i1eY[^_]aÃUWVSu]tVh _uVh"jg `1ɉPhd@u lF tGRhedAu XE @u!e8tuh"C~XZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(hU%' ƹ ߋSh"VI CPhN"VuK C Ph "VcK CPh"VTK CPh2"VEK CC,$C,PhE"V-K C0PhZ"VK tP X}!uhzd@u D @RhedAu C @uuhi"je 4}1󫍅Pu^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPq 1e[^_]UVS4]jhPjS+uIjPjVSV u؋E ʉʋMQ؍e[^]UVS]u VS% YZu Sh|"j=d ;/t"Sh"XZu E"e[^]e[^]ÅtUWRPY_}UWVSuuuuJ É֋EU)jj`RP[ Nju 1ۃ`9}1EPl@hFVk`EUȃM ~MAhQlCȍe[^_]UWVSP]UpEM1^F}tF^ECS}tffCCCCC 1 :}u: 1҉C(S,C8C1ɉ C Xt1 1( Xt1CXo1=Dt1$`t19$9rPhX1'h$vTn1D 1;\t1sin1tЉtF$9rhX1'h$`n1‹ ȋ( Xt1GB돋$9(1҉G䋅$9s1 UVS11 1ɉ u2\-hJ. hJ.v u2Lv2;XZe[^_]W|$wUWSøthw3hR$XZ5v2ho${5v2h$kx3t Ph$T_Xv2t?v29} h$5[()M&MMEuQQ$hҤ$  j $v2Z0|x3x3EEhv2sH~-`v2]PP$H  N&RR$Spv2QQ$SEWW$S h-PP$Sh$V<|x3v2v2"]v24v2EzuN&ٞzuN&=v2\$=v2$h$e[_]g_1Ujj6XZ1=v2PU=`-u =v2ujhu6v2ZY9v2~v2|x3ueUSáu2u2xFأu2u24v2N&wN&r\-y1]X]W|$wUWVS=w2v2ffBw2@v2=Pv29=Dv2u ;Lv2w2]f>w21Ej]Sjj5hx3{ yhR$[jh(x3jjhw2Bf>w2v24fpjhHx3jVP5lx3 Ã9t:y h$XOYSVhw3h$hJ.rZ1`-v2% v2 x3v2@v24v2Lv2(v2=,v2u(=(v2uv2Lv2Lv2Lv2(v2=v.}fE fEm]mE(v2,v2N&5xv2=|v2v2]u}fE fEm]mE0v2 (v2,v2EΉ߃ɚ;~ʚ;Eހ}0v2 (v2,v2Lv2(v2BN&؉(v2,v2(v2,v2 0v2ى 0v2ɚ;~(v2,v2ʚ; 0v2v2rW xv2|v2 (v2,v2 (v2,v2v20v20v2=ɚ;~ (v2,v2-ʚ;0v2|x3t 1|x3te[^_]g_UWVS<ÉUM|x3tUUEčs}uyMăA}9}fE؍t E;v2uJ1@v2Dv2u5}t4|x3u+?EPuhͥ$ Ѝe[^_]W|$wUWVSEU܉M7C]|x3MQURuh$Ct h$2XWh$&|x3Y_t,sE N&RR$Ph $=}x3y"uCJ.e[^_]g_?e[^_]g_US 5&=3u#-1SPh$hJ. jUWVSƉP¡3_tEtPh,$E 39U|} VhR$jB3 su4 1C@C1t )уȋKAPEFCCp1}~CpMуt[}D;19Ue[^_]USӃ 31҅w =w"=wj=w:=w R=wA=v=w.=w "tft uȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs,t PVh`$ Sf PVhn$mBhPSjPVh|$ESgPCPVh$)hJ.Xe[^]Ãt"¸$7t$tURZø$USљRPQhShJ.S/] J.yUhJ.j XZáJ.PJ. UWVSDuhJ.e[^_]ÉÉhʰ$S5'a_E1ҿ!Es,s }uCEtHH1ɉ B u1ۋtЅ}t2}uK]1ʉj.h3EPj,:]1ʉu"r VPh$j.h3h3hϏ%RXZT5؃3VPhϏ%/C 0=ă36UWVS$@<tPhװ$Y[ C8'tRh!#Ph$^_Ph$XZCH<$3'h#C Ph$C6' Sssh%$_C! @6'<t5'<t7'CTS C ACPhD$ CZYPfwk$4'hV$hS$X1Zh`$hm$h{$h"_3h$^!h$Y Ph[$XZ뢍A9sh$ 6EEEEEEEԍsEԈEӊEՈEҊEֈEEUMfsfhw.ffQRPEPEPEPh$jfuVuVuVuVuVuVuVuVQRPEPEPEPh$$2C7'?h`$C(7'(hi$C 7'S Cxe[^_]]e[^_]UWVS0É։M1Eԣ3j53. jEPEPh3VS8EE"1EEE1҉U jj}Wjj]S1yhr$EЅt?P Xu h "j{+ jjWVjSyh$݋EE1E1=ă3t#h$ X=3tuhβ$[_}H1E92=ă3tC҅U% E3t Sy9=3C{PS53w uK)87tA))Ph$ 9~Ph$ZY=ԃ3u=ă3t GaSx5؃3jRU Ph*$CxUtHH5؃3RB Ph*$h({%4 VX1e[^_]UEt Ph4$9XZ&hd8'PhH$hJ.jwUWVSDE։ϋEE3u30-E 3t<t"t(E}u+E@E'E@EE@E@ E@EX0-UZh{y%VZYu=Et'}3u1ɉ[cEXt""}uVY [^1ۃ}uj/Vj ZYÅtUԹ1}EEE}WRh,5&V& t-1EԅۍUt/WRh,5&V 1ۅtVhR$t/Exuxt Vht$j' p}PM ju }~tCUj1}^Exux uxuxu xE@E< u2]Ĺ1jEPEP ¸*#&EE耉E 1}E@1}11FQЀ w0 QwWMQw7u&w$ 4']@ }@11 @]M9ru)u}1ۉj/V0ZYÅurEEPV3 Y[Vg XVYVZHuNp @0u# }u=3uV Yt- V^g ZtMUCUe[^_]/;}u =3BEXS'h Z{ X ?}u MUs1,5& 3Uf1E e[^_]US-tuPZYtC]UPu*fxu#@PhW$hh@3/@3 Htu DP[ PY ZU}uE u  'h_$h $RRhh%PPhe$ UEt#t#$$tPh${$$Rh#XZUVS$8'E׉Íu 9stMtJ@Sh$XZe[^]UVS{y%}tJE t1@jjEPà tj.0^Y^ƅth@3@PYZuUuRe ZhPh@30 @3e[^]UUE Pjjhh@3PR"o thh%h@3k @3UVSE UZ1t@ȅt  )ˉ t Eu7t3jSZYt%u{y%hPh@3]/ VRhŷ$hh@3mVPRh·$hh@3DσVQPRh$hh@3}VSQPRh$hh@3\ @3e[^]UWVS$u} 5E ~y111119FtM |1t 1} L7tMw tLxw tHuGC@u?6ttxtu#  @@1u "5ω5KtB uh{y%h@3V[^vth˷$YEPjjhVPPel t h%VXZSVh%hh@3@3e[^_]UVSMQ@3QA3يۊ8'BZ8'XÃ@.)օ~=.3uC@3[^]UWVS uE Eԃ=4-tL1ۉ4-hh@33_Zu(j.h@3JZYth@Ph@33, @3uhh{y%h@3 , F<tX<t<u^EԉE FEe[^_]G]ع1}ʉfEu jS ^_uSZY6e[^_]VPFPhݷ$hh@3@3e[^_]US]U MC<t,<t<u/MU ]]yMU ]]q؋]YS(PCPh$hh@3@3]UWVS(uE MMԋ]U~u'ẺUЍ}عjuV _XUЅҋEtt SVZY SPV" }yE E$e[^_]OtEEԉE E#e[^_].EEԉEE E"e[^_]UWVSXEEE EEEEEEE"1EEEE1EjjuVjj]Syhr$Et}tSyM9)sxEt  Cy;8-t8-PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth#h#h$!J.HJ.$yhJ.j XZJ.PJ. }e[^_] e[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һ$~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(USPh&$hJ.Shc$hJ.Sh$hJ.$Sh$hJ.Sh$hJ.Sh̸$hJ.$Sh߸$hJ.Sh$hJ.Sh'$hJ.r$jUVSƃ=D3udPS^Zy Sh$,밋l%=`ƋT3t:hC$RPZY h$PRZYu\t_X/tXRPh$RPhG$hJ.\`xtRPhl$ RPh$hJ.PDž`t0P _tPh$KZYDž`9t SX`tjtjjjUWVS TPjhPjT11ۉ`d`Ph|dV @ h;lu\1ɉXSi9dsW`XZuh"\PY_t X\X;lrt\h"h%hWپEPt@3tWPhƺ$t~WPhl$ܿ lSZh`PhedAV 1ۅ9usCaPTh"h&hWEPt@3.t-WPhƺ$tWPhl$ CiV耶 Xe[^_]UWVSV1}jj}Wjh:' uTEEPjjWPh:' t S[!h%S ZYtQh%je[^_]ÍL$qUWVSQhqAdA EAEAEjjj ! h$ Y1iPEZuh "Suj E y h+$j E9tSPh6$蓢 tCtQt_}uEPEP _XE#t[OEE#R$:E$"$@E $"E$ƙ"ESYE܃}ƒ}E ˆotRExurW^Z9EsEhd$hm$h"h"Suhv$uh}$Ǽ$EE1EЉEԉEȉẺEM}dtEh9xE@EE@EEEEEEEou E]u]ű]u]usM] }EݝxEݝpEؙRPSQ Puuuh$u؉Ep݅xܵp N&PP$E])ؙ WVRP螪 PEU WVRP脪 Ph$jj h#SQj}W @u h~#xjj h#EU RPj]S诲 @tjj h#EM)ș RPjuV胲 @tWuuuh$Ep݅xܵp N&WW$VShż$ĺ,mE}MЋ] }tajj h#SQj]S @jj h#EȋU RPjuV̱ @VShܼ$: MЉ]ԋu؉uEȋU WVRP PWVMЋ]SQ Ph$}"Mȋ] }jj h#SQj]S/ @Ijj h#EЋU RPjuV @jj h#EȋU+EU RPj}Wϰ @WVSh$<M]u؉uEȋU+EU WVRP PuEЋU WVRP PuWVM]SQΧ Ph2$ƸW}MMȋ] }m]m]jj h#SQj]S @jj h#EЋU RPjuVʯ @jj h#EȋU+EU RPj}W藯 @Eu N&QQ$WVSuhj$uhp$|M]u؉Eu N&RR$EȋU+EU WVRP誦 PEЋU WVRP萦 PWVM]SQ} Puhj$uh$j$uXeY[^_]aUPh$hJ.Ϻj^UWVSljU΃=3u'jh3h 3ZYuh$N [3Xi 3}u-WUPZYUujtdWUPZYUu=tRhh3蠜ƒ 3uPh$j K c1e[^_]UVSƻ@-tPVvZYt"Vh$5X4蘹W4MC St8tPRh $x Rh$pxZYuj 3h`O4 CDO4@O4 e[^]UjWX=dX4t%X4fPftjhO#P聪 jh3 UWVS=W45W4ÉDžu¿ $RWh.$5X4袸5X4PhPh@J.$y'1=P3Sh?$5X4NR.fDHfn,f?trfauHW4ShO$5X4 (fptfqt#1҉W45X4hr$ Y[C1P3Sh$5X4趷 &SSh$5X4虷e[^_]Ã=P3tO=dX4tFUVS5W4W4W41ɉ W41U5W4W4u1҉P3[^]1P3U̫3j9Z=W4ujȃXW4tW4j譃jh3Lj UWVStEUtj1]ut=tR.TS!@u$EE%@ R.t R.fBuӃ}tghW4 [ƋE]tC1ۊW4t8u9s&HW4 CuݍHȋ])=~ E봉EE} Uй 1u1S4tltf$t\uDS8uOCDC<0~2S8u0x tF8tutt 8FtC1DЋEǸO4:[tL\t$HWыu)@,-x$uvXR.DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2R.DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5R.D^tS@0uU tZBGO])ف~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuPo EE 5X4hN$EZYFbEe[^_]USEU uM軠%@-X4tRQh%P}"#Ph g$ W4ZY2t!h`O4hj$5X4=1W4 B]X]UVS]u9@O4t}5`X4E W4u1`X4@-8t 9XtSh$jP @u=`N4th`N4Ph $p Ph$pZYu@O45`X4e[^]U}u葟W4]ø$]U}ulW4]ø%]lU}uGW4]ø$]GU}t"hN4h$5X4 W4U}thN4hֿ$5X4軰 W4U}t躞h O4h$5X4臰 W4UWVSEuEE PPu `Ht 1}6h.$E PEP~ uh9$E PEPc t}E pj_E څuP$$8at$=W4t)$1Ʌt1Ƀ=W41=W4ƍQV1M Z^9Yu19ARPSW S W4e[^_]UWVS0 EuOW4HuhE$E PEPm tP3h 9jY^_jh3耀 ZYu=W4E 9E ;u"1ۉP3jju à u=W4tՃ=P3tԉڋƅtō5W45W4 W4yZY9u1Ƀ=W4κ$=W4t)$VPSRƒE =P3c=dX4VW4W41ҋtP3W4(=W4t=W4=P3u"C9]j[^1=P3E ƅtˋE 5W45W41ZYU 9u1҃=W4‰ֺ$=W4t)$VPQR˂=P3f=dX4Y5W4W41ҋE tP35W4( 14RjhE 4i u uE 40hQ$Í^_=W4=P3E [Dž5W45W41ɋQZY9u1҃=W4‰׺$=W4t)$WPQR蘁=P3u5=dX4t,=W4W41ҋE tP3=W42P Xe[^_]UWVSEuEE PPuy`Ht 1}6h9$E PEP uh.$E PEP t}E xptYuW41St&1ۃ=W41҃=W41Ƀ=W4111ɍSRtXZ}=M4u5X4hm$ [^닍xPS!dZY}uIy,8tSh'$[^1ɉ pX4 tX4OpX4tX46u2jE pZZutL9¸}9U 9zu19ZVPuWSh$҇1҉pX4tX41pt<Xpe[^_]U=tX4u%=pX4t$Pju uU=tX4u^$=pX4t$Pju uUWVSEu/W4:Huh$E PEPM tP31=pX4=tX4th$E 0}ZYu*=M4u5X4hm$ [^Džth 9jp^_jh3 z XYE t ;u&1ۉP3j5W4u 衶à uK=W4tу=P3thI4S6ZYuSh$5X4 멉ڋE ƅt5W45W4 W4YXtt9xPWYaYZupX4tX4 Wh'$= XZ9u1=W4ƃ=tX4u^$=pX4t$jVPSWh$M1ۉpX4tX4=P3=dX4W4W41ҋE tP3W4pj;XZ1ɉ P3e[^_]UWVS u }t Ĕh!Q#vZYuvh$5X4{ zj h$W > =tX4u^$=pX4t!$tVWjVjjhRSySX W4e[^_]U帥"}us#]U}u h$h$h $5X4訥1W4UWVSE]uu1҅‰uTpuCE xh"WPZYu u0Hhs#W3ZYu1t/s#F u븥"PVh$5X4 e[^_]Uh%$hW4u uIW4U}uW4=`X4tX4E E/$] ]Uhc$h X4u uW4UVSE] u1=X4X4u{"yt gsh"V$ZYtBhs#VZYu 1X44V迻^shr$5X4 맣X4X4노s#Ph$5X4ˣ =X4t5X4h$5X4詣 5X4h$ X4Y[t1҉X4W4e[^]Uh$h`X4u uW4Uh$hX4u uW4Uh$hX4u uW4=X4t1X4Uh$hW4u uMW4UVSE] u 1=W4bu.sh"V臷ZYuBhs#VoZYt1sNE4^hsh3 W43 뷣W4W4t$t:u5X4h$T 1W4ZY4E4:uڜ#s#t"SRQh7$5X4W4W4e[^]UhZ$hW4u uW4Uhc$hW4u uW4UVSE] u 萏uHsh"VHYZtBhs#V7YZt6VZy+sh$5X4$ 1=W4W4L3t "s#L3PQh$5X4Ӡ1=W4W4e[^]UEt~W4Huh$E PEP޽ tЋE ph$x_YZu9=W4uJ=`X4t5X4h$p XZE ph$:_ZYu8N4E41E4USUE W4u 3Pt ]pMYt`P Z@u Sh$t; X4=I4thI4h$P菟1ɉ W4 Ph $ XZ]]]UEulW4=Huh9$E PEP荼 tӋE phE$'^ZYu 8N4USSEuW4Huh$E PEP. tP3h 9jE[Xjh3Dp XYE tE ;u1ɉ P3jju ٬à uu=P3tڋetShE$U][Zu 8N4=P3u=dX4tW4W41ҋE tP3W4tujOXZ1ɉ P3]UEuW4}Ht}6hM$E PEP uhW$E PEP t}E ph_$x\ZYu!E phg$a\ZYu 8N4UWVS}M 1ME1=dX4t5W4W41ҋE ¡P3t@P35W4ujTZY1ۉP3EM9t EPnXe[^_]UWVS}u ̇.jj |ƉXZSa CYujj֔h# à uu5%j/SQ* _ZڅtPhRW =W4t65X4SM X4HQPY^y Pj PY^ J }~j5W4hn#WS f  jWSe Sh$zW4j?~Pk Z9uWjZYFu h$?X1ۉW4e[^_]UWVSPEEuqW4Hh$E PEP菵 EwɋE ph$"W_X}h$* ^u ]E XSh"$VS1 uY}h*$ Yu ]E X Sh4$VSN1 tA5X4h<$ XZ<u}u"E X Sh4$[VS1 W4e[^_]UW4}t'=E4t =E4u#r=E4uX4E EK$ hE4hq$5X41W4 UW4}t鸄=I4u#X4=I4uE E $ hI4h$5X4[1W4 UEt~WW4{Huh$E PEPx tӋE ph$UYZu9=W4u<=`X4t5X4h$ XZE ph$TZYu 8N4UEt~躃W4{Huh$E PEP۲ tӋE ph$uTYZu9=W4u<=`X4t5X4h$m XZE ph$7TZYu 8N4UWVSu huSt 9}1hE4S7 F 9~hh%S GSh$SY[Hu j5NZ8N4e[^_]UEu薂W4/Huh$E PEP跱 tu uh#- UEuJW4/Huh$$E PEPk tu uh>$ UEuW4[Ht}6htK$E PEP uh9$E PEP t}E pphD$R USEu腁W48`X4`X4Hu hU$ORYE ph`$EUYYBu@t)EPmPPE ph$5X47M;MUW4UEU u$tW4]Hu E$]DBE E$]DUS] h^$jSu1tssh$5X4襅]UWVSVEus.Huh.$E PEP̢ t݋E p٭[u W4zh$yYt8uՐ"RUÉ4$|<$舧WURP Wh%SX WVSP (S虌 1W4SvVp e[^_]UWVSEurW4Huh9$E PEP th$6yYt8uՐ"S#Ǎ@$ͦ|GWS@P =X4pX4tX4EU`X41`X4X4pX4tX4jjh$M qVh$b=X4EUpX4tX4`X4(VnZe[^_]UWVS]} t q7h$V苘ZYt.h%VzZYth$ViY[t뷻wZttH3tD35D35H3h$5X4*1W4e[^_]UWVSPU} uRUwZUuUE $X4Ee[^_]قË@t Ph1ɉKXW蜥CZ=`X4ttP3h#$5X4蚂e[^_]USEU W4t tt<]p-t8Cu#PRj h:$5X49jrr 1W4]UVSu W4}t e[^]pvvXuvh $5X4Ё,Ct P_1҉SY3hC$5X4詁1W4 e[^]US}uoW4B=M4uX4E ET$] `X4`X4h$Q@`X4X]USEU Hv;oW4V=M4uX4E E$]% `X4`X4Hu h$?Yrh$?XZ`X4]USMU AvnW4_=M4uX4E E$] `X4`X4BuPh$`?XZrPh$N? `X4]UWVS @Eu} t/nW4AHh$E PEPM tЋ5@3} 19~j k3PwȽ t*Cu%wh0$5X4W4 h@h4P 1ؿk3X 9XrR.DP@tC4<$t<\CFC R.K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mPE4)PE 4V E 43߿iu6CDžؿ9}~)E4)PE 4V E 4 ƃF;p\30mXu 5X4h$u!5X4h$& W4^X~ t=W4u 5X4h$΃=`X4t:5X4h4 X4HQPYYy Pj YX J j 6R \3P5X3V =W4t3~t-X4HQPy;P| J PjoXZh@Ph4 oX3E\3E 9XCؿt G9}ce[^_]USËt PG1XCt P51ɉKXCt P"1CZ]USd̫3jwX=dX4t>NPhG$jd]SYw~!X4fJftPSRm jh@3M USdj+wX=dX4t>Pha$jd]Sv~!X4fJftPSRy8E8 u@EPh$[XZ H< ws 1e[^_]Å8UWVSH%Pty=R.UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu h$j' jh$W uW1ɉK fCPjh$W uWC fCjh$W u WC _t36 vCvCF C FfC (Wuh$&Y Ei$:j/RUE^ZEUu R菚8)ЉUHQMƋMQURP { uEuVCYj@VZYt_{ u1҉[urVj]RUvYZEtH:UttWuVh$)PERVaMVu WuVh$fEPx:t1j:V YZtP>t3tJj EPRUSO U:tM9u HvWuRh;$jW?fC*C ttE4tE4t#R՘CZ{uѳ%{ tг%P赘CX1e[^_]USZKJy ;J| t Y RPwXZ]UWVS\fDž1jh$P _1Dž1jPr$AZY@t(t 8tt 8uShX$U7(8j;Pp ZYƅhi$PFY_t>hq$V5_Zt4hy$V$ZYuh$ZU_SVh$Sזj@Pm t%1ۉth$V4t3hSS hhг%So hVSc $hh$Rh 1ۉ=E4 tSW41ɉ W4t hh$ hh$R Pj?W4GE4uj/VR [ZtP1ɉt PjPjXZW4-cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh@3)? ZY3u Pr$Y[@ S ^<$Zffu/t+;:h2$SǁZY%h<$*t?u+$u =E4uhc$MWeY,,E4t <,j/PX _Zt@,PZ P YE4 t 8uh$c1=pX4=tX4xX4|X4DžtDžx=E4t0 tRPZ%ZYupX4tX4OXX4$,h!Q#P^_44u ,c4P處t$PqY[u/txxX4|X45pX4=tX4ut84P51҉$WVP蟗y,Ph$u_Xj=`X4u=D3D3,Ph$5X4rj pX4tX4 X4uu5X4j /O[^RPh$Q8jhSh@3 M4@3XZ?tj:WG ZYuWY9sFj DPAPB ytD9u9tyPW)P8 …YtEy_ uu1 %=tX4u =pX4t gp8-X@dj VPJ> 19Ћp8/ Pdx*u,j pPR= pd8=tX4=pX4hT$}$tXH ׉dRp^_oDžh8HVRHYtx>$stdF*$TtR$Dth$o=X$$udh$@$td$ƅu!$u}tPPlXV~_Zt:H-,r)=tX4=pX4h3$t;u hX$x3Px3~ h$`X41u>u$Pڋ(Y^'Sh$5X4Z ƅu  Sh$5X4Z ҃th$;XZ h$;X DžDžjXu tSjYj_uRh$DžDžDžDžDžDž 9E4u h#PL_Zu Dž8J.\ 8|uQjj TZY h^$@PE [^88u @Ph$lDž0G8<pX4tX4u!t9Nj}5uPuGxX4 |X4!΃9=`X4B5X4h $豥 ^_+u t=xX4=|X49u 9t Ph.$W9 h% h^$PhXY[88u PhG$"Dž0 h j-S[^hujS_Z$3t9D3tK 3tP(hYD3tЁ~=}$3PyZ 31X4X4X4@tPj~R^_DžjR[4P5$35 3U u hW$*1ɉjP5 3ƃ 39u hy$8"ty-" 3R)Ph$   u @;u‰Њ B t th $Pܔ_Zt h$=0N4u 0N4șu$31jP7Y[؉|tL𙋍|9Ή| ||=X4F|19=$3|19||Nj4PWj5 3耀ǃu4PjZ1X4X4|)ډ|8 3@DžftSF uסtڃ#u)uË9 Ph7#}=X4X49X4X4|#6X4RnXb)f=0N4tYjP [_++y @B19|@B)R`Y맋c[1u9V4P5$35 3蚀 uj@N$$h $5 3轑_Zt h$ 4|ft=X4u4P4}^tch$耸Q=X4uڋ X4X419}NjX49|X4 뤋X4#[#jN8$MmY0= xu tjS~XZtx1ɉ08R18 $Pְ _Z@u*tP(9$re$h$5X4Q 1;X4X4|xX4 |X4y )jFXpX4tX4X4X49؉|1=X4=X41@u @u"PjLY[㋅Pj wLXZ@tPj^L^_@tPjELY[4t4P{@t PD Z0t8t08RX ;E4t t Pa1 X,t,P`1,XtP`1_$t$P{`1ɉ$[(t.(P\`1(Zpe[^_]UWVSÉjh$Pڭ jh$S­ tsh$S?ZYDžt$jh$S蛭 tS)Wh7$j裝 uh $C_u?F t u8t,jh$SO uVj11҉/ZYe[^_]É؍e[^_]*US1EEjh X4F ZYt-=W4uEE@Ejj Y[hNjI[Xhj IXZEE;EEj:M 4_ZYtw1ۉx3=]U̫3jEZ=dX4t%X4fPftjhO#P< d31P33jh3e USd̫3jEjdhU$]Sͥ X4fJfuPSR; uWjh3 USd̫3j*E1P33XX4Yr]tsuAjdh$jdh$SI jdh$S X4fJ ft Ph$j PSR ; jh3m UWVSƉ׉1ۅtfNftщUfEڅtfOftщTSfDiPREPxj ~1tfEt fT Ѝe[^_]USZKJy ;J|< t Y RP KXZ]UWVS\EUMEEEEUEԉU؋E1҉EĉUȉEU} tE EEjEPY[踕1҉EUẺU11}9}E9Eċ}ȋ]}EPuu: à yg8t]8# EEEUX4X4}SWuC9 ƃ y8t 8#)Dž˃}tNEԋU؉EU X4E9X4X4}| ʸ#vEԋUEUEԉUQ>b_M])M]} jEP~EU+EUM[^+My @B19@B)PZ<8}tI X4X419}6;MM}X4#X4 5X4aX8Ct1Fe[^_]UWVS(1=3=3hjAhjADž`3111ۉW41\X4u<P@S5ȫ3$gƃ S5ȫ3fZY= =-vS5ȫ3f[^tPhS5ȫ3fZYdPhhh}}$5ī3)E5ī3`6533j @X}t9ȫ3@ t.j<@j/@W411T3jRX=`X4t91ut4$:'h$5X4qD5X4a_W4j?j?9à tm `X4ƒ5tRtN= N4uj=W4t/t uu5M4h$5X4C X4R.DptkW4 DУW4u#W4v=u dutR.DpuTu@)t+ t&_3s4@du (uu-ut1W4uE9@`X45u$  N4uX4 5X4k]Xx u@uhPh3蹝 =W4uЫ3t R^t&W49tt1t1ۉT3j<j)=j==W4t ujNY3!ȅ!Ѓ„tt jZ3!ȅ!Ѓ„tt jX0e[^_]UVSu=ī3uh$ "W4[11ۉ3hj<ÍE PV5ī3趸5ī3h $ 5ī3~[T3 h$V-^ZPƋ3Y!ȅ„t tjYSj;XZe[^]UWVSDžXW4X303jj3PZ3 yh-$肥X`L3tjXRjhP_ 3<t <=N4=N45`X4=W4u `X4h#$VÉ5`X4X~St6=W4t-W4-wD5X4hU$@ N4^_9h3hh$5X4> =W4u}HN4h|$[=W4M=N4= N45`X4=W4u `X4h#${É5`X4Y~It,=W4t#W4-w:5X4hU$e XZ/h3hh$5X4> =W4uD N4h($_=W4=W4t 53/5X4h$uڀ=3u5X4h$Ċ [^1;#$h#$S:|ZYu1lW4-w 5X4hU$븍RpRRRPh$h`3 t5X4h$n:u:u:uҿ33󥋅pff3j3Ph353Zy/3=W4Pn0 X31W4m=3h3j53]ZYy hR$_3=X4<<3<3P3P3P3P3P3Ph$Ã=W4i)=X41ۉX4303=X4t f33tPQ/ Xjj3P3 y"h-$_X4=X4u#jXRjhP @uh$$3Ph353- yh$蚠^L3tjXPjh53r Džh31󫍅hPR53r9 @ h$$됃=N4D=N42=N4+= N4<u\t3<u1j j WhStPtP 5`X4=W4u `X4WS\hr$É5`X4~5t=W4tN4_h3hh$5X4h9 =W4u Zu<if3RPj3P3P 3P 3P 3P 3P 3P3P3P3P3P3P3P3P3P3Pjjh$ÃX1t X4<uADžXjXPjj53 53$, 314W4$ w=t5X4h$olpRPRRRPh$h`3V #$h($SmvZYW4$ j3<lpRPdPRRRP`P\Ph$h`3輽 , R\x`kd^31f3 Ћ Ћ ȣ3lp ff393C<vlpRPdPPPPPPPPPPPPPPPPS`P\Phi$h`3f \t5X4h$.\` d31f33@ulp ff3jh3h3 x5X4h"$($m=5X4hB$r5X4h$be[^_]UWVSD}3=W4tWPrjjPG( ƃ cPj53(( @H3EfEjEPM]ġ\X4ZZ<ډEUjEP蹳M+M̋EZ[+Ey@Biy1QjEPU uu8tk8#th$Pu h$#E03EEPEP53' à u!#8t8#th!$g[P53{' 3VjS ' @t0}uEjEPjjS) W53LJZY53+' 3X1e[^_]UWVSu1ɉ 3hRj{.EW4[_tp3 3W 335W4W4W4M4thPBUP. UBCM4 33 󥍺0303ȫ3<<ȫ3ī3@@ī3DO4DDDO4@O4HH@O4T3LLT3W4PPW4W4TTW4W4XXW4W4\\W4jhW4`UP j`PhW4 jhW4U썂qP͌ $jqPhW4跌 W4U쉂W4hhS4P舌 hPhS4r $hhO4UˆRV hÈShO4@ uj,3 t13EEe[^_]e[^_]UWVSQ}j/Wv [^Ƹ%%t9uг%jPs XZt/y Wh>$ohWh3觋 3ƀ3. d1/F09tBEjh3 XZۊUx"0t$uOu5X4hP$| Y[13F<.u1F@Fɍe[^_]UWVSuī3u/hw$X=d3t W41Ee[^_]<fDžƅfPftjjWPt h$ԔXhh$5ī3.5ī3I ȫ3gÃ(t h$荔X=d3t W4j<Xt(t#fVfthWPN! jYu=W4(ujZjXe[^_]US E1ۉ]h$ulZYt E$$=W4t)$EDO4u!=M4t=M4u9@O4u%h|$Yt!5X4h$z TjS{XZjpX=W4u)5X4h$z [XjMXW49@O4uh`3h $iZYtjS){[Xjh3 ZY%hjj(Y[EpX4tX4uuuuh% Hu.RPh$ tԋEPj;(XZjXdjC $~XE@EpX4tX4uyuuEu Ph% Huv`3j 1$51$E$j'XZjY1ۉ`3uu h$5X4*,RPh$% sjh3 Y[h˧jO'XZ1ɉ `3h$uj[Z¡W4tt =T3tSjtjrXEt1=W4PVX=T3t(MEu Ph%| Hu\j[뼋Eu(Eu Ph%O Hu/=T3tjY1=W4PZ=T3tCjX=T3tqjUg 1ҡȫ3e~jl1$bX=W4u06u=d3tW4 h1$^Xj7XjVYjN[=d3t W4EPj%XZ]UWVS1X`X4ptXX4`"1\X4X4xX4|X4X4H=`X4t}u=W4tTuu u{ E 8-u}tuh%$5X4) u hN$5X4) ʡDO49@O4u:1ɉdDžhDžlDžL^$jh3 [^u#jPwXZ뺃=T3jXh jz$XZh(jl$Y[hh#u g^_uDžT@J.1X4E 8|u]jj *$Y[lE Xh!Q#S5 ^_TTuSh$MXZk1=X4DždGh!Q#u ([^TTu u hG$Džd Tfzt T@xRPWMZYxE%=tu hY$5X4' EЋUԣxX4|X4jh3] ^_q5pX4=tX4uh$uLfZYth$$u9fZY@O4twCTfxu TjWVPxKT@jWVPSyu h$ˌY[X5tX45pX4h$ 6DžL$}tEuuh% H 8N4LZ\\uOuh$^_뽡3t9H3tK3tP6YH3tЁ~=}3PHZ3j!_l@ujj m!Y^l=X4t=X4t =|X4y X41ۡ@O48\fxt \PTfyt T@S5(N453 3 uu h#XZr8 X4X4P ta\`RPPF @\@ @X4X4TXRP4FPY^@u|u\`RPj vF @uc[pt95X4X4|ȋX4#5X4a?_ptX4pt륅u!J\@ @uX4X4pt9 X4X4|X4 T@ @t0X4#/qXu h#wXZ\@ @t"q`Ihp$MXGj%XdtdTR^1T\P#>1ɉ\ $[zhPjXZDžh=T3u W4c3xP X3\t\P=^1\jf[W41;X4X4}jYh@u l@u"hPjXZ㋅lPj ^_3xPI [3du \u)TtꋅdTRY؋\P<XHX41҉pX4tX4X4X4e[^_]UWVS1ۉ,4(0X4PTXX4|$15X45X4LxX4|X4X4 W4h$u%`_ZDDu =W4uVu=`X4t}t}u&E 8-u}tuh%$5X4! 뺋E PhN$5X4  ɋDtE uPu} 1ɉ8Dž<Dž@1=W4uDHjh3$ _Zt=T3tzj^h jXZh(jY[<}tWE jPX Y[E j/P# _Z{m8tNqm8 tDE Ph>$軅[^W4 E h#P^^_E 8|utU г%9t %%tE jP Y^t/x=W4t l8 uW@l8 u"E hP _ZyE Ph$P=W4t 뽃=W4tE PYE .D@O4uJutY jjlXZDO49u&ju/^_xX4|X4W4ujPlY[=ujh3H $_ZSDu}u/mpX4tX4utRPh$t vˋE8t8Puh%P HTh!Q#=^00uuh$Y[ȃ}E h#P\_ZuDž(J.15X45W4E 8|uXjj !_Z@E h^$@P. Y[((u E @Ph$A15X45W4Dž8G=E uPY[((uE PhG$XZDž8 (fzt (@xRPIB^_@tE%=t1ۉX4W43t9D3tK3tPc-YD3tЁ~=}3P?Z3j'X=X4t=X4t =|X4yX4$1$@O4DtBpX4tX4ut/(f{t (IjRPQH50N43 3(fxt (P0ft 0@$VS u0h8 uX4X4h$#^ڃD =tX4u =pX4(jjjP[?11y4E Ph$ÀY[,RPY<[Zt׃ t;5pX4tX4(|jjjP>yv뚃 $X4X404RP;XZ th(,RPj (< @tv(@ @uju04RP;^_tA gL@L Hu (,RPS; @um$uwPT95X4X4X4#5X44YPTX4ډPT롃X4X4#PT95X4X4|X4 H0@ @tNX4#*mf4`f8 uX4X4 h$~Y݋(@ @t'f,E Ph7#n~XZjJX8t8(R^1(0PH31ɉ0 $[LuX4X4y3dLPh$5X40 5X4h$Pe XZ뾋D(uu=W4uj# _苅8= ju)[^X\Bu@j`S ^_X\lp1tE SPv ZY@XP$+‹E $Ph$5X4H`jh3 ZYt$W41;X4X4}4jE Y*h˧jh^_=T30PH[벋<@u @@u"$SU]UtjQP# UVSƻ-tVP &ZYt1ۉ؍e[^]U`4u"#u h$jc_ `4u$Phh\4)\4U塠\4u"3$ku h($j_ \4u#PhhX4)X4UWVSS1}tS11ɉM1-t4U C:Kut0Bu+U9uE ։Eƃ}Z[^_]UWVS]u t>h*$WNZYEue[^_]P2ø#=W4tJ$PhR$5X4 -t$=W4t~ tPH2PS2 S%%YE ]e[^_] QMZƒMuQWh$5X4KSu QWh$ދ}u#Uj PMQgj MMEPjUR rPj h:$5X4릍e[^_]á4 `3!t$uC`4tJu6`4W4%`4P4-8!u-UVS t t @`4tJt `41&`4W4 tGtBB@"u\uXu@!@B؀"@tՈBut B1`34u/`4tHt `41`41W4[^]US44`331ɉ `4\31ۉX1X3P5\3/XZtX3@ڋ]UVS =dX4t2X4SPZ 0^Z8tPhu$5X4  5X4'jh@h4h@J.D)y}uB5X4h$t.=dX4t X4Hy Pj Y[ J z=X3?\30ZÃu 5X4h$+u 5X4h$x t =W4u5X4h$&Y [^1ɉ W4j 3uVYg \30P5X3S =W4t3{t-X4HQPy;P| J Pj XZ{ ?qhNjhj e[^]UEt]1]US]u h$jY SZu Sh$jY @]U=-u < -X4fPftP4 Z9-ÍL$qUWVSQ0`X4 X4 XjP+ `4`4Z^+`4y @B N&ڽ߭ݕ X4X4XX419}l؞vK߭ٽf f٭߽٭؉Ή߅u#t 11b#RPSQh5$hPٽf f݅٭۝٭Q~DQb#u#RPhH$)PPÃt Ph8#)PPÃ<RPhR$)PP؉19}t  @~4H<'%y)DžkddʉӉف1 Q%1 RPh]$)PP8X4X419݅xX4|X45pX4=tX49Z)߭߭ٽf f٭۝٭׉hq$)PP}à t!Vh8#)PPXÃ<RPhy$)PP+Ë+`4`4`49}9}&h$)PVà hO#)PP؃ uX4fJftPVR eY[^_]aUSR1;X4X4}6=dX4t%X4fPftjhO#Pm jX>R]UWVEE왉U1E}ujEPjd e^_]U0E E1EԉE؉E܉EEEPEPuPƒ xEÍL$qUWVSQ@@u5jh`4菃`4`4pX4tX4`4`4XZjPXpX4tX4X4X4+`4`4_X`49}\X49=`4`4sE`4󥋵5`4=`41~x9؋}lOPh$hSX4fJftPSRP jjj%jh X4 =X4uhhjjujjj =X4|NihQ#P hX4Y[tPh$hP+xxX4|X419߭yN&ݝ݅ M&߭ٽf f٭۝٭y1d~dVh$)P=PyNjX4~-hX4t P=Z)Å~:ùdh#)Sh`;'Ph$)P=Pǃ119ʉst  @~4H<'SQh$)P=P+`4`4+ `4y @B N&ڽ߭ X4X419ظw ȉ߭,N&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4H<'%Ƹd PSQh$)PPáxX4|X419‹X4X4)ލ 19‹݅99}h$VQ;à +pX4tX4߭߭ٽf f٭۝٭?~~h$rtPh8#VQÃh%VQà <ЙRPh$)PPIÃuhO#)PPà X4fPftSVPg eY[^_]aUS0Jji"JX]áda4@ `t1USda4HyPYu1ZJ ƒ,uɍPv"u|a4da4HyPZuJ"\u%da4HyP{ZuJCCda4uh8$# Ya4a4da4HyP-Zu ZJ ,„t@Pv8\u"da4HyPYu JCCda4uq-=a4tha4P:ZYuC ߸ ]UWVSQƉUha4P[_tHj.V [_1ۅt6uPZYÅu#)Wha4V9Y u1ۀa41ۉ؍e[^_]À=3tUWVSh!Q#h3da4^_u"G8th3hQ$)`Y[1$hS証_ZyƅEj.S [^pu Džp#1btH uuzG uҋpM4uSpEƅt1;4 3*%u_3uGE uha48} ha4P 8ZYtE th$P7[_tBda4fPfttRPBZYx|?tha$ h$w$xAE85ha4}X da4fPfttRP[_x"|?tha$ h$ E8ha4}z=W4t5da4PsYt u da4Hy t u5X4h$Jɋ@3u5X4h$Xk33 3da4HyPZu@JR.DB@uGG9u u@3u3 33=da4HyPYuJkPk3B 3k 33da4HyPMZuJ< u6@3k39 3u@@3 {u@@3KZCha4h<$ _Xda4@tRD[5X4hX$C XZ5da4!Y 5X4h $ۍe[^_]1US]R.uh~$S ZYuM4DB@tCjh$SLT u M4Uh$S ZYu M48h;&S ZYu M4h$S ZYu N4]USZKJy ;J|< t Y RPZY]UWVS`X4=W4u `X4h$,^tIh$h3BO ZYƺ9¸} 3.uh3Vh$5X4jh$h3S 5W4tjhX$h3R uSt M4 M41DO4j h$h`O4O t\h`O4hj$5X4B Bt 1M41M4t*j h$h32 u5X4h$0A ^_M4M4M4M4M4N4Ы3 h$躲Y1uī3t-fPftjP 5ī3 1ī3 1ɉ W41W4j芾PZt Sh$j)@ ?0e[^]UWVS ]uW4=P3t =W4u$u 1ۉe4e4Pu+e4tÍCe4C1ɉ e4e4h5N4W{L /thhг%W>M hh.$W+M W5ryWh<$qVXZ1qP =`X4Xأ`X4X4X41X4X4} t1=W4PX^$t!jjRPPht$5%֡W4-cvt3} t1=W4P豼X=`X4X4X4h!Q#S e4Spe4 uuha$ ^a$Phha4C u5e41 1ۉe4j ha4ZYua4e[^_]UVSQQMq`X4=W4u `X4=M4ut95X4h$< Ph$YZuBj h3I^Zuj UR@P[ M te5R.DN@tVu=W4u=M4u1ɉ M4t=W4u5X4h3; X4 XZz`X4eY[^]UWVSQ4MY=`X4}=W4}=W4u `X4=M4u}5X4h$; fPh$Ԭ^_j h30ZYtj.h3^_th3H*Y3uKjh$Vp+ u7Vh$5X4Vf320h3h#$5X483 }1V)ZtVh6$5X4 EPhN$V%g tEEP_uu W4u\]`X4gu=W4u=M4u1ɉ M4t+=W4u"5X4h39 X4 XZE`X4EW4eY[^_]Uuh[$j2ha4Ѓu hu$j: a4UWVSP}u jjh#jWh$Vf ƒu&Wh$Vf ƒ uWh$Ve ƒ USjcEe[^_]UhhI4M ZYuI4UVSE45`X4W4=W4u `X4h#YZuQj h3ZYt?8t:x"u41Ɋt t"u P"u @E4A@ƁE4E45`X4W4e[^]UWVSu huS8F SB h%%Pe)u]WS YZuSh$7PXZ19/uV$'É$VWX( uڊ/ e[^_]UWVS}GE119ut4&Z9sFSU衈X49r1uÍD1EkE1Eu9uE1E9]tzMt5X4RU6 YXU;wrX4 t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=W4u E#$=E4uM=W4MtEE4E}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL#=W4t M4u#}mډ)Ӌu N ty.uup9swBL#=W4tE4)؋u ^ tA9sHBLE H9cS%"M I9OS%49sSڋMA[^_]ÃUWS$]؍U1EEEEPSh,5&u4 ƒ1uu貯 Xe[_]UWVSu] }VuS u1N tuw$t$fN lSZHˀ; uLUJ9uD DJ.y h@J.FY@J.H @J. t@u҅t$ff t1҉e[^_]UVSQuh4Q[áX4?vPh$/ j}uh$P_Cƃ4 1҉UUR@)R4Ph@J.yh$uh$5X4jX319\3 U e[^]UWVSD]} Sj j VhRuWk| t&hh#R= j h#V= E4tzW9Vt vuvvSh @uT.8jjjhSvv{ thh#S< q.8Sh$FY[4jjSu ƃ u(PPh y$h$FPjS7 @uPPh+$fDž=\X4~"jP_\X4XZuWS @-8$}u-8A^PPh$E >jP[_+‹Y_+y@Biy1fDžRjP uY,8u=\X4~{,8#tLVjS ƒ 1BPPh"nu,< tQDžPPhhSo @uF,4, e[^_]UVS]u SXu ]e[^]` x UWVS]} KyCSXu?C u8@t4+8ufc +8#tt+ P0e[^_]UWVSu }EÃu3F u,@t(d+8uff S+8#tt E+[^_]US] hmN$SYZ¸t,h,5&SoYZt;uEuh`$PCXZ]US]SZu Sh$j, ]U臭 u h$j+ US] Su ZY@u Sh$j+ ]UEu h$j+ PӝZu h$j+ UWVShuE ]E1҉UUUt PEXt SE_=1ɉM[h$nEEZt P1EXh$-PGE[_EPEPEPVy$W453 ZEU3X4t\RVhE$P1ɉMEPjP]Sh@J.}yhyP#uh$5X4W41 VhT$P Sj=W4tVRUJÉ4$@|<$WURP6 Wh$S7 WVS7 E(tPX]Rh$?^_}u-h$G Yu]SES1XZuh"$ËuV1 uq}u-h*$ _u]SESa1[^E8uh`$踻 YPh4$聙ËuV)1 uŋEtPh4$O_ZuuE4W4^uxW45@39~Lk3Ph5$ZYu0h@h$h4]5 p\305X3YCE41E4Et P51EX]tSF_1Et P 1ɉM[]tSZ1EtPXe[^_]UEuGW4=W4t%5M4hm$5X4W4fHh$E PEP7 UBw W4t E4u E4u)E @tW4t:u h$j' PRPE pZY=W4t"=`X4t5W4h$5X4D W4j h%h`O43 DO4@O4j h$hN43 N4j h$hN4h3 N4$j hV"h O4J3 O4j hY&h`N4/3 @N4=W4tjjE p UWVS0u=W4uue[^_]=]ȹ 1SjhV u}uVhQ$` Sz 1E0ES` XZEče[^_]UWVS,EPu EPH Uȃ u9$ ỦEЋE0ufEjEP V\X4EUXZ1ۃ=\X4~yjEPUE+E‹E__+Ey@Biy1RjEP u#8t#8#tu#<_u#1҉jEPVd u Y# yJ#8E<#8#7ËU9} )‰UEuNX؍e[^_]UE]UE@(]UPEx$tEjURjj0-f 1USjuX [Zxj0jZYu S Y11҉P$]UVSPuEj0jPZYt,0@$jjVv jEPhhVe ؍e[^]US]t&S13 sPsHSB1]UWVS(]=\X4~jEPS\X4EU_XEE E̋C t 9EsẺEЋ}s)C C)E0}1u&uW3 t}R)EEЃ}um^!8P!8#twF!C(uC,'!8#usZYCEЉC{uMEЉC 1{UԺufU؃=\X4~;jEPRE+E‹EY^+Ey@Biy1k 1҉VjEP] u N 8tD 8#t: C(95\X4Ph$5X4 <C(<1EЍe[^_]UWVSQ} ]{uhCZC{({,C;C C1s sSjjEPu{(uT{,t Cu`EGKSBCEC9Cu3pVs(ZYu+ C(1E2Cs} z뙋s )9|Gs}UC Ee[^_]UWVSSu] }VuS u-~,tuw$t$1ɉN(YS ZHˀ; u9UJ9u1VjjEPat} ut$1ɉN(t1҉e[^_]UE PuAjGUE PuAXZ=e4u e4UE Pu XZ=e4u e4UWVSSƉ׉ˉʁv )…tRUWV tUul؍e[^_]W|$wUWVS||xˋ7GEGEhE_u h$hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}t }}uetWuu& EE)PEW| u h'$_XC1Ʌ}lj}EU1EMu9}uh<$A^_EEu1ɉMCw$d<'E8tJ1M9ȋM}uhW$XZFht$e4XEE@EO}jjjE 1}Ett h$O@EO}E8t h$+@EO}oEU@EO}O=E.E0@EO}E @EO}jEu E8u$ Eu E8u @E"u  NEO}~j8h$jEPNu [h$1RjEPPEZYwP$<'}tR}uL1Eh$XEE'h$h$h$uh1$_X+}tEMș׋EEM jEPYZFUE)؉EڋEC9E:EEU]E}tjEP警EYZvh$EPaZth$yPPPPEPEPEPEPh $hS,ڋE(th[%YEUuSXZ}t]EUSe[^_]g_UWVSEU܉M=-t h$ Y1҉-jjjuBu11@tIjEPu襺  uu hP$uthP$'X1M1SQM]uuhj$E܋U1EUM]Ή)׉u}u܋} ߃u1tN}xC19Ή}EUEUޅu1tiE1-Phy$j]SLLD.Sh$hJ.uh#)$e[^_]UWVSǍxPW^Zyh"[1E%1=uUЋ]ulSYlu h "{=e4t1h$TځvRhQlWƸ tht l)u)Ӄu h$$Z/w h$8h$pPS V;Xe[^_]UWVSÀ8-u4xu.=e4t1e[^_]1Wx1tPx~Y^=e4tg8uvx -Dhl$tZlhu h "txJ5-󤋅txJ1tSh$%=@uxh$ e4=jx. Y^y xh} #cXZZ:PS9^_tSͷ xh$* %1ɉl=u TlhxW WRơ -9~&)V5-4YZu5-V¤ XZe4 e4u xh$2j|PS t"@u xh $sxh<$fjjjS=e4uU=e4uNhh W׵ ƃ ujƹ j蝶 YXuPh} #XZ=e4tl1WD;xjj1ɉNlpS4 t h$_tV ^t h/$u[e4pu*lu!u PPCYxhE$76jjV״ à u Vh[$xPS_ZtVh$S~ 9pu9lt2RPplh$S? PBxBS jx( l[^@uxh} #5=e45-xh%hS=v -)A5-=e4u7hh S衳 ƃ u"Sh$h@J.R xlel7 Y=e4V# Z@u h/$XxyAat`=e4tW =u=u5jx ^_yxh$ S観 [xh$&ZYtt t9Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuV t VP^P5Hx45@x4h $j F94s4e[^_]UWVS1ɉ /t,$Xtt+i9~d\@1ɉÅu5Hx45@x4h"$k1Ҁ8IuC1tOFH@>uj RPv F 5Hx45@x4hK$j ؍e[^_]UWVS ÉUE9C#u~nu Px4x4@ 445x4_1,px4=@x4u8#uxnu Px4M 1M I tpx4@x4t]Ut @uKf px4-tpx41ɉ x4=49G 4@x4t1BJM pЍe[^_]U`x4@ t=x4t/=4t;HyPYuԋJ 5`x4PF XZ1UWVS|u=`x4uQ48u==x4t h$jI `x4@J.Hx46$\x4J.Dx4"lx4`x4tQHyPZt@ J5`x4P襘 5`x4hdx4hhx4 Ã]F`x4=@J.u 1~1P[=|4tdh|4S'h|45Hx4賛 t: $='49Ѐ4r4kP544XZ=Ѐ4k 541h 4154{u5\x4sH Y[ =̀4uu = 4 4t54CPj V u 4p @))Ӊ4SPV腆 mj5 454h4;jjhO#h4j5 454h4Fj5454h4 jjhO#h4ej5454h4M 5\x4s0 4@4D=\x4J.uY-u[hra# Zt8tP0 -_9TPhht@jI uVft--<u -t 11@tR@DPP2Lt%tv$DP 1DžLP u?F;5-r5\x4hC% Y^5\x4j$~ 5\x4j ~ 1W2ZtHWjX;5-r5\x4hC% ^X5\x4LjDtdW虫YtXPh>'貪_ZDžtE;5-r5\x4hC%@ Y^>'$Ph$5\x4 _L<;5-r5\x4hC% XZDL<Ph$5\x4萘G 9tE8t=-1:"u#C؍e[^]USPyYt@Ut‹EBu ShO$j ]UWVSÉk<`.AfEE19E~6Q@94:u9E~֍~@k'4:L4.4 "4 4  $4]]UEU t2t Ju94 'u($44 4 ]]UEU t)tJuJ 47t6h4$4=4t]i]UEU wG$>'4 .4 "4 4  $4]]UVSuU E$ ?' f 4ZKhn%P2ZYt u h +X e[^]ge[^]US]E U $ ?'Ɂ4 4 4 4 $4s4ghn%h4_ZY4t=4t h *X04$4=4t؋]v]USE hn%PݽZYudhRh#h/1]U塠4ƀxjjPUS] 4ƀxj3P4 )t PXjj3P]UE 054BUS] 4)thkj+XZ9ƀxj3P.jj354Hj354(]US] 4ƀx3j354]Uju Uju Uju uUVSu jV^ZYtVjSPFe[^]UVSu jV'ZYtVSP, e[^]USRu aÍEPjS2u ucX jjS ]Uu US]E $H?'4Ɂ4 @4P}4|hn%h}4YZ4t=4t h {'ZE494-=4t54M`X؋]]US]E U$h?'4Ɂ4 4 w44k4_hn%h42YZ4t=4t h &Z(4 X$54_X؋]Q]Uh虶41U14jDO1U14j/Oc1Uhhx$h46 E Uhh$h4 E Uhh$h4 E Uhh$h4 E UE.tgzEEPjjp˹ UE.tgzEEPjjo訹 UE.tgzEEPjjf腹 UE 0^Ph$jjcdUE.tgzEEPjjh[ UE jUE jUE jʧUE j谧萭UzU ]UǫU ]U謪U ]U'`U ]Uj^_U UjH_U Uj2_U U觽U ]U塠4,P1RP%U4,P@1RP%U塠4,jh%U塠4,jh@%Ujjկ1Ujjů1Ujj赯1Ujj襯1",Uh$I Uh$5 1Uh$$ U@1]U4j1U趰1]Uj+1UD21]Uk01]U+1]UVSu] h7#C Zwu@t2E0f~ufFsHPh%h"e[^]Ee[^]#UEU ttu(4L4 4]]UEU ttu(4 4  4]X]UVSE 0ڸuh $| h${ XZjSh $ jSh$ 1e[^]U4=4uh ${ h${ XZ%jh4h $ jh4h$ 1U4<=4uh $I{ h$?{ XZ%jh4h $J jh4h$9 1U4=4uh $z h$z XZ%jh4h $ jh4h$ 1Uhn%h}4?ZYu4dehh4h#hv$1Uhn%h4ZYu4dhh4h#h($1Uhn%h4裲ZYu4dhh4h#h#1U54Zujj54 US] 4)thkjOXZ0ƀxj3PRjj354lS ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} PуP1E9~SR USC9uhI$QuRn,s=h%QuRR,CuFS}u0Kx9tF( Fat~UCuBEsD})EKʋEC _9~M{fufSf9} z)f{)MS9|M9~fK)y1fsf9|MS9~/E9}(CPuyRuFYXCuE9}ys(ulXZ1C9uf{th$uQs*Cujjsn uCuS)Ps7s e[^_]UE @]UE @]UE @]UE 1҉P]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE 1҉]UE 1҉]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]"U14jA1U14jA1UE uU]U4 -1]U4 1]U4 1]U4 1]U4 1]U4 1]U$41]U$4p1]U$4U1]U4:1]U41]Uh袧41Uh茧41U4 1]U4 1]U4e1]UL4q1]U 4l1]US] 4)thkj<XZ*ƀxj3P?jj354Y]UWVS ]u t/{u)P.vP= t6vWKC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>PqC ZtsPVs 1C sfs1CZY]UWVS`.1AfEE1}9}FQF @tf~uߋ}9}֍~@ksCf;ssfF 2tkgC,t{uu S_XC0tu SY^{hC E{CE܋Cut 1EEuECutiPEZt[8tVU1ɉMj RUtKdtF<-u(=t5=t,-v3=Rt=Su%t!+=L4S>tL4|@hJ.jHF XZV ]aCfS K)y1fK)y1fC\{f}}S׍ MQ9UK fMU)y1s9~fSUʋMM9ULfKsvXxut fCfCjz `~x~Ja (EC99C@ 'fS?u ? =St=VYvt1ҡR.DPIhJ.jD V  oesuC Zt sPL_Xs\Y t?F t!u S_Zt Cs~ft^F uMs}uC ^tsPKs 1ɉK s[s 1C@4XZu W_XF suC Yt sP:KXZsE[XCt2P^o1s_$uCD0tP?oC1҉T0YEC9E|ӋC4tu S_Xs& 1ɉKC ^tTP 1C ZFu uZu 5L7fteE9s$[ Xe[^_]UU@4U fP]UU1x9D4~@4]UWVSP.5D49B  MP5@4jY_Mu11@46D4@44ujH à uhjjjPX4jjSjjPj]?.,SH .YthY$S訓YZt jfZ뤃SKt T4X1]US]w>.t.t)9T4r!DPt Zt;X4s ..؋]U5t4j1`4\4ZU5t4XU5t4 XUS]uTu PmSPjh]US]u+u PmSPj?]UE Puj& UGuPh$ UuPh$ US ]uuPmSuuu jPQ$]Uh#uuu uUWVSu5t4&5t4&XZugu,u4u(PlVPjjMƃE}t'E8tE$9}uuYtEE$t9}=2}Et,~(E8t P;ZU$DE9rE} u)@E }y$u{[Ej PcZYtE@M}})ȻEE9~)ω}u uVQM5t4:ÃMu$u uVQha$5t4U11MQS<XMtW5P7=ZYMM5t4:PS 5t4PSjjSg$SvrE @PE@PVMQ5t4:P0S P5t4訉SGP5t4ou'u(PjU,Ru$u uuP$t6SfXtSW=W[ SMVPFS@e[^_]Uh#u$u uuuuu u3$US]uuPiSuuu jP/$]Uh#uuu uUS]u5uPiSuuu jP$]Uh#uuu uUS]uu PSiSPj]Uh#uXZUS5t4"5t4"؋]UjAUS]S$ hh#R P, }荄k =4t7S诇Phr%54N54i54i14=`4t8SoPhr%5`4N5`4i5`4oi1ɉ `4=x4uhJ.h+r%譛 XZ]UWVS h!Q#PN_ZuohRjP譋Phh$hJ.!NS^ j@h`#S(M _Z؉Ph~ $p_Y[@'tCVhS/ uW聊$W  t ;u뵋Ct{ tዅh`#RL ZY€:=uZh`#SjL ZYhBr%S{ ZYWS訨 ;VgXe[^_]UEPE 4UWVS 1ɉJ Pٌ ^腣 Zp j hGr%V uՃ{ uC W- hг%WN VWN WujƋ;7P  yC9C u=CPW|Y_Zu YaCPsWY_ZtۉC{ CP GC V Y^e[^_]Ã=d4u U4t uPϧ XZj>Uhh#蕰 YtPj Zt hг%[ Ygjhn}YZ hZjXUWVS$1ɉM܍}14j5j袆[_ ]߉j jPM =4u:S<ZxEPj w_X}`jhz[^14S`clj4PgZY~>jh8j4Pfyjh_X= 49SE^ujhY[SZu41$Hu_k4Ph$jXjc4)t]SU^/}EEjPUY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEP.e_1;}s7klE@0 t(Pdt!ztHhr2p8p4jG19t4EPZYvGVX_}kSlY^u`S[Ohj]jYju8j]SZYu'lڋS踕Sjj^ڌEP蹚Xe[^_]UWVShPV0 hhyv%V hVW $hh7%Wۣ Vu1EWZt/SSSSSSSSSSSh#h4jj.Y[ WVXZ뷍e[^_]UVShPV耢 hhyv%VP hVS^ $hh7%S+ SBt VSXZe[^]UWVS}11u܉54jj7_ZyjVPHI e]4$*u u^)uYjhbY[,u>tPZt4$PX4$SX^_ES9bSZYS^]_v%v%S^5P7fjj5L7词5L7[5L7ufEPj  }tChj_jZj u,jSZYuv%v%Ј贒SʗXe[^_]UWVS}11Eܣ4jjfZY=wjSPyG xpuࡠ4*u$tPV_XEV[[u4EPj ZY}t!hj`jju ޑVXe[^_]UWVS1HH;E E8u EH1LEL0< t tLEL8P^Y$}1ۉ889E S5Z9$PuS^ O]1<%rA <%t)R.< u"DB@C8Cuj PPSw P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uR.DP@tC8u$C<54Y'=@4t#30VPht#h%j[#0VPhv%hJ.>j%11]UVSƉ5L7Tj5L7V!5L7W`hPjj PhqPh\Pjj"Vh$A hh%CPjD_5L7@jPSR)R5L7&$uhJ.h w%׊ j30jPJ@uZYt'5L7EwPSv5L7PSjjS諅S^؍e[^]UWVSӉVjbVj(P$P@  d4hd4hpt$i =$.h$.hbt([i ud=$.u[jh&j . h$.hf@$(i=$.t"1҉$.h$.hbt(h $.4tP*WX`4tPWXt %1d4]Lw%Zw%u j/ j/ jjhvx%. jj蜞 h$/ 󥁍 Pj(贸 (4t#u hkw%PQ;54V14`4t#u hh$P%;5`4U1`4h]%&3y^_uhzw%syZYu s Xe s h4XEt28t(P1 _tSPh}w%Z S3 3hw%A j艆41ۉd481󫋍$88EDž1 $tWDž1ɉ CL81jj Pj+ 9AX8󥋅 ,014,PjjXPh+ c 8uE 1h.% _=4t t0QPhw%548hVS+ ~IƄuSPV$<* ud#Xh$: ^t@ ?uz4tPWY 54S 8uE wh $P ZYt f W00X Cxw% 󥡤4xt SP7XZSj ƒt=$.+ (#+ 4^_tP+R[1ɉ 4/ ƒuhKu $=t th%M Z1e[^_]UShhjhejjjjj jjh $.h4y.hJ.hw%赃 4Y[t Phw%蟃 XZj(jP0Sv ]UWVSEPuhS1}u=xPSY^tE 1҉Nh!Q#ST6YXu;h!Q#Sa" XZ1u+4tSh`B'hw%P5띺tVRp=ËE Xw1ppWr Zpt\B9rOw wtSEE 1҉Y>lRpSmBËE YXۋplt 3F늅t 3}uWOW% Xu#4tRh`B'hx%P4e[^_]U< UWVS0u 1EEEPVEP6 ] 1EԉE܅ukVhx%E܍t0SE)Ph"V 7 hKx%S0 ƒE؀8'uE؋E؀x*h%u.3 ^_]EԊk<'uMCj'SmE^_E؃}u SpY؉E؋Eԍ4VuAE_ZRSh6x%jT j 벋E؍J9d<%u<@Q)IB*B6j/Vk ZYDžtV]s EXuЅt GE/}!uo_HEu M܋}ԍYtqUĀx .tx uuWq uˋU;2tEԋEԍRUu-@EZYUWVE)PhNx%E܍DPr5 y;2tV:CXuf XtE܋M1ۉ2}Whht@j_ f}ufEf}ufEPEt|e s+L7EjP5L7yz5L7JS6Et55L77Hj5L75L7SL7EEKEfmEURuuUjh@J.l ]u uAE@ uEÉESESXZ9L7thPjjL7t-9ut hO#_<uY 9th?PbXZRtE@tEEug9L7tSjPx t hO#c_hPRRDJ.HDJ.ZYy h@J.L@J.aRj^G b_ ZLS9L7tS[}ter+5L7OF5L7j5L7Ru@Y]܃Ct P@Zuv@Xt EtV]"e[^_]UVShV[ZuYtPEj.VAZYÅuhVh@4 'hVh@4؊ hCSh@4NJ e[^]UWVS֍y9sjʅta}t7E t/t,R.DHuUQMut@ZYMUtC)؃~QhUx%PS)F1E ؍e[^_]UWVSƉUMjjjà @t5$1UVjh@4V VuS[S>" ؍e[^_]USPh@4h\x%EPjhO#u0 [XhO#j0 ZYttjhx%Sk u؃hx%S ZYuhx%S ZYujhx%Sk t؊t t@hSh4 u'>X]UVSh@46j$@4(j$h@4h4Ј =@4tR)~?4.u@4Ph@4BZYt+hh%%h4i hh@4h4U 4e[^]UWVSd1ɺ!iu$xtx趽 jPh 4! 1ɺ%iu$xtx耽 jPh4 jjjà < 1jh@4V豇 Vh8i(SXS ugL8PBhPh4t  v$8PXt*hVh4) hSh4 %Íe[^_]ÍL$qUWVSQ-T4LChx%(Pj y,4t Phx%xx [^hJ.hy%gx jhb3Ƌ(Y1ۋ(?RXgZX9hU%W# YZPWV虫 hU%W |R.PDžX@$.XtIQDWg$HDQVh uHPDAu&XhViP C iƄV:(:_Xujrjn[^TDž$Hjj$V(Why%g @u"Dž$ jjVWh0y%f @u/ ;TshDy%jPZYt,뱸 ;x|s:hcy%jPY^u(hdZt4DžLh jSZ5P^_u5 4[DžL9 P‰f@ @ 9uhujjjjjjjjjSPjuH41ɉXTDžhjthPH;h uHiP8XZ{ 4hiPh@4菃 jhx%h@4et(jhx%h@4e x%x%1DžPhy%j@$V"jjPpPVd $@t puh4xB'h@4h%h->jbt8DžpjpPjj$Sd @tShy%]^_1@1ۉX=@4su%=A4luB4R.DPX(Phг% ZYu7h$P}e^_Džu\DžTX/1jv$X󫍽p!1󪍍pi[@u 1ɉ$Nhhy%U_Zthh4h4j=4thh4h4hh%hz%3&ÃtϽPhy%j[hy%S[hy%S[hy%S[$hy%S[h4hz%S[=4th4hz%S[ hz%S[Y^h,z%S{[h:z%Sp[S?h=z%j^[h@4hBz%he(h@4hWz%h$SS4.h{y%h4c_Zhz%h4lc[^hz%h4ScZYhx$h4:c^_hx2#h4!cY[h%h4c_Z=4h4h@4hz%jxtnh@4hz%$Pj~ $-^$z4[hh4h4j~hx%h4xb414hh-{%qSZYt/h"__t h@4h-{%h:{%ht1i 4hF{%\Pj ~h\h4~ \3j h4u4 th{%\Pj ~h\h4<~ \J3j h4"4 t=4t 4hA|%\Sj( ~h\h@4} \2^=@4u8h|%Sj ~h\h@4} \2[j h@4}3ZYt=@4t 4hh@4,^_u =@4u 4,hP$S} hh@4h@4jx`hh@4h@4jwJ,PS$`Y[t%4Tujh 4h 4jyXtjh4h4jz_h 4@ Z=4u=w jhE}%"P?w jhP}%-wjh[}%h4E| jh4h4j{hh4h4j}m4u:1ۉllPjI^Xluhh4h4j|*4XDžD4u DžDx$4=4ux$4=4ux$ 4= 4ux$4=4ux%4=4ux$DVSQRh@4Ph@4h@4h#h,4ux$4=4ux$ 4= 4ux$4=4ux%4=4ux$VSQRh@4Ph@4h@4h#h^(jjj x%x P Y4Rh$h( heZZ?HPN/hf}%jtj94_V=4h^$h}%Y^u>=4th54Pvk hvhJ.P^k jh}%j\TpV VVPh}%h}%S9T =@4th@4h}%ST =4th4h}%ST h=z%jSj8Ss8= 4"Xh4h 4h@4h~%jh%~%h4 hh4h4jjFj jh<u`h=~%$S~ h4SC dh%dP _Zt 8tV [^^jj`RP^ HTuB=4t h4h 4h@4hM~%jh 4h@4hr~%j=@4th@4Y$h@4 ZYTuY=4t&h~%hh4h~%hwhph~%h[ TT4j64LXXLeY[^_]aUU#whB']UWVS] }Vhn%-ZZYuu ƅ?jh~%@:jjf@Mjh~%ZY9t x/t/@?/uGjh~%MXYR4$SRPh~%hue[^_]UWVSƉˍPhn%'YZY#u~%t#VQPSS$4t4PVSWh~%hie[^_]U幀4E]UUS]SUZй4؋]4USPEEPj耱EZYt= 4G4=4/u4萱SPhљ%hh`41]US]=4ujXE]EPj EZYtt 4]44=4/u4SPhљ%hh 44=4/u4ݰSPhљ%hh 41]U Mh;$V3M=4th4h%VM h=z%jMYX4Ltd迮SPhp%jL=4th4h4h 4h%VLh4h 4h%VLh=z%jLXZh%h%YX@Ph%jdLhy%SYLhy%SNLhy%SCL$=@4th@4h%S'L h 4h%SL =@4t_ZExN1jSEpSe S}WS}Wttg`PR][^tEPPR跟ZYtU6V8t,V8u"E@t$RP]^_uh͍%EPGY[tEXt p$l(h,`d04t:$VS\_Zt'EPV4Ph\%hSEpFjhg%qY[@`Yhs%h%SDVh%WDWh%S$WPh}DSi6S|?Ph%8‹ t ?tPh%P蹭_Zu[h΁%P藭ZYtލRh,&P#C tjj h#04,,RPj$W SCR. tHLDJ@tSPWVh؁%hFP\ @41󫍝DžƅDž@4DžDžShQVZ  @4f=tfyfv4f=NE1f=FX!ʉ׃11Ɋv4w4t 'w4$@'w'$@'wt$@(u$@| uu1Ƅ$jj h#04,,RPjS\ $PSVh%hFPv4J1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VLX j!?jAm.jUjj h#04,,RPj#W (S?PWVh%hFP& Ljj h#04,,RPj$S SVhB$hFP 0E@8@ue[^_]UVSPjjuVjjhC'@tbu XtSjjVSjhC'@u SY2h%S ZYt PuU ^Zu S[ h%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUh/EP%ZYtE1UWVS`NjEw1h%wm Y[uF hг%w !A[ZÅt#h,C'6 AZYG辟t똀\t @BJu Xt@w44$t)tVP҉[Xt4$1҉94PSK@YZtXP,40Sƒt/t#VRЉXZuTRY8puo$uVP҉XZtً$HjjjjhSQRPx jjjjhSQRPx ۍhS%S h4PS\ h"P h4PP\ W(R<^pT`~a9fhGPS;\ hwVP&\ ;hS%S hwS\ h"S hwS[ (uYh%V hV[ hwSZ Ph%S à ƅG1ɋÅth"S=ZYu!Ph%jr à uhT$S=ZYth#Sx=ZYth$Sg=ZYth%SV=ZYth"SE=ZYtt hh% hh%VZ hSVZ ƅGw PV謙à wh$jj9k؍e[^_]UE1҉UMU ].UEEMU ]UWVSQ]} E10$hmj6Su E %4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVSE 1ɉ1D󫍕D1҃=45L7eh@J.7 5L7*=4 GuujjRAXZ1Ҁt,DžfDžDžDž=v Dž1ۉ11119tD5fDŽ5DŽ5H5=fDŽ=DŽ=BC8[ty1t1DŽZfDŽDŽDŽBt1DŽXfDŽDŽDŽBhjjjjjjjjjRPj轜Ã4uDžRuh$j@DžPS(tuiu5hjjjjjjjjjPj1ƃ4t@DžPV轑ZY^Hy VXSڜ_u?t6hޤhPh$.U 4$.DžM=4yu4Dž&1ۉ49i8511ɉ9=4t9i854t(~SW7YZ[ڋ44ƀy1҉LPTXjSPT hCP4"PS jSh4S 54,, 0$4(804DH$u"u $1҉DHQ,RPFP$4()n,, 0$4(804DHu u $D1H$ 4HpuDH9jj h#RPjV jj h#4$P@ RPjPf 48t$4VHDPhP%RV 4$p~ơ4$0hRRVP4Pjj:5Dž1ɉ$Pj躍^_u654h_1Z7$P1$Xu@P4P54 Pz^4$HXDH-1ۉ,048DHƂ(48<=454\44Ytu 4h£4a1X@_yuƆy$tP,40Wg$͋e[^_]UMw1vB ]UWVSDž1ɉ4*)Ph%hS ͍%#t+hf)/ZSh%h豾 ju藟hг%֋4Ph\%hS4 hг%Sh%ҍǃ(hг%ShjlE0p811R ZYtsE;klEX{41 Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQh%hǃBYcLu۝XZ=4CLSSRVǃSRjj\0jj!6?$B'v=IC`,tPh%hV Vh"%P C`,tPh1%hV CXtPh8%jW WVC\tPh?%jWn WVST"tJ%tmN$VPhF%P CH@͍%%CX,tS\tPh_%hV Vhe%P %т%hx%Pe _X%ׂ%h%PC Y^%߂%h%P! XZ%%h%{Tu%PP ^_%%:13͍%Ă%$tt1=161e[^_]UWVS 4*Pƅh%>h^$h$;蠆Ph%j$=4t"4XzSPh%54U u6h艚4Yt Ph1%b; XZjj3_XhM%WQ$4Y[1D)SP-B^ZmPdR& P,V dRh%W#TPVAL$TH\@H1ɉD@9DtUh"%腨CCP$C ͍%CcC"hP%\C C$P$C(͍%C4cC8b%hh%3CZEZURuh4PVSuh%j¸$KEtVS Và E)ËE9th%hC'h h%EEe[^_]UWVS EUϋMMjW@Y[tK1MU9t FRlSVPNƃtPEV]XZ]e[^_]Le[^_]USj$uZYtD1ۉ]XEPjhjjj EPSU Vt;M rj$S뱋]UEPM UXUEPM UXUWVS Ɖ1uP$kƅAPh{%W, tPkYH%t,%Ph%kXZp%t;%Ph 4͠ Vj&4W Hv|=4uj{^1+.Dž&.Džjhh% kPj(Vu1h 4h&.V #=+.u3h).hn%CZY#u~%=).t#VWRh%h谉WS誟 =4uj膒XDžjhh%3jVj'U(=4+=4= 4h%V V h 4Vhљ%S* Vh4h4hŠ%jڈ$WSh%jVhÐ%j讈V  WS衞 Y^DžVj)TXZS=4tZ=L4tQ= 4tHh%VM V h 4Vhљ%S* Vh4hL4h܊%2;e[^_]USڸxtjS ZYuSh%jʇ ]US18tjS` ZYuSh%j芇 ]USSJ=tsg1EEPj%SEZYtt`Huȃul"h%%hX t&j h%%hYXKuh%jTXZ1]Ã=@4uiU@4"K46%<$4@%-4a$ 4%4r"(4]USE] tP:gYSjR{fXZ@4E]UWVS18Z1Dž@DžDDž<jj t0hh4h 4 hh4h 4 @1󫍵HDžP4jjjB ǃ ~Jh PLji RP 9|yhJ%hC'h'h%Hh:V۵LT jie4[uCh4h4蔚 QZYu"=H4jjn[_14؉ى8f@ @ t9ujjjjjjjjjjRSjlZÃ4ujjmd8PSlPS[k8t4Ph4ڙ @DžHVj0PHZYttfe[^_]UWVSE= 4t h4PYES\Ɖ$4$SPh%hP jjb ơ 4 uS`ZuWU2ЉXt0t4hbujPjPjS V t4uPX} tExuh[%j苂Y_}tuSh%hpǃSh%hYǃ V VXZt-t4Sh$hbjj@= 4t=4tShЋ%j E@4t 4e[^_]UVS]u St tuh֋%NX֋%г%2u%jjPVSe[^]UWVShh%o`4_Zt Ph% [^411۸`,.P/t8t4u ҀuAلt 4Dž`,.{54/y;h4[4u1uSZYH/454j5P75L7K5L7-b344P54h%ja`1 4Pj Ltu44ue4111t0u@/u#pt14uƆ4B뷄t/4'tju_X4u44u9uh*`j 0VR545454Ph%h_ jj[^1ۃ}t_4tVh %h~ZYHu%h,_j ^_thF%j~Y[h}%j~h%j~4tQ}hŌ%j~~XZ }hг%KRPl urhތ%qKxRPl uT|9u;xt8h% h%P^_th %j}h%hM%`Lɲ辚}uuh%jT}Y[ju=XZ1e[^_]UWVS+.{t0u1#W3OYZtWh$h] ك1ujhXZe[^_]UWVS1h~%6JPh$P` ytQP#XHh_%JPh$P* xhw%IPh$P y6륋tPXuh$h3\jjm2_xPҤh$I à t>2^ySh^$PXZ1ɉu|SnWxuh$h3\\jjrRh`#W臯 ZYu$u> t*Wh$Vm ShW u<=uDžSV_Xtq[^uZYtCh0[jN^_u2軤Y[tjh2^XZ1 jh300տʿ迿؍e[^_]UWS]S 1E CM [_]iUu uUWVSW]S 1EE @u1ou tkl1ɋ}9x4uAl9ut؉KjlQCY^t11҉Uu ;s'klM q}9~4ukUlSE@Ұe[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtCڍe[^_]US]s սs$ͽXZCE]鼽UWVS]1;3s8klCxdF@0 ttWD X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@s)XCEe[^_]UVSjhPjult)uu P @u0S0Z1 SXe[^]UWS] 1Sh|duw t#S;S t%iSR3$ZYt3\X1e[_]Uu hzd@u)UVSujhPjV蒨t(ju jPV)S=y 01e[^]Uu hedAuUU EHJ Ju BM+KQsPR` u&y RkZu @tfa EfxNA t @fFFf9ߍe[^_]UWVS] u@(D=D4u jPD4XklhNA0 y841RPq1l^Ɖ׋lAdP9QhslhPPlRWVh]%Ep茨EXfC u>4ufC ;^Q8tWRPQL }E84u.XfC uVhD 0 tfC txPT41҉`dRPTP9HL|]d`SQX\lppX\uX\lt4PTd`SQ誎X\tj2 t j3ZNXtj4uu赗Y_FhD8L`}Du/E t)E8u!@4uhM@4ZE}`thMXGFhD0 thMYG@PtэL)QWNht18RЃSZt49sL}uFEt8u:Spl\XLHh%Epȥ$f#`tEt8u#PEPp4PSRRpl\XLHh%Ep`8e[^_]UWVSXu} ]=x4hLt4PZY9x4}x4hsLp4PZY9x4}x4hOLl4PZY9x4}x4h+Lh4PZY9x4}x4hLd4P~ZY9x4}x4jGK`4P]ZY9x4}x4jHK\4P<ZY9x4}x4jIKX4PZY9x4}x4jJKT4PZY9x4}x4h_KP4PZY9x4}x4h;KL4PZY9x4}x4hKH4PZY9x4}x41ҋ;Q$s+k UA(0JP\ZY9x4U}x4Bʃx4F@ t_u {4 H VkZE#UREUt(@t h#5x4h%v t85$441RPs$s 1RP5l4S4C8u%uh u hI_hPR>Y[P5t45$441RPss‰RP5p4.5$4C S$CS 41SQRP蒉RP5h45x4hЎ%vP ^Gu1C( P/IP5d4MGu!SH1BLPIP5`4lGuSH1BLPHP5\4llu'CHpX5P45x4hގ%vB muCHp\5L4ρXCHP`u&hoHP5H45x4hǎ%vOEERh"&jP h5HURjPcà P5H45x4hǎ%v蟠Sbcfx5X45x4h%vmCH@Hth%vTXZCH@Hth%v<Y_CH@Hth%v$XZCH@Hth%v Y_CH@Hth%vXZCH@H th%vܟY_CH@H@th!%vğXZCH@HE &%FEe[^_]霟WuCHP5T45x4hǎ%-+{jPMQKQWsPRdk B(0F}WP5x4hǎ%v10e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4WJ8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhI SPXZ1e[^]UWVSu jFHP}W jWWjjjjj IR.E܃,11ۉt}DW@uu@tA~Ht҈Uth#SZYUu GFH`L+/tG/jSFHPjSW FHHL1e[^_]UVS u vDh"&j ]S} j SSjjjjhH0SFDVHB`1e[^]UWVS jj%c[^8hLDC nHh9DCCnHh%DC C,nH E1҃t^tZ F'tOE4F nH}Ou/UDEjh3}EZYUMB"t}$vuhCF nHX}$th/%hD'hh:%AjjjjhGhjj jjj%SjM+:ƃ4xu P/V ;S聨e[^_]UWVSQE @4tt3t.t)=t" u E x8uu u\XZjj ^_x 1҉j4F'UG IUBXYu؍{sheBhYBChLBC h?Bǃ YjjjjhNIhjjjjj SjM8ƃDxu P.V9SK1e[^_]UWVS] B({119tuklKI0΃@jj h#BJJbRPj!W jj h#CKJbRPj'P 8uth9AjPPVr E@ tPAjPPV/ #u h@Xp@0@'QWMQVRPpjjA)$4,jB@SPhB$j -Pb $4jC}@SPhB$j :P@ $40j-X@SPhB$j GP jD<@h,@ YÃst4|Z£p4Tٰ-LƄT 19~-@Vhl%jPh 4苏 j.?h 4P5p45t4GP:P-Ph%hh4= Dh%DXe[^_]UWVS] 4$DV跲Y_(V胵0(C<@8jP@ x 189}gGBu CP@@<2<9s SklLT<R+A<Q@+QP$@ 09ȉЋ(}fF돋<@} EhujjhLjjjAjjj8@h4E4URP*u5@P}j8Hٞ<_Zj $^DPRH04EZ1ɉ(,~!klSLQA<Q@(,1@8048;HHD88`VpWRLV7uVP 9jj,(40EU+04RPjPPQ,PTEUjVP @V PRLk@8< 󥋽 x08x4@u}u} 40WVUz)׉(,8E@@PEpɝ_Xs$Ep@f E@fx@CklPs腝ZYVCU<8kl4@0E@)Ћ@)P880PzCUk@l( 9s)klPVPz 180(󪋅<18@98tNH0N8HV@8 QPWRL -B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhPhpKjj7jjjjF,ƃ4PVH"V-E)PB89B4<PZufLW WPF8PP8 WRPQLP $A%LPy bPW0hN%LPy Dt%PPS0hA%LP|y P0hQ%LP_y 0+W%SV4X1\(,;(,p!Љ  1ۡ41RP,(daRPh ]$jpPq Lt;tPShQ%HPx HjSjjFj jH%H 9LtP!^SpP7ZYD:&@<`~ZuVh$h%dSbe[^_]UWS0]}ȹ 1E1EEE =4ujjS)@ jP4E܍EPjS@e[_]UWVSM 14f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh%j]UWVS4}=4PklUVE 0`ZYE UlVSClP=11CC,C0CLCPCT 4$p( u1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC h`#VVO ZYS$S t hV1 uE<=uV蒌Ƅ<$SVh'%hPJ 1hjXu5WSh<%4 tYWSh5%PlO 54\j<4tShC%PAO 541jSh$h~%蘀 1e[^_]UWVS]u Cp}SYu 9h% :^%B4tWh%PN 54iWh%h%VS1e[^_]UWVS}u ERC%E2E쾓%1E4ÅujEPYX9uG@<5hRĉZuG@<KtG@;1e[^_]U14jC"Zt%61UWVS]u 1j "Yt5DžPj[XZuC@<=4uhܓ%jYXh4h4h@41h@4h%hzh@4h%h$%}~hI%hXtWhf%h< jhMőC@;XZ1e[^_]UEJ]U(EPE 4P1]UVSU E0pVSPh%Ep Pe[^]UVSu] hqj軇ZYt,h%hoZYFu @8@V1e[^]UVSu] FPjFph%htF@V1e[^]Uhh%h UWVS\]D1t=u41ɉ 4h5xjP!N gSbZX@/.1ۃt"tu舀4d/.)4tPw[_th%h4js Ph%h4jW4x/.nth%Rj) $}vWPh%Rj=4t$R$RhR%W J Wӆ<$ZYv /.8./.="FtPVZt F9F:Ch4h4h@4. 1@/.Ct@t!1C F z~uʃ5P7_jjj5L7t5L7E_5L7:jhKjjhhj&jFjjjPjÃLPSS e[^_]UWVSQƉh%)h^$PH uA=4th%Ph%54kH h%Ph% /OuPh%Ph%i _XVh %S(H Sb]th%hC%Sj h%Ph9%Sjh%_P#4ZYtuVhS%PG 54bujh"V蛅 V,XX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝu1ɉM] u]u]܉uu9u]{ u ;}}w1] 1ۉMԉ]M]x(Ã}t*M 1]1 uM ]M]U9uU9u {;u U| 9u܋U} U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á@4"UWVSXE؉UȉM]E EUE} }}$}}؋wu}9UM}։lj]19؋]| E1ۉ];EE}LuuWV#/ut4EUuuWV.);uE}u}]؋EUCSE܉U1ɉM̋EUEUE9ƉM ]9]E؋P@MAQEUEM])M]EE1҉UЋM9M+}EԀx EEԋ@1҉MM]]1Éً]1Ӊ]ˋM 9u]9ƉE9Ɖ]E9E܋Eu};EEEUuuWVx-);uE}u}E9ƉM1EEO)]9؉ӋM}EUEЃEE9EE]|Eȉ0xUMPH EE̋EU׸;EEu}uuWV,);uEu}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UVSQMAQuRPRPjjjjO IuEU11ҍeY[^]UE]US]sha%ji ]]RUWVS]} j/W ZYƃth)PCDPW ƒuMV`~Dr9s6t'19ty u9t@e[^_]Uju EDPzSUEvPEDPu 趜 UWVS]=H4u 3)H4K$9C |b5H49s sW}jjjjRPRP t39r,1tu{(u t @9|1e[^_]UWVSU}119y u 9;] u}t uz(tt}h~t[nЃu"9uǂǂ1J Z$1ɉƀJ C@]tq%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS41ۃU U]UWVS]u=4u1҉U1ҋM9bx u 8D;U +}ߋE싃E苃E}t }u{(u1+FV C S$FFlN(1tF$1F,MPFtk9t jPR F tV"}uM9MuǃǃFt$9th%h(G'hdhŖ%谁F t'uBK 9M sM 9rE1e[^_]US]=4u!w k 4"1;@4s k4D4C([]US]=4uS1wF'E[]UWVSSÉU=4uv!v=@4 D41k 4B9tp4;u(}u1BRQFZYtD4@4k44B@4V 1Sh"&jRUZ4 F hst~ SPh%jW:4 F'F(UV,~0F((e[^_]UWVSPu]=4u1E1M9z u :;E  1}1ɉKC1C CkEt CCEC S(‰C$EPC,}u uK9Su;u tK }u0~(t*u!K @N 9M sM 9rE1Z[^_]U1ҋE ]USR] j EPup U:tt htX1 k]UWVS0]{TuhG%h@G'h{Xuh_%h@G'hhŖ%'~{\uhx%h@G'h߃{`uh%h@G'hȃ{duh%h@G'h뱋CjCDPV- u hŗ%V XZ{4uD1ttʋ5R.DNuT4@׀{4ujhf"C4PmH ؊LD tB:u JN{ PhΗ%W3 h^$WU6 ƃiWh%jlPh%VlsXs\s`h%Vk,Psdh*%VksTh;%Vk19aW 4H'PwP7PhF%VqkG P u"OQPW RPh^%VDkH9~hC%hO#VkZYZh=z%jkVOPPVhm%h}%jÃ(VҵXe[^_]UWVS@E PẺUЋE @EE @ EE @EE @EȋE p@ E1ɉMMMMUjjuujjjjE u}zhM]EUEԉU؋EP@9ȉ|YtTtOM܉]}ىΉ߃SQWV)׉M܋]))EU؉EԋU؉E܉UU9UEU} EE܋EEE̋UЉEU9M̋E}M]ċEԋUڋM̋]M]9ȉ} +EUĉE܉U=H4u H4E1҉U19~W}]Exv(*uutu Ex(ut kuƄE}@ P$@ ]9؉֋]޹| +EUӋEH X$EEԍe[^_]UWVSÃ=H4u [H4{s1ɸ9|%@89@|{w1҉[^_]UWVSE Eu}hj<[ZtAǀǀjhPju-@uS AY1PC,PhedA] x0u<1ҋ9Ћ| ;}S@#XZ뙅~1E u CCCs {$s{ECTCk_19 G u ?C <t)<yG1ɉPPPG1RPItA8t} tƃEC ƃ1EC fǃ؍e[^_]US]{TuhG%hXG'jg{Xuh_%hXG'jhhŖ%cs{\uhx%hXG'ji{`uh%hXG'jj΃{duh%hXG'jk뺉CKUU U@8P1RPPjhQ]1UWVSPEE=P4u111ҋt]}u=G'u B8t88 Ӌ9(H' Puuu jju҃t-Ӄ띉uhG'uuu jju(H'e[^_]UWVS] ߋuE;Utf1Myt]J8{ sStWVPщC u5EuV2P4CZuEPDCuEjP4CXe[^_]UWVSo4G'94kP4rj2_11 I't;Gu܅tT5L4PO2P4^t7;t Q'{t W'{t 41҉Sn:Ye[^_]US1ۡP4;L4stCP::X]UE p 1]UE @<1]UWVS]} O4u Cf` 2@XtQRЉSfB ^^uփfB f{ufC4CEs1EU9U~*Ex ufP ufP E΋OfVJt Ѓ9tЃfFJ1;p$s4Vw4RP`EG8CfH ʃ}ufP FÍe[^_]UE @1]UE 1҉P1]UE @1]UE @1]UE @1]UEPE ]US]E UuhHPR0Yu hZ@EE $CE]+UWVSu} ]=4@14j4PDdZY94}4j4P#dZY94}4h4PcZY94}4hd4PcZY94}4h@4PcZY94}4h4PcZY94}4h4PocZY94}41ҋ;Q$s1k A(0PhujjhGjjjAjjjRVhE4URP腵uV>.}51Dž<Dž@;us<`RVSPL t$hl`d<@FjHk)4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DPU1]1EEPVJXZ}y1Q1҉Tu1Hùxt%| q1@ 4SG0|GEE;xrB;Us E11ۃ}t E;]sP7/C_P|YV54jXZ}e[^_]UWVS0EDž}uElL4jSZYt jS^_uY13jSn_Zu[^ƅ1;L4P4} tE 9duE(u)tURYu0;$s{ЉuE, EDEHʋ9Ɖ}fjj h# WVjWhpƃ 3WVPh%Vx V Nj8ƅ3ܶPc Nj8XZЉ8@ Vw؉1=uRhnFjj h#EDUH,,RPjWE$hoRjPHVRG$DGY6GL9  $VP V Gpf $V $SF[f Vz WFÃ9r$h%h8I'hh"%PuZ1hjjjjjjjjjPӫÃ4tPSi^X19s 419t4@Y؅ttWZ tS&Xe[^_]UWVSljfDžv/ƅujh%%Y^yhh%%S8d z躠t&豠8t觠WPhљ%hS hWSc =Džp!j/SS _Zt.xv9tH9s8/tQ)k YyߍxPW@YZ%=puDU>hQWf iƄ/u%谟QPh%hS $hQSb =@uW^j ZuhWPb =hSޱ Y_1Ҁ;/u 1Ҁ{‰hSCp<$CZlhЃpDl=w4uhhг%Sb =whWSb =v S?V[= _y SV7YSV5= ZVSX1e[^_]USÍEPSƿYZy1]EtjSXZxj `PS t SYS`Z=vf u]UWVSEUPE ^ƃ}t11ɉMV>\ Zt{fx vX jhw%SYC uSuhљ%EP @u h-#j 3Et}tESWuhș%jcu[zV8 XEEe[^_]Ujh*IjX UWVS hי%411tY+ڸ%xuڸ%tu#WSXZuWSY^1yah%hPS_ WSX1u h%蛜PSh%jdSh%j4:hS׽h%ShPPG_ WPu'h%SӛPPh%jh%hPS^ Shf%jtPh%h$%juhؙ%S^hPW^ h0%SAPWh%je,h]%S%hPWn^ h<%SPWh%j2,hؙ%SPhO%jMh%SϚPhO%j*h\%hPW] h]%S薚PWh%j(hי%ΚhPW] hؙ%S\ythm%S= PhO%j_ hl%shPWa] hm%Sp141.Phљ%hW ttpWh%jC utjh+bFXZte[^_]UE4fP]USE@k I't!I'ShWE 0-C4 ]UWVS$h.ƍPhW@j-@1jh1%_ZRhW@PB- 1ڹI'1!tT9u Dž0AVP>ZYu=4B G jjjjhjjjjjj!ShÃ4tj"PS觗SXe[^_]U辗4tPPRRRh=%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ41RPSQbRPh ]$j]S ]С$4Eԃ7x6P URjP91ɋu ;Nsklu ^c0AO0}u}u ]u]uutu9]}UEG0uW+EUu FV}t ]U]EUWE `1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A B}lj`K'fG G5G.G G,!G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{~S(xE+C$PR蔖XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP2YZuk{8ueEC8EC4FV SVCt~8uklHCBVPDXHXXe[^_]US]5L7?5L74YX{$ujCP/C$XZC($h4jjhhphRjFj jjPs$h@4yC(4ys$91҉S$Y1-C,SP]os(zs$C(1C$C,]UWVSuV[t$V"Yt&jPX: S uue[^_]}hjXZ1e[^_]UWVS4$)t uiVu`j(PjRƃu1O4jjHDjjPÃt͡4$3t j4PLSЉƃu11P;^ s-URSVPL tEuEt 8uPC΋4@u <@TXuuDHTX=4pjj h#,1ۉHL,ËHRPjXPQjj h#jhj^W38jj h#jh0jdSpfH 0T4DP&$WXRHQDjP p H0SWXWHRP4Pjj'm(h%0lppltDžxDž|}1 EPt!EfEEEDžPf@ @ @f@@@ f@*@,PW=L4v~(u@0f@:@<BhujjjjjjjjjREPhuÃ4t#Pu@,/tPS6kS|v|Cwc 4LPdhTXlpF(t|lQdQP҃ fVYexM|AEAEA Q119~.u2FN<uF EuPEXZC΅juɋEtY_1}z 9u}Wڹ[fB EB h;jjujjj(jjjuSjsjƃ4uP`VXkSEEEe[^_]hj XZe[^_]UVSuE ]wi$M'hDs A[4hE2[ 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph#jS` jSSjjjjWd0S ZS Xe[^_]UWVS(]}h#uVP @4XYu81ɉUO'M`PZYU9‹M}ƒ$uӃ@4} E $O'h4_ Wtjj__h5ku241RP 蟟RPh ]$jEPB h6&tjjI_Yh7u)tjj_ZPh$jEP h8t"u h#jEP谮 h9t"u$h#jEP{ h:bt"u(h#jEPI h;0t"u,h#jEP h<2^VP@4Ph%s谶e[^_]UWVSX1ɉt @@D44t=$txuP1$Xytƃyjh%:_X= 4T5|uÐ Dž81T5ktƒ8C1;8 8/T0 RPhљ%hWЬ 541҅t4҉uFWPWZYu Ɔyȅ4ƀy1LPTXƀ);T54ǀ,ǀ<jWP hW4"Pr =4u/41҉4h4aljY t^4tByu/49u4ы9u􋐀뺃:54'xk<ǹ1󫋅PB XsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB X$CsC C8RPL u;x ruكtЋQ__k<y׹󫋅PB XCsC C8ci1fD @9s=4t1(O'󥍍P{_4t5xt$h`3jY^tjjXZǃ=D4؍e[^_]U=(4tuh%jPR UVSuu1r$ugjjjVcyÃtjjHDjjFPt$4KS;DH} DHe[^]UEx8th#hO'hm hҢ%@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$虛詧$zuubPCsYtWWPZtNjE@ u WVX_XWPV tjVSnE@ t VPZYVXjjS;ƃxD4 e[^_]UWVSuXYƍ}Ĺ 1uVZt틞$S_xt,jjjSǃtSYt$SPHLPd 1Z} w#jM O'RjP8x u0h#hO'h hҢ%ER'ƹ ߋSh"V蚲CPhN"V茴 C Ph "VzCPh"VkCPh2"V\CC,$C,PhE"VDC0PhZ"V5tP PX}!uhzd@u  @RhedAu  @uuhi"j4}1󫍅Pu9^_@4ȋ9'9t(Ћ}1ۉ1E1ɉ [Eƀ*Pnj PEP 1e[^_]UVS4]jhPjSB|uIjPjVSVru؋E ʉʋMQ؍e[^]øUWVSXẺUMEEE EM]E EE$E;EEE̋@8Ɖ}BEUuuSQM܉]gM܋]);ME} M]x 9؃}E̋P@ut 9}Ӌ}}}}1u9u| E1u}GWEĉU+G<EU1҉UEUEUE9؋u}9}E̋@,EE9EE}|EċUEU)ډEUEEЃ}EЋP0@,EԉU؋EЋuԋ}p4x8u܉}}E1lj}U1 9M܋EE9E9؋}E9EE2M܋];EE(M]uuSQM]:fM]);ME}M]E9؋u1EEYEԋU)ڋ}9֋}}EUEЋE9EEu|EXNjEUGW EEEUӸ;EE0M]uuSQM]ieM]);MEM]Ee[^_]UVSQMAQuRPRPjjjj IuEU11ҍeY[^]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UM E@,1҅t9t Bx@t@]UWVS}u UG,1ۅt 9t C1J?1;W$sAk W(:u3Q<Ӄt#Q<H<ʃ9uʉP8 Cu38 C1҉։UR'u ZYUu*R' R'K4R'C8 T4u T4Bu1C4C8G=`4e[^_]UWVSM ]EP,1t 9t @1~ 1r,z03{r4z8s{ tOCCCC C$C(C,uC P'[^_]UWVS]h~%PtW S'XZFu!Àthh%P> h6Q(  ۍuWu uQhS%j@e[^_]UVSU uEX,1t,9t @=P4uh P4X}w1C<t P4Fe[^]UWVSuE 0M$ȋ}_,1҅;U t Bt}{@EpT41󫋃1t4Q,1t9E t @11tt:[]UVSQMp@19|h%hP'hh%/9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s8SrY;C K$}'ujjjjRPRP Ɖe[^]Ã=`4uUhQzXUS]=`4u1;`4s k<X4[]Ã=`4uU`4]á`4UWVSSÃ=`4ut=;t6`45X419t$USF P螭ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h%RXZYuj ju}C,S0h%V0Y_uj ju}C4S8h%V_Zu0j(uY^ƅj)P_ZFh%VǬZYuEh%V觬Y_u j(uhģ%V茬_Zuj`u@S8 Ohˣ%VhY^u>h#EPB XZt(S'>ttVP5YZuG C<e[^_]USPQRhף%EPj6~-hO#u pEjhP'Pt2u}[1Eh`#EPB XY:tjME+[hO#joEZYuud}X]UWVS1jhPjEpiqÍPhd@S" @SSB`EP,[1Dž Džƅ ƅ tpÃuMtGutЃ ) u DžuЃ A댋Ex@uP@4tPh%P ƅEpPh%j6\E@@Ep0Et(pv0v,h%j6V{1ɉH0X,H{09L;C,P{89T;C4 PCPtރuVtjYj jVm uj jVYmTuj jV8m u7thh%P hVP  sh\]$VZYuDG8PW<G4hj]$V詛ZYu)+hM]$VoZYu)j h Q'Vf thjh^Xۋu0lY19ȋWl[j`RC@P{ C,S0C4S8 u+t)CQ RP^YZuƅu_, G 1%E u G1ɉOOO_O _$UWG@jhRjPXƋG,ÅtjP4tKRPPs0s,Vt'8t"Pv PXZ@8u ǃC4S8)G W$q1ɉSh|dV iRZbZujYSh|dV蓆 u܋1;s̋tpH,9H0u0;u"H49H8u;t밉jSP۴ BrV MZ1e[^_]U覝1=4t =(4]UWVSE8}fHfMfMfXf]f]X]߈]X ]P Uf@fEExstExlu31MjQkT'RU U؍MudBuDEPEPEPEPEPEPSEPEPEPWh`$u uXS 8~u Pu豳 ujgFpX1MjQkT'RU[ U؍Mu$Bbu PuW uIFu>e[^_]UWVSu] t>u1}ZEPEPEPEPEPEPEPEPEPEPEPhD`$V4 uAEyƒt ƒu&UUSCEC EC fEfC1O1kT'Ut4VP踕ZYUu$T'}EECEfCGue[^_]UWVS@utcT'CPCPC PC PC PC PC PCPCPCP3h`$j@}WwQ 8ssWփ V'ue[^_]UWVSEUM܋}EEۋM );} GEE1EEƒ< ‹E䋀,uF;E9r+F9s,t }P;U u)9sE䋘0 }t%0tt13t]ƒt<tՋ,E39Et:ƒ}u9r&39s#P;U sxU9sډ)9sу@uEE}t(}tE8}tE܉1 )1[^_]USMU Zyu t tR9Qr[]UWVSHXH X$1ۉX p0uu]9]E}u1ɉMUtj}t}tуtat\@ uуt=t8v1]9]t UrH X$9} 1҉P P$ )H X$EE}u}0]Q[^_]ú=tUwB=tGwH w8RXs.'-v=uUWVSUM119}uP0uQjVRjGуtux`ڃuV]0]}tT1ɉ]Ut4u9}u*uu}7SjQWuPEЃuGAuFA1e[^_]UU 1tEMh]UEUUvU ]USMEX؃< uʄt E0‰[]UE1҉U U ]U EEEEEEEPU EjUWVSÉЉʋuˀ{u,C { K?H} K.C { K?H} K KI1ۋ}_ik?19Ή[^_]UWVS u]}1u܉]EP^U Zu tX%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EMȍEPEPEPUE_E @/EЙ]u)։]u]uEEMԍEPEPEPUE @Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋEԉMϋUeƉωؙMʋEE)׋EU t2 t,EPWVuuN2EE}u u}tE}}4E؋EؙRPuu9EU4DH~1ERPWV9uuRP9EE]ÉUӉыUe9E1MȍEPEPEPEi @tKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9[YeY[^_]aUE]ÍL$qUWVSQ1A1҉U1҉EUF0E؉E1Ɋ t,}uÃt$<t ,}u9]t@u0Eu1M]ƒ< RWvWڋEy11AtE1ҍeY[^_]aUWVS,M$](u,}01EEEEEE1U9ЋU| E1E܋EE19M}M9Eyu1EEU ẺUЋEH9M}GE;E]UE0juQu@M]E@E1;EE }Vű}΃Mu uWV%5);uE M}uu)9s ])] 1҉U111*1҉19]]܃}MM 1yAQ Eù19Ee[^_]UVSEP$9p |$1jjjjSQSQjURP),1҉Ѝe[^]UVS]U M1k N( u4؄tfEB 19EtJ @u,1u.R E@M,9du 1dd[^]UEUUUUUUEUUURU UEUUE1҉UP0UURU }UEUUEUUP0UUR6U LUE1]UVS]MU2U k V(u؄t=&ukE U1uQЃ<![^]UEUUE1҉UUURΨU UWVSÉ΃8t2$41jVR, $Rh{dЀ3IujhPjRE@ue[^_]UEP0RPJUWVS]E EC0E1xp@u4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@t 逌}WuS yуtu G{0Ea;hhZYoh}SZYa }U׍e[^_]UWVSEX01҉U1Eߊt]t}ttR<tNwtw A,<vxPW/=u7sE@,9uQVP3" &=t1skE P3 e[^_]UVSuE =d4uhd4X>y d4CFU,U9u d4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU PQ 1]UVSUEu Nt+t6uXE@VvpSQFD.4t(vtvPSĚ e[^]USR] =l4u0j EPu ƒ =w uE8tt h'X1kD 5$5u]U U1vEEUEPӱU E_ZÅt*UVS14OFZuS OXe[^]UWVSQu>xp19|hu%hDW'hxhE%F]9|@89@|ue[^_]UWVS0uU=4]ډ@E =~Mȉ\1ɉ`}ډ1@8;FF| FP1RP|~ tlURjVPL tYEċUȉḾ1ۅuBu>dž9|Ӄ!!ut9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E }uthv%h4W'hhE%ShjlH^_W'u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP'@ǃEPu^_t!ẺEЉEԉEȉC1҉؍e[^_]US]=l4u]1Ҹ;l4s)=w9t kD`5B1=w kD 5[]Ã=5u ^,5UWVSƉ $41󫋅 EU RPVhh%h4P5 E jhPjVp7xShydPf @u V.X1V.jSu褕 e[^_]UWVSlu] E EE$EEPSV EPډXE8t%E8h%hV'h hE%讀1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}u }t#1A}tPh\%%uPuV "}tPhI%Ph%uu3 ؍e[^_]UWVSHÉ1jhPjSu5J1Dž11҉1ɉډ1ۉ؉!!ׁuO1 RPh/=fU?XqWVSf/9u)9u!V!ʍ4󥉅SGX99;ƒ<<„t <uh0101ff=Uuf=u#(,D1ɉKu1󫋽{w%RXuX tHtt7tqiEt,EPFPVC,1RPP Pе~ 돋t6t%C,dDž $t tx9,sbthjo@^Zt31ۉ Dž1ɉ1҉Jx 'Xu&1󫋅fǀUe[^_]US0E }uthv%h W'hhE%yzhj?XZE u CEUY~11ɉKKCSǃ?ǃjh>RPU@ECǃ1҉oK0SUE Z@u SWCX1d3{ uUC$9K }DURjSPL t1Mt* 519t @D=u=u S뙉؋]UWVSUMtQ0t),0Ut,]))111҉XZ[^_]UWVS}UM] A<t <t11É1uvB? ڈ49'fDžU1 WV)Ӊ1!!ډuAWVhPz$x30 14^uPa$ƙ9uK9uCH!؍S#ƃS~<Y9k9_'X؍e[^_]UWVS]Euh%h W'h .1uEE}lj1Ʌuha&h W'hhE%crs{u}Ɖ 9uE}QRuutK0S[Puu e[^_]UWVSÉЋ{ 519tBDu3{u}s{ u}u}u}v}t 4M1;})ωxMH PC u h"kE UP XZ܍e[^_]UWVSE }Ĺ HUMx}}t}1҉H 51ۅuh%hV'hhE%p9tCDuu}E%}}1uuuuE1} u}w2t tu'}\JM1ɉMr1u}}}E}u}0}}u}t7}u }|ڀtu(}E}u }E}9}}u1UMUMUM}9}}u P @|UEUEUE9E}}}pEbE`Mt:EUu9֋}|}9֋}}ً0‰EU,Ɖt1xtx}9ЋU99uE|{}EE,EujSUr }4u9P7u 4XZm1hjN3E_Z EfǀUƀEEl1ɉpplxt }9}u|H1+EUẺUЋ,E,EEujuUs }t'4}9ttP6u 4XZE0qEHEUȃƉplRP)׉E9Ɖ}ME,uȋU)Ћu}ƃu}|U9E}}EU+EUẺUЋEEEUEĉUȍEujuUx }t'4u9ttP5u 4^_E9uh0u_E,9EE}KhjC1ZYuEb 4}uu,fǀUƀ0Ë0}00UMыE`M]}v*}}u }t}iuM9ʹu}UUpx u}EEMEjR}wR‹E@vM1ҋu9Ћ}_EEE1}$tuVME]1uCu}ƃuuWVM )׉u}9]EM} EUEUE1ҋM]M]9ȉ} +EUẺUЋE\EUEĉUȋE}EuuW< }t2EED4u9ttP3u }D4ZYEu0hjjP,1}?t;_u}E@Eu1EE1}EE1Vt_}9ti@уtuH}0t;1Ɋ_]ttt}t9}t#@AuՋ0U9u1e[^_]UWVSP]E EuEE}t:C,u)C0E1҉UĉUȉỦUЍMċUPX{,4}u1( 1}jjjj1RP1ҋ};}ERPjEPS,tE.5EUEĉUȋEUẺUjuVSUEaUċMȋű}Ѓ uEYUċMȋű}Ѐ}u.hG'sWVQRUMs(H'C,UMtX(C,u 9}8SjWVQRs,H'C,tPC,e[^_]UWVS}Ĺ uE0xE0EEH 519t@D=u€t E1ɉM1Mtكtu‹]9] uEE@uȃwE9t}h=E]1ECƃuuWV)9މ}u}1E1҉EtqE9E E˃tuSE`tF1EM t}tȃ<ttE9E tw̋E0h#jP]S jPSSj Sm8 ƍ@[=wʡ4EHDEU}~ E1ɉMRWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]4480h%h}WuVEPS$xuuuh%hWVEPS>tuuuSЃS@e[^_]Ujj aj j P USRbPS$#PSh%hJ.6 j U=(2.u ` (2.HE5fPftPXZ9(2.UWVEE왉U1E}ujEPjv e^_]U0E E1EԉE؉E܉EEEPEPuaƒ xEÍL$qUWVSQ@@u5jhdE5誔 XE5dE5(E5,E5PE5TE5XZjPs (E5,E58E5<v UD&0Ep V<Yw{t)1 E@ȉC,ub Ex txj(Zu h4]'3XYǃ,f@S(P1.1;,s$k(рyus1(D@1u e[^_]UWVSSƉM׋ttZ9t<{ t6 1ɅuufujuP t[뷃 S Vhu%2 e[^_]UVSËHt2L~tHHHZR1ɉL^Pt2T~tPHPZR1ɉT^`t2d~t`H`ZRj1dXt/tVfG,X11҉Yt/tV-G,X 1Xt/tVF,X 1Xht/ltVF,lYh 1hZe[^]UVSNjjjVnD@PjV%l8@t@4%1҅ut 4%1҅ut 8t48SVlXZe[^]US]E ftPhD\'h;%0 jP t(@t (IhD\'/YE u1҉U E](ShjP#@uE D\'Ea%]i/]US]E ftPh0\'h;%W/ j|P t@dHv|y NH7`xv | xYZt>1҉Shzj"@u;E 0\'Ea%].h0\'.XE E]d']UVSĀptQPhhxVԟ@u h]'8.XV Sh%- e[^]USË4%1҅uau]h̪%SXZ{PtS 1Ytk%1҅utSLtª%Ju#PSXZ]UWVSÉ׸r$u2ܪ%+1uԪ%PSzS_jSZCt PSXZe[^_]UWVSÉ֋8 Ph%,1ɺhXZu%VSSjjN%1ɉK 4%1҃uuj%XZe[^_]UWVSUM8ttY@@0tM~ tBEU  1ۅut1҉FXZ[^_]USËltu;RSlZYt&hvRpPaPh%+]Ãx tpUSË%1҅u:u6S]% Y u=uSnZ S.YuS\X]US]S躘Yuj$XZIpQpcvPh %+j#Shjdj#]UVS]E ftPh\'h;%* |)RxP> uh\'*X;|t xD8t|xhJ.H 1tf J.yhJ.j > Y^J.PJ. Shj @uDE \'Ea%e[^])joXZu Ee[^]y"e[^]UVSjhvx%\ZYuhvx%h.#-)[^"VPXZY@u Vh %)ZYSXe[^]UWVSMy t %1 EU}u%1҅ut6`u,QM3Y}Mtu1ۉ1@EU}u#%1҅uZ`LQ.X}t u 8 ى%1҅u1` 1e[^_]UWVSM48%`uu %t%ti utSYt %@utS6-Zt %`ut[1҅u%u! u@uM1ɉȍe[^_]US]'%P'jjUjjU4]UWVSQ]4Ɓ@1utg%@1҅u\uXt0t(VwZ%t4[' Vh(%&NvSq_%t4['h,%%[^8thF%&j( Shj4Ɓ1uguc%@1҅utTS,1ɉMjEP,3@u hd]'%Z,wǃ,Xe[^_]UVSuh3#%48ӁYt:tt{ u h%SkYX[j+XZe[^] @48ue[^]-UWVSD]u Ctt,PCQPhj@EPt@uhL]'$E_E{ VEPW3bƒuVWh]%:$ st#Ej@VCxPK VWho%?$UCxU3`UXYu"D@RWP_׍e[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3=_UM  {Mut';xu;0tQh%n#11҉Y^{ tFEU   t3"Z@uh\'3#Xe[^_]UWV։ϋD@WVXZe^_]UWVSu%1҅ut V%ZuF Ph%z"Y[Ӂ u% 1҅VGEj EPju^ ]PShȫ%"M1҉-1;,sYk(jQMug Mt5j EPjQPMAPuhԫ%! MQC럋 V4Z@uF Ph%![X ~ u#V3%1YutVdX~ tV#[ӁtK~ uEӁEuEuEuV蝢ZY@uF Ph% !Y[t ~ uV<Ztue[^_]We[^_]UWVS(]} uS#ES|Ẻ{Ls$S# { }u }s uJS0Yt?Vh % S SdSj3poE %%]e[^_]@Vh7%hª%S*11҉fs$t jjSa" S.#Z@u98t h]'X1}E A]e[^_]"}{ tC uPhH%Phi%(Y^{PtRStCQEЍ}ԉƉщUS&CtZU9uPEPu| t{ t11҉s{ t411ɉh#SSFS8]e[^_]e[^_]US]C Pt$ZYts$sLP ]] UWVS];1{Ly)tC$tjjS 14%1҅ututEC$u?tSp!Y@u h\'ZjjAS @u h\'X]e[^_]US]][].UWVS׉΋;M EU K 9}!E4UQM6(YZMUtBu }{ t~EUh~%SYjjMtuuSD tSޟZSOSX+9t'C jjMS [e[^_]UWVSP] 48%@1҅utjZE1t6HjEP, @h\'hW%!_tm@h%hĬ%h%@t+XRDLtzh%h%h%I Eh%h%h%& 1Eh%h%h% 1u1hˬ%hԬ%h%t C[hܬ%h%h%<@uuh%YhjjjI TPh%EpE5u>pE54%1҅uu u_pE5XZe[^_]USS]E uPhX\'h;%R jEP, uhX\'jYuZ8t$hX\'h/%j,,ǃ, _w$jPhX\'hI%ju6M8tu ho%YuESQXZ]US]E U{ u)C щ‰{ t][]t[]UWVS ]]} utSEtXZu #2w{ tC Ph%K%p^_CStP }tQSS[1pEPjEPu] Euh\'WYASuMXZu1~ WEt YXt3{ tC Ph%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh%$11ɉddY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu^ ؍e[^_]UWVS]DžPPhhs @uh\'hέ%1XZhݭ%Y^1hP*F1׃ u Vh%AXZu/87t/8 tt Vh%^_\XPSǃuh\'[ttlHp VWZYu VjS ϋFVt=PVF PtZYt%Vhjj 7u7W1FtPV2VP~ t11ɉ#VhxWtSPtSttPSP e[^_]US]E ftPhh\'h;% S虡Z@uD.87u ]]-8 t-8Vt-8tEh\']]UWVSD]} uMMtFMPVZYt3Mv/-7S UE \'EfU#e[^_]EC(f9t { tQPC Ph4%f{(K>:Mu#M}tyEPVC*P Mt_{ tEj<}WQC*P9K PQMhd%Yjt S*ȉe[^_]UWVS0EEE EȋEEԋEEЋh%S_ZuEE %+h%SY^u,Eȋ@0SZ@E] EȉEe[^_]uh%S}^_E܅hϮ%SeY[u EȃHg1E9}E4:Z\FSX}1ҋE9}?EЋ UQMƉ$MQu9 K)Eƍ@E UB 뺋E@Whخ%W1pC.E 1E111E܉EEPh`'h%uuttktA(NtR4tU6uE뾃UuM@밃ptxtn 뙃M듁M늁M끾wEkpC.E%@1҅uE䁈4@EԉE1}11uE䋀t0tR~ tGߍV }9}~E4RUZYGUu9]uuVj-v EvjEPEp  uoE䋀t0tL~ t-ߍV E4RU)ZYGUt}9}9]tvuVuu @uE䁠41E䁠4E@tf)E܋Uu9]u)}u#U܋MEtNf}fC(ffGfJuj? ȋuFZK>s*S>+Ee[^_]UWVSu} lh%hPV@à t1=whlh%hh% <&8th%h$_ XZh}h[u h]'> huPY1l>uZG Phɶ% tXZt{>u[C Ph% _Xhh% YhuPWhQhnRPhnR% =nwHƄn ƄoPRhh%V舆@u-h]'h?%, XZhtjWhà ppe[^_]átE5tUtE5PtE5UxE5]UE@]UWVS]u }uhU%h\^'hG}t}uh%h\^'hHhc%tu $:t 9ptUC tHtJKHjYYu<tBCXCpf@up MH1҉PfxCM1e[^_]UEM uhU%hH^'hhc%u #t 9Jt#BH@MUWVSM Ep}y1yy9s)}_+Yyutʚ;1Ƀ}t}[^_]UWVS$Ǎ]Sjx EPGPSfEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uhU%h4^'huh%h4^'hhc%'}ʚ;vh%h4^'h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;vd![^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuhU%h^'h|hc%sB 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuhU%h^'hhc%U PH@LUEuhU%h^'hhc%@L11UEuhU%h]'hhc%U P0UP4UP8UP<1UWVS(]}1EYE@uhU%h]'hYhc%71҉ỦUЉUԉU1;s4s,C0 I>v X DFu EPj @u11EEEE1;s4sjEPC04 @tF1e[^_]USjPj[ZtÍ@Pjs ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tP>E t9VuFt9t,NtJKNt PKXV^Xs@Q1s@sDCMYC t6HtJKHP!ڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]UWVS ]uChU%h]'hhc%tE5t,tE5HtE5xE5C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t&zLu1t]UWVS\u~>u Vv7EEEE1]Mu^ EMQUE UJHOuԊEEjPS蝹PF Phط%F>PSVD}(u V*N>׉e[^_]USEtS,jSV[ ]UE t E] ]USEtSSG[XZ]UVSEu Ʋ9t t !ʉ11@u1[^]UWVS}] ?jWS" s jWVg" wmj:VW ZYDžt?EPjhjjj jGP C8 }tUC8jVCP! R. DJu <:tFu}Wjhjjj EPVJ C0E t/it.u#Wjhjjj j@P C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPfZYt[u{1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjjURWPVsu ju(C*WtE84%@1 u/t%SrZ@uh%SO qSnC@SCvfCDCCHSu @t CPCHC pSuCL1s@CX_Xƅ2e[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[ ؃4[^_]~ UWVSƋ tC1ۅu)u%O Ƅ  1ۅut1ۅutӃuӃ u %1ۅuu[^_]UWVSljQ} Zuh`'RÉEh#EPG ZYtfP| Xuh`'S[_LUj@PV? Uuh`'SsURj q7SQXe[^_]UWVSljӅt΀9u113j/Q ZY…tH@EEPjj jjj jua }t uh%-t SPZYuUUWV趷 ZYUuVh%0ZYtB/1t7!Xe[^_]UWVSÉUQ YE>"ux"MFGVj趬XZt7t9}s7VS耬ZY1}u>t tCEM9tHM9MsuN\?~Vnt>0bt!# tt:xtBrt#   C  E R.MNMߋUDJt!U߈U~MDyu~~U}EjjEP2$  tE1ҊM΃0wGMLBu}t?jjEP# t.S=~ttCEE}u$@t9E,1}XFe[^_]Åu À t t @ u1Ått u@ t1UVSQÉ֍EPjjjjjjR }uȉjDZ~~1CtCHuCЍe[^]UWVSE։M؋ERx EYuh`'j=u6 _ZEu Vh`'h%u1?E}u5 [E܋EE1CEE8j=W ZY)9EuuuW8 uʃ}t'Vw ^tOWE[uXuFW É4$ EBU$W.ZYUMuh`'u[} DED1u3V\w _XjCPu): uh`'yVY[41҉TMe[^_]UWVS]s {X1;s s WF,Xs1s s{$X1;s(s WF,Ys$1C(C$Ze[^_]UWVS,ljU؋E1=b$$^'E*@1$} $t uh˸%$;@2.tPXjM 11rXu 1#u1ۉh`'6Y#VQZtjM !^@t;thvx%S ZYw#So1ۉ^c#@PYO#} 1# U -#} u#jM Zuh`'h%t.u h %u%" "} t% jM _u h'%1 a"} C"H"<;"u [t <P[^""} !h#u  ZYudž!EPjjjjjju  }!u h5%!} !EPjhjjjju F }v!u hT%]!} K!8M!jhp%u u/E܋HL@ư`ijht%u [ u/E܋PTư$E܋@DFNPpMju PWSuRUSu=ju MQWSu܋URSuju VWSu܋URSD u h{%+ }  8 jhp%u n u2E܋HL E؍`ojht%u & u2E܋PTE؍'E܋@DNF0E؍FpMju PWSuRU~Rju MQWSu܋UR\Rju uWSu M 1'1} tjE 8tbj/P Y[Džt@j/P _ZDžtM @t/O1!t1ۉ/ } EPjjjjjju  }u h% )jM EYu h%  T } luh%} Uj,u A _ZDžtxu u hع%89E u=E H j[u h|`#Q 1ۅut%Ɔ EPjhjjjju % , }t h%ZO )ǍEPQMu ZYHMu-) 7: U艔) jY  T } E <4t E x4u  E 86tx6u @E @E 묃} zEPjjjjjju  }cu h&%} 8=LHM *L} j,u ν _Zt u P $Uj[Uu hB%RP& 1ɉW藼}}} u Ƈhkh"%u ZYu ƇhLhP%u a [^u Ƈh-h$u B ZYu Ƈhu jy[^Pl裸ZYuh`'iXlu P>p^_} u Ɔ 1hx2#u Y[u Ɔ |h)&u _Zu Ɔ  ]hT%u r Y[thY%u _ _Zu Ɔ +u ha%} t% jM n[u hx%1   ~o} Q8Sjhp%u u/E܋HL ư@ijht%u a u/E܋PTư$E܋@DFN0PMju PWSuRUJ?ju MQWSu܋URJj} <8>jhp%u u8E؋HE܋L @ư`xjht%u C u8E؋PE܋Tư*E؋@E܋DNF0^PpMju PWuuRUIju MQWuu؋URlIju SWuu؋URKIju VWuu؋U} j=u ȸ ZYu h% @Ej h%u ud}u11҃uM6Sj h%u u}u<1ۉ$jh%u w u0}u 1ɉM1jhܺ%u 1 tFjhպ%u  t0jh˺%u  tjhȺ%u }u(jP%U XZTEÅu h% @E؋M܍UE@u WM1ҍE@t WY#X3EPRU1EPU܍BP1EPU܍B8P1WURP)%$1ɋU jh%u }u(jP$U ^_MM1ҍE@yW"[h1ɉMEPRU!1EPU܍BP1EPU܍B8P1WURPY$$1ɋU 9jh%u  tjh%u  uB}EPjjjjDjju聺 }duh%Kj h%%u }uߋE j/u _ZDžtGSuj HuNt>EPjhjjjjW }u Guh2%ƆtGuhS%!11Ƀ}U jUEM j/u , ZYuEjP:& PJM JM UEM j/u 訳 [_uEj P%  J M J M b} DITPM 6T*߃  % Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ2Ɓ&E DžtGEM 1?j@P #  JM E } u} 8jhp%u uHLHjht%u uPT@Dju ƐVWQRP7A 8u hh% }  $ɯu _ $ZY h`'m}  4%1҅utu hû%9FU m@u u h%N K < - ! @   uh%F EEӋ4%1҅utu} t h%\ڀE Lt @Z} t6j/u D [_DžtGEU N@uu h%/ 1,E؊EE19MtIk(P} u*t,]f9Xu#U8uU8PuU8Pu U8P AjE@P(  (,P,k4EfF} FEt'EEFEFEFF}t uF1~FH j/W" ZYÅtCuWj3 HtWhS%1~_X f~ EPjjxjjjjSF } Sh2%QF[^  }    @EԍD1HEԍL PEԍTXEԍ\E؋E1҉E1ɉ} u^ }t EX]ԃ E؃}  h%}  EX$]ԍX(]؅uh!%}tlE ƅu u h>% EPjjjjjju 蘱 }t u hQ%j FVE tMhb%1E̋E ƅtFj:u  [_t8URjhjjjj@PEЃ 1ɉM܃}t)hq%j=u ѫ [_E1҉UЅt@Eh-$u ZYu'E uh%qp3h %u [_1ulE Itčph%u 诮ZYu. 5E uh%qph_$u nY[u&E uhļ%뽍ph$#u 5[Zu&E uhڼ%넍ph%u ZYu πsh%u ޭY[u @Uh#u [Zu Qh%u 袭ZYu hO1#u 脭Y[t1h%u q[Zu h%u SZYuh%u 8Y[uh%u [Zuh%u ZYu|h%u Y[u ah%u ̬[Zu@Fh:#u 豬ZYu (h%u 蓬Y[u $h%u u[Zu h%u WZYu @h%u 9Y[u @h%u [Zu h%u ZYuwh%u Y[u\h%u ǫ[Zu[h%u 謫ZYu@h?$u 葫Y[ t u h%}tu h%uXZ1E s!t@uh%NXs"}uh9%1[uu hT%urBsth c$SZYtSV Xu 1E؋Eȋ]ԋ }t&1ҋE9tE9S{IB,j,E@PQ? uh`'V]ԉ]؋J k,1CC C$C(Ẻ{EЉCs }t"u _S׋u܉)1S׋E}t5E-}t }pEfE\} >hu% `<"- } u 聀^udu h%@d} E aDžt @kh0%u Y[M܉]t&h*%u q [ZthMv%u ^ ZYu E܋U  E܋U%h%u ' Y[uGu h%Åt @Í0PWjҬ Ht h˽%|hc@&S _Zth%S ZY@yj[B 3}  jM _u h%> @} EPjjjjjju 轨 }u h%} tyEPjjjjjju  }tfu h%P} tBEPjjjjjju H }t/u h*%WPT[uhB%ZY@1 S Xe[^_]UWVSEu} EEEE1ۉE싀`'tM܉UVP ZYUMtCnuFE샸`'uu u E$EEEEE} `'EEe[^_]E8uu E{%e[^_]e[^_]UWVS }]u1pC.} t[%`EUh%% jjSǃ t:jWSƃ }tG9Et G99EuWSW* e[^_]US]t"jjSM tu S@T06 ]US] UHSuwZY9tS X1ۉ؋]UE PTuh*%hg'hh%% 2PuUWVSSljӉMBTx t41҅utSWYXu'S$ZtCP^1t<CT9FTuwFt ;CtulSVZYu_FttCttC8PF8PZYt>CPFPZYu+֋CT@$uFx9CxuF%=%}uW?&ٸt[Ftr0tCtt&SjK6XYBuc 8t hN%>XVj%6ZY@uy 8t h]%XSj6ZY@tS 8thl%X1tEVWV Ee[^_]UWVSP}tDjjSƃ t)jVSE 9~TuVSCVo uӍe[^_]UVS E uhN&hg'hPTuh*%hg'hh%%> 2uh{%hg'h߃}uFƈPVgXZt1SVuh%j uVw ى1Se[^]UWVS8uhXh']Shxh'EPhxh'}Wu WV8$thg'h%w_X14SV萞ZYujEPjEPe[^_]SVRZYt1xjjSKà jSEP2ECT x t8jSYtC8PsT!<_Z@u h%豯YS;U t2C9t ;E !SEP_Z CTESPNjC|ZYtwG|tEuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWuW R /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh1&hh'h{uh%hh'h|h%y Fu#<u;FuFPhW$WSLq @u612WSPFDPgÃVWSPFP Ã؍e[^_]UWVS}] uh%hh'huh%%hh'hh%̼ GS8t)R78s<t<t1&vvRS Q/ e[^_]UWVS(uuh%hh'hFE<t<FVU1QF1 G!)JO9tx$ dB@t8tM9r1=8}1ɿ}tAut]@}9s8 /`1ۀ=E5uU}ع1E׈EE5S}W<WV-th1%hh'h'h% E51ۉ؍e[^_]UVS]C<t<t1 /g S'؉U Y=E5t15E5S>Z;E thI%hh'hnh%聺 E5Ǎe[^]UEU uh%hh'huhz&hh'hh%6 fPUWVEu uh%hh'huhz&hh'hh% fe^_]USi'tPhc%o XZ]UWVSD1}]SN[Z@j0Sl\1uuuu}WS\1;5]'s/]'H>v 薿  DF1;5x]'s/|]'H>v ]  DFWS\6 1҉u uSjE0EPJƃ S[YEt  0e[^_]UVSuEPu V uVjMV ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWhk%Vu 1Íe[^_]UWVSU} u19s$@u9s8uhq%h|i'hC؀xth%h|i'hh%׷ u1W9s*jCPUK tًUGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`PHXZ `SKU X4%@1҅ut _t^Fh#Yu%Ph%S @ 1 Ph%S @uWh%S @ydhlh%W YZu@ltDžplxDjVYZuGDžph%W语 YZW蟫 Z|6h %W舭 ZYuDžph̪%Wh ZYh#WS ZYhª%W> ZYh%%W) ZYyh#W ZYdh%W ZYOh%W ZYpDžp Džp_t@F Ph%SU @pi'tPh&%S. @7@t pOdTX%u#Qh2%S @hVL$&t $Juf%PhC%S @9vHhP%S @!FPPh\%Sr @v$hj%SZ @V舨Phu%S>@~Pt?vtFQPhhtRE@ttRh~%S @~xuF4%@1҅ 1hXh'tPtXY#FxPh%S @u(z u RuARPXQTtP@ZYT9Pth%Sk ZY@jjtPƒ ttqTjjP T9u-BTT Ph$Sdk @T`jR뛉Th%h$S9k @Tu4jPSjO @h%Wũ ZYu>dTX1҅u%#h%Wv ZYh̪%Wa ZYh#WL ZYh#W7 ZYhª%W" ZYth%%W Y_twpuhehxOpu VZ;pul/lxDpjV}Y_#%#Ph%S @Wh%S @VvtZ%u6u_%u*Ph%S @umt:u%u @t>(W&tY%uPh%S @u'h%S}_Z@pu^hh@hq PVh8%ST@d8%O@ugpll@LlqPPVh8%SY#@\puPhtfh@tYhqPVh%SS@d%pu,Vh%S蚭 @1d u{puDt׃8tVYtËlpHpDVh%S}"럃ptpuVS_ZPh$S @tXd 0uS. S_Y^u hpi'/Z#_tFP`P u,hpi'X_Džp.؍e[^_]UVSË2\tPSKd e[^]UWVSQ} utu@GLª%t #Ht#}tE1@ۅt 1ۃu4t&xt HHt}tEP@uCWZt!CE}t%EE@t]jWb[^t WYuu"Ep}t %Eƃuًt 8u1W Zt^}t8EÃuˉ؍e[^_]UVS]u tPހ~t9~ :jh%S uSg S诡 \ZY9rhJ. X1e[^]UWVSEE} u |UGƃuh\i'蝘Y[jh%Ww uu Ee[^_]E1҉UWPE Ph%ԗEPƃuuhPi'hfU# jEPVd @u > 8thPi'hm#ܗ1ɉM^_EuƒutSP賜 ZY} -];уM I+ѻ}h#EP2 ZY;tjht%Sn ujhp%SW uu1;}1u1;} uJum艪 [EPjjjjjjSs }tG,9uSv 袛 ZYEPjjjjjjSjs }u9G,nFu2m d!umX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9 1E؉EErE,@x VuQ9uuɨ "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms Y 7뎉ߋM_.MIE)M܋E9,}v M}}t ;]tC }uUUt;]tC } t}E[^_]UWVSu EEE}1ۋE9EeEEHes2j'j'Gesy4EuyR.DBtes R.DB@t E\t-x)R.DBte/t M¦ M\u/t#w覦 7f\\t0v\0G0G0OttNGCt*tesUEu EZY[^_]UWVSÉ׉U7(ƍPS裔YZ@Wh$SPX @}uSj== _Z@u$p hW#SX @u@ s=Vu hV wXPj sVu Sn> Y s Vu Ss=ҁ u V( t.Vu PhV@Vh$SshmN$SZYsC1D0t<0u FuM  )sSP; Y_@u|u } 9K;} u@tPh"&Sj ; ^Z@u3tPh#SV @G루tffPh"&t&ffPh#SEV @c t Ph"&@tPh#SV t%7 Ph$SU @sWj.VWjt tcVh$SU @tQ?tGuUWVC*P U[҃VSo_Zu VSo[^tRXZR軏YtPtˉrVSA_Zu VS貎ZYtX袛 /1 蓛 ؍e[^_]UWVS,E̋A tӉ΀ytu[ x1}ԍVx}W}ԉ}Z@$1FCt}ЉF tCUfCF t&EȀxu xtK|@Ft C8UF t CXUF0CxFftPEt虈_ZF tU tUȋECTt14~t e h%EtCTZYuՃe[^_]UWVS8%XZe[^_]UVSutFt P>XCtP>YS_[1ZtEe[^]B[e[^]UWVSUu ]8Z>t F1Dž@jB UPPĥfDž ˉhPhiUpv UJ>r*hPhipkv ,؍e[^_]UVS1ƅ@ CtDžC8P.^CP~ƋƒYu9Zu)CT@fCXP_u tt uC| t Cxt(1ɉ,uCTƅƅfDž1󫋅@p׉މ;tHH t2fDž f󥃅 ZupV耆XZtHHt'CstHHt0fDž f󥃅  t'CXsXtHH)fPR5 @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP4Y@OHuWTY1CPW+QXZ$jjVSjLPX@u 8 넋H؉@D@9DDx9@sŐ DD9@r׉F u]dEuGuXu hs'wX?$RuhnPmpPC(PSZ뼋F1,1t zuB01$t$uG4h1 jSVfDžx,|Vhi@(g @u6) 8t 81ths'hl%nY^<< 4R0R,RSjP(e$4󥍽hr󥃽$t$j4PSƃ u6c 8tY 81ths'h}%mXZ31 "4u5c @tcCDžDDRhpBPc @t>uSU ^_u1C YuCtP)ZSFX1ۉ؍e[^_]UWVS(]c{u'ss s(@ S1sSC ЉEԍENjuEEEE؋E܋uЃ9CrHuԋEƋM9MsMM̉MV3ZY{MԅUЉu}ԋEԉC} E܋}؍D8CC;Cr 1CCK%Ѝe[^_]UEEE EEPhgBua UWVS`fy(u}u'󥾀t'Xҍ4uV@t'DžLDžPDžPhBS a ;賁 .Xt'DžLDžPjRS e[^_]UVS ]E fy(u/UEfEq*ufI.fMffEк11҉EUEEEEjEPs%e[^]US]sq's %DXZ]]DUE@u(1ҋEp@th~B Ep_ ZY@UWVSM}]utDw z .E C[UU +29sJ "1.1U 1ۉ19t9u} A,[^_]UWVSSÉ1҅tލ<}})v ~tCf…t‰Z[^_]UWVSEӁcSctu V1E E1}}1EEEtHe{l}܍}u܋U9NQUt9Mu&~ Ee{,}܍{l믍~}~MNM9Mr}ʀ}t}4u NɀMU;Uf}}tcuU9s;1t)ЉuRT>ZY}艇} u E苀MNjuu؉uUU} t] u3tMNjuE苀E}u } Ee[^_]USSӉʍMQM QMZYt }u1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]USSӉʍMQM QMZYt}uȉ1҉Ћ]USS\t rXs\1C\ ]USS`t RXs`D#C` ]US]$S<>XZ]]E@UWVSRË1utOC><vGD&BTtt_9t;t1zT9yTu)1uuUZ U밋@븀{>v P Sh!%b e[^_]UWVSÉ։h,j:ZYt:PǀcScufǀ,1e[^_]UWVS@ÉRiY@u Ph9%aXZ.Gw*hH PhG%a th, Pj9_Xt@dtVWv<u?(9x u1Wt cScuGhu @G @(GH>A<wOw*󤋅% 1҅ut&x utmtdf@ tStJSj]jPSU9Ѻrf‹fP@TȋG,D8ǀcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃf@6Vt4L7Pu"uJƃv9nC,m@1ɉ;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃qf9 ffC tHGY u<)9(CM A 󤋽 \ tC)9C= A󤋽 \wr sb@WuM tB)9iC< A 󤋵 \ttWH4%1҅u/u+@t@Zu)؃fPhPIƃ tjt jVC_ZP)9}QC t  CfCtKSVY^>t/t+Va Z@)9  CKttdt[%1҅ut)@^u)؃ftC t@)9rhC A 󤋽 \S)‰)=+wD@1,w,)Ѝ4? Ph%+X4 hAe[^_]UVS~\jhžPF\ uFp 8u!5l6.h%WY[ Shu'hfU#tW 1Sh jpK@uhu'ha%?WXZ1e[^]UWVSMuh%hu'hh%j Ӌ}S OuO 0u싐1utXt Ctw qjSPC u3BC C^PP S@BSjuME"ZY@u 3~BCXSjuME^_@u C CS j3uMEZYtC Sj:uME^_t1ɉKSj;uME_Zt1sSj6uMEZYt1Ce[^_]UWVSu/h4j-ËXZ1C`CH̪%1CPsijhV%1҃utV0s^_ p11 % 1Y t/@P( ^ A %1҅u1utfpFPg( Y?V @ QP lpS@>p@P' Z W(P O>w*󤋅Ɓ1uTuP%1҅ut3 t)hRR@PP Ph%>@>u1DhRP*PP Ph%RhLu'RXe[^_]UWVS$Ɖ1iu1h%7RfNJ.Xfth$SP2à 1GiPV Rh,%Qh$SP6~Ãuk 8t8iW VhfU#,R!w h@u' VhB%R 1d4@1u$u j5SWY^@uƅS%Zu h@u'QX랍lj󤋅e[^_]UWVSS]Sj8_Zt,]t#8tCP%Zulj1e[^_]UWVS$ϋEE EhZ%R[ ZYu}WƅP~Y $$Xۋuhtu'PYuQVhRSV-<@t-PSP XZuEtu'e[^_]=P1ۍj6j4@uƅx,w #j@,Ph@hW0u臬WPh#pWPh#SVho%[N$v#t8%u)PWVh% N(PWSVh_%M ]e[^_][+UWVS] u'tPh# XZE1E;s31;Et k, 9t@v 6h% PV|G,1;uts 3h% PSVF,܍e[^_]UWVSEvpE E] P1}tEuSPh%u @tBE^PҪPhϏ%u @t E9sT;] us< v!f Juj k ZY@u؍CT9Ubf "uj5 ZY@te[^_]UWVSuE ]xKt t4SWhS"@u{Sh$VO Xt6f S7ɩPh$V @tuuVj~ ZYVj r ZY@u@ue 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hHMЋ@E؋E E@_tE@oE'EPjyMЋU؋E X^XtE#,EPhMЋU؋E .Y[E̗%E4u1҉UMUu X1E1tENjM U)уȉEU~@uCtEPS萣EPCP胣EPC8PvSu  EE9w< v c #ЍzD9E7c "E@Tt 1ɉMEPj!MЋU؋E XZt؋]u1E9EFEtu ƔXu EEU9t M;At;A u1EEIʸy,%=t%=t 1tȉE@uGtEPW'EPGPEPG8P Wu趕 ]E@PEPjMЋU؋E Y^E41҉UU9u 譓XEEPW胡EPGPvEPG8PiWu ]뤋EԋE؉U%1҅u7u3E @hu$űE Ph% HEԁ Ee[^_]UWVS$]ƅj4uM^_@uƅExux uExl!WPu h%u7@u1juMqZY@t+W3ƉP舤Pu h%uڡ@tV)3Pu h%u贡@yjuMZY@t,E#pV!Pu h%us@ 3 PPu h %uA@ut Ex,u@GhElPhhV4Vu h!%u$@ut 1;j@E,Ph@hVVu h0%u蟠$@uc;s WF,X鋃@1;Ds WF,Xh1;ls WʿF,X鋀13;⋍T9Pu{@D19t ;t_B,RPMUXZtu-Vdt&F$;BuFhuPќSPG PhO%^?v$跜SPG PhO%p?E苐84EЉU%1҅ut*FH%h%W蕦jEY8~HuJFt.Fhu(VJ9Hu~<t>t FH%FHl%>u FHs%FHz%~0uF8F4eWhv4jE6Wh3v8jE6(Wh v0jE6v8v4G Ph%+>$~@u\EEЉU%1҅uY[^hEtGW4ZueE苐84EUt]hF%=jE6 >vHW7juW#*tFdFhӉe[^_]g__e[^_]g_UWVS EEE EEt uujjE5ZEE싀ƃ1ut{%1҅upul ! CiPE0wu@ t@{t:{<t4s$ʙPE Ph%_EHT%u v'rt E:tQVC Ph%:1uEPLt @v@}GLihS ES2>ZYEE1}m5 N&EHT%u v'zt E:tVV$QWC Ph%=:MElE@eEEE@ht 1ɉMExdtj$PS& tڋE@$Et͋E@4%1҅uu hf&&SY^Sjj01҉UuX}tSuuj@0e[^_]g_USE]UWVS ]ESjj0Ghu/E$t#tShPj/E1u}}{ u}tE3PWhz%6!%u%QWh%6 ]e[^_]UVSuF Ph%6s b1C CCL ue[^]U幖E]UVS]tVwLShj.v$cPC Ph%5 1FL]e[^]낍e[^]UE]=UWVS]{ Wh%5F0+F8PWh%5ShjA.1FE]UWVS0EEE܋EUE48%ua=uZuQjYuEXu'e[^_]{0Sh jP$@uhXu'ha%R0XZ8u#ujh0j> @tEi@Eu Ph %0EPjE1pLp d E1x xE܋ƃ1 utEe[^_]Ɓ1EP E}GG @EjEPuUJ cSc}܋]ԉu؉t t@tQDcScXEp$pEE@@[xYE@ cSctP@ E1p p_!E܋EԉU؁E@ uEEe[^_]cScuE܋% 1҅u΅uʋE;E1{L%1҅ut%u 1^uE Ph%-ZYE䋀ƃ1%1҅ut/s$螊PE Ph5%U-EEe[^_]E䃸C cScs$DPE PhQ%,E1C<wPh*PBP uhx  XTTu ~P1ҋPX#\ًP9 tW9r7)Ph Ph#%s TX#\PˋP9 / 9r̍oj5`hUZY@u ƅoATX\th Ph%(Y[ oX< uBHvW`Vh%W`Vh% duW`Vh%%uW`Vh%d1҉PLDžPPPTDpt;jP`h:Y[tW`Vh)%PPuDžPXT@6@t:tj6`h[Z@uW`Vh5%W`VhZ%`hKƃ tPh Ph@%&V:d8 h4%1҅u.u*h<%hdiPh0ڠhhidpPjh;d@Pud@Pi<wPC*PEP u%C PF Phz%KuMUd[뚍e[^_]UWVS8EE] }uP8Yt99s&}E EE u'E%e[^_]b)WPS nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉʵfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMЍE eUfҋESftuxPE Ph% (fEfu)T3EPE+Xe[^_]UWVS$}E ^\ftPhu'h;% cCubh$RSU u#>t=G Phu'hfU#EW*sPRWt^\ue[^_]UWVSE 0xjPu( uEdu'e[^_]ËOwvwPw Sh%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhu'h;% t @`jVP u hu'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuV4Xt,sss Stttt:uj@苃t$P ǃ tPǃY%1Ze[^]W|$wUWVS }7tu PdYF><vu#%1҅uuF(fu  Ӂt1ۅu uuE0e[^_]g_h{ ÉE1Em5 N&RR$F Ph%VhTSjt(e[^_]g_UVS]ShTj|t~ht j3.fXZe[^]UWVS E} w]~tuE9{dfG PuF Ph %`VE1҉Pdhܪ%VV *!GuE@ @;Gu}P;sPF PhA%%1҃ut V[AV%1YuمtӨtW1~E84%u!uG]9C$uSh{dChTE胸,1ۅutEVZ1҅uEpE@]CO W؃~]CX{F$E}uEUҊM]脄tI_E@Ѐ8t HD)у@v - M@X@E}uE@Ha%j6cEpHVp{e[^_]UU1t )]UWUBvg- 0E 1ɉJI} ډу¸)Ј1_]UE1҅t3Ⱥy(t%=t1҉]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVSdEtE}?Ex 'Eu1E@$ hXh'EPLjju OÃ{E8uǀxhtxduh%hv'h*h%=$ hXh'uV`LE@dZYx tWu[Xu1RK|EPdB#B E}WS}iE@d@ EWCPgiC9SV]jjEEPN jjEPNE }E8P\d_uqE0@Z^D$NjuuPZC| SEPq\juEP?NEuEPZY@E@$tvtguvZX1uuVSOhVCPEhE@dEPC8P/hE@dEPCXPh SEP[_Xu[jj}WMà SWMsxC|ZY uC|E@dEPCXPgSu K9tSYS-WX떀{tjSu Mà uhSb_tߍC8EPb^ujju Lƃ t9tEuVdZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E1u}}G$tN}u>}Ghu5j}Ghu5jLZt tSpPx]UVSu8jjÉ^Xu hw'UY1[1҉SCC ؍e[^]UVS]Cdƃ CdC`tChPC Ph% uGuAC Ph %zY^KtPd sҀ(t h%QgXZe[^]US]u:jYt'1҉@ǃǃǃ1҉Ћ]USPE]UURPDRptPQRP>RP*RuM UuU]UWS]U vJ 119t@u1 Gw'[_]UWVSUyv  u1΃y tËAdr@t$tt @$u@h(%DX؋UÅtF PSXFP}WWCPXFd@t Kth( u} WC8PWY_C9@VCXPWXZ؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PVJXZ?ˍe[^_]UWVSQEp1҃t<t19sAM1ɻ BAt }ut1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}]Cfw EHfv, f9]u1Ʌtd@w 1 w w w ?w xIÉEU)ЉE9} "uu}u1EEftff@~jVC@P5 ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjS'ƒ ujjS]m ]UWVS} uEtCt=u{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVS} 1EEEE3CdEu u%StVMQS2uCE䋀%u=tuuStPMQSjC@PE0 tK9Ht ESXESut URP'ZYSXu e[^_]UWVS} Et0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UVSEt0t.ttju CPPy t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j]Zuhv'$YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZoECCdUSǃt_{ u Pu uƃ C S@t@sdKQPuR[@u s{ u @t{ u j.EPC K{@u RURY^@s@{ 1UĊ  L @uj.EPC@PjJ tOSRPh%j.ChPS jC@Pu+ tP`S`Cdt  K`(Cdhv' SXZ1ۉ؍e[^_]UWVS$EEE EEU}uM M؋M$M܋M(MԅuEtLRPEY[8E(uZEЋEt2jWC@Pv uE܉C`}tp}ʃ}jVWu{Px{@u 1C$C {4s(E܉C`1E@CEX}CPt Nju (CdE܀t CdtS` ttSX{@t4E4uSu!uSuu}uLSYMCAPu<{*Vhhw'Wr tVh`w'Wxr u m  ] VvEU1Ejj@EPSƃ@$@ 1ɉM䋃%1҅ut6EPSFPF PF@P@u VE䉆F F@FFDf{(uXC><u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLVI VFHtVo/ eFHE8V@?jG@PRUp UuG`t7%1҅uuV 1ZiEGhPG Ph?%>V oj.FhPRj 1E@F0EpjVt8;Cdt,rq PjCPPCP@SF PtjR$če[^_]UWVSEtt?u[0tFdЩu1҉t Pu /Y_6ҋEt^tTCƅtDGPEPn8WRV @u hw'!Y|@P|WShJjj Vh%XZe[^_]UWVSPUB UPh%xUXYu-jjαËU_XuEw'e[^_]~U3CUB>^t @H KUQjsZYtUJ>t/@}wFH r*NjM;rC 1CUe[^_]&W|$wUWVS ue[^_]g_h< ƉE1Em5 N&RR$C Ph% Sh~LVj(e[^_]g_UU t,t9PuƀRhRjj&UUу1t.w 1#tRh,x'h#% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`P EF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS81ۉ]]]E1u1EEE9CEׄCdt\URSTRP譖 t t0u5CPE Ph=%+1ɉKd EEt9sEsxF URV4RP; t tlVdtRNh\%t#%QPF PhT%Vj_@u 81t 8t h x'Z1F$F fdEt9sE6NEtXMPF$Pv苕 t t1F0PC Phf%V tPVujSTRPEċCPEЋCL }ffMM9Ms KMɉMMԃщu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u(}uƃEȃ}v1ɺ>]4tuhyOWjE}t?E Ph{%EEZjE0"h %u:e[^_]UUt&t9PutƀU]a]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S^ u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EɮEP1ZYtU9pu 1ɺ]GEttu4@t$P蔑ǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj>E _X1EE 9CEuh%j uV艗 CPVh%u* @uosXsTVh%u*@tuuVh%u*@tCtPVh%uw*@tC`PC`^E#tE%"t #Au]$# t]##@tWR$#y#uRWVQuVh%u) @&sdVh%u)@ C1C;s WAIF,Z拀H1C;Ls WIF,XCPECLE}EfE9Es? SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhDPB PEPu2E UU)U0sx1t8Fd%u'~ t!GFhPWEPh%ui(@6ċ?e[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09XuƀلtKj3n%Y^u=t h %S4XZe[^]UWVS} 71ۉff}fuEfǀ< 1҉1ЉЃEu.Ef}w z'Ph%j ]S 1:BUP XۋUuhy'XߋMDغuf}f9<t >tuă PVh%R蕷SEf]f< 18f}uVh%}ȃl(Y[Eċ4%1҅utjXZE΍e[^_]UWVSSƋ1;,k(Kfu{u#{u{ u {u{t]fuCUhPCPVUt1ǀ Kf1ɉHG[e[^_]UWVShEw E@EEEE@|tXdÀuXdBEAE1ɉMM}Ef9UrZ9]s# E Ph%¶XZu<}])Ӊ]ff}ftftfu f9s# E Ph%Y_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPD< UtLF΅uE4%@1҅u/u+j EPjEPGsPE Ph0%;f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPruSVPE PhQ%D(b1ủuEEPM1ҋEPE[tE-Eƀ>f}uEȅEEEPjuWƃiUЍ M))Ufw# E Phu%谴ZY%EܹEȉEUʉU9s* uuE Ph%QEX|ۍEtjPS׷ u`jhPuhǀEfEĉ{(u 1ECECdu%Cd{4u EC$U9S tKdS t};sC t u9FhsFhE}{}uuE Ph%6 Tf}t21u~`}W9rF`E̅t}OdMQ9rGdE}uE؉EEe[^_]UWVSljUMu w@ Ph% 1҉u1ɋUYt E1ɉKhKdK`ǃu uVj XZƃ>VuMUZYuC;u}tG Ph%G[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[] 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύG=DQK wWF(1RPQh%~(WQh8%j EPjSuuAtBf}u;8ύG=DQK wWF,1RPQhR%蠰~,WQhl% e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@%}tQuЋE؃ Ph%ub18ujjE؋謨EPjc$@x'8u ǃ8%EPj s@s<Qtf}uʁXsXS`1CdChǃF8u ǃ8%8u ǃ8%8u ǃ8%8u ǃ8%{`tps|t8Fdu.S`F !AtH9sFhPE؃ Ph% 16ċC`tPE؃ Ph%1CdC` u9t.E1Em M&}fEހ fEm}mދEȉC`{duEt:E1Em N&}fEހ fEm}mދEȉCd ǃ8%}Eǃ;uCTt>}t8sLъCDCLCHCPCFd rFV t#tFhPF Ph% 1F$upFhPF Ph!% Vd s"1F$F VjjF蝤-NtHN rV裰XVBYHC`;}؍w u PVh;%MuVhU%,KdSh tRQPVhm%u跪)uVh%u蠪 RVh%u茪jE0XZ}uA}t;WVh%sHsDhWE0% @u Wh%7^_E؋^|tFCdҀ t ujC@Ps tKd Cd uًE؃ Ph%sw8uE0 E؋041ۅu2u.}؋1ۅut$%1҅uuj\Y[XZ렍e[^_]g_W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@,u1siS0,G$u u iSS0S ti;S0sS0udR Yd{u1ɋS0) N& ڽ 1$߭ ٽ2f2 f0٭0߽ ٭2 Љ ,茪Z{ 1߭5 N&u +t #u¹%ݝC4HH H¸%݅u%+t%WW$VQ RP, Ph%#,{t 1s,薩Y6Pjs8s4Wf6t脿 ,TVj>XZGu 1a8RPVvljփ 9иr781kddȃ9ƾsff+tST1󫋅,@EUUE E)E.E d}TjEP%c @u, Phy'hY% C@Cto ?9sS0S9su,S$t%,R jŜP, Phi%d e[^_]g_UE]UE]U E]UE]U,E]U=E]UNE]UE_yuP]zU庁E]i twUWVS 1tx 4 u1ۋM9s3ru2u\tffW׋uUuƅtfC [^_]1UWVS@D@H@4tPH1҉P4YH8 w$Xx'ƅ< dƅ<;  ƅ< Bƅ<ƅ<0ƅ<ƅ<D 4u:ƅ<D8%1҅ut,Dž41DhP  14H,X@(fDž11,,9(DPDT19tk,<>98tB9rIpr@uDtDu f,,ht1(4tj(\ZYDu" t\1(fDžD,0% 1҅ut#j@wPB$t @pt1$Dx@1ƋH8G 5bu`(uHX<@D&v P Ph!%՜ HP4BbCD_Zu hx'Y#Nj󤋅CH_1҉tjhj|PtP6-sD/j1CDCH| e[^_]UWVS] E1E;s31;Et k,9 t@v 6hh%U PV=G,1;uts 3hh%_U PSF,܍e[^_]UE@|tPd(t1]USEu1X|tuu SC u؋]UVSEt0t-uvX|tuu S u1ۉ؍e[^]1UWVS} G@4j.DVCPjv 4wVhp% ~}tE@<"jWu茙< u hy'G8@Pj48Ƌ<% 1҃utjtHuƅ0eDP< Ph%]Ph%> YX؃t w t u F19tAE9uuUM7Ph"&D> XZUM΃^Ѝe[^_]UhJ.h%ގj:4 4J5(J5t9W|$wUWVSHJ51B(J515x6.% J7fj7 s fLJ5/sfLJ5 s/fLJ5fI5fNJ5XJ5tJ7 erIHJ5@J5ffLJ5fNJ5=J5tijEP EȣPJ5EȣTJ5ZYFIJ5LJ5HJ5 8J5F h%~AFfVRVRPWSPh-%: j.]SFPj2] uj.h#S讙 ShO%: j.SFPj] uj.h#S~ S@F^(ZU)ڃ<,wJ<w1tR<CSPSPh%<+hg%"<:tI<g YƄ4\n1j7:h/$& T@Z<t <uh%h9&& XDž8)T@Hʃ8tHj,c% XHT@uRh %yRh%Rh-%& YXtj,$% h4%% XZ)P\uj,$ h=%% _XRT@9@8j,$ VT@PhE%% j7P!PWhͥ$i% T <x2<w><tG<T@8Ph%P $z'<rT@<w*${'h\%Bht%;h%4h $-hH$&Ph%,T@t <uh$h%.+^ Ph%$ Y[THFh5%f$ T@Z<t%w uhI%<uh%h[%5$ _ho%Ph% $ [^T@8Ph%$ THjh%h%h%h%h%h%h%}h#%sh9%ihP%*j.STPjE uj.h#Ss ShY%I# j.STPjE uj.h#S= Shi%hy% # h#" T@f8fZYfw2$({'h%h%h%h%h%h%zuh%nh%h%" S1ɋHQ t Sh#$h%&uj.VSjD h%!" [h %" h#" T@fHfZYfw-$<{'h%!h%h%h% h%h%! Xj7t-T@<m4|'h!#PhW$! ^_j7 j7uhJ.? [g v狝t݃{)!C2t!#t1 h"%3th2% C YhB% C HC SRRPC PhN% HlǃxPhs% XZ h% XCPh%~ Y^19~gVHlYZuVh%Y XZCj.RPjB uj.h#RF PVh% F땋L 9؋4J50J5t9~~j7 qm0J50t 90P UWVS]u#j7tP3^1ۉj7j7S_ j7@$#+j7Yu8p U1҉j75R.t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSU}tIB<:u1ɍ4 E  8uAu t<@t:u <:tu9uF~@u1[^_]UE6.]USE] u|À:u%u@C8t9EsH:tt @|u1[]UWVS4}!}u[=j7tQu Wn[^u<5j7P)YtHWP D3XZhY)^1u?]n Dž)Etw}xjjjunM !jh@PE xDž1ɉ1ދ9rqhQuƒ ?tuZ_m 0S0Rm 0HЀ u%V1Iu8:ut+<Dž\t-Dž t t11:uΉ1҉V9r)ډ)ށVSv,ZYu"S/^u[Ɖ‰.1<#kcu SZYPFS7/XDž6.M1j=hI%&S ƊtV:t֍HX)ىMAQPuVË tF}t uXWi.^KtF:^Dž@DžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QW_*ZYu:W-Xt uXr-2j _<ljljƉlj )PVQR SR? ,Ymt u^)؍P9s&PSD)ZYuS,Ai XË Dže[^_]UPUjujM EUj7tPS6 1҉j7Y1j7j7j71UWVS1=j7uE j7=j7uYh o%j70 j7^_u=`P5j7EY[t?Duz1=j7j7t=j7uj7j7u@ @uPp5 1j7j7Pj7@Zu 1Sh o%PAًR.TZ:u#t =j7t|0\Nj7G|0\u j7P1ɍt:uf:Y\tAߍP5j7 Y^u'j7tB @Ry4 1j7ZD돁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u wu ][^]UWVS j=u uy ljd![Edu!f l8]EdUru<:<^uFG<:wMu})ߍGdPS%ZYuS([w<\ůG<:HЀw+1ɉMF0MȉE9t HЀvE농w1e[^_]UPEPhh r7h@v7uƒ1uEUWVS} uLu7uuW1ɋU à =$v7u u1Ɖ>1e[^_]UPEPhh r7h@v7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ@#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rסv7EСv7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSU} u]RI $URjW I $WjVH $Vj$SH ZE] Ee[^_]UVS@ÉjjjQjRP5 tNtL9tHVP ZY@u:%Y j@]S0%iW hO#Sh %P6.=v7t/ 1e[^]UWVSSÃ=v7tO1t v7<!j ơv7!v7)Y9sRUv7Z9Uu)@uÅu,v7!1ɉ1ƅtÉ5v7v71e[^_]USX?v79v7rv7Év7 4t1[]À=|v7UVSh#h#h#h2%6.h#hO#hv"hS%6.6. "=}v7t]#j&=~v7td&%=v7t%QRPh_%Ӌ56.r$=xv7t,%;i$=yv7t~v%`R#=zv7tt"/%={v7t &SQRP֋56.]ڡw7h#hO#Phx%֋56. ڸh#hO#Ph%֋56.ڡv7mh#hO#Ph%֋56. ڡv7Fh#hO#Ph%֋56.ڡv7"h#h#Ph%֋56. ڡ6.h#h*$Ph%h#h#h#h%6. e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVS v7v7v7k(0.h~'@P9w1ۉ^,v7~0XY1ۡv7E9s6U1h~'GPwKGU!C(XYk(|0v7EM9sCU1h~'GPvv7E؋M)@v7GUC(XYk(|0EMv79U1h~'GPXvv7Ev7EEM)ȍHv7GUWC(YXR h#h#h%P6.=v7t* v70e[^_]UVSv7;w7s4>uDC[^]áv7uÀ=w74UWVSS DžDžDžjjPhw7jP-@u w7 v7Pv71 @Hv71t3tShPh%B t!Ƅ9h%jXu ƅ諆 t5tv7u v7FtB<97$|'v7}v7}v7~v7~v7볡6. v7Q9}H 6.@6.|v7|v7w6.iH6. v7Q9P@6.E6.7H6. v7Q9@6.{v7{v7zv7zv7yv7yv7xv7xv7ƅO hY#Rh$%P6.G%Q =|v7t h Y=6.6.9}6.׸Év7 v7 v7r5v7v7v7)I v7v7Pv7tPv7 6.v7Bv7 v7Љv74v7#5v7t@v7)‰v7={v7t*1҉j Ph " h~'hv7qj>v7v7v7h~'hv7q11v7w7lãv7u&w7 1tw71e[^_]1À=w7u1áv7u v7UWVS@É;v7;v7ji¡v7_9u739u0PLY;v7u;v7)v7v7jVS` 19Z;P v7PPhv7q=v7XZVS Y_@u:N j@}W0^M hO#Wh %P6.=v7t3% 95v7u"tX v7PPhv7rqXZe[^_]UWVSEЉʋv7!Ë v7)){ MA L>D=}v7tMjRP_ M95v7sxu@)lj|| >;v7Fs"J| u| | DT>| T 9Ss$EExSWrED CSWp;sss{uISC PrXZ=}v7uE@,t v7EX,v7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC v7‰ى[^_]UWVS¡v7!9t> v7)su܋tu 9t)D @!u܋D UEPhv7En@ZYe[^_]UWVSQӋv7!‹ v7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS Eܡv7Ћu!9`x }؋ v7)‰Wt~v7]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w ~'w~'"1w}'1;SsS |C@C;Fu ;u1ɉHt SFPpXZNZH9t9sxt PFPmY_SVmXZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPhv75lPhv7o=~v7t KZ{ SC v7v7e[^_]UWVS9v7tv79kjjhv7nǃ t؋_ jWhv7|nEWhv7nv7=v7;v7r;v7rw1ɉÅuj}먋 v71ÅuP=v7@u1jwNjv7!‰)[9tPWv7Y9uō3v7t]EPhv7IkXZt>G 9r7 39s0jWhv7mEWhv7nv7=v7}뾉؍e[^_]UWVSÉU v7EC1t}9xts@Ƌuzơv7EF}}1U9s1k`;$'t @u-$ ' ' sjtt5 0@p00uHP@$u1S$0t9(s5 *\p0믋H@9(s(0띍e[^_]UU%;\(sR.]UU%;(s4D.]øUS] uShJ._ h"S脯t4 0Ph"$hJ.o hJ.j FXZEJ.]I UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt 3 )wu PEPà Et T3 1]UWVS ‹@E졐R.E11 =E}9s%9]D{t}tk Y DFɅt}uzuB w7Bw7 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEPÃxuUSˋ@ ى[]ÃxuPw7@w79Ps=UVSÉjRpfg u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD P` C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$'sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj=P.t9s?MjC,@Ps(c Mu e[^_]C(S,z{,f P{<tgFR.0=P.u9sR.0=P.u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E 7.HuVQM  t uMQ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCCw7 w7w7'8[u"x.u.K9r !f3r9s:.u z]u{uCw7Cw7[^]èu'B R.fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uCw7Cw7{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4݀' ZYuCC u1]UUE ft҉U|']1]UWVSSɾ=P.t9rC,E5R.=R.113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh%V u 1ɺjh%V u1ɺ,S j@B@Pr ^ u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uCw7Cw7w7<-t<]u{uCw7Cw7w7CE؋ R.Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ=P.u˸jE@$E@PEp \ u fMA Q$JuN$f8-P9x]x-t A -f9k=P.vNf9~;{uC w7Cw7ff9UPF΃=P.uމEa~{uC w7Cw71E7* UFup>-uF3-U;Cr{uC P8]u w7Cw7{Ex8tC @tEHfE1P.u9}~Ju9sE8}3G8GEx<t4t fEfu-GR.8EuޡR.8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF R.f tNt R. t< R.ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCCw7w7GƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC w7Cw7{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JR.DJt%9~{uC w7Cw7PU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uCw7Cw7<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $P'^[m\p{|;{r{uCw7Cw7S B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)uw7Cw7 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCCw7w7Gu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM R.Dyu},t{uC Cw7w7@}t{uC w7Cw7?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJR.DJt%9~{uC w7Cw7PaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPR.DPt 1e[^_]UWVS} UҀcE tEp9J) Wq ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEu+Džh1"1DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXR.DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qERGPx u )MuMA}dM)ыU9uG PVUx @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ R.Qu?f_t9f}fMQҋ R.Qu f}_zftQ R.WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgR.OJf_ f}_Zf_ 8u_CfCU R.DQuf}_f}u2ы R.DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVeh @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRUUb UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f R.DAu;f_t5f}E R.DAu f}_fEzftOR.DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡR.DHf_ uR.Dpf}_Ɖ 8uaCf7E R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRU_ U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRU)[ UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG R.AuE R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRUX U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVP @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=P.lt1ۉ]tMEAEWr YE}M9MP F,EF4EtpF8EtfFu}D$ Ġ[^_]Ëhld<D$gD$<$D$D$<$ D$gD$<$D$gD$<$D$gD$<$D$0D$<$zd9M`D$D$t<$A`u!phD$gD$<$'UWVSG,} uttEEgEEEED$E$OQ…PEt: /ĸ [^_]ÉUD$ED$$EDžDžDžDžjDžUDžDžDž W}׉ƍWOt%%VF9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$UMDžDžDžDžDžUE@fE@fMIL$D$ RD$D$$p t$ D$D$ 4$up EDžDžDžUE@MIMI Ɖȉ } Dž UE$D$D$4$D$:4$ U H9EDžDžDžDžDžDžDžDžE@fEEDžDžW19ĸ [^_]øzR%Kwҋd>V9s%u9sF?V?r95+ gNv.&.&N9sVu鋽 Ex[ hML$ D$D$$wt.&.&V9sNu[Ex @?⋅D$ ~D$D$$m &.&.&V9sNuE@D$ D$D$$l Pf.&.&V9sNu;&N9sVu gN&.&.&N9sVuR ZgN&.&.&N9sVu;rEgNf.&V9sFuEx6hUT$ D$D$$]Zf.&.&.&V9sNu;t94gN.&N9sVugN&.&.&N9sVu{Ex̑ @?ውVgN.t&.&V9sFu鋽Džȉ&.&.&N9sVu#1'hhD$D$D$D$ D$L$M $.&.&N9sVuD$D$ L$D$ D$D$E$;ҋȉ.&.&N9sVu鋽BD$BD$BD$D$ $D$D$ $f Ȅ.t&N9sVuAD$D$hAD$D$ mAD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ dD$D$ $e AD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $d B D$(B D$$BD$ BD$BD$BD$BD$D$ @D$D$ $Vd sit&.&.&.&N9sVul.t&.&N9sVuha.t&.&N9sVu{i.t&.&N9sVu;Ru.t&.&N9sVuv.&N9sVuv.&N9sVu{EDžDžDžho$h~@D$ D$D$ $b .&N9sVu@D$ D$D$ $a N.&.&N9sVu;A D$A D$AD$ 8hD$D$ $` .t&.&.&.&N9sVuD$ D$D$ $j` 1v.&.&N9sVuUE@D$ /hD$D$$_ EDžDžDžDž DžU1})` UWVSt$ U11 DrEEEEEEEEEH>U DEED$ED$$UU}ĉ|$T$E$ ƃtdE$X ƃt'D$ED$$HU1҃ډ踰 MD$|$E$蛯 藰 M荰 8D$ED$$Tk 8t[^_]Z UWVSP ÏDž/devDž/XtyDžyXXD$Sh$Ut-ƍD$D$FtH4$0 4$OVD$D$ D$D$p$N@DžChp0ƅpD$D$<$TƅtFL$D$<$XuD$<$Xtg$BUnC蜮 P [^_]聮 8u)΃wΉ<$VuD$D$<$S`TEE ut|$E$AUt#ED$D$ $EtED$D$gt $ 1P [^_]پDžUVS ûED$ED$ E D$ED$E$tKBB ƃt?uE$SE$:[^]ËEUE$sS[^]þUVS E *L L; D$D$$w t@ $q ǃ L$RǃLƃ 1 [^]K 0ǃ L$RǃLƃ t 0ǃ ${RǃLƃ ߫ UWVS</ uD$/4$o D$@4$'Qƃ%D$T$$PV 4$QƄ=D$D$D$D$ D$D$ D$$蟅 tVuw: ul<[^_]À uMQ Ɖt$)XD$ \hD$D$4$=X =x ? ` UVS Ôu 3D$/4$2n "Lt$ $K  D$D$L$t cD$ D$D$L$ !Ѓ2 D$D$L$軙1[^]_LRD$D$%@4$NLD$t$ $ 脧 Ɖt$)XD$ \hD$D$4$pV =諨 ?G$`S tƃ Qw 8#u͉4$ƃ Z J 0_> 0UE$]UWVS$ fE@ E։υU };EE EU D$T$ $""""D$"""@9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""?]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""?UM]9ȋEE9EE },EU D$T$ $D$>9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""\>9BMϋEE}19}E UM T$L$ $D$>]u9M΋E eƉi`T$L$ $D$=9MϋEEƉ]u덁݉a)u}T$L$ $D$+=UM]9ȋEM""""9""")Ɖm݉]u UWVSH< !D$T$|$|$D$$[> D$$H*)R)L$L$ |$M $> tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8X 5}܉EԉŰR.ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}ŒR.UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$]] E܍ eh D$EЉ$] u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍ eh t#D$D$EЉ$]諏 uKE܍,mh t+D$EЉ$]4 u}g]܍m$D$EЉ$ t2,qh t%D$EЉ$]֏ u uE܍L]̉ލzh tD$EЉ$]蒏 uruЉ4$]{ T:sE܍LD$EЉ$]Q 2u݀}u<E]DCt.E܍D$EЉ$] u1ۋEЉ tC.uu#ỦD$EЉ$]迎 Uus5uD$EЉ$]舎 tu#GW ]ԉSG UWVS\ AƋ'<'wwEVN)щȉMEED$$\t_FMȉFD$F$f\t:F]؉F>FDF 1[^_]ÿ'E {UWVS nD$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$`lMD$@|$X\$LD$\D$`N|$Txq|$X\$LtL$T=qwT$`9lA-D$@tT$T=qw L$`9lAtL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$XLGD$\D$`t$\lQT$Lk)ЋT$P ‹QD$dT$hD$t ] 1uUT$$]8tFuɿ [^_]UWVS͵ òt: >t M1uU T$$7tFu̿[^_]UWVSf Kpt:l>t M1uU T$$H7tFu̿[^_]UWVS E $ ƋE%EEgUuUT$$$…plU>t M1uUT$$6t1FűuUEEu54$2E [^_]ËUt }1]uЋu9t!$U] D$UT$4$ E0E렃}tE1҉UWVSdz ìu Ex}u 4t+D$4$5uE)E@ [^_]Ë t 1[^_]Ét$(SD$$nUWVS= "E D$E$Pm D$ED$4$NjE8tB|m 8"tn@ uOt$ E D$-sD$$҉[^_]:m 8"u썇v@뱋 t[^_]ÍvҋE D$sD$$mUVS@ %uF$/F $/4$/[^]UWVS$ }E 1t u$F'E[<$ E܋MAnD$4$+EMA  EU P8E܍gMUT$${!ƅ>nED$=4$/ HE } M D$4$%3uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE j t(E܉$J.E$?.EE$[^_]Ét$(SD$$k $ .ffffffUWVS8 uj D$FsD$4${uD$:4$. DžD$nD$4$H{hF$Y $$D$$D$D$|$ D$D$DS4$1$$6D$D$|$ D$D$4$?1|$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $H  $2D$$Y |$$ƅOD$E D$ ED$D$$$cD$E$tPT$$}$;+$-+g 8[^_]À>/uEt$D$<$St'D$<$D Sg 8E D$t$E$u}뎋E D$cD$E$vuE D$D$D$ ED$D$LS$.BE D$t$E$urf E D$LsD$E$tDž1D$ lsD$E D$E$? Dž1ktf E D$LsD$E$ot1;$ 5f t$ 'D$E D$E$ <$ 1gsD$E$xD$/4$se E D$D$E$sDžDžve E D$%X`e E D$%XUS(訪 ÍEEED$D$ED$ ED$D$E$,x E([]øUS(< !EE>ED$D$ED$ ED$D$E$T,x E([]øUS(Щ õD$ D$$?D$D$D$D$D$ D$D$D$D$ $+x D$([]øUSZ ?ED$D$ ED$ED$~s$Sx E[]øfffffffUS سE$ U֨ U\t \]ÍL\]UWVS蠨 Å}|$E D$E$2q9s [^_]b ?|$ t$D$$\[^_]UWVS/ }|$E D$E$q9s [^_]b ?|$ t$HD$$\[^_]US åE$ t []ÉEsT$$\EUS z _E D$E$ t []ÉEsT$$\EUVS, u4$t[^]ÅtEt$sT$$\EUWVSۦ u} |$4$3 t[^_]ÅttE|$ t$T$$\EUVS{ `u t$E$ t[^]ÅtEt$sT$$\EUWVS# }|$E D$E$ u[^_]É` 0|$ E D$D$$\[^_]UVS踥 ÝuE D$4$8 t[^]ÉEt$sT$$\E[^]USa FED$E D$E$uEsT$$\E[]US ED$E D$E$uEsT$$\E[]UWVS$蹤 ÞD$ D$EUD$T$EUD$ T$E D$D$E$9 Ɖ׋D$ u $[^_]^ L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]UWVS$ ܮD$ D$EUD$T$EUD$ T$E D$D$E$'Ɖ׋D$ u $[^_](^ L$ EUD$T$EUD$T$E D$ ED$ D$$\$[^_]U7  U!TSፀL]Í]Í]Í]Í]Ía#]Í]ÍS]Í-]Í]Í]Í%]Í]Í]Í]ÍS]Íݰ]Í T]Í]Í]Í]Í]ÍF]Í<]Í]Í]Í]Í]Í]Í]Í]Í]Íˁ]Í)]Í!]ffffffffffffffffffffffffffffUWVS æƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS\} fE}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ  ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s U D$/4$ϑtLrtP‰T$|$t$)D$ $tD$ED$E$1$[^_]Åt xruS뵀>ruGt$|$ D$ED$E$X뺉}UE$[^_]e{M UWVSΒ óD$ED$$t{NjE88/tbD$/4$轐…tL)JBU=wsG|wdD$}|$M$] Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSÑ è}UtlƍxD$4$u tD%=`u'-$U ytĄ[^_]K O1Ą[^_]K 1UWVS }U)tlƍxD$4$η tD%= u'!$U tĄ[^_]t}EE u[^_][^_]UWVS4蛈 ÀL78ủt$E$ϣE D$t$<$4[^_]UWVSR 7EE}L70E D$ED$4$=t}EE u[^_]p[^_]UWVS4 ҒuED$E D$4$Q=t%}̉|$E$ ED$|$4$ 4[^_]UWVS4莇 sL70E D$ED$4$<t%}̉|$E$觢ED$|$4$4[^_]UVS + EM thP8t P8P7@:t1 [^]ÁP88D$D$7@<$)OH8붸 [^]UEt @:]ø]UVS 耆 e$7t^dB.@J.T$XT$$p4D7tE$/2P7$$L7 [^]Í$SXu뎍.t$$fUWVS(х ö}tG{E{EOEEME EM<$bƃ t tu#E([^_]ËE1([^_]ËUGD$ D$GD$<$CE9E9G?@UR. DqEEmUT$D$<$4:E;E :E+m}EE;E tu}MMD$ GD$GD$<$vhD$ GD$GD$<$UhMAE9O~D$GD$<$9iGU9ut$GD$<$^9u7D$ D$GD$<$gD$ ut$D$<$gt$GD$<$9E;E v}D$ ED$GD$<$}gEHU9_E9G5MzUG;U D$ u4UT$D$<$gED$GD$<$P8E E&OL$D$<$f}D$ FD$FD$4$fFD$FD$4$7}tE9} uD$ FD$FD$4$lfFD$FD$4$77D$ UT$D$<$3fG3L$MGD$<$d7MD$ L$M܋GD$<$eM{D$ UT$D$<$eGU D$E D$E$]U ] FD$UT$L7$^]UWVS + u}ED$E D$4$6tE} u [^_] [^_]UMU E~tEU M]]UWVS 袀 ÇuL78E D$ED$<$5tEu } [^_]~ [^_]U I *E L7~"tD$ED$$9]ËEUWVS ފ}EEuED$E D$<$T5t'~#tuEE }[^_]E[^_]UWVS oEEuL78E D$ED$<$4t)~%ftuEE }[^_]VE[^_]UWVS0 E}GDEEP798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$]fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]cMEE9G~0W,10[^_]Ã]1^E:<$]~1U| L7$]UVS| þD7p t4$ u N8@[^]ø[^]UVS| yut4$ u N8@[^]ø[^]US$X| =E UD$ D$D$D$T$T$ D$D$E$$[]US${ E UD$ D$D$D$T$T$ D$D$E$ $[]fUWVS{ Ã} uUM=tUG$~Ur|7tUF$U5|7tBU$HU|7,048<@DHLPEtE@$|7  $(EtE@$|7TX\`dhlptxE tE @$t}|7|UUUUUUUUEE$tE$@$^|7U UUUUU U$U(Uċ,EȋE(tE(@$w?|7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉdT|t ʉt ʉ`|Mt ʉt ʉ\UUt%  XŰE@|E@hDž$ */ E@,p1҉,MI, qfL>9<ffNv tv$3uMI,4vD> qxf~g$_O HG 9u͋9 <>f|>y_u$F,HfD99f|9y.NDfHD$F|$NuĴ[^_]Éщ$'E@,R|)ƍTxDlx9qf+fG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YMQ, rfVAtωp$0V PF 9u͋tp9l9h\T$ xy DžxEP$ty DžtEL$y DžEԉH$y Dž4$ry Džx|Ƌ)΋)ȉpl9^p9dE@,H1҉tvf~94>ff~~ t‰ljv$cu}O, I4F uf~0r$4W PG 9u͋9 Ƌ9l9|)ȉ9~ht|Ƌ)΋)ȉpNj9p9 E@,H1҉lht}f~94>ff~~ t‰ljv$ku}O, 9I4F uf~k$ W PG 9u͋9lhwDž?lxE@,@xMT6MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bǃ <ǃ ^ǃ vǃ #ǃp :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ |ǃ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$89T$ D$D$E$o1.t&.&.& Tp=u[^_]USK VM1&.&Tp =u[]UWVS,K ÎV EƍME$+FF(9u݋uD$$48Cuxu!D$$$3,#T$$/ǃ !ǃ +ǃ !ǃ ,ǃ !ǃ -ǃ$ !ǃ .ǃt %ǃ 0ǃ %ǃl `ǃ %ǃp aǃ ǃ fǃ ǃ gǃ4 %ǃ hǃ\ &ǃ iǃ %ǃ jǃ %ǃ kǃ %ǃ lǃ %ǃ mǃ$ <%ǃ nǃ %ǃ qǃL #ǃ oǃ #ǃ sǃ %ǃ tǃ< $%ǃ uǃd 4%ǃ vǃ ,%ǃ wǃ %ǃ xǃ ǃ ~ǃt #ǃ pǃ #ǃ rǃ d"ǃ yǃ e"ǃ zǃ, ǃ {ǃT `"ǃ |ǃ| ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$89L$ D$T$$%Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^ $v$ $#t $: $' $#| $#j4 $#X\ $-F $-4L $_" $| $o $pt $r $y $z ${, $|T $}| UUSE P ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0aE FPEU܉MD772EE4E fEE$Hƒ=4M4%y 4 44fǃ EDPfvM䋑f8;@E fWf^fqf$MdU܅47Q)ʉ$ 2E$N‹E@ @M M4 'UfB 49}} 4% 44;4tf 7f1҉Ѓ0[^_]ËE44%y 4f y4D$ D$D$$F 4449)‹4L$ T$U؋MȉD$E$!4;4U}dž4…f 4xp4fǃ 3E$>0t3E$=E0U,)4fǃ E܅U0tE@ U؋4 E44B%y 44D$ D$E‰T$E$~v4%y 4 494114M%y 4;4)fǃ Mԋ4D$ T$U؋ED$E$U؋M~4y 4 49411x4Wy 4 4947ff @}AEE܅U$-E$‹E@ N@FM MtUB.jE@ U؋4  UfB 9 4,fǃ !E܅{47Q)NUm~ 4}} 4Hx6 44m4%x4뿃ߋ 4}} 4%y  449}fG Ef` @J.D$ D$!D$l $ؽ $ĝU= HEfǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX= ÈHuD7MV8у$33`B.EEt\7 E)V8N<t=%G*tE11zE}uAX[^_]Ãt $*tًE$ۼE@EFF$ڶ Ut p@뮃$<UVS7 Bƍ D$4$ 6tD$4$ 4$ 11t)0tGB<1;NVt~΅u׀>u|F[usVmt2t00uVFtJeNVu1UWVS06 iAUu :uH2tU$1YUF@fu2ML$ MD$T$<$#2M EPJ(N$JN 3;t$1D$D$$ FTDt$zD$D$$ FXV  ~$879<7NT47 072P3PB0zp12džp2E싂E苂TEtU܉Udžp2ELɉMEEEUtwD$Eԉ$UiE܋U؉$Mԉ $E܅IH 1$迱t2džx2EE-EED$E$ u džx2EPED$E$k u x2t|$E$J u x2dž|2UtE)dž|2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(EU܋ED$<$ UEU܋ED$<$f Uu p2MU܋ED$<$8 Up22@@,EF@fL$ D$TD$<$2XE1ydžt2džx2Edžx2;Et ED$E$^ u dž|2EtD$E$: u |2|$E$ |2LMFEidžt2džx2dž|2Mdžp2EEdžt2džx2dž|2E@tg|$E$ uTx2dž|2EJt|$E$ u x2dž|2dž|2E8ENdžt2džx2dž|2ExOAOU[/ D:D7D$E$]US3/ :E87H$ <7H 47HT 07HX "7Hl X72 p2 t2 x2 |2 2$4P[]U. }9MD7tJX071]ø]fffffffffffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS - Ǎ8}ƉDHfx 4 [^_]Ëf=tyfDN4f>tX$]蹢TP.t&ffB9uǀFF [^_]ËEFf\Nu]ED$$]VMME$ ]UMtZf@f@@ f@@f@@]\]X ]]9Eu] $ϭ$]@J.D$ D$D$ $ȫ $贋] $v$藋UWVS + é6Ɖ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS +  6Eu^.&9t)fxf8u@$9u׋~1$]膨9> $]n4$f[^_]UWVS Xt&.&9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS) 4}fǃ  $<P.&ffB9uǀ2ǃ ǃ ǃ S2@tL$" =w4D$T$$N2!9u[^_]Í $e$膈US ( š3E ED7t+2UT$$U(E []ø []UW( @3UM ~*D7t2t _1]É1]UWVS ( 2D7te3339}}<31 [^_]à D$$<‹3t333뱸빋3L$PT$$ 33]\33u-U 9' "2ED7t%2UT$$1ɋUE]ø]U& 1MD7tJT471]ø]UWVS& Ü1}<$ƃuOG @tI& 8u?D73t-<7D$87$Htǀ3[^_]UWVS 8& 1EUD72E, EE$3= %y   fǃ  LNfu f9q  fmffjMUU$) E$mE@ @ME@ M  %y   LNf    yt鋓  9f  y [^_]ËE$Ot3E$8=DEMR [^_]ÃUfB   9|, <  9f  [^_]Ë %y  ; fǃ  Eu-E$E@ @aσufF 47Q)=  Ef` [^_]ÿ@J.D$ D$ D$ $蝢 $艂UWVS" Û-uD7MqV8у$2c33`B.M MEt\7E%F8V<t|‹FD73t53@fuT$D$$ []1 [] D73ts31 D73tu31 D73tUs3E1]ø| eD73tUu3E1]1UH 1D7U31]UVS% D7@@fuUT$D$ht@$Ϣ t Efu5l PwtU$Ѓ[^]Ëǀ3[^]Uft87<7UWVS, g  f}D7@@fu|$D$ht@$ <7 t }f87P7;Pu9HtL$MԉT$U؉$6QMԋUL7;Pu9HtL$T$$Q43@fuT$$) 3@fuT$D$$$$觕,[^_]EfEf87;8t8>LJ3}9t:ǂ3EEEEEEl D$}܉|$$B ǃ ED$$U  ǃ  USk P t[]ÍD$$  ǃ []US  u[]Ë D$$躽 ǃ []US$ ú t$[]ÍEEEEEEl D$ED$$ ǃ $[]US$Z ? $[]ÍED$D$$躾 l 9Et $[]D$l D$$耾 1UWVS4 D73;3@fT$$(   yP7B$,oD$D$ HQT$PT$@$詧7@|U8E؉D$D$ $cUԋ@t A:zUԋ}؉|$D$$+|$D$Uԋ@X$ @$軋 D$ D$D$@$ǀ343@fuT$D$$4[^_]7@|8M"E܉D$D$$x l 9E P7R뒸 D$$d ǃ  |14[^_]8MvUԋM؉L$D$8$Uԋ@YD$l D$$謻 CUWVS, EEEE uԉt$}|$$`EEEED$|$$`D$$aD73tD$t$$W`,[^_]5  D73tUS D73u-3@fuT$$f []øUS Ý D73@fuT$D$$ []USi N D743@fuT$$ɒ []>US   E U7RtI|t78T$D$$AD7ǀ3@$ 1 []Ëxt8T$D$$D7ǀ3@$蚇 뵸 []UWVS T 9 ED72tQun7@@tt\ǂ28T$D$$`@$ [^_]7@t ǂ2뮿 [^_]7@tǂ2{U{ d D72$]ffffffffUS]E  }t J;}R ;~[]ÃUWVS }tG8 u^@u[^_]ÍtG~W,EO(G\p;}@ ;~9Uu׋u멉<$G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U091[^_]É봸USEt=H~6X,1".&.&.&9t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًU-9u1[^_]øUWVS}] UG9)9i4utU}t]G,E] Eu pW(9|_9}W(p 9 _9} E E;E 1[^_]É듋uW,G(D$OL$$D9UED$ PT$D$$]UWVS}G~EW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]ta{tZO~[w,1 t&9tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]ffffffffUWVS ãЍR4ր33V,U39VG8 L4U;W81҅ZE1EEEEẺEUMD>EED$D$ E3@@D$UT$M $mV,UD>Mȉ$xUV,E3EEE;4ML$ T$D$E$7ED>$zxEENjE94~-D>D$E$5dEE94ӋUЁĄ[^_]Ã4$ D$t$ ED$D$<$‰ЁĄ[^_]ËED$ T$D$E$ED2Mt$ D$BD$$D$M2$P‰ЁĄ[^_]úsUWVS8W <ƉEЉU̍R4Eԋ4}8<$ ƀ?EEE4E؍EE'E$vM9Er;UU)ր?Et)E؉D$ t$|$E܉$tEy8[^_]Ë}ԋGu܍WMtFȉ׋uԋ6tftE‹u)uƋ@tQuEt}|$D$ $U} UEЀ4SŨ8[^_] EԍPMtыujuE)ƋEԍPCt$D$ $U} U)u}E)9s뷋E9r7EԍP9UtU?$9Uu~X24H90t…#ȋH90utJ$`2UWVS ølj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$,UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS Ɖ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u;u?uGt7@@8tf@1[^_]Ãf@t4$t4$미[^_]US MU L7t%t X@t @@f%f1[]ø[]UY BUL7M u]_]U- UL7M u]]UVS E L72Uu0ÁE% úډ1[^]ø[^]US UL7M u8tHX2H@H@[[8u1[] ʉP@[]UF /L7U]SU( L7U]UVS L70tFFX2@Ttf@4$4$7@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]i]UEU Mu]5]USEUu2U Á ӺEڋE 1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]aUVSL 1utFFX2@Ttf@4$+4$7@@8tf@U 1[^] 7PT1 t t t@t̀t(t t8t ttLt 1 7PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS  u4$ D$t$L7$H [^]UVS êu 4$襃 D$t$E$ [^]UWVS quE L7:x<ut&.&9t<uЉD$t$<$ [^_]É4$! UWVS }L70E D$ED$4$|t<$݂ D$|$4$K [^_]UWVS ëu}ED$E D$4$'t<$舂 D$|$4$ [^_]UWVSq V}uL7E D$ED$$UǍt/Ux0u 9t<uƉt$|$$ [^_]ÉU<$ ƋUt$|$$W UWVS ý}uED$E D$E$6tAxEut&.&9t<uƉt$|$E$ [^_]É<$N UVS N 3u Ex8u9t<uЉD$t$E$| [^]É4$ ffffffUWVSH }EUċEG,4@4E@U {}X E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$藼uH[^_]à zE1H[^_]É$W'EEFEȅE@$VEyEGM+M9E O(U @9~F t$vhF E@ffO@EE %WHUUȁ ‰ЋM ȉFEfFE@EȃvA}$xJMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$gG UMȋE@A%GGfGfwu}G9uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$ IjMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$B%UčJ‰Uĉy19uĉ)UBHFBLfFMEy19E0B,4v4BDfFt$B|U$du 4M$SE u E;GTuO,u u6uč @4PA!EE;GTG8 <$<$2 EE EOT9E M MO(ʋH98OU9U+GHFGLfFfFUO9{UGDt$G|$jcu2 ȅM cUuUȋu6O, 4I49~X}uEFDfG|$F|$bFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 @!78u E<$GG8 <$gEuĉ׉EċE MO(@9/(E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM EG8 3E RW9)ʍBE <$9ENG8 <$n[tUWVS 8uE0E,EP@,Dt@ 1H4 #L70E D$ED$4$t&D$D$ ED$ED$4$[^] L7t<7R8tt H@Ëuø oL7t"7Rt`@øUL -Et97R8ttH@]Ëu]U Et#7Rt`@]ø] L7t=PX2R(tt H@ËuøZ CL7t @@øUEt:PX2R(ttH@]Ëu]UEt@@]ø]ÐUWVS æuF8 4$lj4$ED$FPD$4$|D$4$cUT$|$4$|P7;0t 1[^_]$ z!78uFָ[^_]U UM L7tx;H}9~ PPHT1]ø] L7tUHPU PTE 1]øUWVS }u} F8 u 1[^_]É4$E4$ED$FPD$4${߉|$4$*ML$UT$4${P790u$ y!78uFx[^_]U UT$L7$]UEU Mtx9H~9~ PPHT1]ø]UEtHPU PTE1]ø]Z C7@t 1, 7@t 1UWVS( EUE u79}tP79zH}z}JP9krT9`N)9c\]u܍D;9u׋WE1MfFM9yA,U[4ADEFFfFt$A|M$]Uu([^_]؉9BT9H)9)Ɖu9EMAIB[ωރtftEEE}9B,}4!}#zuŋJ)9q)؉E9E]u=[BI߉΃sEtftzmEm9FB,M4!]؋#zu띉ϋMG9 u9|-׋GD$ D$t$<$]C9w~׉BtU$]U$]1)J)9A:0UM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]OSucE9EuM܉r9M׋GD$ D$t$<$] 9uuE:fS 4fU uUT$L7$m]ÐUWVSE89tp@EOE)w~TEP,G(UW,΋M4}.&.&y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS$ }GDEP798 GH%EWUG,E40UutWUыpG9UfFE9svffEF%M ȉFt$G|$cPu¸$[^_]ËOU9~VUEEGGED01E_GD$ ED$ED$<$<$ӿ1$[^_]EUǽ L7$]fUS誽 ‹E]  *t&t A  1[]øUVSu^(~^F,11҃} <.&.&D,~9u[^]Ð.&9tD,y)9u[^]1ɉ[^]UWVS0ۼ EH,87E  E1<7EMED$D$D$D$ D$L$ME$t#UB UUB(ҋM~CMM L$$Vt=9 ~#tyمjE)c)Mǃ 10[^_]UWVSϻ ô}W$G(E1Uv.&9w(~hD,tO L$y؉D$D0$uED,yD$UЉD$D0$P tD,E9w(E[^_]EyUWVS }G(~"1D0$־D0$$9w([^_]UWVSɺ ªu 1~M1$v.&.&.&9t% 9 uDŽ 9uۉ[^_]ffffffUWVS A &]ƉE׉UM$FM ]EPt MA +B A(EEuFF]^]^FT4$] 1ۋN]uF,MzF@1ɉU܉fGU9VUGfGFD$]8G |$F|$=Ku [^_]ËEED$E@,$]3tыuF,U)D$F0$]d3tF0V]K +J K( <K,[+ZR,UʉUf.&.&rprpP 9MuԋEqU܋zUED$<$]ZLUBEE9F~EP1 [^_]ËVE}ǍD$uF4$]_2ÅF4F0V, M܉ً]Ӊ]ut&.&.&.&HXXXX @x9UuҋEo];90G EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS蝶 E]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$EP791[^_]C:}87P79H79L79S9M 9u M S E<789E9EE)Dž#EH7tS} x }x$}u UM su 9+E<78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1UV 7E~M ~D79B$t ]1]ËE 9B ]UWVS UE D7Ex$9}iP7P H4 9uogH$p <19} KCJpH7P H4 9u91H$p <19}  &D$E$u)L7P H< 9H$p <19} E}x$} x 87}:<7} :2u $vt@:u$vuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )8)UWVS ED7ǂ3~aM ~Z;B$t_M L$$D$P7$t [^_]ËE D$$o$1[^_]ËJ 9M uUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS ʻ}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$F|$4$D$<$̵1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8t @P81]Ã⿉P81]ffffffffffffffffffUWVS } fE} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]/CFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HMJ$x9MtH}9űMQ ztQuut duH8 uX8J$UWVS(8 EUMia$y#ƅIǀǀǀE܉$?#EF,D$E$ 'ljF0EF4EFXFF]^EF^ F$EFE F F8F8~xfHf@fuEfx~OE@uFE@#h2u 7:tx}$K t$KutE1[^_]f~E@tfx~݋E@uD7{uGm뱅t}$K u%D$P7$G}$J QiUEPT$ PT$P T$P$11^]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]z뭉U델[^_]UWVS% P7@@Mt7J y 8ED$D$7@$,]A@7#A@t2ED$D$@$\B@7#B@~ED$D$@T$\A@7#A@7t $E[^_]uX~t78ETt8D$D$BL$-\`@78EfED$D$@L$[`@77[^_]78EUWVSC uEӉ΋}$EP, 9u;u t5 D$E D$ |$t$$]K6[^_]èuUWVSĀ賒 ED7Eԋ3 ]P7]JxV HJHUE@8@u B8@U B@ ]8t$D$7E@@D$ZEԋ@@H D$u4$]蕗f8E@PhtzEԋs]sEX78 S,11.&.&.&ȋ ˃9|u 9> Eԋs/E@ Eԋsu EH| P,CEfEE}Ǽ7}]qM I, 9quV2xH uV p92fEuu؋sU;z)R,M<} :MMUQыP,UMUhyEE  EuFD]䉃  FH fǃ   ED$F|$#"iFLf FHEċEԋM؅~E@,}D8uF,}8E̋@E;F\E̋@ EЅI}9|GEЋCEE@,]] R]܋]̋[UЍ.&A@uUEPrLuȅ]URu72@ x]9]ΉMEu FuE܉D$4$]u (]ԋHP}|$E؉$E[E؉C{9}(UEH}ȅt}9}E}89^y1ۋE<9|"E@EčPE9E9U܉bƋUԋSuE܋U9}|:}EcUċE܉D$4$]UCEԋ}U9{tSEM9Hb{E<79UR zsC}]9]EԋEP:xE@EH u;F}F(9~E 3tEu;Cw|MȉE3Fu)F)Ǎ)ƅ~ED$4$]utʋMȉ}yEE@@LEEԋHE@8ZZE8tE]D9FEP]9ډUMUȉ$]6 EMЉÉ؉؍][ )؋])9EUr8^y1ۋE<9U܉[^_]ËE7E}G}WX@#h2t $0]8D$D$Eȉ$SEԋ}uW PEw P,u2 R4UE9x]DFfFt$D U$!UDfF4E9u]䍃LtD$ XD$D$r$ $> E@ xkE}G}WX@#h2Et @@D$$];[EH7EE@9SD$$]EԋCB[EEEE܋E;E^]9]#}E܉D$4$]$FNj]ԋSuEƋE9~@9M9CSD$$EEԋKiSKD$B$EEԋCCEfED$D$E$]JEԋCEYEԋsSE@9 EPSP$#]7Eԋ@$a ؃[^_]Ëx}HJHw1 ;G}7ƋW,tGD$BU$]UB;G|ɋELME@8k 79FEЋEP z@tP N][]̅  MċEËM)ˉ]D$\$ ]؉\$D$$]o*U܉M2D$E)ȉD$ u؉t$EȉD$4$]-*EE@ ẺD$$]t8t$D$$N1ҋEeE܋E@vE}E;xEԋuFECFCEԋXE7E@PhE@E$]SK}GD$G$Y3]OEԋE`8@@$]Z$$ ]9EH7E̋QY,E1ލ4}R,z9~uLIR~1ME܉]9uT$U<$]MUuՋE܉EűQpY,ЃE u؋E<}܋4;aUR,:z9~_y}R~}419uT$U<$]UuՋu؋E̋Y,QB}9~E@@%E9u~_})E1U܉M0E؋@D%EU׍FUM9ƋPB%M9uU}}E)Dž]9E̋EًU)E9EEE}ӉʋuEEȋE}EЉ]uċ]9]MEȉE܋ZE@,u܋xB,p1҉]M؉M9}L$M4$]DuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9E@uԋsEEzE̋Y,E܋4mEpuE܋]؋}̋q,"XQ9M$mE@8MEԋPuFD$FE܃$M&:U܉\EK]CD$C$ESPSPM؋E̋EuЉ9}9}}z}ӋBM!EuȉuȉM}ӋB9E܋u9~EEBDu9, tT, #FfFEBLfF9t!BDt$B|$]Hu E̋sE;  [?1ɍ, UL$D$ <$]U€w֍V)ƉL$D$<$]mljEЋE̋@  $ EȉEu9~uE})E؋u])؃EEH,E9w]]]E})uu]9}u܉1}9| u9}9}9}E؅,9E܋u9pwE䍐, E̋@=vm EĉEE܋Hىωָ tftEĀEā =wEဃ)ȋ}܋OωփtftE܋uЉpE̋BD$ D$ED$$]AE؉uE\U܉uk|nd`t$D$$]EDd]8t$D$$Ed ~Mċ]CED$D$ E؉D$\$$]w U܉M:D$E)ȉD$ u؉t$EȉD$4$]5 EE@/]8L$MD$$DU܉tE܋M؉L$D$E@$DBE}̋R, }9}uE]E@,E]EE9E|EH,EE}؅'E@}ԋsE؋}9Ef r uv'E܋HE̋@1Et$qt$ $] W9}u܋]䍓, T$UċE܋@$ U(fv[1ɋE䍸, E䋀$ EEpu@E܋}ȋE)NjE@X0ppuChG}uNű;JHED$ut$$]g8t$D$$eBD$D$ D$M܉L$M $Ht$D$M@@p$BD$D$ ED$D$$M@l|$$ft$1|$$AE̋@D$D$}@@0$]ft$D$$|AD$D$ D$D$E$^t$D$@@p$5AD$E܉D$ ED$D$$tuv`D$1D$ ED$E܉D$E$]18U؉t$D$E@$]~@U؃9u1҉Ut$D$E@H$]E@U9uyD$1ۉ\$ ED$E܉D$E$]|$E@$e8t$D$$?E)ED$D$ D$D$E$]E@|$$dt$D$$m?D$E܉D$ ED$D$E؉$]1Hz }p D$1D$ ED$E܉D$E$] 18U؉t$D$E@H$]>U؃9u 1E@Ut$D$$]>U9u HH_ppu;t#t}uNű;JXLJED$ED$$]b8t$D$$=D$D$ D$M܉L$M $t$D$M@@p$=D$D$ ED$D$$aM@}؉|$$]ED$D$ D$E܉D$E$]E@t ]̋ ;qtE؉D$$]Ra8t$D$$(<D$D$ ED$D$EЉ$]E@E؉D$$`8T$D$$;D$E܉D$ ED$D$E$]SE8Ủt$D$E@$]H;Ũut fhE8t$D$E@$]:u0L% E̋u;p E8Ủt$D$E@L$]:Ũu^D$D$ ED$E܉D$E$]g|$E@I!t$D$E@L$]:uUWVSq x|]D719X‰PtFC:uk11ɋCD$ CD$C D$C$rtB[^_]]C9uP7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]Up {L7$]UWVSp DŽ{u] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$u>vF9u+P7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSo zut$W$vu[^]UWVSo Úz}GDEP798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$&tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$XtD$D$<$$1EUxn ayL7$]ffffffffffUEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSm xU} w ty1 f.&t6~RutF$nu1[^_]ÉU$t8U F@RuDžtÉv$ uG 멃UEU  HJHfJHfJU @ E]UVSm wutv$u[^]UWVS l ôwMq~X1Q,zQ~>1҉EM׋q tMv$WuME9xԋEM9A [^_]ffffffffUS] t[UӋE+v.&.&.&.&.& ȉt %1ȃ9u[]ËE[]UWVS]} 1115.t&.&.&.&.&.&.& ȉt %1ȃu1&.&.&Lȉt %1ȃuڋK tBu1ҍ.&4Ɓt %1uۋIuċu9 [^_]1[^_]USj ÙuE t$D$ $}x) 1[]É$91[]øUWVS4Xj =uU܉   E苃 E7E@E@pE؅"7EE싳 tRyF%y }93}Ѕy}Ћ})щ})9uM)9IBljы U)y<93}}Ѕ}}A87L9+~ EЅ[D$D$E$m1ǃ  EE1ҋ u}u!7E8 ; |~)EЋEHAE̅q}؃E9|9;[T$D$Ẻ$0E@p ǃ ; QuJ `7l[T$D$$i0 E8uuE@@l8 } ; MJ Alu  D$ <$l…y )Љ m t}艻 u䉳 4[^_]ËE1"7EEU苳 u}4y yFȉE!7E8`7)}ЋEHAE̅ ; }tM؃99R D$  $J) ǃ  ; y E 9U Ǎ["t$D$$\. ; ~a x E@@xu XD$<$y)  ;  [? t$D$E@$-  ;  uԀ> u)ʃ<7E Eԍ[EișǍry )ƋE9E@M؉L$D$$,  EE89~1$ & _$U ;  P7uR,r@[E؍ E0   } [9 EP, 4v4~}}܅uE@}؉|$D$$+  y}9[D$D$E؉$+ǃ ǃ UN;H@uRFuLf~-$^ D$ D$F $V fI E@$ =   tD$ Eԉ$9…y )Љ 늋@l[T$D$$v*  E9 ȉljM$ gf t'D$ Eԉ$y) $ Aǃ  D$  $.y) ! E)ȃ9E@[D$D$$F) 9  Ǎ["t$D$$ ) ; ~b E@@xuƋ t2D$<$Oy) $ 4$됉Ƌ  t*D$  $y) $  E1UWVS _ äjE苃 <7M19|    9 87E79 9`7E8E)$ Eu ǃ E98.@@ltˋM t‹UT$D$$J'뵉  PBh9}d T$t$$ LƅtDE; t4$x U 8D$D$4$&uU1    [^_]Ë `7Eu@@h9ME4M䉋 E;0 GE  7p >u~x`7U8t$D$$%mtGUt @@tut$D$$%@@lu$ mu ǃ 87E 9P))Ή  $ 둋 xǃ U\ gU U U  U 11]U|\ egU U U  U E1]ffffffffffffffUWVS-\ g%D72H7EP7]19u9uVF,E1҉MEF~`CH1U.&.&9F~59uuS9~S 9}͉9FˋU9VMIS[^_]Ë]S~Cs, 9tɅ~UMڋXCӉu.t&.&.&.&΁9u9uu9u_Z e7BH8~NHD~GBlthtËuu拐tt 1)Z e7@ xUWVS$Z dƉEY7EBH8ˁ=u,7}@D-=}(7LJ D7Y\A`fAdBt%]8D$D$ $!EBt8]8D$D$ $!P7p2!P@EBlhzǁl2ǁh2BxT2@@Tth2t h2t h2t h2 t h2 @t h2@t h2t h2E[A\sfǁrǁt5Wfǁ~ǁ;fǁǁfǁǁfǁǁfǁǁ|fǁǁt[tfǁǁ~>Rr&.&ff@f@@ 9uǁp"ǁt"~@p"p".&.&.&ff@@9u}싇 %ȋtp"xt"LJ LJ 2H7EP7E ItiE9tE9tE싘 ZHB~&zr,EEz9uuMD$$]R[MIu1$[^_]ø(7ˋtiǁl2w}UM܋HQf.&% ؉9u9ut͋UMD,7놋tǁl2]tOǁl2[UWVS_T @_EM ]fMf]f_(7;7Nftv,7969+D7l2tot"уt>]f9p"t"]fp"]fr"1[^_]Ét"ufp"ufr"ft|WfffufEftoEft\fYfEN}f9r"at"yfufEffEfEfEfEfEu%UVSR ­]EM ]fD7;B`N4f1Dfl2t1[^]ft_/ftMfufft2#ftEfuffuffufffff끸yUWVSQ \EM MMUUfD76;F\<@<UfrftMfv7? tV2vtCL$҉T$ UT$D$4$>8T$D$$1[^_]øU Q \Efx?D7;B\}1@rU f tUf vEf1]ø]P [D7ǀtǀx(7 t% ǂp"ǂt" u1U勀 %1]UWVS;P $[}M D7l2t^ftfvǀx(7 t) fp"fr"ǂt" uI1[^_]fPfftifuft_Bfthfj` %=1[^_]fuf/%뛻늻O ZD7h2UVS N YD7l2tt f@d [^]7Rt8D$D$$ 7M!A@f@d [^]UWVSwN \Y tP7} 3x@tOu fD7f9pdt6l2t3P7fpdQ@E % ЉA@[^_]΍N} f_f|SP7UL$2@l$,;8L$D$$UUULf`L$2@h΍N} ff|P7UL$2@$:8L$D$$nUUULfL$2@t$J:8L$D$$ UUP7$UM fxGUP7$fUM fLL 5WD7f@dUWVS.L WUD7pFFy ;F|# tH4$ [^_]Ét$$\UWVSK îVUu FFy ;F|# tH4$ [^_]Ét$$UWVSlK QVD7x|$E$~Ɖ<$l [^_]UWVS*K V} |$E$DƉ<$2 [^_]UWVSJ UUL7tX } xQH9M IX9}Bxp,9!39M t' u pP1[^_]Ë#39M uك׸[^_]UWVSEM UtY xSpu9|Ip9~BXx,9!4>9Ut'PH1[^_]Ë4&4>9Uuك׸[^_]UWVS UztzB EBE wGGtXNjEB_ ])؉ƋEBWU)Љ xыOM9NjO9}_W,9~ ! U9u뗃 [^_]ffffffffffUWVS@=I &TE}E E EE E @$] ÅGE؋E @ uWUXts E07E_E))9~ىL$ED$<$]؃@[^_]à u:G1@[^_]ûkEGy1Gڸ@[^_]ËG,M؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9rTU).&.&.&.&.&AFAFA F AF9sڋUB E H %BfZE @E܃vKMȉ]ĉ}}$]艼M \_ XG 9uuϋMȋ]ċ}EԃUt3uމr}ߐ)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]{L<$OH<$]7E9GTG8 <$]h~E D$<$], MԋUЉE E9-]ȉMĉ:BD|$B|U$]|UBHGfG9}s*w tUv$]^uUG 뜋]ȉMĉUcE LPUT$L7$]UWVS 9E Pu}ED$E D$4$t} u [^_] [^_]UWVS D OuL78E D$ED$<$Atu } [^_]X [^_]fffffUWVS|}D fOEMu ME $]\EMqM$]蒹EEÉEMAEȋQUċE @U zދ]07]t_ @ U$ ]ÅyEEę)EEĉEċuMqQ)փE9yUċAEȋE uEE07EEkEĉEE U rUUEσ tu[ $ ]yEEę)E]É]EE E  uFE EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9wU@t)G$fE9rFUv.&.&.&GFGFG F GF9sڋEȋUUċuV}ỦUUĉUUȉUUUu΋^,EEEF@ED$ED$ED$ ED$ED$4$]v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(E: *EEUM؋ufUވM݋U 1ɋU EEԋ}R.Et$$UEx}P$u܀G$R Ut}EMU E‹E Et~MލAf qCXЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wCXDž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS18 CUE t\J;A t];tUZ {$u_Z[pۋtC R(D$ t$D$$b1[^]ûu11U7 oB  D$ ED$E D$E$1]U<7 %B  D$ D$D$E$1]fffffffUWVS6 AÉU:GEG<\<^ЍtR.z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PR. Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~]E$XE܅ƋEx}ԉ}VUR. @DAE1EE1EM]Ѐ%,UJMUBERwuvE܉$] 1E܋E܃0[^_]Ë]1/v.&.&.&DAu.tt]*zE1PUX]+GwۋuXE%X]]X}i *EEBER]ЃvE܀|8\Uԅ%ދM)΍D7=EPf$G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVS. 97t t~9t $Q EED$D$E $!uI tG@t  Ğ7  @x [^]É댋E[^]É @uUWVS(%. 9UEtBEE7u4$ UT$ D$D$4$bM踵N)‰)`EีNe)‹E)`Egҍ)lnUD$4$F ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$ UuG([^_]1([^_]ËH pn([^_]UWVS(, ï7UEtBEE7Eu4$ UT$ D$D$4$}kLЍB),`E܉eЍBE),`E>)<;LmD$4$ ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$ MuՋGy([^_]Ë;Pm@x([^_]UWVS(i+ N6UEtBEE7E܋{u4$ UT$ D$D$4$裴}-?L) RЍ)ЍYGEeE)  IȍE) GE*SRЍ)<;`D$4$h E܋;`AQ tUy$E܉uv.&9t(~suED$$ uދF E܃9u؋E܅tЉ)43LmD$E$ jEOMEuu4$ UĉT$ D$D$u4$TuĹ-?L) @)ЍYFUeȋE) @E)4FU։*SRЍ)43`D$E$ }tux}cur}ulGEEt}fOMrBEER3pn$AE'u땋3Pm$B3`$pCk}t EE$UWVSA# &.E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىUi Uƍp@Hπwx9}몋E D뛉U) UUWVS" ^-084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0荛t,8C,{0K44y0q 1[^_]Ë0 8a$08 t@0@4$0ޕ8G,tG0ƅ`%0R. 1Dž$Dž(Dža`,4:~Jwɋ0oʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0pV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0pው,4O&4PD]Em PUT$,0 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$0yF8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0AÅ8X,4H0@44,-0 1s0 ,40 ,1!4e0 1,40 14c,0_ 14,,09 ,&GwҋTr1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]UX AU|]UWVS> #}u >}0D$$s+D$t$$`‹U$4UtUuE2$ƅ_EE[^_]Ë}ut$ D$$M$E2@ x tbMut$tD$$EQ D$$$ Ex tUE9ED$D$ht@E$o tEftUft IA(Q|uEt E1s$t!D$D$$=RB(~$\tD$D$$ RB끍H D$$}l D$$_t$tD$$ErtD$$/UVSq VEtD$ E D$ED$E$ƋEt$0[^]ffffUWVS ƉEωD$$ tB4$ո ƀ?u1)9tXzzt"D$|<$m …uۉ<$蟸 9t 1[^_]Ét$ED$<$6 [^_]ÉUt$ED$<$5 Uu[^_]UWVS$U *uEUt E<t] $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%]]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]MljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$mUu$pEE܃@[^_]ËMAOMփ_EtfEtǤ$pE܉$pEP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$oEp@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMxn 11EMIuE4$}nE܃@[^_]px11Eu؉4$PnѨu2u>M_u$IEUw r}fm밍Su$ E0UUWVS UJEtB9swt$U$LjUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$dU[EfUWVS uVzF9sHtT|$$Jit8~VM f FHNMLF [^_]Ëu1[^_]É<$cUWVSTd MED$,E$6 D$|$]a: xD$|4$]l HM4$] =M t<$͗ = E$]贗 =n D$$P]gÉE@ t$$Ut E t E D$,E$*E, EEER.EȋEE u<.tk)ύ)ȍD$4$ t [^_]U E=w ]1]UWVS õu4$谉 UT$ D$D$4$5i}-?L) RЍ)ЍGEeE)  IȍE) GE*S)ύɍD$4$ t [^_]fffUWVS4 ufF(}ȉ|$$Rq t4[^_]É<$PM1".&.&.&t9lufV(4[^_]UWVSd Iu   ƞ7fV EĞ7 4$&V(EfD$FD$  $U蜦=UwDE |)ʉM싆t7T$UD$E$[U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$Ğ7[^_]ËUыU|UVS utgF$ZF$ZF$ZF $ZF$$ZF,$Z4$Z9  t 1[^]ǃ    @ k  @tÍ!ffffffffffffffUWVSA &lj$U D$$ Et$UT$U$:9UuED$$ 術 1[^_]ÉUED$$ 聓 $<UD$<UD UWVSdf K9EEEEƍEE> tqE9D$t$U$:Utˋ$ <$;UDŽa 8Euu>vt1< tHv0FFU$;$;UDŽUWVS< ç9U1ҍ Ӭt"u Džguԉ@!&.&O@6ƒ:uƅ/nFu$W>$8<( .Ɖ$9D$v9t$t$ D$D$o4$x@E+<[^_]rD$@|$/$r:tW.&P:uVpƅ끋1$a8Ɖ$p;Ɖ$?8D$-8$!8D$/;$8D$7賢$苣趢$8Ev$ƅD$/4$/tY1ɉL$T$/T$T$ |$D$4$t$NvD$$h1҉T$T$ |$D$4$u빉o8vIUWVS u}D$:4$T t!D$cT$$ t|$E D$4$5 [^_]ËU t考 [^_]UVS m RuD$:4$T t!D$cT$$d tE D$4$q [^]U Ewt ]1]ì]UWVSh òEu 9M9}xUED$ ]vD$D$@U$U<UƒE9~ЉEΉ )t$|$ʉUM$3MUӉϋʉU$4uD$4UDM !}|$t$$~3uU+u h[^_]ËEUWVS`c HEM 97upUMED$ cvD$D$@U$UF;UD$$ 衊 EED$ML$ED$i1;EUT$$ u>i %!`ut$L$$'1U+uW`[^_]+ U$_3ED$P3UED跌 CUWVS` EU97t$\pwbtNT$E UD$ T$ivD$D$@T$$T$9T$Mt>$uT$ U MT$L$$jk L$\+u`[^_]ø{UWVS = "Exw|Mt_ƃtAƍU$1ED$1UED [^_]Ãu$1Ɖ [^_]UWVSp s}EU 9u]]p3MmLm8@EwEߺ81tEI}E )|$t$ʉUM$]~/MUЉ΋ʉU$]0}D$r0UD܉ !\$T$$]h ]U+p[^_]ê0f%CD$D$ ]D$D$@}<$ 7mo8뎉f>~%E~LSC9u1Yf7k]  ]uUS9 EPw*Ӑt諈 -[]ÃӬu$'2[]US EPw*ӐtV -[]ÃӬuU T$$ ` []UVS luD$:4$L t!D$cT$$~x tE D$4$ [^] - [^]UVS  uD$:4$K t!D$cT$$x tE D$D$4$, [^]ËE D$D$4$ [^]US nEMPw*Ӑt - []ÃӬuL$U T$$, []US& UBwÐt1[]Ãìu$^ []UVS uD$:4$vJ t!D$cT$$v tE D$4$ [^] - [^]ffffffffffffffffffUWVS Q &uE1ҋEL xtGEljу1Uvt 2uU@u [^_]UWVSĀ ǡ}E|9xƋE pLA EL1 E|1E]ELI Eƒx  EB A ǁE9uʋE%u  ͮ EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËUL 1ۍUL @tBEtʍЉʍI$ wu1묋}LA E@1ۍEL1 EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }C\uE,^@]l1҃DD  u̓E9uEL- :*.&@t$E,Du۸@u܋}L ƇL l}8,T 8L 0u}̬L ], ]Ec M{ }~Et M  ЋU 1ҋMDŽ, DŽ0  r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹Elt a1v`,tEUEEt @Eǀ -]UWVS` suE EM9ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EEL- EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEE E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋL ]3L ]3L ]3L 3L! 3L" 3L# ]3L$ 1EEԋL% ]3L& ]3L' ]3L( 3L) 3L* 3L+ ]3L, 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}uL u3L u1E䋼L% u3L& E1ljE3L 3L' 3L 3L( 3L! 3L) 3L" 3L* 3L# 3L+ 3L$ E3L, }m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1L E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEE$ UWVSP轿 EЋ}] ]9EƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍsv]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝ, }}̫̍?tLD$ D$\$$.t&Ҁ09u$?uE]Ј, E؃0 , }E̫ủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝ1 ]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍvvN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍD ${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]/UWVS E9EEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]UWVS,k TE؋U9E]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSD艹 rU uU9‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$; @D$$  @D $9sӉ t׉D$@BD$ <$L$  $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$譻D$$葻(D$$P4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$vtD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*|UWVSC Eu 9E1D$D$LI $iDžDž4$8$u vt$4$Ɖ$i^ DžD$$8vu[x=uUT$$l D$$: DžDžDž DžDžg|$4$-pt5tmuIT$$x'멍T$$ye뇋$01U+Ĭ[^_]ÍT$$.x+t$v$^ uDž't$v$k^ DžOD$$ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$t*D$ 8D$D$p$$F.[4$NZ |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$D$D$p$)$&D$vD$@J.$7(UVS йuv$H‰)Ѓ[^]øh`UWVS4襮 ÉED$vut$u 4$Y u3D$ ED$$EE8$E $]豳h`)‰UE E h`9t$u+E E܋E$]W NjED$ut$u t$u܉t$ vD$D$blK E$LK t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃vD$D$b}<$WU^D$O O ȉD$$EPU9uD$]^K _K  LK ȉD$$dEPU@D$D$4$E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVS賧 ƈ9ЍPH USM HvH?aЈ>Df`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂ L $2?ƂL aD L Ƅ L $,T$ vT$D$$7H4$tI `D$HD$T$14U+[^_]Íxƅ?n)nOPEȉHTDUWVS虞 ~u(} 9E14$UH $?$u 1H t $t9u틽)x  @4$$D$(|$4$ D$vD$4$T$|$4$}<$T$D$(L$<$T$T$<$$D$(L$<$v|$0, $}$lj~T$,D$4$&Dž0Dž4Dž8Dž<$D$#,D$<$u։fǃL $1ƃL $ D$D$L $ dD$xvD$ B$et$,$m1<$ʉ)Ѹ%I$))Љ)‰ ;$D$(D$<$ ɋoD$,D$<$|$,$:L 򉓌L D$06 < ȉD$$L L D$17 = ȉD$$L L D$28 > ȉD$$TL L D$39 ? ȉD$$L L D$4: 5 ȉD$$L L D$;T$$L PL @D$D$,$(E+[^_]D$,D$<$ ɋ$D$(D$<$l|$,$y$D$(D$<$6p D$D$<$ ;$D$(D$<$[ D$D$<$ &(D$<$$Dž0Dž4Dž8Dž<Dž Dž Dž+ffffffUWVSڗ âMMUu9ƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$ͯD$@|$<$0E D$D$<$|$$,<$耯D$@t$<$D$t$<$ϯ|$4$E+[^_]Éu4$ UT$L$4$qt$4$膱Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfffffffffffUWVS術 ÆutJD$ED$4$NjE9t58u0M 8"tE 81[^_]ÃuE M UVS4 EU ]~<ÍLt&.&.&.&у? H9u[^]UVSג EU ]~Íу? H9u[^]fffUWVS8聒 fƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$et8[^_]É<$uEĉ|$4$2Eă8[^_]Uܑ ½Et'tu-E t:v]ËE t#v]ËM t v]1]Ív]Íyv]Ív]UWVSj Ou} 4$uw[^_][^_]UWVSd" u}$}(E($oEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$<<$ UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$5UtE(D$}<$ E0D$E,$ <$Z jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVS覌 Ëu4$u1҉[^][^]UVSn Su4$u[^][^]UVS3 u4$Zu[^]}[^]UWVS ܖ}u <$…uL}wPU>…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSXk PM $C5 ƉEE$ljE4$ƉEE EEEED$ML$}<$/t.1EM $M $4$EX[^_]ËuE$)EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS ޔ}u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVS肉 g}u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVS }u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úU茈 mE##+ፂv]Íb$]Ít ]Í ]Ív]Ífx]Í~x]Íx]Íx]ÍH ]Íx ]Í ]ÍNx]Í ]Í ]Í0 ]ÍP ]Íw]Í#w]Í9w]ÍNw]Í`w]Íqw]Íw]Íw]Íw]Íw]Íw]Íw]Íx]Í1x]Í?x]Í ]Íx]Íx]Íx]Íx]UWVS 2 EwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu$0 tffUS  hU T$D$U$ []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVSE *u Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG U܁ ŌUM ̲tt M U],]UWVS4褁 MU 9ËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&D̲ɋtxD$$̲ҋtFD$4$2Z ̲tt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$z؍ŬUWVS  lE}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$]' [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0f~ K}wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;Hu̲tD$$]E+u <[^_]ËUEU Mt t]%]UWVSXy ÄuU 9E1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS [ fu} FEFED$E$?$ug$E D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=uztUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$t? [^_]øUWVSX Z d}EE9UE1D$E$ƋẺ$E]} Kf$OME Eĉ4$ U9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$dYUĉT$ D$D$u҉uȉ4$i4$ ‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$qi4$i 9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$h4$ ‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$_h4$W ‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉf賁UMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVSS ^Ѝ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$,$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSLE PuE 9U1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFT#rUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVSB xMlj(UE u9, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(mUWVSdB@ 'KML$U T$9D$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$~!D$0 "D$0 r!D$06 T"D$06!D$0f !D$0H!D$0* !D$0 6!D$06@ !D$0I!D$0 d"D$0qF!D$0v, (!D$0Xa "D$0:b!D$0!D$0|!D$0g!D$0Nt"D$0V!D$08!D$0h6!D$0J!D$0,!D$0!D$0!D$0,!D$0mf!D$0H"D$0x *!D$0Z !D$0g@J.D$ D$D$y$ a@J.D$ D$D$Wz$ڙ@J.t$D$$Nt$ D$D$z{$藙 @J.D$ D$D$z$e@J.D$ D$D$Wz$3@J.D$ D$ D$ $@J.D$ D$D$z$Ϙ4@J.D$ D$D$${$蝘l@J.D$ D$D$R{$k@J.t$D$$t$ D$D$z{$(o@J.D$ D$D$z$!D$0@J.D$ D$D${$谗5@J.D$ D$D$z$~@J.D$ D$D$Ez$L@J.D$ D$D$z$@J.D$ D$D$iz$]@J.t$D$$\t$ D$D$z{$襖@J.D$ D$D$3z$s@J.D$ D$D${$A@J.D$ D$D${$@J.D$ D$D$z$ݕ@J.t$D$$Qt$ D$D$z{$蚕@J.t$D$$t$ D$D$z{$W@J.D$ D$D$jz$%ffD$1ffffffffffffffffffffffffffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS  ]E81}8tmCC tvS(s$taD$D$$ЉƅtoC@8@4?E D$$tt$C($S$C [^]K$C C(1vиUED$ E D$D$E$]UVSEM t]X tVP$tOPtH;uDB-4?w7t-x:t&(r@1 w#EB?EEE@D$D$$]@UBu܉F0B??E E@}EmEE@N?EP B M}]؋u.t&.&.&Fǃu}M]؉uKwE*]ЍuFPFX LFTF\FG?} mmUԋE@H?}؃ U E܋]ȉX PUԉxu}~<}~@ỦT$lj$]\/ }ȋPU]ԋ@E؋Fߋuԃ(tftE@t E@ >)UUԋExD})щHDE@uFDF:?E@}W$tB}GDG;?uV$tB$uFЍt&(M9}U؋u.t&Fǃ9u}MU؉uffB " f= fuN9}U؉MuԋE).&.&s9u}EEUȋ]4EuFD]FH?.)W,WUUMЉ‰EE!MUЍ D89U\ uuUԉ}}|;v.&.&.&.&.&.&.&BEME!MMȍ MDM9 uu}؉U)11]؋uvFǃuu)ƋE@DCE@ E@ : t$EԉD$UB$]gUB)uuԅRuU؉]ԋE@$t]XE@t @ E@7?11U؋] MU؉]ԋUvm)E]艃{DE@M?UuMU؉]ԋ}EG<0EЍXu܉FE@Q?EuMU؉]ԋ}uVdFh ^`}mw EЍ E@ E@  t$EԉD$UB$]DfUB)uuԅRAE@G?} EEuFHUVLFK?fM9}]؋u7t&.&.&.&Fǃ9u'm)EU艂zD Eǀ@??N}MU؉uԸЋU!Ћ}GDGDU)]$}}M]؋u)&.&Fǃtu[}wr}M]؋u}M]؉uԋ]̉؋u)}G}G E@O?EpEE11]؋uh}]؉uԋu]^DF$tXVt ]C }G9?EEG}M]؉uԸЋu!]CHu)U[EЍ{EPD@B?} EESz@EЍ|]܉CE@Q?EL}M]؉ut }1uF$t @0V EB))9EEЍX>tBO)ڋ]ڋ_ۉD$T$ $]b]CU܉B0S 1 EH];XEЍ|U܉BE@Q?EEE)N9'}U؉MuԋE4.&.&.&s9u{EЍ|]܉CE@Q?mmUE}ȉU؋uԋ}Q })EM9MBMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋u}~lbuu}؉UԋU}]Zf]m)uUT$UEԉD$uF$]`FUUQfU_EȋU;B4EE1}}!EED$ED$uF$]w`FEЍ{ ։u!މ Mt M9M]]}}؉EEF&puMu!MM΍ MtM9ou]}؉EKEXL@I?E@l@E?1N9{}U؉MuԋE6v.&.&.&s9'uv}ȉU؋uԋ}Q})E_]MU؋uԋUwHEЍQ&].&.&.&fDSt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]r7|U܉BGQ?uE u5UEP$t EE@t @ E@6?11ɋU؋]E@ TfvPEfED$ED$uF$]p]FF7MM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)u}twruԉփRu=E@l@F?XdPhUuEcE@ y%E܋]ȉX ]XUԉ]؉XEUP<]X@E-UUEEyYEX(u@(D$D$$][uFfED$UT$$[FF5?11U؋]]]EEx@O?]Yf]^}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$] UMP|]܉CGQ?pmEUB(uJJ(vLmEЍ{-EfED$ED$uF$]ZFw9ȐruF1ɉNL$L$ $]aFU܉B0eF??1҉UAE]ԋEЍ|]}GpGTG\L$G\D$T$ GhD$GdƉt$$]V l|U܉BGQ?;f tURGmm1EĉUeE@=?11ɋU؋]E@O?UVS]iu9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0t?t*U UMu[F [^_]=>?u>D$D$$^ML$M L$$t^9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ EԋMM9E܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$IExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffffffUWVS ǣuMx11D rt"E pt&.&fDU9ux.t&fG0UofxZUWVS4 Ǿ}̉ÉEЋ@,E܋{t-Ek@^S,sutftߤEw uEH,@lu6^};s9sӅz}G8‰ىuFl؉Flv,)9_ʋ}?EE؋})EE@,u~89Edž3)ƃj'E@,uFl‹uF\l] Lus<9S} 5E19믺}O\)ȉ9ۋuVlv}4M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^t]FDVLfDPTT$D$$)dž% @9E,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS EuE E]E}}}}U M$:18FV ~$h}uEMQ~HHtk_} U}KB/&} } M}W} }؉1MD$D$F($V ÅMF0@*x@H0x,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]MV$MV F(d V [^_]øCE`{-@F4$U ED$ED$D$D$D$ D$E D$E$j]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8 C,{@uv@ CL{DMqD-{uvueu^CMQ+QS $ | 0 E[^_]älfbft.t&eft&W(f.t&fu5AfY{8f3f+0f(-f%*$E1E%ffffffff Ϣ,UWVS<̗ EċM uS}׃,]f.&.&2A3Ѓu߉׉MEEEE]č,UȉEuϋ1EԋM3OMЋU3WŰu3w u܋u3wu؃4E‹EE܋EE؋EU} U E34}Nj<1}}Nj<1}}Nj<1}Uȋ1EEUu} m Eu] 1}3؃uU3Q1к}3؃uU3Q1к}3؃uU3Q 1к}3؃uU3Q1ڸ}3ڃu߃ȋ]č,1UM 1ω32P3<H1ω32P3<H1ω32P3<H1ω32P3ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+ øU)9fGHOWGHOW)ULuuJE0,uTUU ھ])9 fOY_wWJOw)ًUML fu苜]u'ME;uMU]u+,Ɖ кu)f9OWrwWGpw )щfEDE\uΉ.Eu,E]؉E$]ˉ]ERD$U_NjFD$U$藎tE 8" [^_]1 [^_]UWVS fg Kr}GtUD$UN_ƋGD$U$1t+4$艦=yarauE 0! [^_]É4$諣1 [^_]UWVS f q}GtUD$U^ƋGD$U$贍t+4$ =tciduE 0(! [^_]É4$.1 [^_]UWVSlf QqED$E D$E$.tSEt4}D<$;^ƋED$<$!tE01[^_] [^_] [^_]UWVSe ýpED$E D$E$tJEtZ}D<$]ƋED$<$荌t54$=yarauE01[^_][^_]É4$[^_]UWVS-e pED$E D$E$tJEtZ}D<$\ƋED$<$t54$:=tciduE01[^_]L[^_]É4$R5[^_]UEU E MMM]GUEU E tcidMMM](UVSEd *oE D$E$gwƉ$舣=tciduE0[^]1[^]UVSc nE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS c ÁnE$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]USBc 'nE D$E$dvUT$$c@[]US c mE D$E$+vUT$$@[]USb õmE D$E$uUT$$A[]USb |mE D$E$uUT$$;A[]US^b CmE D$E$uUT$$oA[]US%b mE D$E$GuUT$$xA[]USa lE D$E$uUT$$A[]USa ØlE D$E$tUT$$A[]USza _lE D$E$tUT$$PB[]USAa &lE D$E$ctUT$$B[]USa kE D$E$*tUT$$B[]US` ôkE D$E$sUT$$B[]US` {kE D$E$sUT$$B[]US]` BkE D$E$sUT$$B[]US$` kE D$E$FsUT$$B[]US_ jE D$E$ sUT$$B[]US_ ×jE D$E$rUT$$B[]USy_ ^jE D$E$rUT$$B[]US@_ %jE D$E$brUT$$B[]US_ iE D$E$)rUT$$B[]UWVS ^ ñiE$D$9t,ƉD$E D$E$rlj4$7 [^_]1 [^_]UWVS i^ NiE$D$09t,ƉD$E D$E$rlj4$Ԛ [^_]1 [^_]UWVS ^ hE$D$8t,ƉD$E D$E$qlj4$r [^_]1 [^_]UWVS ] ÉhE$D$l8t,ƉD$E D$E$Yqlj4$ [^_]1 [^_]UWVS B] 'hEU$T$ 8t,ƉD$E D$E$plj4$讙 [^_]1 [^_]UWVS \ gE$D$7t,ƉD$E D$E$plj4$L [^_]1 [^_]UWVS ~\ cgE$D$E7t,ƉD$E D$E$2plj4$ [^_]1 [^_]UWVS \ gE$D$6t,ƉD$E D$E$olj4$膘 [^_]1 [^_]UWVS [ ÝfE$D$6t,ƉD$E D$E$molj4$$ [^_]1 [^_]UWVS V[ ;fEU$T$6t,ƉD$E D$E$ olj4$— [^_]1 [^_]UWVS Z eE$D$6t,ƉD$E D$E$nlj4$^ [^_]1 [^_]UWVS Z ueE$D$5t,ƉD$E D$E$Cnlj4$ [^_]1 [^_]UWVS ,Z eE$D$=5t,ƉD$E D$E$mlj4$藖 [^_]1 [^_]UWVS Y îdE$D$4t,ƉD$E D$E$}mlj4$4 [^_]1 [^_]UWVS fY KdEU$T$x4t,ƉD$E D$E$mlj4$ҕ [^_]1 [^_]UWVS Y cE$D$4t,ƉD$E D$E$llj4$o [^_]1 [^_]UWVS X ÆcE$D$3t,ƉD$E D$E$Tllj4$ [^_]1 [^_]UWVS =X "cE$D$M3t,ƉD$E D$E$klj4$觔 [^_]1 [^_]UWVS W þbE$D$2t,ƉD$E D$E$klj4$D [^_]1 [^_]UWVS vW [bEU$T$2t,ƉD$E D$E$+klj4$ [^_]1 [^_]UVSW aE D$E$7jƉ$X=gntst 1[^]É4$'tU[^]UWVS V ÝaE$%%t,ƉD$E D$E$tjlj4$+ [^_]1 [^_]UWVS ]V BaE$$t,ƉD$E D$E$jlj4$В [^_]1 [^_]UVSV `E D$E$%iƉ$F=atadt 1[^]É4$kwtUEt 4$+wM[^]UWVS U w`ED$E$iut,ƉD$E D$E$Gilj4$ [^_]1 [^_]UWVS 0U `ED$E$ut,ƉD$E D$E$hlj4$蜑 [^_]1 [^_]UWVST ó_E D$E$gƉ$=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$ 1UVSBT '_E D$E$dgƉ$腓=gntst 1[^]É4$=$tU[^]UWVS S ^E$R"t,ƉD$E D$E$glj4$X [^_]1 [^_]UWVS S o^E$ "t,ƉD$E D$E$Fglj4$ [^_]1 [^_]UWVS /S ^ut*t$E D$E$flj4$謏 [^_]1 [^_]UVSR ]E D$E${Ɖ$"=loobt 1[^]É4$WzU[^]UWVS R k]E$lyt,ƉD$E D$E$蝊lj4$ [^_]1 [^_]UWVS*R ]E $yt%ƉD$E$Plj4$裎[^_]1[^_]USQ ü\E D$E$sUT$$.[]USQ Ã\E D$E$:UT$$I/[]USeQ J\E D$E$UT$$/[]US,Q \E D$E$ȈUT$$/[]USP [E D$E$菈UT$$0[]USP ß[E D$E$VUT$$ 0[]USP f[E D$E$UT$$A0[]USHP -[E D$E$UT$$0[]USP ZE D$E$談UT$$0[]USO ûZE D$E$rUT$$1[]USO ÂZE D$E$9UT$$"1[]USdO IZE D$E$UT$$.1[]US+O ZE D$E$džUT$$;1[]USN YE D$E$莆UT$$;1[]USN ÞYE D$E$UUT$$;1[]USN eYE D$E$UT$$T1[]USGN ,YE D$E$UT$$T1[]USN XE D$E$誅UT$$`1[]USM úXE D$E$qUT$$m1[]USM ÁXE D$E$8UT$$m1[]UWVS aM FXE$D$((t,ƉD$E D$E$qlj4$̉ [^_]1 [^_]UWVSL WE $D$'t%ƉD$E$lj4$p[^_]1[^_]UWVS L ÇWE$D$i't,ƉD$E D$E$貄lj4$ [^_]1 [^_]UWVS?L $WE $D$'t%ƉD$E$^lj4$豈[^_]1[^_]UWVS K VE$D$&t,ƉD$E D$E$lj4$O [^_]1 [^_]UWVSK fVE $D$I&t%ƉD$E$衄lj4$[^_]1[^_]UWVS &K VE$D$%t,ƉD$E D$E$7lj4$蒇 [^_]1 [^_]UWVSJ éUE $D$%t%ƉD$E$lj4$7[^_]1[^_]UWVS iJ NUEU$T$1%t,ƉD$E D$E$zlj4$Ն [^_]1 [^_]UWVSJ TE U$T$$t%ƉD$E$'lj4$z[^_]1[^_]UWVS I ÑTE$D$t$t,ƉD$E D$E$轁lj4$ [^_]1 [^_]UWVSJI /TE $D$$t%ƉD$E$jlj4$轅[^_]1[^_]UWVS H SE$D$#t,ƉD$E D$E$lj4$Z [^_]1 [^_]UWVSH qSE $D$S#t%ƉD$E$諁lj4$[^_]1[^_]UWVS 0H SE$D$"t,ƉD$E D$E$@lj4$蛄 [^_]1 [^_]UWVSG òRE $D$"t%ƉD$E$lj4$?[^_]1[^_]UWVS qG VRE$D$9"t,ƉD$E D$E$lj4$݃ [^_]1 [^_]UWVSG QE $D$!t%ƉD$E$/lj4$肃[^_]1[^_]UWVS F ÙQEU$T$|!t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSRF 7QE U$T$!t%ƉD$E$rlj4$ł[^_]1[^_]UWVS E PE$D$!t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSE xPE $D$ t%ƉD$E$~lj4$[^_]1[^_]UWVS 6E PE$D$F t,ƉD$E D$E$E}lj4$蠁 [^_]1 [^_]UWVSD ÷OE $D$t%ƉD$E$}lj4$C[^_]1[^_]UWVS uD ZOE$D$t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVSD NE $D$#t%ƉD$E$1}lj4$脀[^_]1[^_]UWVS C ÛNE$D$t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSSC 8NE $D$dt%ƉD$E$r|lj4$[^_]1[^_]UWVS B MEU$T$ t,ƉD$E D$E${lj4$c [^_]1 [^_]UWVSB zME U$T$t%ƉD$E${lj4$[^_]1[^_]UWVS :B ME$D$Kt,ƉD$E D$E$Jzlj4$~ [^_]1 [^_]UWVSA üLE $D$t%ƉD$E$zlj4$I~[^_]1[^_]UWVS {A `LE$D$t,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVSA KE $D$'t%ƉD$E$5zlj4$}[^_]1[^_]UWVS @ ßKE$D$t,ƉD$E D$E$xlj4$$} [^_]1 [^_]UWVSV@ ;KE $D$ft%ƉD$E$tylj4$|[^_]1[^_]UWVS ? JE$D$ t,ƉD$E D$E$ xlj4$d| [^_]1 [^_]UWVS? {JE $D$t%ƉD$E$xlj4$|[^_]1[^_]UWVS :? JEU$T$Lt,ƉD$E D$E$Kwlj4${ [^_]1 [^_]UWVS> ýIE U$T$t%ƉD$E$wlj4$K{[^_]1[^_]UVS~> cIE D$E$vƉ$}=gntst 1[^]É4$ytU[^]UWVS !> IE$ t,ƉD$E D$E$9vlj4$z [^_]1 [^_]UWVS= ëHE $3 t%ƉD$E$vlj4$@z[^_]1[^_]UWVS r= WHE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS= GE $ t%ƉD$E$>vlj4$y[^_]1[^_]UVS< éGE D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS S< 8GED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS ; FED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVS; tFED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS4; FED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS: þEE D$E$urƉ$z=gntst 1[^_]É4$ P$UDžtڋUT$D$4$ t U:[^_]É<$+1UVSM: 2EE D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS 9 DE$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVS9 zDE $t%ƉD$E$rlj4$v[^_]1[^_]UWVS A9 &DE$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVS8 CE $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVS8 wCu t#t$E$qlj4$u[^_]1[^_]UWVS H8 -Cut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVS7 BE 0Ft%uFt$虵4$葵1[^_]Í$M <$fFt<$W1[^_]Ét$@M ${<$3FUSh7 MBD$$M $̝D$@M $1[]US 7 BEU 9t8J 9H u(Rt<@t-T$$[]1[]ø[]Í!ˍ!US6 ÖAE @tUT$$[]ÍL D$ D$D$tt $USV6 ;AE @tURt$ 0ƅt' D$4$oFF F[^]UWVS~3 c>u$ Ϩ… D$$UoUBB BU4$EE$|Ut]NjMs"EtfEtBEB Ѓ[^_]׍}D$ 0D$D$/t $$Lo1UVS2 v=ut4$m[^]%}D$ D$D$}t $UWVS02 =Etw} |$ ED$D$$ ƅxEH $M[…t1|$ ED$ML$$UәU1{[^_]1[^_]Í}D$ D$D$Ut $Us1 \<UT$8$]UVSL1 1<ut4$([^]}D$ D$D$}t $DUWVS 0 ;utb 9uXFt@~ G$.…t>FtAD$$U5U [^_]K4$l [^_]1 [^_]Í!UWVS \0 A;utJ 9u@~ G$襥…t,Ft/D$$U~U [^_]1 [^_]Í!U/ :Et 9t1]Ë@ ]U/ :Et 9uP@tt ]1҉]Í!]US/ d:Et 9t1[]ËU tH Q9Ur@tD$E $}[]Í!U!/ :Et 9t1]@]UWVS. 9}t; 9u1G $2ƅtGt"D$4$<}[^_]1[^_]Í!U. j9Et 9u @t ]1]vÍ!]UWVSH. -9ut 9t 1[^_]ËU tM 9uFtA F EP$UjDžtŋE HɋUtOFt@L$D$ D$T$<$ F~}~ t$ys!븍!UWVS- i8ut 9t 1[^_]ËE FtE $8F EH $M衢…tFMtI} |$D$ D$L$$UFFUV}~ t$豪o!믍}D$ D$D$;t $US, Á7Et 9t1[]ËM tM 9uL$$mUSU, :7Et 9t1[]Ë@tU T$$[]Í!US, 6Et 9t1[]Ë@tU T$$[]Í!US+ Ò6EU tG 9u=t99 u5Rt@tT$$b[]Í!@uፃ!ٸfUSC+ (6Et. 9u$@tU T$$[]Í!fUWVS * 5u~(Ft  [^_]D$ED$ D$D$4$tȋUBU$DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ 蕟ƅt' D$4$PfFF FE 0 [^_]É<$譧D$eD$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]USX) =4gD$ $PM $[]US) 3PM $[]UWVS4( 3M EpAQAtp}D$ T$L$D$ uԉ4$D$|$E$Bqt2t$E$"nt|$E$7r4[^_]Í14[^_]ÉD$ T$D$D$ uԉ4$ey D$ LD$D$<$:UVS' 2E 0t$lM $4$芥1[^]US' Í2D$PM $ LD$lM $1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS& 1ƍgD$ $覐PM <$vt$lM E$Et $Eb<$JUЃ[^_]ÉE<$2$ ڛUt֍lD$ $MbMAFAFA<$t$E$Mt+$Egb<$ÌM $ˣUЃ[^_]ÉL$ME$M9uE<$臌UЃ[^_]Í}D$ hD$D$M<$UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVSw$ \/utl9u4$`[^]1[^]UE@]UWVS0$ /Et l9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YUh# I.Et l9t11]ËP@]U;# .Et l9t11]ËP@]U# -Et l9t11]ËP@]U" -Et l9t11]ËP@]UVS" -Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS%" -Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS! ~,Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE US0! ,Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U ¥+Et l9t1]ËHP@txE P]US b+Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UVS *Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS g*Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS )Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U s)Et l9t1]ËHP@txE P]UP 1)Et l9t1]ËPH9иrE ]U  (Et l9t1]ËPH9иrE f]U ¦(Et l9t1]ËP@uE ]U m(Et l9t1]ËP@uE ]US 4(Et l9t1]@uP@xM A]ËP@M QU 'Et l9t1]ËP@uE ]U ©'Et l9t1]ËPH9иrE ]U d'Et l9t1]ËPH9иrE f]U= 'Et l9t1]ËP@uE ]U &Et l9t1]@uP@xM A]ËP@M QUS Ï&Et l9t1[]ËM tM 9uL$$\USf K&EU Mt l9t1[]@t Xxx3P3H []US &EU Mt l9t1[]@t Xxx3P3H []UVS ¶%Eu ]t l9t1[^]ËPH@uxx11 [^]UVS f%Eu ]t l9t1[^]ËPH@uxx11 [^]UWVS$- %uEEEEVt $[^_]À~(u~-+0u xZIE܉D$}|$F$ugEUщ¸9иeEF>t"D$ioD$4$VJE@U $[^_]E E܉D$ED$F$fEUE܉U}9EXV8"J&<8"0f,E܉D$|$F$ΙEU!Ѓt4MEFcD$ED$8"ut&4fffffffffffffUWVSP "<$Wf0vH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$c>_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS< l 4$cB BBB$BBB(B8OwuBfn'"H[v*B|DžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{BJHJx"t_Zxaucxlu]xsuWxeuQHBzB(J1xru+xuu%xeuH̃BB(ZP)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{j<$O1USEt&.&.& w u[]US ) E ;Et1 []ÉD$ED$E$9 []UWVS ]u}E E $谻VEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]%8?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]}D$ D$D$h$f)щN$x>qUWVS, EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$prvvxEpD$}t$$t}(u GtLt51E$萆[^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVS í$Ghp$}tD$D$E$gǃxD$<$̙aEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$1^Ƌt0<$gd3D$L$d4$ollp ȋdE D$4$aNjtPD$T$l4$llT$4$-t$҃Ĭ[^_]1)<$ft$訃1Ĭ[^_]D$D$D$D$ D$hD$l$ ]lthȋtGL$4$],t$1nUD$E$U]fffffUE 9E]UWVS ƅtBD$$M~Et E$@5zDžMu% $胂1\$@zDžtED$<$@D$G$lEG,w0G4G8G<[^_]US@ %|M $j[]US 3D$,$m|M $j[]US D$|M $@jD$M $$1[]US yED$E $j[]USg LED$E $:[]US7 E$kE $k[]UWVS( UM܋p4@,EEGEt@E<E tDMUD$E$菮UMtLօuE܅tE܉1([^_]Í}D$ (~D$ lD$D$$KUWVS uFt09u&x<$WeƉ<$Fe[^_]ÍD$ D$D$$ӰUWVSz _Ƅt1XƅtptC[^_]ÉUx<$d1ɋU'ƅtpt<$d[^_]ÍD$ PD$D$$8US E xt"D$ D$E$r[]Í6~D$ D$D$ $ѯUSz _UB4tB4R,…t8$7[]ÍN~D$ D$D$$m~D$ D$D$$CUWVS4 UM@8t 14[^_]ÉƉ׍PU$DcMDžt6pE$6EG4$67E$c4[^_]Í3D$,$6d|M <$aED$M E؉$E܅$w6<$`V09V4E$X6N4~,UEE؋UЉMԃD$E$豥MԋUvA)D$E؉D$D$QEF,}܉8}xF4F<<$`E$HE܃,n}<}ܜ$nEMD$ $F5UT$MA$GEM܉H<$_UT$U؉$kE܅$5<$l_E@,vu1<$/^0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$ D$4$~D$4$=4$<U܋T$4$P tEO49H1gEq<$\D$4$ ?Ɖ0[^_]Ë}4$Z<E$5mD$4$9n}э D$ D$D$$}E$5n 4$;EԉD$4$|=l~D$ D$D$$輧UVSd IE 0t$M $AF,v ut 9t 1[^_]Í~<$Vv4<$V[^_]UWVS ut 9t 1[^_]Í~<$dVE 9F0r<$OV[^_]ɉUWVS Åu~<$VƉ<$V[^_]UWVSc Huth9u^F4$I"EFE$UF4tM1;~4sAF,D$E$U&uߋE$UE$)EE[^_]ËE$[UE[^_]UWVS ÝutB9Uu5~<$UU9u/U Ɖ<$T[^_]1[^_]1US\ 5EU t$9ut9 u 1[]1[]UVS Eu Mt 9t 1[^]ËP49P0r [^]D$ D$D$ $UVS }EU ut 9t 1[^]Åt9 uH49H0r [^]TD$ D$D$ $mUWVS, ut 9t,[^_]Í~<$tSF8t<$fS,[^_]ÍMU tߋUUN4Mt{M9MV,UMM9M܋PU؋UM)L$MUTT$$lBn4F<M܉ $&U؉$&TN~D$ D$D$u$Y~D$ D$D$v$/~D$ D$D$w$US –EM t 9t[]Åt9uM E[]TUSj OEt 9t1[]ËM tM 9uL$$*U+ Et9u]1]U Et9u]1]US øEt 9t1[]ËM tM 9uL$$ *US qD$E$4[]UWVS _ D}U uFt  [^_]ÉU1$t~(Ut [^_]ÉUE$r]MUt E [^_] $$US ôD$E$[]US ÇD$E D$E$65 []USp UD$E$|[]UWVS A &ExU(E P $D$L|$E$/E p@ E4E}pM9D$E$_+E}D$E$=+ED$E$+trmEV0MM<NʈUV?UMD$E$*.1 [^_]ÍLD$E$0 [^_]Í D$ D$D$s$}EE}FUu0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃D$ D$D$$ 8D$ D$D$$U ˆEt,9u@]1]USw \Et ,9t1[]ËM tM 9uL$$US 0 Et ,9t1 []ËM9H uU tL$M L$@$} []UWVS øu>t=~(u7Ft=D$ T$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MPEtFVT$U$MUs9}D$D$4$ $QPƅ,D$4$FEF~ E 0%:D$ED$F $ ljEt\UF$F 9:" ~D$ lD$D$$腎E$W [^_]诔8"uE$W$jOƅtEE$W1!1U ²Et l9t1]ËM tM 9u9]UVS rlt$M $ƃM t$M $ƃM 1[^]US: E xtD$E$#[]ÍUVS uD$L$BtM 4$[^]ÍM UVS Íutl9u4$[^]1[^]Us TEt l9t1]@]UJ +Et l9t1]@]US Et l9t1[]ËM tM 9uL$$fUVS öuFt [^]À~(tD$ 0D$FD$F$Vu_D$ (D$FD$F$.tWD$L$#AM 4$E 0[^]ÍD$L$@M Ǎ`D$ D$D$$)fffffffUWVS æƅtBD$$PEt E$@KDžMu% $DT1d$@KDžtED$E<$ED$G$}>EG,w0G4G8G<[^_]US E$o>E $a>[]UVS éPt@9 u6p 9rt 9t%$c$Y [^_]ÉUMGE$4UNjE$3Ut$ M9t;E [^_]0D$ LD$D$4$hA$衸MA8,uA1)UE]UWVS }9GE$;3G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$2UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS ut 9t 1[^_]Í~<$\2v0<$Q2[^_]UWVS Ôut 9t 1[^_]Í~<$ 2v4<$2[^_]UWVS^ Cut 9t 1[^_]Í~<$1E 9F0r<$1[^_]ɉUWVS u~<$l1Ɖ<$[1[^_]UWVS Þu~<$/1F8uF8<$1[^_]UWVSz _u~<$0v8փ<$0[^_]UWVS> #ut<9u2~<$0F49E s+F,U 4t"<$0[^_]1[^_]1ލXD$ D$D$a4$|UWVS Òut 9t 1[^_]Í~<$ 0F8u`F4;E t\9E seE V,tUEE$N,UEF<U$<$/[^_]1UA܍DD$ D$D$4$({WD$ D$D$4$zUWVS Êut 9t 1[^_]Í~<$/U Ɖ<$.[^_]UWVSK 0ut 9t[^_]ÍFE$.~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$.E$[^_]ËE$-%DD$ D$D$4$zyXD$ D$D$4$PyUS Et 9t1[]ËM tM 9uL$$FUS ×D$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]USE *D$E$A[]US  D$E D$E$ []US D$E$[]fffUEU @]US ÃE$;t[]ÍjD$ LD$D$p$wUWVS0E *$}`HtыpG$萍`tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$ Ku}DžPtҋ@w4$躌)T$$PtЉ4$~taNjPu냍tD$ 8D$D$$uxD$ 8D$D$$utD$ D$D$$uxD$ D$D$$cuD$ D$D$$9utыt$PD$ D$D$$tUEt]1]UWVSDv [$UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]Í<D$ D$D$#$rEEU D$E D$E$]UE]UE@]UVSB ]C$$;[^]fffffffffffffffUWVS޽ ƀ8$gD9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$fP /.pl@istX@XXXXf@ X $;ƃtb|$D$4$(9v84$q$Ӫ1v8[^_]v?1[^_]PƄ$fى4$g^$lj$ׁ|$4$+D$$ v84${UWVSR /uM ^t^F9tX^ [^_]ÉMD$$x5…FFM빍D$ 0D$D$9`$nD$ 0D$D$:`$nD$ 0D$D$;`$n1<&M䍙D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$Vuύ T$ T$D$#`$jt][^_]UVS ]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍 T$ T$D$D`$iE >][^]UWVS( ]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]Í T$ T$D$c`$dhD$/$9E >][^_]UWVS ݳ ¾UyEx i} _$)ƅI$(+FFF E Ft.ED$4$ׄuG$114$1 [^_]Í < t~D$4$uD$ 4$tFu.D$4$tD$ 4$wpD$4$_DŽ^OD$D$4$G)D$ 4$Ex 4$ 01 UWVS > #ED$E$;t>Ɖ$ \E lU4$/lU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSd IutFwyM MJ]ZMJ [^]$l&t|] X]XMH ]X뼍D$ \D$D$A$dD$ \D$D$B$d1fUWVSi NUu }t`t`tAtA}tA uutA} $-[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍D$ LD$D$Z$cUWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ Ɖ) ‰L$D$$_ f1 [^_]ÉM4$aM랹čےD$ D$D$>H$U@넍EUWVS Ehl}ptDžxAEEEEEE|(D$ut$$ D]E$D$t$$CDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$XD$4$ |$4$%D$04$c<(9D$hD$t$ D$D$0$U,c4$,4C8D$t$0$tD$(D$$^BD$$D$$@BD$|$$4[^_]D$$X[^_]Dž4cB,Dž4GD$(D$$AyD$(D$$}AD$$D$$_AUWVS@ˇ Ơt$(D$T$L$,D$,t "|$GD$8UT$$\$(.uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$($D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(?"D$8D$D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(wD$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(H;"D$8D$D$8HL$L@L$8t$@|$D<*tXD$=E$/EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $)u֋U$U9t5EuEEEuU܅/EEUUыr/Eԅ0tC.t*E8:t"UED$ED$,$轹MA70E<-<+<::[B9FB 9F  E;u~#9E!xtC.0tE8:tD$W$7WE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$Ett p1pu-x/ED$ t$D$`H<$EED$ t$D$<$*tC.t$E8:tED$ED$T$7?D$ D$D$aH$4Eԅd}؉:t0Ex pq yMMMyM؋E!xEEEЉpE $MЋtp+t)kExutC.8tE8:tt$$u70tC.E8:ED$$7qx:#EE9E:E MM؉:ŨE uЋE؉tC.t+E8:t#MED$$谵EЋMq17EЉE<-WKED$ T$UD$`<$EUuD$ T$D$a<$t$ t$D$<$D$ T$D$a<$ !xtC.E8:t$$袴A D$ t$D$a<$*[u x;UWVSe p} u*P uǃP |E ;M!8-pxP -!D$-E$ǃP --|$E$tAx:ǃP >u|[^_]ÍrP :u>u|t2E8:t*|$ D$D$@J.$?[^_]ÀxF|!_|>uTx:tL|9M!E8:t=|$ D$T1P !|[^_]ÍԀD$ D$D$Rp$uD$ D$D$Sp$E 4l:bUVSRc 7nutD$ D$4$H;[^]ÍġD$ D$D$/$UVSb mutD$4$%e[^]ÍD$ D$D$/$fffffUSb hmE$?1[]UWVS\b AmEtVu;U E} Uz BD$E@t$9s0E@ 1҃[^_]ËE@D$Mxe);u EE UD$9sNj]C 넋E EuGE@D$Ex gE UybE E%5D$ D$D$$g,D$ D$D$$=TUWVS` ükUB Eu1ƃu}9}EE}B269r|])9ErGË}u sJu(u J J ZR9r [^_]ÉfftEË}u rucuk띉UGD$4$ƅt[UB)ǍD|$D$$U0MJB E2Xf넃@UWVS_ lju} D$$$…0x@@ D$D$D$ 6D$D$$UDžt1D$$[^_]R1[^_];8U$i$_818US l^ QiE D$ED$@J.X$C []US5^ iED$ E D$ED$@J.X$C[]UWVS] hu} t(ED$ 1D$|$4$Q[^_]Í&1D$ $D$D$4<$UVS] ihut'D$ D$D$4$yQ[^]Í&1D$ D$D$A<$=UWVS] gu} t)D$ 1D$|$4$Q[^_]Í&1D$ 0D$D$6`$UVS\ Égut>D$D$ D$D$4$Kt [^]1[^]Í>D$ 8D$D$0$FUS!\ gED$ D$ E D$E$ 9[]UWVS[ futtE D$4$~7F0u D$4$[^_]tF0uҿF0뻍&1D$ @D$D$/$R]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSZ seE0x$Etu[^_]1[^_]UWVSQZ 6eu tLEt>?t+fx f@UPp$MH,UP(UPDUP [^_]ÿUuy1UWVS Y ôd}u$%‹EE Bzr EBtntpE tZE EU>UtnMfH f@PM H$x,p(@DP [^_]ÍE뭋M tE E딉UU$1UWVSX ùcUE trB0~4r,txM q J$tE D$ E 0xt$|$$[^_]ÉUKD$ HD$D$<$4 UY&1D$ HD$D$;$ U US W übED$E D$E$辶 []USW ËbED$ ED$E D$E$&[]UVSmW Rbuf~ D$4$F0tN@9t $F0F0ǀǀ FFF t1FD$4$e1[^]ËFߍ&1D$ PD$D$<$ I2 UWVSV jaEU tgP0~4p,tu ~r H$t} Lj $[M׉‹M y!1[^_]ÉEKT$ XT$D$9$ Ed&1T$ XT$D$8$ E+UWVSU v`utFD$4$nx$P8D$4$[^_]É4$ڍ&1D$ `D$D$74$+ US U _ED$E D$E$iH []UST ú_ED$ ED$E D$E$F[]UWVS,T À_Et8uj}ԉ ;o$JFFF )t$|$$踲,[^_]ÉEԉ$E؍EEu}wW끋uUS µ^Ex9o]Ë]ÍW]fUWVSTS v^UE }}9}7uցE0 tS9utOD$2@D$u4$4$PEt8UED$t$E$Uu-p4$PEuȋ}E+TЃT[^_]Ét$ ݁D$D$2u4$׺4$yP볅U@E 7t"ED$G$3ut$ 닺8R}UD$ hD$D$$UEtT$ hT$D$$uE7M,ET$ hT$D$$E~fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVS^P C[ut;F)F3E uF F[^]1[^]ÍуD$ D$D$Y܃$UWVSO Zu} Uts~F<FF DWPWPW P F F 1[^_]ÍD$ D$D$v܃$CU`UD$ D$D$w܃$ U+UVSN ýYut~u@~w:E [^]ÍD$ hD$D$܃$뺸UVSqN VYut~uAF u9<.w5[^]ÍD$ PD$D$܃$6빸UWVSN X}u t5u%G u<.w~9|D7[^_]1[^_]ÍD$ 8D$D$܃$UWVSM nXu} t*~uPF uH<.wDx>9؃[^_]ÍD$ D$D$܃$<몸UEu E D]1]UWVSL W}utQEu@D69E r4E D$D$<$6GfGG[^_]1[^_]ÍуD$ D$D$.܃$UWVSYL >Wu} t;~uaVL\WQWQW Q F1[^_]ÍуD$ D$D$M܃$뙸UWVS4K VƉEԋE} 9uЋU1҅x%PލT$D$<$]wGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍT$ T$D$h܃$E܅ E܋]ԍT$ T$D$i܃$Em]wUVSOJ 4Uut~uEFu=:Fr6[^]ÍуD$ D$D$܃$뵸UWVSI Tu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍуD$ D$D$܃$fffffffUWVSQI 6TƉׅtat1>t F9rF9s1[^_]ú䍃7D$ D$D$p$뾍D$ D$D$p$pUWVSH ÊSt4ljփt3Rw0FGT$D$<$8[^_][^_]ÉU*D$ D$D$p$>UUSH RE x[]ÉEGT$ DT$D$Tp$E[]UWVSG ÝRu} Et,tYPσF)F 71[^_]ÍуT$ 0T$D$bp$fEuE[T$ 0T$D$cp$2ErUWVSF QEu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃iD$ D$D$p$MÍD$ D$D$p$M}]썃D$ D$D$p$L {P7f/UWVSD OEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍD$ D$D$p$ME]荓T$ T$D$p$EjUWVSC vNu} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃D$ D$D$p$LwD$ D$D$p$VUWVSyB ^MU} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]ÍD$ D$D$Wp$UUwD$ D$D$Xp$aUUUE ttuB]ø]UWVS$A KEEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]UMi1ɉM]썃D$ D$D$p$MXMUEE썘\$ \$D$p$MUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUS< ÂGD$D$ED$ ED$E D$E$[]fUWVSPN< 3GƉЉ9U1҅[ƅD$D$D$D$ T$D$4$Ct1U+<P[^_]Í1ɉ D rFDžDžD$ T$8D$<$EuutjƅD$D$D$D$ t$GD$G$Cut$$tu<$Vt$CtT$ XT$D$$jgUWVST{: `EƉ9E1 ƃ Q ƅD$D$D$D$  Q D$|$4$AD$D$D$D$ L$|$4$A;DžDžDžDžDžVDžDžDžT$ D$8D$$stjƅD$D$D$D$ t$GD$G$@ut$$thuGtLD$ D$D$$r$q1U+uXT[^_]Ë묋$qʍD$ hD$D$$8GeUWVS8 BϋEE uE9E1,VD$D$ D$D$<$YB4D$ D$D$$7t6D$ D$D$$zw $ɗD$$D$${$聗D$I$cG$M$?̅~f$N$ t$D$D$$荣U+Ą[^_]Í @$0/>>D$ $HuD$<$2rD$/$T3Pt:D$D$$_#xD$D$D$D$D$ D$T$$D$D$J$C$@D$D$:$$X$D$!$$ D$ D$D$y$ȄD$ D$D$z$؄D$ D$D${$bD$ D$D$|$*{D$D$D$D$ D$T$$Q@$8u D$/$0D$t$ T$D$$D$D$D$D$D$ {|$D$$U*VD$ $эD$$^D$*$z$UWVSn1 S<EhU9E1pl 1} } uqƅptBxB |BEBEE qD$D$E $_Džy@E+Ĝ[^_]</ƅptBtfDžrlD$<$$xSrfh뎉lVD$ D$D$ $<ll<$l']U D$E D$E$O]UVS/ â:utD$D$4$[^]ÍVD$ D$D$$~UWVST/ 9:ljEE Et9|E1Eh]DžDžDžDžxD$D$$脍_DžDžDž@J.D$FD$$ǃD$D$<$蘎FD$FD$<$Žh<$ҎN80t&<‹F:=4$袱Dž'8#Qq$#vD$xD$$|E+Ĝ[^_]ÃNZƅD$D$D$D$ |$FD$F$j4|$~$EvƅD$D$D$D$ |$FD$F$4u4|$D$$%$$GzD$\D$<$uD$\D$<$Y.0$ϰD$ @D$gD$@J.$蕘8tD$FD$$DžD$$D$ D$D$4$4$D$t$<$fƋ$9fDžfDžD$D$$^D$L$$;Ƌ$ t0<<4$D$t$<$]4$D$t$<$<4$nD$t$<$D$D$<$AD$xD$$-D$D$D$D$ D$D$ $0u(4$v=4$g=$wD$!D$<$3DžeD$ D$D$$T9D$ D$D$$ȄD$ D$D$$؄D$ D$D$$D$ D$D$$t$*$><$6!D$t$$豅 tD$t$<$ԆtƋtt$ɇ뉍D$$談hD$8$j뛍d$t$;rSUWVSl4& 1uEEEEEEEE9E1MGUqEE fD$ D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$4_=EPt%D$T$,U $UUEML$ML$M $MƋE$c^E+l[^_]ÍD$ D$D$$MȄD$ D$D$$U؄D$ D$D$$dEeD$ D$D$$/6$Q]D$D$r$WrQUD$ED$ED$ED$ ED$E D$E$f]UWVSl# {.uEEEEEEEE9E1xMUEE fD$ D$D$ UЉ$UWEEEEEEM MEEML$ D$UT$$\E@t"D$D$,V $U<U3D$ $tM 9HtCED$ED$E$MEƋE$[E+9l[^_]ÍEv$bD$ ED$ED$E$ME 멍D$ D$D$i$M^ȄD$ D$D$j$U4؄D$ D$D$k$kE D$ D$D$l$6$XZD$D$r$^oNUD$ED$ED$ED$ ED$E D$E$ ]UWVS +}lE \EXE`9@E1D$pH$FXp`DžLDžPpR.dR.DlD$ D$D$<$mD$ <$`bdh< Q< t< L .&< t< t t ~ u9P>uXp<+%<-q<@nL'PHD$ D$PD$r$y؉DžL<+<-w҉ht$`$jhyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$exDžL<+F<@[hU\l K4$  u9F<@t$`$qU\l<+<-t$`$>qU\؉<+N<- t$`$A_Z<+<-DžLDžP.hHD$ `D$D$4$vhQ7F<@uhHD$ `D$D$4$v؋h]PFF'<@hHD$ `D$D$4$uhU\1PU\PF]<@UHD$ `D$D$4$&u)F<@ DžLDžP1D$ xD$D$$ ͅD$ xD$D$$XۅD$ xD$D$$aFUWVSt Y$M(E<}98ƋE1f<!ǃP U@D$D$ D$DD$<$v@D$@ D$4$aD$D$4$'"M4'0@@ $@@P T$$w@@$,D$4$ͅ,t$D$4$p?,|%=&P $ӟ4$u0$8E+[^_]þ뿍,D$$…tE|[^_]1䍃D$ hD$D$N$ /UWVSt Ù EUU9M1ɅtBE}<$EhM L$ED$<$hED$<$RU+u:t[^_]ÉE$L$ \L$D$h $<EK/US E D$E$[]US E D$E$[]UVS ß D$.D$W 4$ED$ t$ED$$薍[^]UEȅyt ]%]]ffffffffffffffffffffffffUWVS0  E؋}u 9EԉËE1|$}܉<$]&1&.&.&.&.& F TFuF(}ԋE+uW0[^_]$)]uƅgы]؍D$ D$D$Ft$ +],-UWVS EE u}9U1ҍ$iD$@$_E E19xu}_D$D$$'_D$D$$L)׉ 9|KD$D$$^D$ D$$19 })׉ q0$d_0D$$%U+[^_]É裸0$_莸0t1D$ t$|$$՗b$^1농D$$tыptEU**UD$D$D$D$ E D$E$H]UWVSx2EUU9M1ɅtBE}<$M L$ED$<$.ED$<$U+u:x[^_]ÉE$L$ L$D$t $躱E)fffffUWVSzc8]du 9<ËE1dENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ ]]Ћ~$|}ԋ^(x]؋~,t}܋^0p]^4H]~8D}v<@u식d3`s\s{ l{LȉEl1؋\!1؋`LyZ؋u\ɉT1`!1l yZTىˋ`MʉX1!1ыXP:yZω}ω}E1ȉ!ߋE1NjE0yZEȉ1!׉M1ωEMyZω9EEȉ1щ!1߉EMyZNjMu}ω}1ϋu!1׋MyZ߉Mɋ}u1!Nju1hyZ׉}ωM1!ߋM1ωuu1yZ]|ɉ1!1lj|]yZωxωxU1ډ!U1׋xyZljutʉ1!ω1߉t]yZ߉pʉU}1!NjU1׋Up2yZ׉4:u‹Hω1Љ!1ωuu0yZE]Dω1ߋ]!1׉EyZωE@ω}]1!]1߉EyZlj}X1u1u1Ƌ}1!ϋ]1߉u]yZ߉MT}1|1u1lj1!ljT1׉uUyZ׉ :X}1׋x1u1lj}1!ߋu1UT2yZUu1֋t1֋U1։‰1މX!1ƉUM yZΉTXMu1΋p1΋M1Ή11MnTƉXEh1NjE1NjM1ω׋X1ϋT1ωEn߉TE}1NjE1NjM1ωXT11En׉h|1NjE1NjM1ωT11߉MXnljh}x1ϋM1ϋM1lj11׉MTnω|t1׋U1׋U1ljh11lj|2n>Xxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVSuJ]} 9EEGWEU?@)ƒw)ƒT$,D$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼnUE]UU ft1]ÁE ]fffL$$Yai qyD$A(tQS[Rjj [1Ít&.&T$D$ Zbj rz $z(t RPS[ØjRj [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj [1Í&T$D$ Zbj rz $RPS[þjRj [Xt@US 谿ÕED$E D$E$ []USdD$ D$ED$$'[]USD)D$ E D$ED$$-[]US D$ E D$ED$$[]ffffffUWVS,æuEEED$D$}|$ t$D$EE$@EE ED$D$|$ D$D$E$@EEED$D$|$ D$D$E$0@6EEED$D$|$ T$UD$E$?UEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$L?؃,[^_]bw8 u>ƆUNےD$ lD$D$<r$qfffUWVSnS} 9E1}D$D$HtHE$Vt=ED$D$<$Ą;Es1U+[^_]ø"㍅D$E$kNtt@D$E$1Nu[ED$cD$<$T;EsED$|$ H%D$`d$T$UuID$ tD$D$B$BpQUWVS D$W \$E$qƉ؅u [^_]Éku01UWVSpźêU[ ut$$[ @B1NjEEE1UЋUME1EHt$$xx[ @B1Ƌ}E1NjExME1EH D$E$~u([ ]ٸ@B1E1؃p[^_]øp[^_]$'[ 8D$ D$D$H$nfffffffffffffffUWVSA&D$trD$E$谄uE0D.".&.&.&@t&tD$E$u܉[^_]D$D$E$6t 1[^_]ËEpD$D$4$E@<-u?EPR.DPtEPD$ ED$$U9MU9p9g^My+th)ƍF߃1BD$+D$4$XE@t<+ !M?!fffffU{\E?w0D.t u]Ë u@u1]U@EP>w 0D.]1]UWVS(u}܉|$D$4$upxINE uG>wl%9EظE! EED$|$4$(p([^_]Ã>w2%9EظE EppUWVS<!uYoD$ to-D$D$[ <$My)[ S.t@[ [^_]ÍU T$ t$)‰T$$뵍8D$D$[ <$fffUWVS聵fƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUT$ T$D$t$$^iEF!FUWVSu] "<-EEEE}|$EԉD$$$~$E~D$|$$TElD$D$Ẻ$lMẺE0EUR.DPщMEE1Eh$KTU$U~9E~T$$lƋUfffffffffUWVSTݞƩEu}]E E bEEE;dE܅~ 0MU tEEGz;EGEEUEUEUEUEEEE EE؋E$]G 8MЍD9E  0^EUM]L$\$ $T$]9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]D$E D$E$9} T[^_]ÍEEEE2rEE!E7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]Mȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;E!EbEdEE Eg]U]EdEEUM]$CUЍD9E ỦUM܍_׉F u ,[^_]Ë]Uv]uNՃmu$],[^_]ÉUE$] UtÅT$D$ $M]LM>D$ D$D$&$`Hn]hD$ D$D$&$+H*uf~*u1f~*_lTODlmT*lJD$ D$D$&$>hTD$ D$D$&$A>XPTD$ D$D$&$>p ThD$ D$D$&$=13=qdTCh/p@ @t`<$PG$`$Tk)؋`$TU)lT8UWVSܒ`hl΋}p} M\9dE1h!lKp{pfXlp1 9sYfPftf/u܅t0t&.&.&.&f@/f/u%9rdU+İ[^_]flpP`hD$ D$D$o&$;D$ D$D$l&$s;l`D$ D$D$m&$5;p`D$ D$D$n&$:PXllftp‹hG t\SJKt*lfx/t|%=@=t`G\h;FX\D$|$ pD$L$$lh 1h1h C ukG @tKpD$$W([|%=@E9ll/(pD$$`D뫃=u`vD$ D$D$S&$X39ġT$ T$D$pX$ 9``i>1҉l/UWVSD趃ǓÉ9E1vHf~uQ@ ~ύff/P9uݸx0f"f*ffʃft>f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 _T$ D$)L$pP$gf[!~ʉW-0$P…ZJD$D$ D$D$$T@7pf@!fH9"|$ t$D$& $2|$ D$D$ $2hT$ D$D$& $i2T$ D$D$ $92hT$ t$D$ $ 2|$ D$D$ $1rͩUWVS4|qgU9U‹)߃r)ڍHPftDΉ1ff}tYFftf[tWf{uFfuM E14[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1Gf,f[uSf]efً99S{f{vf}uͅt8Ĥf}Xׅu9f1TffuM M1B:qQf]tىC)ȉD΃tft FT$ |$D$&4$^.ɋtFUT$ |$D$4$.&hT$ |$D$4$-^&눋yuI󥉽SًfvfUWVS)xƅtyB tA xy f>{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃D$ (D$D$&$,MUQMU썃hD$ (D$D$&$M,MU1NUWVS(wu} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍D$ 4D$D$&$*U} UhUWVSnuSEtXEPtF@u=@=~Ӊƍ!=[<= J?tD$'$ɱo@D$'$螱<@sD$'$s!@@HD$'$HJ?@UWVS8bãm9U1ǃLh Lh DŽPh r捃Ld l lh D$ D$D$$Khh T$$D$\|$4$NA8t߉Lh 8#mD$\|$4$bNt8t㉃Ph D$\|$4$?Nt8t㉃Th D$\|$4$N8t߉Xh ǃ`h ǃdh D$\|$4$Mt>8t$`h D$\|$4$Mt8t$dh D$Xh D$4$)gD$\D$$AMƅ8tщ4$j uċܳtܳ >t|$$0 uቻ\h ?x{U+8[^_]Í D$\|$4$LK8t߉Lh 8#wD$\|$4$lLt8t㉃Ph D$\|$4$IL%8t߉\h 8xuxxu xXh 8sxwxLTh D$\|$4$KtQ8t$`h D$\|$4$Kt&8t$dh \h ~hh D$D$k$Yx{ElǃLh 1Z71PǃXh ǃ\h 芋HT$$9 hUVS.^ilh tJtKLh [^]ǃhh ,D$4$~lh ut$s$01UWVS]Ýhuǃhh lh t3$t$Lh $h tIu1[^_]Í,D$<$lh uˉ|$s$0Lh [^_]ÍےD$ D$D$$ FUWVS\guǃhh lh t7$@t$Ph $tMt&u1[^_]Í,D$<$lh ulj|$s$>/Lh [^_]ÍےD$ D$D$$,BUVS\fǃhh lh t$o[^]Í,D$4$Ulh u҉t$s$.1US[vflh t$zǃlh []fffffffffffffUWVSPI[&f}ƉUԉMEԅ}@ER.EEEÃ]}ԃEȍFE]|ЍL]DStER.Eԉh EȉD$qD$Ẻ$sEԉi EȉD$PD$Ẻ$RsEԉi fEpxEfEbxEfEfxEfEoxEfEtxEE`a i E؉EEEčEEE4$0T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)v,j 9u(Ƅ,j [^_]Éր>/tJ1),j ǃs$utǤƄ,j [^_]ftt鍳#fffffffUWVSA:&EE$!}LtR.DBt;R.0fkfbfgfE@ E1ɉMQD$ ED$E$|Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZENE0US8CD$ E$胙[]ffffffUWVS8ÖC}?t<$D9uzf.&9ti8/t9t`sc~/t9u)=v,n ׃rtftƄ,n Ѓ[^_]ø1)€8/t Ƹ봸#US<7BEEEEEEEED$ẺD$$tEMt<[]ø<[]ffffffUWVS a7FBt4ƅu"t$Ut,E t: [^_]$^ [^_]Í#$1E uD$D$$ ǃtD$$D$<$D$<$h<$褗[US6gAEt=tU T$؉$͖[]UVS76AutE D$D$4$D[^]Í>D$ TD$D$1`$붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[t?? [Ḯ̀rS[T?? [ḭ̀rS[4?? [̀ffff̀ffff/̀ffff^̀rS[>? [̀rS[>? [Ḥ̀rS[ä>? [<̀rS[Ä>? [̀rS[d>? [ḇ̀rS[D>? [̀rS[$>? [ḓ̀rS[>? [̀rS[=? [`̀rS[=? [R̀rS[ä=? [2̀rS[Ä=? [ḩ̀rS[d=? [P̀rS[D=? [ḷ̀rS[$=? [Ḷ̀rS[=? [ḉ̀rS[<? [̀rS[<? [Ḛ̀rS[ä<? [̀rS[Ä<? [Ḩ̀rS[d<? [1̀rS[D<? [Ḍ̀rS[$<? [òrS[<? [ìrS[;? [l̀rS[;? [t̀rS[ä;? [s̀rS[Ä;? [r̀rS[d;? [p̀rS[D;? [j̀rS[$;? [m̀rS[;? [̀rS[:? [Z̀rS[:? [ ̀rS[ä:? [!̀rS[Ä:? [S[n:? [f.&*̀r׋L$Q1fffffỲrJ!QS[:? [UWVS+/:,r 0r D$$\0r 8r +4r \}IED$ED$4$ NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$UE UπUE댉E䍋QL$ M܍ T$UD$E؉$REFEFd9¶hD$4$舛E,[^_]ËF$輇\}Ef~ FFCFFD$4$.E,[^_]ÃUML$ T$D$E؉$荾EFHUE$~E UtRπM&1D$ D$D$?$5ZE(E9Ut'$b~E UtπUEEUVSÞuD$4$V(4$F u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$蚙D$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$Q[D$D$D$4$$UVSwuD$4$ӘV(4$ЎF D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$uEUw0E[^]ËVPNTUMutt+FEU<TD$4$D$4$UWVS`E}?ew t>Et[^_]Ft$ރV tQFtB1ɉωMT:0$躃V T:($諃V D: $蜃MV ;Nr$膃F,t$wF4t -$cF8t$T4$L[^_]ÍtD$ D$D$M$d?e[^_]ÍgD$ D$D$K$&UVS4$kr D$E$y4$k[^]UVSÝ4$^kr $x4$Hk[^]UWVSy^<$kr D$$}Ɖ<$k[^_]UWVS.uED$@$fED$E $g…t?t$U$ӯUt'zu Ńtt$$謯uUEHutU$蚋EUЃ[^_]ÍےD$ D$D$<$p7UVSG, 4$ir D$E$e4$i[^]UVS  4$ir $ f4$i[^]UWVSè  <$iir D$$.fƉ<$Ji[^_]fffUWVS0qV UR.E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍD$ 4D$D$F $˵ULuԍE9s11UWVS n 詹D$-D$@J.<$mE tED$E D$<$D$$ >RE$_US 虺UT$ U T$D$E$mffffffffffffUWVS æ uEEt.\u* [^_]M %L t. [^_]E } t=Q tME  [^_]ÍD$ T D$D$$ GD$ T D$D$$ٳE TR. } } U R.DPwM QɨE E nE 0<rMЈE} #EEE} ;c‹}Ǎl EEJEu}&dW09uus E} ?U  ЋM ME U R.DPE PEE ЋM}ljE_k EE TR.DE 0M EEu } \Et } %Et } &Et } =2ME E 0<cMЈdE TR.0+E P} ;U R.DPtOEE DЍPE} -} ^u!R.M DHE 0ME\ErEEEE E E pE _E NE =E,}MEu}9tedtH9tud1ɀcFdE P ZE PMuU{R.W0EER.W E UWVS(&E܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]讲([^_]ÉxÍ7D$ H D$D$$U U ]܍6D$ H D$D$$責U ]j  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]ÐUWVSu,s n/>3)Ѝ)Ѝ:~ 9w$4s ugP U$Ѓ4s DU4$Ѕt9w$D$ D$w4$[^_]É4$Duljw$t$ dYD$D$ w4$:^E t1붋4s t9U$(7kNjU4$DY[^_]ËPǃ4s 뭋U tuGEǃ4s Ds hD$$=n,s `ǃs 11UWVSu(s o))Љ):~ 9w$0s ug` U$Ѓ0s TU4$Ѕt9w$D$ D$w4$[^_]É4$Tuljw$t$ dYD$D$ w4$T\E t1붋0s t9U$(QiNjU4$TY[^_]Ë`ǃ0s 뭋U tuGEǃ0s Ts hD$$l(s _ǃs 11UWVSu4$Dž$s ED1.t&.&P9u/>3)Ѝ)E:WɉM~4T$U4$nUuMG$U 1[^_]Ë4s u$PU$Ѓ4s UD$ t$$Ǻ4$H@G$됋4s u$PU$Ѓ4s UU$((gNjUthP뀃4s ts u/D$$=jE$s ǃs ǃ4s 4$HtՋ@UWVS$ u4$Dž s EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$}UuMG$U 1[^_]Ë0s u$`U$Ѓ0s UD$ t$$ָ4$X@G$됋0s u$`U$Ѓ0s UU$(7eNjUthP뀃0s ts u/D$$hE s ǃs ǃ0s 4$XtՋ@UWVS3UELtЋ,s t'Ǎt$l9uǃ,s ǃs $s t'Ǎt$}l9uǃ$s ǃs ǃ4s EPE LEHED1[^_]øUWVSH-UE\tЋ(s t'Ǎt$k9uǃ(s ǃs s t'Ǎt$k9uǃ s ǃs ǃ0s E`E \EXET1[^_]øffffffffffffffUWVS:#pUE  DžXEK/tBD$E $p-E $Ŗuv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $p:!%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pJDž`D$`p脔D=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p_?t9E DtX$phg1Ĩ[^_]tN~uPf/tpڢ?pĢx貢zUWVS}E ttrD$<$(xX[^_]Et$<$}@bDžMtAt$$h(ymt *8"tƉ<$Xe1[^_]1fffffffffffffffUWVSA&}<$Ls $\Hs ǃDs 7tyR.E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]ËHs t$+dǃHs ǃLs ΍yU͠ UWVS"u} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]ÍD$ D$D$@ $o[=D$ D$D$@ $@UUd]UWVSu} to.&.&8u$ u|:9s :t|tu[^_]ÍےD$ D$D$@ $db=D$ D$D$@ $3-1UWVSp ƉE 9E1=m}! Mu0Hs t |$$U$X UD$ D$D$E$|DžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$|\ lj99D$D$E$A^Ѐ txE<#=D$ $,#dDžUD$=D$$yS<:uA)ljED$L$E$:=w!C:SDžDGD$ |$D$$HD$D$ D$D$@$kD$D$@$?qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$k6L$t$<$U6 $[OދDžމ:DžD))))T$<$Xo<ljljÉtE$>)ȍP9rH8E+p[^_]ÉEDžD$$W됋Ls $Q!Hs D$<$*|70dƋYq0$Y\0DžƋ|$bYDž>*D$ D$D$@ $Z6D$ D$D$ @ $cےD$ D$D$ @ $ޏ.D$ D$D$@ $譏tp@a$XDžmE$C;;E$-;n땉Ƌ$W>$ŃD$ \$|$4$V Pu Dž$@H $NDž L$T$$14$V18Dž4$VDž鋝ےD$ D$D$@ $藍0<$3V0$VtE$<9貒 M4$V薒 1ϋ$Uu%$U됋E$8UVSxEM ut.t^UD$t$$F[^]Í=T$ T$D$@ $?M EuM E6T$ T$D$@ $M ElM EےT$ T$D$@ $NjM E1US~@s t$^ǃ@s ǃ8s ǃDs ǃ}<:tkOML<^uF<:mu‹M])ىύAdD$$]JljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]IEEM$[^_]Ë]뽸 y]䍃ġD$ tD$D$@ $Í=D$ tD$D$@ $调]䍃D$ tD$D$@ ${z1*E$]L<$]K]諈 UWVSEu} uE0D$=|$4$Dž$d]Cƅ<:d <:tCZtsu)Cd]D$4$]GUn‰ƹd<:uЉƍX)Ӎst4\$$U]GU@Љ)ӍsűE[^_]Ë]썃D$ hD$D$#@ $́E]썃ġD$ hD$D$$@ $蔁Í=D$ hD$D$"@ $cZ]썃MD$ hD$D$`@ $1)D$4$]Ft-M14$]I։4$]I]K UWVSÈ}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/` DžDž)S$K9>:hf  81Ƀ4uA )čD$pxr󥋵t$D$$'D$nD$$%|$t$$x%D$wD$$Z%ےD$ 8D$D$E ${udurP1)11)rBvBDžqfzU <(9D$E D$E$]UWVSt}U 9E1EtqMyu )čD$UPtMP}y:u}<(9T$D$<$%U+ue[^_]ø"fUSD$$Jpw D$ '$Ilw []UWVSHv}}ԋE E؋uu9EЉƋE,0D$l$-.pw }M؉MufuUT$U܉T$ D$ UT$$Luu vU܋9El} u lw tUԉ%9pw t1MЋE+H[^_]Á} u lw uD$D$ $4XƅtDEĉ4$"]AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UAnDžuED$UȃT$Ẻ$蟋;Es4$O[f % ЉD$D$ v6D$ED$Ẻ$*x ;Es1"B9EBf9EzJ Uȍ~|$D$ $MnKNMMčD19C9}rỦ׉΃s$tft1V4$rZDUuuB r EfUSD$ls \$ ED$EU $T$u؃[]1[]UVS_-t$LFL$\=$|$(4t$4D$h$?2D$9L$\$D$LD$,1|$(D$$D$ |$\L$8t$dX-t1+t,D$hD$L$0$qXL$0"D$\D$LD$\xOFF2D$49;|$\yȃ9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -UWVSL1}D$<$2ED$ ED$E D$<$D$<$2[^_]UWVSѫ}D$<$-2ED$ E D$Q.D$<$D$<$$2[^_]ffffUWVS 聠fU J}8D$$U 1U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$SU  0Muωƃ}EEu2J0B0upH MHBD$$0E [^_]ÉU U fb ߋrEt9spE9-JUT$ U T$UT$V$Љƅu E[^]S0E[^]Í8!D$ \D$D$8l!$M@U 辘Q.D$E D$E$2]UVS萘uE$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]R0E[^]Í!D$ DD$D$pl!$M@$U΢Q.D$ ED$E D$E$$]UVS谗ÕE$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í!D$ ,D$D$yl!$2L@(UQ.D$ ED$E D$E$$]UVSЖõE$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í"D$ D$D$l!$RK@4U%Q.D$ ED$E D$E$$]UWVS(ԠuEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}O0E([^_]Ë$ 1ҍ}uU썃"D$ D$D$l!$I@HU]EU썋d"L$ L$D$Jl! $IEIUӐT$ T$D$}<"$LIEXސD$ D$D$[<"$IUUӞQ.D$ED$ED$ ED$E D$E$]UVS觓ÌE$ tKtE@8t>UT$ U T$UT$V$Љƅu E[^]M0E[^]Í"D$ D$D$l!$0H@8U Q.D$E D$E$2]UWVSԒùKD$-D$@J.<$Et8ED$ED$<$w|$ D$D$$5E $D$txD$$pE$US*D$ ED$E D$E$[]fffffffUWVS0Ɯ}u t$E$6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw"Nwq\E@VR.PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$tU@}ظ^DE@uS4$uV tQFvIE %Fv7 ,-}ԉ}؉xE7R.DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$ rF<gE\}؉xE^E?!} }fGH]&G @E}G(UċrDuG$]EЅEċ@hUZG(UċZDuu떅uEċ@뽅?~t&UWVS$/kv} EdD$,$kƅEF$~(EEt=}1҉Eu׉ $9sǃuEuw1ɍ!E‰EM@DEwE1}EBUE$UUQ…U@DEBBTBN(U?fUufBHEuBMEPUEo}}Ut E1ɋUt9xf@H F(EuNE$A}# $uE$F$4$1$[^_]Ã}uω$9sǃuu0UU~8#릋}|\1ɋUYxf@H F(hD$D$@1)$qFN(ՀD$ tD$D$`$ՀD$ dD$D$`$1ɋU@f@H F(ZE4UWVSgir}tH@JHDy$VDxpup$VDy4$wtv$uGt$G$G(t&<$1[^_]Ë@$$dG$ ƃtCG$뻍͟D$ (D$D$ `$Ev EG$k<$Eb UUUWVS*fq}57KW(?FLfFL;NHtlfv$NDFLf;7tȍD$ D$D$`$Affu@F83G N<3O FJ"Gt uƉv$uuGfFHPp$~DWF(VD{G(G$O(1[^_]ËGt+tEW(uƉv$auuGGIG)t룃8N?wGGENQ(BI|/u‹E/N,QT$VTT$$7[^_]Ã͟D$ D$D$U`$1ɉfFHG(uG$F,F(NTD$ML$G$wD$/M $at;9EP$U) @MD$UT$E$+MN,GFFF8V}F)uGHf fű~t$u} EHDu@8/tF(tF[^_]ÉUD$D$@1)$莿ǃUttF<$b<$ugFF)E@[^_]ÁN(f͟D$ D$D$1`$F߿UWVS^àiutp7u4E4$u(4$NE$臿[^_]ËF$$뿋F$$F$$F$$ 뵍D$ D$D$BL#$+aUS ^hQ.D$ D$D$E D$E$l$]]US ]áhED$ D$D$E D$E$l$]]UWVS8|]ahƉ׉t,MO=U= =T$E؉D$E܉D$ L$|$4$=ƒu܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1"كL8[^_]1UN\7gQ.U E]UMU E]fffff̀rS[f? [̀rS[f? [ ̀rS[ôf? [UWVS[Öfu} u !t9u[^_]1[^_]͟D$ D$D$*p#$kUWVSD[)fu} ttB|$4$[^_]ÍD$ D$D$B#$ uD$ D$D$C#$UWVSZÙeu} ttB|$4$[^_]ÍD$ D$D$B#$yuD$ D$D$C#$KUWVS@1Zet$(D$T$L$,D$,t "|$GD$8UT$$\$(9uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(芫D$$T$ D$0T$4D$T$ $D$1D$L$8D$9\$(["D$8D$E܍ 0MU‰T$UE$]U})ljEuUD$ D$D$E $]MAQt$|$E $@t~")Ɓwf]O 8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$]…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]D$ D$D$E $m$뫉EX@$]MA }E@@eBE $]RD$@E$_E |EMH ] ωu]z7D$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]uDG uNjUtG~uU܉$]}닋]썃MD$ D$D$#$.$]q‹EE1]vUWVSMôX}G $wt6$uuG[^_]UWVSMlXu} t"tL D$ $N[^_]ÍD$ D$D$:#$BuD$ D$D$;#$UVS8LWut&== = ED$E܉D$E؉D$ T$E D$E$]=t3w Ef>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[ÔV? [ffffffffUE]UWVS$xK]VE։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]Í=D$ 4D$D$r$$EPD$ 4D$D$s$$!UWVSXfJOUEu Ud E' } E EE̋EƉE$]肿Eȅ E? Ef UȍBEԋEЉE؃)֋]ދuމuED$E$M!EȍDU؉UT$}}|$}<$U1Ʌ9uWuuEȉEMEEĉ}NjE4u܋E9MuЉEËE9s#ED$;D$$UU9tΉMuЃ\97]ˉ}}܉+uED$|$4$UM9t#+EU‹ErUENjE9r}܉ً}}M܋E9ED$u܉t$)$UbE‹E+EuEuE9EԋM9KEEEUčB}9EU}؉EC‹u)}U92؋u)uEԋ}9}EЉEM]}9}ED$}|$]$U}]UEE܅U؉!ED$|$$UU9~S}E9rՉ߉ËE9M̅fU؋E.& 9r}G9T)E؍LEDEEUv9uM؉E}9}M]U9UU̅U؋E}f.&029r}Gu9!F)u؍DE؋EԉEUEE9'EUċ} :9t?Eȋ}ĉ}ȉEED$E$ME>Eԋu؉0EȉEċEEȋE9E^Eĉ$]c1X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$];}~]D$ LD$D$y$$ ÍD$ LD$D$x$$k]D$ DD$D$&$$]D$ DD$D$'$$wh]U4?JUT$D$ ED$E D$E$]fffffffffffUWVS >IEuVtG~^ЉUv.&.&tP1H1 uN9H u [^_]ËUU$]t"N^HXNH UF [^_]ÃUWVS=>"Iu7uu[^_]*F$$Ȥ4$NjF$$賤[^_]UWVS=H}E wu v.t&6tk9uFVO9N uO1MO1 MtGD$ D$T$$|GWG1D$<$KtG9F [^_]ÍT$ \T$D$i@$$3E GffUWVS=Gu8F}9FiF FD$ D$D$$FVFD$F D$$FtotfxWFvthV uAzN)91F Ju M ]z u F MЃ[^_]1}81F u1UWVS;F}7t2G$$蒢D$<$ƋG$$u[^_]D$<$Ɖ[^_]UWVS ;lFE70E@$$D$E$,ƅ@ ‹} 6@E@$$蝡ptiEM 1D$E$ƅt[P } uWuYu}8닋E@$$t= [^_]äDf9ft8}8E1E xIE xfff̀rS[tD? [ḃ̀rS[TD? [UWVS$Q96DutqEEE E8D$D$ED$ t$D$E$_ƃt 1$[^_]u8 uk81ፃےD$ pD$D$<`$$`ffffffffffUWVS0}8fCE̋]} 9E1u9 &t8u)؋U+0[^_]ÍM1D rE̍.&TЃutS؉].t&.&.&t\="t]W$]nI1B]dfffffffffffffUWVSA7&B}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU 7D$ D$D$=$$U 끍6D$ D$D$<$$U KfffUWVSa6FAM} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$Ɖ[^_]ÉUM7D$ D$D$A$$UMP6D$ D$D$@$$UMUSU5:@Ey \(9~)ML$„R.D$E $1[]ÉD$ ͑D$ED$E $1[]UVS4?Ey \(;}.D$@„R.D$w 4$U[^]ÉD$ ͑D$D$@w 4$K[^]UWVS`4E?u} taEtHR.EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍD$ D$D$?%$uD$ D$D$@%$FfffffffK̀rS[T>? [UVSU3:>ulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS2ú=]l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp4819u[^_]Ë]싃tpu޸UVS1à<L4$aulU4$D[^]ËE4$-[^]UWVS ^1C<} lE[LE$lttp)ЉȉB}H}wQǃǃǃGlhEG1E$qE [^_]1뜍Gƃ}?v8}}E?EG EElE艃hE=p)ЋM@G@EE띍ޑD$ D$D$Y@%$vE$fEEE3UWVS n/S:lEEẺEыE)ȉE䍃LE$ٕlUp)ȉAEplt)̋Ep1thE$>E [^_]1끍ޑD$ D$D$@%$bUWVS8.9L<$ޔƉ<$ϔ[^_]US -8ED$E D$E$t []US-ó8E$[]ffffUWVS-Æ8}tHD$<$ƅt&tt$<$[^_]1[^_]ÍےD$ D$D$Ax%$9UWVS-7uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]*"썃ےD$ D$D$Vx%$kNfffUE U9r 9]ø]UU E9r 9]ø]UWVS+6w w uw <(9E1ɍt-ωD$4$>t w PEu׉MD$D$4$ MtMljMuD$|$E$ w 8Ftt$E$ 4$uMEw 9t$$Ȩǃw ǃw [^_]Éw TD$D$$苳[^_]UWVS*É5u} t%/D$4$tt=t1[^_]À=t[^_]UWVSJ*/5ut4t$<$ƅtD$<$ 4$ާ[^_]ÍD$ D$D$%$UWVS)ô4}G$)ƅtx @D$$~[^_]UVS)g4ut/t$$tU 9P [^]1[^]ÍD$ D$D$%$3UWVS )3U<(9E8s7i1}ƉUE D$ED$<$u E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVSQ6(ƍUI*ET]UWVSh9E1D$<$}AEtFyL$$L$T9~L$ T$D$<$U+u h[^_]>f+̀ffffj̀rS[$? [ÒrS[? [UWVS}u t$<$u 1[^_]D$FD$<$ tۍFD$<$YtȍF D$<$Ft$D$D$D$ FD$t$<${z D$ D$D$G%$:6ŸD$ D$D$H%$ffffffUWVSö]}E 0|$E$Ctp?9}raeto1Ɖ\$E$U]9suM9u+EE $] E E E8t 1[^_]ÅuUuCtD$$]wƋE 0i]D$D$랃t.t&:똸vLE8qw .UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVS9u 9E1V F\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …x^D$dD$ TD$XL$E$6 …x'hD$t$E$‹\f8tVE+oЁĸ[^_].֍F\DžTDžX\IP\p9{\hD$t$E$x\NP\6DžhhD$pt$E$Fx'q\D$ hD$D$4$d\D$`D$ TD$XD$E$ \88Jffh̀rS[d? [UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS  u}F9r+)F|$E D$F $a~  [^_]1 [^_]UWVS Ýu}F9r+)F|$F D$E $a~  [^_]1 [^_]USs LEU ]t,HPP UP[]ÍlfUWVS! }u tgt$<$kt6tu*t$<$L[^_]ÍFD$<$诬u 1[^_]Ãt$<$蒬[^_]ÍVD$ hD$D$&$菽j D$ hD$D$&$`7UWVS6}u tnt>t$<$脲u[^_]D$ FD$t$<$腴[^_]ÍD$ D$D$X&$Ѽ떍 D$ D$D$W&$襼cUWVS{`}u t$<$u 1[^_]ÍF D$<$褱tF t6u$FD$<$tăt$<$뵸[^_]ËFE }F[^_] D$ |D$D$w&$ͻOɀD$ |D$D$x&$蛻 UWVSqVu} t tJD$|$4$葱[^_]Í D$ D$D$g&$.uaD$ D$D$h&$UWVSþ}u tet$<$蝩u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$U뵍 D$ XD$D$&$QqnD$ XD$D$&$BUWVS}u FFt 1[^_]Ét$<$藨tFD$<$ tӍFD$<$qtF D$<$^tt$<$K랍 D$ HD$D$&$NVD$ HD$D$&$'UWVS}u -t8GunG toFF[^_]Í{L$ M썃8D$D$%&$U艸GUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ ,L$D$$E GFG F[^_]ÍD$ 8D$D$$&$螷G EL$ L$D$ $uE   FFfffìrS[ ? [v̀rS[ ? [VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS1 uM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1э5D$ D$D$:,&$pM E9M D$ D$D$;,&$5M fffUWVS( ƉЉ9U1҅OD$ |$D$$ċ<$脩@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ D$D$ $)g4t9um΃tft%D012 (T$ 0T$D$P&$]v2T$ 0T$D$P&$"-D$ D$D$ $fuoN }L$$ te$>ff^N mF.t&*UWVSþƉE 9E1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$Ї4$营9E{ED$t$$+1F5EDž*FfEMfD$ D$D$<$6c<$ؤ9EED$|$$sF<<p EED$D$D$D$ T$PD$$v~0wDžFȉсI<<9fE^<|$ L$D$$U8<$]9Er8ED$|$$$mj$m~3LED$E$NDF <Džytt Eut2ED$ D$D$$st1ED$E$1C%UWVS<uU EEMEE܋EE؋E E9E8}1w~wF}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ D$L$M܋E$^M܅x9lEE܅t E؅aFfVT$D$ RD$L$M܋E$^DžMn9fFfF fV ffuu҉T$D$ D$ȉM)D$4$-^Mx 9EtEc҉Uԋ}^UT1!E܍E؍xE̋E܉M܉u ET8ẺT$D$ E؉D$t$ $M]9M)ƃ9}u1hȃiviD$t$E$製1?FD$ EEEDEԋ}1!E܍E؍xEЋE܉M܉u E8EЉT$D$ E؉D$t$ $M\M9)ƃu1yMFD$ D$D$}<$D\<$M9L$|$E܉$腼MFUU܉D$ D$ȉM)D$$[M9\D$T$ RD$L$M܋E$[M UWVS@G,lj΋E9EG uY$fto|$$gt9wuҋtD$G $謞u1ffh$}@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$t$ |$D$$gu8u Dž11fBUVS ut$F $eE $MUYF t [^]ÉE4$cE [^]ø̀rS[d? [UWVSaF}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$>qn8[^_]1[^_]UWVSÛut7D$4$FftID$4$[^_]Í&1D$ |D$D$@t&$_띿ffffffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUSuPtSt /[]PtfHuX uHuxuπt[]Pt#u[]@ tOEYD$ ED$4$05uEt8u x[^]ø[^]͟D$ LD$D$&$eqUWVS(C tƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJ f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.^<븍3UWVS0Ɖׅt5tet&u 1[^_]É $GuMT$ $T$D$&$םMuMT$ $T$D$&$裝MkMġT$ $T$D$&$kM6UWVST; ։9E1|DžDž&F F`FD$$D$ D$D$D$F D$FD$ D$D$<$lu G @u}D$D$ L$D$<$_O @,1ƒ $VD$D$ D$L$<$~QG KD$D$D$D$D$ T$L$<$負E+ȁT[^_]ËQu7Iffft#fFPЃ6tRrےD$ D$D$ &${Uߟ+t't܃t&u貟襟蘟UWVS(ƉЉ}9U1҅t\D$t$ D$D$4$L=1U+([^_]É4$PPwstP|.ut$T$ bD$D$4$eL댉ےT$ T$D$ &$fOUWVS4Ǟ}ĉÉ9EЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ]OUWVSƉ׉MEOD$A M$H[…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftugD$ DD$D$&$=0D$ DD$D$&$f mUWVS&â@DϋE$E,9ƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} u-=(Dpf@fPff[PD 8Hx LD$ |$ T$L$$蚖…P @@ u+!<$菖f$R莏t,$ډL<$軌 LwdmPu .8tX<9 u拽4t t҉tH9Y PP1 UWVSpùƉ9NjE1>$ I$H`11D r틅FFtGGFUCF薍胍1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$蟌8=.t&脌G au$1ҋybK;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$oN$aNU+cp[^_]Ã){$M$M1녃1(@<tcE D$ D$D$$u|d@=1$1ҋ_/@ P$1ҋ|f8ےD$ D$D$ &$較$1ҋR@uu*$HDPDE诈E$K茈1gUWVShEdpPt%=~h讈Dž1E1 Dr]`1 DrV]pdMEE`]MEE$E]1 DrFdd<$hdU[^_]É<$hŇh.[^_]ÉЉ`6`fXh\G]1}`X D r틅hHOT`@pPDXLHHX9HHD$ PD$D$L$h)dL$P T$ D$DD$l$:xq]1EDr틅lEEE!$\Xl$hNH9TX\d\$h萅EE؉E؉d<$hIdS|dMEEdMEE‹`MH@A‹@u@<$h軄UWVS`Z?ljUMMME EEE9E‹E1EE$Uu\WtUL&t89uML$MML$$OMt u܋E01}U+`[^_]ËG;t?OƅE$1ɋU "D@u듍ML$ME$1rD$E$T4M<MMG;tƅE$1ɋUv.t&@uD$ 4D$D$&4$|EED$ XD$D$4$T|%uܸEvWt$D<$DuEaME뺋M#U—Ew ]Í ]UWVSjut(vGt$1D<$)Du[^_]ÍD$ D$D$r&$={UWVSEdE tEpMh9lNjE1x1󫍵1҉D r퍍T11D r틽dpPu x x$9Dž hlE+[^_]ÍeD$ tD$D$&$y t]DžDžDžDž|wHt;u Džx$tT+ l`XtGt`u\W9tCu+w9 t  | t1҃1҉ TL9G9}Gw9 uuttdx$tTLf.&9u`q@D$%d$e@gd$…^ d)xD$L$4$tPTP `pLH@D.t&.&vZ~u~ x G<_x$tTLt&.&9uiJTƅyx$1ɋtH`phG <t`V9&ut뎋x$+-Ls8vDž:@D$S6`ptu t Džx$y,vGt$5<$5ux$%,Dž|.Ix҉$+Dž>$058J9D$ D$D$u&$=l>x$z+Džx$]+DžX`A{$0"DžDžt?G t,Gt&H?wB11  ?uNj<$7D$ hD$D$c&$kG H닋Dž(D$}3Dž{vGt$N3<$F3u DžDžvXx.fǃ 4$1ɋt.GtuŋG@fuXHS$L*D$D$D$ L$D$ $6ȉQH9rs$P) xrHH9s $1GDžPytp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$Xx$1ɋD$D$ $y|$L$$ ~D$|$$FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $7ctpDD$ D$t$<$~')ʍ0&J9uB<$}.Xt;1AtF0 $Q.Ft4$2.X@FXVDž|1dH1׉D$ D$D$$蔢T$D$Ii $IwjNxa 7 $P-x$#5x$#DžFB0$,t2Buቅ߉UWVSpԮMEׅ M11D rEMEl EED$ E$]-HMt$E$]OoX@t\}}< < ߉ډt$$]t!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍRD$ D$D$h &$a]D$ D$D$i &$taUWVSpJ/uE$諐>FEu11D rE@tmEEEE<$UML$ML$D$ |$lD$E$觐twEЅUp[^_]øp[^_]É<$|UMML$UUT$D$ |$_D$E$@t2E$)RUEetFE$(gMEԋAE܋A EAEAEAEAEEUԋEtEЉƋ@u{Ve!UWVS\ 諪Ð9NjE1al D$ D$ D$ $3ƅ?8#D$4$D$4$x1҉< tv< tr׉ʋD$$ƅtbHT$$NGFt < t< uσxzT$$uЋAAA AAAADžD$ D$D$4$fU׉&.&t틍tڋ$,D$$}k1ҋE+Ё\ [^_]ËډD$ D$D$ &$\ےD$ D$D$ &$S\\UWVS4EȋE8Hu11D rM̋]ȍ,D$$nEЉuЋM̉t(Ct&.&Ë@uM̉u؋EЅt $].EUt 4[^_]ø4[^_]UVSQ6uD$F $tP PH p[^]UWVSDljE9EG ut$gt$$ctӋD$$lQtD$F $KQue$1O@=wI$ O‰@=wЋЉ=@1U+D[^_]Ë~D$<$Ptu狵1DžЍtftȍtftD$D$ GD$D$@$+9qt89FD$D$A$z<FL19\9PB 9=0t9$9uۉD$D$ $wuD$ D$D$$I(u9u Xu3fvfvB[UWVS}utHt$F $=E $UF t[^_]ÉE4$E[^_]ÍےD$ D$D$8($VfffffUVSÉ13v.&.&.&.&.&.&   lLLLL9r[^]UWVSTNjEGEGEG EM],t&.&.&.&.&.&Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVS4ut0FF#EgFFܺF vT2[^]ÍWD$ DD$D$`($NUWVS轙âEBU oP?ωMM1ÉPHUʉP@)|89]riڋu uwuoxEE);UEމ}E} ]7E@9r})uu Eu sItft[^_]äftX] E]DEvWT$ 8T$D$`($WMEU E4T$ 8T$D$`($ME\f7u S,f$UWVS$螗ÃEE} 9E1WEEG?78)‰T$lD$<$cD$ED$<$LEyX1tftE+$[^_]úx)rdD$ ,D$D$`($KWD$ ,D$D$`($qKWZfPdUWVS$. }ЋME E9EƋE1R.ljEDGtXEE؉ƀ0xC1E 1҉uËutFt9}t`}׍Ty1ME+$[^_]Ã}u1ft* ta) 봻A8w믋u܀.u{E9twVË}DGt03Y؃PuuE @4E [^_]Ã댉U }OD$G$\DžUtEuUE@ u*x(9P,ӃDtftEp(ff} GуcF9TNO F|?L)09"A)‰UtEPE PM1EE/E P FD ]t)É]x9EEPB9uҋEPU@E]BED$UT$E܉$ΒMyBuTUEPE Pa@ ]PBD$D$ E${)B]B0E$E@$7E@@@0$E@0@($E@(@,A01$[^_]ÉT$<$]DžqEx(UP,ӃuCu*E $[^_]ËEP fZUVSdu F tcu.tR4$tEED$4$tE[^]èu?V$ED$ ED$T$F$q t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$a[^]fUWVSp譅EċUOD$D$}Љ|$ D$D$]č4$EЉ$rD$D$|$ D$ED$4$U1}9U1EEމU]̀{u9S4u'ft"Uf9rŰR UMщM9rƋUE]؃{UEU$]EUuUE0U]Ӊ]t$D$Ɖ$] űUfEU{u4C<<u$Eftf9CC %E9rU$]u̍F}9FE81p[^_]ËUBtnr uv ]ȍUȋU]TUMщM9bCu=fE9T1MщM9*vC fEȍM114D rCEEMύEtfEt}DE}}E<vtft}d}Ds!E󥍀EEEEE9MEE$]\E$]C]̃ ]1ɉE]txà uыE]E1ɉEfuuà tu؃ыűEFEFFCFC E1ɋ}ƉtRƃ uE1ɋEt\Etwupű}~utftEEEu u}̍G E9Yt#tfE뽸ű}~ utftűN yu }̋uwEEű}~utftEEuȋEuMщM9Eƃ E̋up1MrEtfEt}}EXÍbD$ D$D$]($:4]EErEu<u"M%$]&fmHMUVS~{ut4$N[^]Í%1D$ D$D$/($g34$[^]fUS3~ED$E $[]UWVS,~}} 'v?NBCDt}81,[^_]ÁB u$<2ƋEEFOM؉NGE܉F G EF$G$xF(F,}EE=V-~U V O(N1utE)NE܃UȉF99U9} 9U܅TEE = =w=wUUE=?B 11 +EUEUEUD$T$ $ED$F4OF:ON;J64$0}vPEF(V,}{EF-~E F O(NEEE뮋EAE܃= =w=wU܉UE=? @11 +EUE܉UEUD$T$ $E܉D$tF0F8GF9UF0F81F4F:1tx11 +EUE܉UEUD$T$ $E܉D$F0dx11 +EUEUEUD$T$ $ED$F4[F81F:1UWVSyöD$E$ƍxD$4$ }и9ED$D$t$D$ D$|$$t4$IttKD$vD$ E D$|$$ƅt/Ĝ[^_]É4$z31Ĝ[^_]É|$t$Ÿ뽉4$1UE@ ]UWVSxEEU ;P snH,X<3t;t-?39r09Pr+HE)E1[^_]?SӋ?̋]2Ӌ]2UWVS$wuF$ED$ F(D$ED$E $X}f4N:^;)ЉMMЉ]MF$)lj}]f4)MMF$)É]Ef4E)MMF$U)‰UF-NσthtT?<߉f0ED$ ED$)N8N9^ )߉|$4$D$[^_]Yf.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴,1EE<2w]EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVSemJxljE 9E`M!t8\$tD$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,hhDžD$ D$D$$]j uit_atP%xrt& r; ut$D$$u f})\D$|$D$ D$D$$ g:t$$%t$$ H%88%$ED$D$$t$E+Č[^_]}v.& p;8u}v%hl.t& P;8udt$T$ D$ȔD$$U$8<$\=!\$YuD$ D$D$x$|$D$ D$D$ $uz|$D$ D$D$ 4$Iz|$D$ D$D$  $z|$D$ D$D$ <$y1) D$D$ D$D$4$y}艽EЉT$UT$ D$(D$$0R.9D$D$$\)U frffXftD$D$$1D7D$D$$9|҉ƋD$ D$D$;>$1D8 DAu.L$$*9|ȋD$ D$D$$aD$$ 5 D$ D$D$ $0fuAD$ D$D$$lD$ D$D$ $1D7D$D$$9|҉ƋD$ D$D$;>$91R.D8DBu.L$$<9|$AD$D$$UWVSdôoEĉED$ED$E $a>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,1`ẺEEfEEEfEEEfEEEfEEE`t3 u'^"lUo&Ut& x;uED$|$ `K.D$()D$E$?E`t eED$$;E`AED$ D$D$C$~D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^;D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,7^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,g]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\aD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,/\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[=E`ek‹wt& puED$ t$lD$E$:k‹w p8uED$ t$ut$E$jWc& PJ8uED$ T$t$E$jWuf Wz?uED$ T$t$E$aE`t tED$$ ED$$1ɋuEzED$$ E]ED$$@E@ED$$E#Ef Ef Ef EĈ[^_]Í T$D$ D$D$<$=n D$D$ D$D$$UnU D$D$ D$D$4$m D$D$ D$D$$UmUP D$D$ D$D$4$]m<$D$.D$E$nĈ[^_]ËED$ D$D$h$ED$ D$D$d$ED$ D$D$`$uED$ D$D$\$^ED$ D$D$X$4QED$ D$D$T$ ED$ D$D$P$-ED$ D$D$L$ED$$ jIUWVS$ZàeuE }9U1D$L$ t$U‰T$$}xVD$t# $U+u#$[^_]$.19UED$ D$E D$E$]UWVSYõd}ED$|$ ED$ED$E $x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$LY1dE9E1D$|$ D$E D$E$&…tD$<$HE+u Ё$[^_]UWVSXÞc}u Gu 4 Gt*D$4$uUt E[^_]ËEtE[^_]UWVSHX-cuSd~M u7&.& ~t9uUt E[^_]Í L$D$ D$D$<$hEtËE[^_]UWVSWÈbu} cVu5f.& Vt!9>uMt Ev[^_]Í|$D$ D$D$4$hEtËE[^_]UVSWau c%hlt& Bt ;2u[^]Ét$D$ D$D$ $gv ~[^]Ét$D$ D$D$ 4$Ng[^]UWVSFV+aU} tfUBb~U f ~t;u[^_]Í T$D$ D$D$<$f[^_]ÍlUVSUá`ua&.& Bt ;2u[^]Ét$D$ D$D$ $?fv [^]Ét$D$ D$D$ 4$e[^]UWVST_}auwX w t&  @Bw- wi ue@w, u85\u(ϕLu<u,1|$D$ D$(D$4$d[^_]Í捳ȕލ֍΍ƍ뾍붍A뮍릍֕랍떍뎍UVS:S^uE_D$(YD$4$_x#_Y[^]_t$ T$D$(Y$UWVSRë]}^&v.& rt;:u[^_]Í |$D$ D$D$4$Lc[^_]UWVSLCR(]9E1E <tmD$&D$ D$.D$M‰ $MbMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$M~UWVS4xQ]\EEEE$GE܍U}}؉HEU;EEU t 14[^_]ÃuuU<-1E<+u JMBR.DK+r1&.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF RGEuuESt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVSaM>XEU UHMHMHMXˁHɁ@ ='-E썇!E)ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)MEC$yEE-$yEE$yEÅU܋MXE^}d\$DD$@ED$<]\$8T$4]\$0]\$,]ĉ\$(t$$L$ ut$ut$uԉt$uЉt$ủt$ uȉt$X)D$u4${%E$Et $Et $EČ[^_]ú)‰U썇iEESEW- uVE; er@ror:@ unk@ nown@ LOC@ RR @vers@ionEČ[^_]ÍsEs}\$DD$@sD$*t<.tȅx%[^_]Åt<.1[^_]ÉM-T$ H!T$D$)$E[^_]UWVS0HSTE荰EEEE$WPlPHH8|$ x|$x|$@ D$L$T$ DD$D$4$觰~ Eƀ0[^_]UWVS9HSu Gt-D$4$u?E tE [^_]Ë?D$D$4$aukVR.DPtM@D$ ED$4$讍ҋMyE8m1Ɂ]1VUWVSIG.Rul%h Gt-D$4$ u?E tE [^_]Ë?D$D$4$qukVR.DPtMPD$ ED$4$辌)ҋMyE8m1Ɂ]1VUWVSYF>Qu D$4$FFy ;F|/} t)P}D$4$[^_]Ét$E$sUSEPEM QQy ;Q|< tZ[]ÉL$$%[]UWVSEuPEu E$jEEEEED$4$F0u ǀED$4$D$4$[^_]UWVSEOPPƠ%9uV@ttuF*V@uuOFuuFuFf~@t8D$4$Tlj4$kP[^_]ÉFu뺋F몉4$QfF@UVSGD,OƠ%9Fu t$@J.XD$ D$ED$4$'[^]UVSCNƠ%9Fu tE D$ D$ED$4$[^]UVSCÊNƠ%9Fu ztED$ E D$ED$4$[^]UVS,XC=NƠ%9Fu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$D,[^]ÉED$4${EUVSBîMƠ%9Fu t2ED$ED$ED$ E D$ED$4$37[^]ÉED$4$EUWB@M%9U]U9B"M%9U]USBMED$%9$?[]UVSALƠ%9Fu t$ED$ED$ E D$ED$4$[^]USAL%9$mO[]UVSsAXLƠ%9Fu Ht2ED$ED$ED$ E D$ED$4$=[^]ÉED$4$EUVS AKƠ%9Fu t9ED$ED$ED$ED$ E D$ED$4$9 [^]ÉED$4$8EUS@lKED$ED$ E D$ED$%9$D[]UVSD@)KƠ%9Fu t4$lM[^]D$$US?JD$ , D$ED$%9$9[]fffffffffffffffffffffffUWVS ?fJE8tj׉ƅt|$4$Ot@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS>I}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$ET$ D$D$*$ L.EE룤u9sftuu_SfӋ]KUWVS0=HE׉΋UU܋U؋U$իEM9L9MyE荃EEuuE9D$E$t4$ME*t4$MuuE$EtE؉Eu܉00[^_]ËuE$Etu)y9uΉE*T$ %T$D$*$E0[^_]1UWVS$N<3G]Uϋu M MUL$T$ L$U‰T$$"EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂D$ D$D$*$ L.Eډ)؋ux$[^_]ÿ뛉댋]썃D$ %D$D$*$뷋]/EE}8UWVS(u:ZE]}u ӍR9M)ÃM L.E썁EЉU u2D$ED$ D$D$E*$EJBs1([^_]É4$Et+([^_]ËUU]UE([^_]UWVS+Y9>DE}E(M,u M0p9tU1҉u$t|$$I:ƀ?YE4$k DžU4T$|$E$-Eƅ9s9D$D$ D$D$*$ L.7)U4E$NjE$|$D$ 5D$ D$dD$$HNj $‹>|$ $}wyEt}wvM!򋽤(t#t<.z<7|0.}u$ݜU$!D$T$t$םD$ D$dD$4$nG‹$i9=xR.|f @)~ DžƋD$D$<$9u׋)lj4$}O<$xJ|$4$1ɺ0f; @|01x DNu.9uՋʋ)‹4$9gƋp)p9D$ %D$D$E*$J}+R"}$4$VD$t$ D$dD$<$D‹$$D$t$ D$dD$$nD‹ $eGD$t$ D$dD$4$D‹$9zc9[D$|$ D$dD$$C$utE+-Ĥ+[^_]ÍE4$1)5tD$$1ɺ~l;>8E4$3+D$D$$U &Ƌp)9D$ %D$D$%*$I}$ 4$VD$D$ D$dD$4$A‹<$4|$D$ $Dž- Ɖ$H}u ;}$$|u$)͜,D$t$ D$dD$$@‹ $ GGD$t$ D$dD$$R@‹ $IG$D$t$ D$dD$4$?‹$_wGo"cD$|$ D$dD$$? $9u}3$;x% nG GGDž====Dž$`lj9w\&79&&Gt1Gta$D$D$ D$dD$$~=‹ $uuO}$<$fOwG$$T$t$L$D$}D$ D$dD$$<‹ $$9 E$p͜}$4$V~NL$T$D$aD$ D$dD$4$;‹$TD$ *@D$E$pt$<$C-Dž##?#1>)0~0 $a09"$,‹ $#u|$D$ $U R<$0|$T$ $ 9$sƉ9$)u}$@<}$D$t$ D$dD$$9‹ $GGD$t$ D$dD$$K9‹ $BGD$t$ D$dD$4$8‹$bGG<o"q"}4|$ t$D$$軳4$9s?D$D$ D$D$*$ L.։)׉}49)= $S@u$D$D$ D$dD$<$y7‹$t6c'92@Dž@DžDDžHDžL@)‰t19rE4D$ |$L$$賱<${9s3D$D$ D$D$*$ L.)U494$Pt$|$,ED$DD$ D$dD$4$5‹$@t$$4$A븃}$u$f}$v}4|$ t$D$$.4$9s?D$D$ D$D$*$ L.։)׉}4FD$TD$ D$dD$<$n4‹$iF9|Dž1p[ƀu2$BDž |$D$ D$dD$$3‹ $|OP9w|$D$ $U v<$T|$T$$U Y%<$)‰Ѓƍ͜@t$D$E$$+4$)D$D$$U r)j1K:f.&.&.&.&.&.&.&9t؉4$QD$D$ D$dD$$$1‹ $u}$4$F$$D$t$|$JD$ D$2D$@4$x0}$<$.G$ D$t$MD$ D$2D$@4$ 0‹$q4$Mlj4$$zlj$H$0lj<$]|$D$$U ^8%<$cG$UOWT$D$t$D$ D$(D$4$8.‹$3E$p VUUU)ȃ= $[Ht$|$$U C4$z4$2~$bD$D$ D$dD$$ -‹ $o<$~$D$T$ D$dD$$,‹ $<$IfF $7 4$)D$|$D$JD$ D$dD$4$,t$|$$U a4$CF$~t 4$o4$dD$D$4$4$j9E4s3D$D$ D$D$*$ L.>D$D$$U v9pF9Gt1Gta$bD$D$ D$dD$$5*‹ $,uOE$ VUUU)ȃ=F$>+}$e}4|$ t$D$$裤4$k9s?D$D$ D$D$*$ L.$}~F$B= g$}$+4$%VD$D$ D$dD$4$(‹<$}$ )ƍ͜G GGG GG GGƅ=t9yG GGG Gƅ=fDž==fDž==Dž====W GGW GW GGW G$g<|$D$ D$dD$<$$‹$eDc9D$|$ D$dD$$w$ $kuD$ @D$t$$Dž  1F)0~0 $K09 <$譼‹$uD$ @D$E$D$$ 1F)0~0 $09Y <$‹$uJ}$4$lj$}|$dYD$ D$dD$<$5"Nj$‹*T$ $1ɺyk$ C4$Nj$u4t$D$<$9Dž9s3D$D$ D$D$*$ L.)u4t$$1ɺm_4$ =$Nj 4$u4t$D$<$3Dž9s3D$D$ D$D$*$ L.)u4t$$1ɺgY4$)7$Nj4$u4t$D$<$-Dž9s3D$D$ D$D$*$ L.)u4t$$1ɺaS4$ 2/$|4$u4t$|$$+9s3D$D$ D$D$*$ L.lj)Ɖu44$<Mt$$1ɺ7)4$ ?}4|$ t$D$$$iH)$qT$ @t$L$$X…$ЉPzD$D$$U 9ȋ$r< s}$ f<tu$;>!<$r $D$|$ D$dD$$x‹ $o4$-r$WD$|$ D$dD$<$‹$ t4$D$D$ D$dD$<$‹4$t$D$$U )D$ *@T$t$$ 1F)0~0 $D09<$覲‹$u $;>xɜY}4|$ t$D$$Z4$"9s?D$D$ D$D$*$ L.։)׉}4<$͜;>~($Oɜ;|79})$;>vɜ$;>CɜD$ @D$L$$ƅ[o1>)0~0 $097$~‹ $uu͜$1)5<u덍D$D$$U R$='1$;>|ɜUWVS8P-E  U8u1)E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$P8[^_]UM8E#ʬʰ]UWVS}bu}'|EtG9E r'Gf|t+E D$<$պy躽([^_]9} r+Ey;}uET$ &T$D$l+$E뵋E9E r1UWVS EE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]~(UWVS Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]07F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,bxM]`]P(UWVS  Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cAN])](ffffffffUWVS ]FE}]} 1E䍘L&;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃0u FH+${zMUWVSI.}u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉET$ &T$D$gH+$EEL UWVuL o^_]ø1 fffUWVS\æϋMM9uM1t$D$FD$ D$2D$M $MaƃM9r,ML$$A7M)11}U+u\[^_]ø\ UWVS EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: E E+Ju}: w) ]u$M EÉ$SrKE}~=Ut3}ƐR.njR.w\DAtu܋E Ƌ})x [^_]9u]䍃D$ &D$D$el+$ [^_]ÍM U$WEM E$DtiEEM E$HEbt?EM EÉ$MM7tEMffUWVSöu4$豚H9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} q(yUWVSãE 9E1D$|$E$tGD$T$${tT$<$4NU+u [^_]MfffffffUVSEuUMx#L$ T$t$$Vx9s[^]ÉL$T$$[^]fffffffUWVS vutcEt\E $)ljD$4$*u?|$4$Q&u%džt$|$E$# [^_]É4$%f謨UWVS utcEt\E $(ljD$4$)*u?|$4$%u%džt$|$E$" [^_]É4$O%UWVS oTu t\E$'ljD$4$)u?|$4$6%u%džt$|$E$! [^_]É4$$蓧UVS uD$4$o!tD$E D$4$5 [^]D$E D$4$ [^]UWVSdu} tAv-u3D$4$'tD$4$3(F1[^_]軦USEU tttu P1[]vUWVSî}u t' td@t/tZv{Nw u6(D$<$&tD$<$R'71[^_]D$<$&tD$<$"'΅uʍ&UWVSu} tPD$4$a&t͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈\$8؉ȃD$xtD$xj݄$D$|'tru|$T݄$L$PtT$0D$4)‹D$|(Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|;ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|TH$$Lt$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـX\$8ـRD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|(S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|SMD$`U|$p|$$N1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$|'D$4$.$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|9LD$`Z|$p|$$rM$%|$x==p$$\$|DD$h$DD$p$DD$H$DD$`$D$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaUQ.U E]XUMU E]Fffff̀ffff̀rS[4? [̀rS[? [̀rS[? [̀rS[? [UWVSöu Et"4$tEExu4EE[^_]ËED$t$<$utGt8Eu׍GEE[^_]ffffUWVSA&u} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]Í+D$ X(D$D$e+$}+D$ X(D$D$f+$}UWVSrWu} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í,D$ t(D$D$C+$| ,D$ t(D$D$D+$|D,D$ t(D$D$E+$|1sUS6E*T$ D$PT$$>[]USE$uE []1[]UWVS$ÛEpEEEEEE1ҹEEuxw88 w38'E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`USqVEU} ~\wEBu - t wJt Bx1[]ùr u-JuB-袀萀 UU1Ʉtt'4$nD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US[@Ut/9E t*D$ (D$D$ph,$dxE []USM E%t.9t*D$ (D$D$ph,$x[]UEtt]1} ]ËE ]USaFE ~>uTEtKD$ (D$D$ph,$`w~Ewǀ[]ËEǀ[]USýEU tt 1[]D}UWVS|$ 7Etc@@|D$D$4$&|u E[^_]|84$?|81EUWVSuthF~O9tHNM 1[^_]ÉU^|ED$|$E$U7|u=FUF맍ɞD$ (D$D$Z,$~vi|UWVSJ/}t;t-M tWt1$>;wr$><$>[^_]UWVS}tJWt7E1U9}t#E4E D$4$lu߉[^_]1[^_]ÍɞD$ (D$D$,$uUWVS[@E@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(2D$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 D$D$4$Hff D$4$>[^]Í&1D$ )D$D$6L-$bUSܬED$ E D$D$E$$>[]ffffffffffffffffUWS肬gDžt)tYBfBfB B [_]ÉU7D$ )D$D$Mp-$7aUuU6D$ )D$D$Np-$aUrUWVS֫ûlj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]ÍԞD$ )D$D$`p-$-`UߞD$ )D$D$ap-$_E+wD$ )D$D$bp-$_UWVS\衪~ÉEEE 9E1fjDž9E]qA D$.$(zR.8tGt3\_u<.uuy.u}fD$:$(tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $3R@)9x‰ ȉ@ ME4$'QL$D$t$LD$D$ D$LD$$蕏A,Dž9E0aےD$ )D$D$Bp-$~[D$ D$D$$DTIf ugx.fcD$:$u$?fnUWVSlaFZ‹BcB $(dDžmDžDž l D$$DžtUpЉD$D$$<+Gt< tu򋽜$H@)49O)9y )ЉA V1ҍ;tftH<@ lj)9t?9rr ΃rj놉D004$L@9U$ @ E]Džl[^_]à f.&< t< t򉍼D$4$j P8 t$$ N19<)׃ D$$IT848#Iu‹tft‰)‰DžNtftR :)9&44$J@9‹f&B0tP< t[< tW< <9s>z2D$4$ tpu׋)ʉ׃ (D$ $F8f cFt$$]K'9Dž1Ct$$Kz90CRD$ <)D$D$^p-$SwP$Yf0x0k$Gtxf\>0N7L1UWVS``EE‰Eu9E1FE@ D$ .u‰t$L$E$')}EE4$FML$ML$D$ t$ED$@ $藁‹Et]$mE@ U+`[^_]ÉM@ $M<ʍE`MUƋE$u눍D$ H)D$D$p-$Q$UWVS(˦uE>FE苳@ }tglUE<$EML$ML$D$ |$UT$4$_‹Et)$5E@ ([^_]Í_뗋MUƋE$t([^_]Í@ $t:@ ED$ ,)D$D$ p-$OqUWVSh跚Ü։} }}U9E1} o-=$( 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$I<))9yrtft1'$1U+ h[^_]>z 7t$$l*D$t$ D$D$$BK@ 9N04$==3׉T9E>f t$$c9P }u,04$=tp9J90Љtftפ9P'$1;NjE$$;$[<|$t$D$ D$&D$$%6<$;=9˒D$ l)D$D$p-$F.ڒD$ l)D$D$p-$qFD$D$ D$D$$&Hg@ 399x04$:=1Ɖ$}:P)9| At$ D$)D$$%r<$ :p)9L$L$<$X8f&($ЅwDž$! I1Ht$ D$D$ D$D$$EDž8@ ?9$8x9D$D$4$W>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $CUlj$ FfDž 1DžD$D$4$T0։9^f 19s<04$CJ})σ (D$ $ljUWVS$u}6EGBEB $#E+EDžD$ED$ED$ D$ED$<$R…F D$FD$FD$ D$|$E$MElEE$<$lEEt $[^_]ËF t:$[^_]øEE$<$E$[^_]ÍD$ x)D$D$p-$>E$LF 뮸xUWVS@U>Mu9‹E1kFB FBPƋ.}ۉ\$D$ D$)D$<$~HNj9s4$@ D$ X)D$D$p-$:`4$D$@@ -$@@ t҃$S@2fJz UWVS迄ä?ƋEtvF u>ED$ ED$ED$E $Elj4$?[^_]ËED$ ED$ED$E $EDžt뼍ےD$ )D$D$p-$9[E1UWVSȎ>t@ËED$ ED$ED$E$ًU EƉ$>[^_]ËE1[^_]UWVS0oTE}u  t=/10[^_]Ã} uyMMUUUUu|$M L$D$LD$>D$ D$ D$E$skuE0[^_]Ã} t==a8t{bPWPtD@ 7 E #T$ )T$D$p-$97Ex{UWVSX܌}E EЋEEEE9E‹E1$($1l E؍EEȉMԉ}܉<$XD$D$ D$D$E܉$qDž E؉D$<$XƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$zPu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$)@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$(@9Er7‹}ԃrsSt}MԉM܋E$E܉$D9E1uU+X[^_]ÃỦϋU)׃E (D$$t 8E܋UEȉD$|$$79P@ EĉỦ $R9ŰEMEЋPEEE$E܉$Eaf{E̋EM8Mԉ $ EE7ufiK1E܉EUS|ùS7D$D$@, D$, D$ ED$E D$E$[]US~|c6D$D$ @, D$, D$E${[]UWVS<|6'7tDÉt$ D$@, D$, $ًU EDƉ$07[^_]1[^_]UVS{Þ tpǃ, ǃ0 ǃ4 ǃ8 ǃ< 5D$D$ @, D$, D$ $?Ɖ[^]Í $ t5ΐUWVS0{ƅAqR.8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]NȃE@ fu+-dtr ufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$E@0E@}Gfg D$<$1İ[^_]Q}Wf9xD$$3‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09F^u}U >E E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$E 1[^_]ÃuEt$xE ԅtEuT$U$EM U_D$ @+D$D$`H.$M D$ @+D$D$^H.$U D$ @+D$D$_H.$@+D$D$$UWVSQÇ\}u t'tQD$ t$t$<$ [^_]Í D$ 4+D$D$H.$XuD$ 4+D$D$H.$*UWVSQ[}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃D$ (+D$D$H.$XUpU썃D$ (+D$D$H.$#UE1U썃D$ (+D$D$H.$UU썃 D$ (+D$D$H.$UUWVSOkZuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$E 1[^_]Åt<$E냉<$E ωЃttkE녍D$ +D$D$H.$ D$ +D$D$H.$dUD$$NjE 8Ut Eo+D$D$ UWVSMXu} t tJD$(#|$4$4[^_]Í D$ +D$D$?H.$uD$ +D$D$@H.$UWVSXM=Xu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í/D$ *D$D$XH.$B D$ *D$D$WH.$k UWVSAL&Wu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í.D$ *D$D$|H.$B D$ *D$D${H.$T UWVS*KVu} tt@} u[^_] D$ *D$D$H.$u/D$ *D$D$H.$UWVSJÁUu} tt@} u[^_]' D$ *D$D$H.$cu.D$ *D$D$H.$5UWVSJTu} tt@} u[^_] D$ *D$D$H.$u/D$ *D$D$H.$UWVSIeTu} tt@} u[^_] D$ *D$D$H.$Gu.D$ *D$D$H.$ffffffffUVSHSuED$t$ ED$E D$E$E~>.t[^][^]USHtSED$ED$ ED$E D$E$[]UWVSNH3S}E D$E$St u)x[^_]9u|.D$ ,D$D$.$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]USFPE D$E$[]USEPE D$E$[]USEÕPE$r[]USErPE$@[]mEVP%9U\E=PE M7]UEf]UE]UEfU f]UEȋU ]UWVS$DOEE EEE0PE }썿L-}Uuu9E }9sux.tb@tx U9sS@}AnVUBc} 980]($[^_]uuG뒍V>[U|$M $jU:M)ȍ<FtOD$ $=t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\] ( [^_]ø!!"UWVS(F:/EEEEE܋E9ErME 9EsEEH0}}]EEƒ@dt(]n(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]DD$ 4,D$D$.$=EKuV]ڋ]9 }9;] }|>}uE~΃s/uuUED$D$<$tE+uЁ$[^_]ú^UWVS$1Ɠ<E MU9E1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]É@^US]E M9r 9s9su[][]UWVS0;EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS0:uE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉT[^_]É=()[^_]UWVS/q:EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]s[^_]Ë]X(1[^_]UWVS .Æ9u}E9E |2&6D$D$$umtF;Gt1 [^_]ø [^_]UWVS>.9U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]ÉO(;,?UWVS-l8EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]É(F[^_]øUS-7E D$E$( []UVS,ÿ7uD$D$$NtD$T$ tV[^]øffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS(),7}EU܉΅lt F"}uFEUT$$]@uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVS"-}D$<$#|$ ED$E D$E$ND$<$[^_]US"i-D$d $*[]UVSS"8-7uT [^]ÍD$L$d $訋ƅu$hƅtD$d $\FFF US !Þ,@U T$UT$$ []UWVS!g,D$-D$@J.<$脎E t8ED$E D$<$|$ D$D$$E$FD$txD$$[^_]ffffUS ø+E D$E$[]US Ê+E D$E$z[]UWVSu Z+E։ϋUt%T$ML$$Xx[^_]ÉD$4$謚ƅtU1UWVS *u} GD$F$uD$$~[^_]UWVSã* l$^xD$4$mFE9l p ELh$,D$4$݌ (9d Džt`t\Os1Wp΋ t $詜pP9uዽp$苜Gt$vtt ; r`t4$Lǃ ǃ | t\1tt:$Ft)NtF D$F$ыF9pt$g; rtt$ǃ ǃ| Kd$˥ uAEUl p h$*l$LĤ[^_]ËWjT$ D$ D$ $UWVS,H-(9U1DžDžDžDžDž$Jt3D$D$ zD$D$<$=~h$ | | FD$TT$Xt$\L7k9)B)Ӊ))ʉ)щL$T\$Xȉ"D$TT$XL$\_u)Љ))щL$LD$H/D$ i)\i(\ËD$T)\QD$dFEUED$ ED$ED$<$ƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F.1'Xe]؉ E܋؉ }<$}؍4 1ƅ F(EUjUWVS$|$8ljD$T$\L$XE \$\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}Q)à u\$hT$P.׋T$h(.&.&.&)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 qL$@t$<;t$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9\$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 D$pT$t9#D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`6D$D$eЉ t$x|$|KD$pT$tD$xT$|D$pT$t D$pT$tD$pT$tD$xT$|É։D$hT$lD$xT$|D$pT$t9؉D$xT$|D$T$D$xT$|D$D$ ED$D$HD$D$X$D$\ЅtE D$xT$|e[^_]Ë\$8`TD$<=9Ћ|$$)D$xT$|$$$D$ ED$$D$D$X$D$\Ѕ$;$D$$9$;$$D$pt$0)$t$h|$() ‹$|$@D$`) $Ƌ|$4) 5T$<;$$$$t$x|$|$t$h$|$p$$|$@$$$$$$$D$$$$$w\$hL$piF\$p9hFdN-00dFD$xT$|L$hdF)ډ$$D$PD$ ED$D$@D$<$D$\ЅtcD$,;$uV$T$0)Ћ$L$() ‹$L$`) Ћ$L$4) uD$<;$u \$p9$t\$hL$p$$UWVSD\$ljT$(9D$Ë$@1΃ ~G \$1D$D$D$?D$$D$E$T$(Bщ€|$?t>T$4L$8\$\$T$4L$8\$$@+nЉʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$[1ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0x$@L$ @D$ D$4L:f.&.&.&.&.&.&.&9t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Oщ€|$? D$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G 9t$ tG -t$\$49t$ \$|T\$a\$UWVSHǏ|$`ƉT$lL$49D$PNj$D1fB:/ t1P.tt!P.u.ux/ >|$p|$X40>D$HD$h$t$|$tȃ|$dw|$T8.&.&.&.&.&.&.&%1 ڃ9t$tuމ|$Ty\$pC\$hsK\$l\\$T\$l\\$L9D$Tt$hL$h\$lDT\$d߃D$pD$p\$t9D$Ht$D$l>71D$t":tD$l0>D$t9yD$@9|͸!9tx/aN?|$P$D+ e[^_]ËD$`rD$84$\$`G,뷋볉D$0AL$<L$@lD$,/ \$X))D$8t$8D$ t$|$$\$`9|$t |$ DD$40|$8%|$x |$8G|Ft>8t$|$lG$D$\t$lD$dk XPD$T1$D$L\$hD$X$(D$TT$dT$t ;H Pl$ty1pYD$tT$pFP~L\$t9\\$p}3=H\$t\\$p\\$L ;N>VD$\9W\$hD$lP~7|$ldF$ _tft|$lGD$l@11D$h ؃ux\$T9؉ӋL$LT\$p|$lw|$ldFT$|$@u)D$lJD$ht$t|$hwT$xmD$`tD$lD$XGtt$TDD$Pt$p@dPdPltftߤ1ۅqD@|$p`Pp@D$LD$pf@D$`<EPHЅut&.&>u)׉|$HT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$tVtftt$l0e[^_]r1D$LD$`*t -~0 wNjT$`)׉|$HL$Hy|$8u|$X|9|$@ ,;T$|;D$dY$|$$8,$|$ g8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d/D$Dt$<uVQ9L$X\$\{9L$TT$PL$XD$\tD$XT$\v9D$Tt$PI=D$XT$\_1ɋt$pD$dit9D$TD$P11D$L4D$x-D$|D$pD$TD$PD$px|$dt$xt$Tƍ>>>!.&.&9iFuD$pD؉D$X1T$p>4iF>kFuL$T\$X)ىL\u dFىL$X|$d9uD$T؋t$pdFdžhFD$|؉lFD$lpFƆqFfdžrFFD$pt$@p dN\$lډNjt$ttft|$l 8D8\$HډNjt$`sFtftt$H0|$xT$|p,g;^1fc뛨{2Oi)\= ףt$D4)L$X\$\9L$Tt$P|$t$CD$<D$DșD$XT$\D$D$0T$4T$4T$ D$pT$0TT$ Tp-\$T$T9Ӌ\$PT$ |9t$dt$<0>FD$<șt$9Ћt$L}D$(D$Dt$,D$XT$\D$XT$\poD$DD$(9}\L$T$$D$dL$T$ D$,3QL$dlD$,9Pt$pD$dN$]=uҿT[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]M1DžuAM荆dNdNt_9t:*~+uـZ@̓avÅ1t&wUVSP54 $0tu[^]1ɉt[^]7USٽ7t̿$^[]øUS軲à}u[]Í̿$%[]UVS舲m}u 1[^]Í̿4$4$[^]UWVSD-EuM V~KhFhF1.t&.&.&P9u dN9ut [^_]Ë]rl1[^_]UWVS˱ǨUM Z~>dFdF&.&P9u09ut[^_]Ék[^_]UWVS(K0EEM E3 mEE1u,(0ǃ 1}tME!}t,0ǃ Gp7>袼u U1)Љ3 ([^_]Í3E؍3 E܉΋E؉$YNjE"D$<$EE3 ~|$E܉$[tm}tM썳̿4$4$MN([^_]ËWr觻y}D$ 0D$<$HOGщ돾Bb0vUVSMu tE [^]AD$$E4 [^]UVS虧~Mu tF tE [^]jAD$$(E4 [^]2UEt@ E]UWVSu} tF AD$$}4 [^_]UVS4諦ÐuD$FD$ FD$F D$FD$FD$F$D$,D$ D$(AD$$&D$$4 4L$ xLL$L$ NL$NL$N L$NL$NL$ NL$$NL$(N L$,N$L$0N(4[^]UWVS]u } IXP& ;r B}y[^_]ÍIlP)׉[^_]UWVSnS7̿$  3 D$tQ|$RXPL$u} &&.&.& ;p H}!yL$u} t1EU [^_]ËL$u} R|$lP)EU uύ̿$ 1L$D$D$ D$$ L$(3 t7D$oD$^L$PUWVSET$RuXP$M ]*&.&.& ;H p|yE U $\$,.&.&.& ;A yyƉ;u ]9u ] $\$,.&.&.& ;A qyƉ9u ]|M 1]1 ȃ[^_]ÉƉ;u ]}# $\$ ;A y}&yϋM 1]1 )ȃ[^_]Í [ulPƉ)똍 [ulPƉ)L [ulPƉ)RUlPE UvUWVS7̿D$$} ƅ3 t<t`UM T$L$$Ɖ׋D$$9 [^_]D$D$ D$$&uu} 벾[0ffffUMU t"1&.&9t<u‰]ffffffUWVS}u tSR..&.&t(TSNLKf9t)ȃ[^_]1[^_]ÍD$ 00D$D$BP/$U끍D$ 00D$D$AP/$WUNUS/t u#$p tЋE$>YUWVSͪe=t:F$V FtD$$]4$nuƃ[^_]UWVS聟f}ƃt $tCƉxtD$<$\E FEF e1[^_]ÃUWVS uE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍŀD$ <0D$D$H/$rS멍yD$ <0D$D$F/$FS3ŀD$ <0D$D$H/$SD$ <0L$MD$G/$ERUҋEMŀT$ L$D$H$RffffUWVS聝fƉUM <$EtC$pupMH  <$1[^_]Í̇ 1#.&.&#txu8u돍D$ D0D$D$/$Q7<$TuUVS胜hEU Mt [^]MUE􍳮t$ \0t$D$/4$IQMUE[^]UWVS  E$  1̇ E0E}M D { uZMUCЋMU 9u` tgߋt}Ct9K ttFߋteC9K ut2 MUCS$ЋUM 9tV uE9rRE9sKu}샮 E$ ut?$u[^_]ËE]1 tߋtCU11ҋE]ffffffUWVSnSUE0}E,9E1M zhEED$E$D$h8$PhǀPǀTǀX71DžD8H@L,D$ |$0D$8$"8U+d[^_]ÅE ((hEED$E$D$h8$ShǀPǀTǀXE (D$ l0D$D$Q/$MW(D$ l0D$D$P/$nM((D$ l0D$D$Q/$3M(RT'UѢUT$UT$ Q.D$E D$E$>]U誗UT$UT$ Q.D$E D$E$]UED$ED$ ED$E D$E$]UWVS<!D$@J.FX$w(F`F`y ;Fp|4} t.FXPVX}D$FX$f([^_]ÍFXD$E$HUS跖ÜE@J.Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US _DE D$ED$@J.X${ []US( ED$ E D$ED$@J.X${[]UWVS͠M} }E EEEeD$E$&E@ E@U~5M19E}EtfEtME)‰UE$UE@몋U tE eMOTEfH @1[^_]ËUulj7wWU<$\UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $%E[^_]Í=D$ |0D$D$Q/$(Il&1D$ |0D$D$=/$HE)1u E MOuo U0D$ |0D$D$/$pHE@UUD$E$$EU)1u .fBefm7MyHMUS ŒêED$E D$E$w []US蔒yED$ ED$E D$E$x[]UWVSZ?EED$E $ƅwDžt}D$ED$E$9xY=?fGfw  G$ G,r G(Y G Eu/[^_]É$CLfG 1[^_]D$ D$D$<$)[^_]ÍСD$ 0D$D$>80$\FUWVS2}t6D$<$o"G ƃD$<$|"[^_]Í&1D$ 0D$D$;X0$EUS 跐ÜE9ErD$E D$E$ []蠽ffffUWVSqVu F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9u0D$ 0D$D$W|0$D+V9Vs4$u^4$qg&1D$ 0D$D$<|0$ODI fffffffffffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS G,UM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$ F0`UWVSL ljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw 0t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$8021ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$eL$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$!L$D$$9$L$D$$9$L$D$$9$L$D$$9$UUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$FHL$D$$98$)+L$D$$9$ L$D$$9$L$D$$9$L$D$$9$L$D$$9$UWVSHv$M$} |$8}|$<]\$@9D$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$JD$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$2⋼$<$$ "SG f A$fx/D$<M$$DŽ$DŽ$D$$$$SD$$8$$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$3 󥋔$\$l{$ [L$8L$ D$T$$4$$JFD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$F@$4$1$RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pdM$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$s1$$|$D$$4$$H2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$$$D$l@$3$"$T$p$$$ÉD$d4T$p$$D3 t$8t$$DD$ $D$$D$$4<t$d$$h$$$ $$$x4$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$4/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$ $5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$ $4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$ y$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$4DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$3 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$tPvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $D$ l4D$D$0$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$ҡ$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVSû#}ED$E D$EE$$©4E܋\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$ܠD$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$ $B@Ɖe[^_]ËED$E D$$@Ɖe[^_]ËED$E D$8$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS, }m|$D$%U <$Y!4m܋|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$ $d=Ɖe[^_]ËED$E$D$$2=Ɖe[^_]ËED$E$D$8$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`#E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$X¿4፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$4$U:ue[^_]ø랸뗸1fffffUWVSp9==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$Pأd܋܃ ݃T$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$`(\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$`(D$D$PD$ D$`|$Nj} t$@ ;؋l\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$ $6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0كڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$`(D$X (.&t u)D$@L$$~YD$`D$؋4T$HL$H؃h\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVSu} G9F}uuFV|9s]B9EE)ׄtdD$D$$UhREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVS$}<$"GD$t$rD$dDŽ$ݜ$DŽ$E$E}É$-wʋ$6牜$}D$p0E@D$0D$h/$D$xDŽ$15$DPЉ$K$C‰ǃ/ ˃9?~ыL$xDPЉD$xU tE u0e[^_]ÃL$t8et ED$PD$TL$hA$Et$LD$t1|$F$ߍN L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$vD$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$(1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$*=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈T$@$Lܾ݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـD$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈,D$@ؠTD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@ܾ݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$بt\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$ yD$$4$$$D$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$(݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$(݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`L7D$h$$$ $$D$x$$G)‹$(݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$(fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(=&E܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<=&E 9Ex0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVSuEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS0ޙ}u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS٘EM]E TsCD9sf9r)؃L9s&)D$D$ $]][^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVS L0)ˉf.&.&.&, u썊a)ˉ.&.&, u썊A)ˉ.&.&, u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVSՕUBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS 聊f7} w.L U4tfMt@ P.$0E $ƅEFEFuFF [^_]øMEP$UуL ‰)U= w$| P.$It P.$0xUWVScHut"F w"7u&L 4[^_]É4$[^_] P.$UN?L 4tU$[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8& } EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $MnMUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVSG,u ,  P.Eut?t|$E$EE$`EtsEu7Eu?|$<$r‰EtUE$7Uu P.$u먋E[^_]D$7D$E$ E1[^_]7EuO$rDžt@q@, E P.$} P.$g, u딋En P.$=1Xǃ, Eu1>UWVS$T9u EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVS{ñutD$E $zDžD$D$4$(ptt ʃ9t*xD$4$ t|E%=`t`fx ttpu ffx fp@ P$ P,r P(Y P Ĕ[^_]K51Ĕ[^_]ÍD$ 8D$D$E2$/514O1USMz2E UD$T$ D$E$[]UWVSzutFD$4$O nx$P8D$4$X [^_]É4$Tڍ&1D$ 9D$D$=42$.UVSykut&nxP[^]É4$[^]Í&1D$ 8D$D$I42$@.ffffUWVSyuT2$'- ffffffUWVSwւuf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $6F0F0$F0ǀǀD$4$FFF [^_]ÿF yF$i4$Lǐ8&1D$ 9D$D$8t2$+81 fffff̀rS[d? [UVSbvGut8F0u ǀ4$uAnP[^]Í&1D$ (9D$D$;2$ +뜸fffffUVSu÷ut#1V ҃ t[^]É4$[^]Í&1D$ 09D$D$;2$*UWVShuMu!8FF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $F0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$ e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$QW8t6D$D$ V\$D$4$ ?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$AuwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS vl[wEU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVSkvƋ4D$D$4$-EtE$kGu͋$JtMtf~ 18t$9⋎t $?4$uu&E[^_]%U9%8}%]EUWVSjǽu]tCƉ$[^_]þUWVSj}uljUD$@$:ƋUu 1[^_]ËOD$M$…1]~˃Mt|tatOt=t+tt9EGX<^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ $$ ;F@tNO$跺4$e%81[^_]ËXP.NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$ p5X|Plx ,H XPp[^_]Ë8f8F8FF F FFFF4XP. ~D1 󫍾$F~ 818t181D$4${dž0M8?8UWVS$V}auF(x~(V0!UN9F9MUD$N $MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$+EEtlE܋UT$ML$E$袭ME)UЉL$D$$AM $2EUVU(_US]ED$U $ #C,9C(}#C0[]fUVS U_EpFtD$D$$F u  [^]IUWVST~_EPwhHtwSuNP L~8xpXpTPtYtQ1[^_]1DžLDžPXDzDžTHDD$$$ƅtǀHXdž$$ljFHDt dž w?GciG G 8G pWGMG>GE UtAtCf\ Ft$t$賳4$g XxD$ ED$E D$E$XE EUuM, Pdždž QXTtt!ЋTDTT9QX1XA1L=f+fdžXD$ L$D$$T PD$D$$fxuu fxD$D$$E t @E@t E DžLxpX]DzpTPO AfXmxD$0$s XD$`D$$` =b1уX`abcddefghhijkllmnoppqrsttuvw `b1d}h=f]t_LX Љ lp&D$$ 88D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$O,t$ I<T$:T$$X +XFT4T$ P9T$D$*3${TfUWVS$>L#WEpFtD$D$$FUED$E D$4$kDžEtuD$D$ED$D$ D$|$4$踜‹!@u FЃ$[^_]ÉUD$D$$LUЃ$[^_]D$D$$'Ѓ$[^_]fffffffffffffffUWVSKUuE U VfFFVVfFFVV f F F V V fFFfFFfFF=6F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\Nt&.&"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍMD$ \9D$D$b(3$F lUWVSHÝSuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\Nf.&ɉHɉH@tH ɉH H ɉH "B9uȋF mMD$ \9D$D$b(3$F ƒl'UWVS(vF[QEpFtD$D$$%FE  D$D$$kEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$f$u ([^_]1([^_]UWVSGE,P}wFtD$D$$FD$<$tr$tcFt$t$t$E4$|<$tE$譥[^_]øUS }DbOE9ErD$E D$E$* []fqUEtu]11ɍT9r]1]fffUVS!DNUE Xh91rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS41CNEE@Et } 9x 1}EEEEE*EP}GA у@3=0fuftpfuE@E܃!‹EH}<}0}}Gu kUzu@G GGBPWxG8GBW}O ME9kOft DAfEtD$D$ E܉D$L$4$蔨V1ۉ]E@Ex#} EHU ꋀEEƒUƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$E0E@ D$$MAt MM} y AUtiUJAUQ}Q D$ML$D$ M L$D$<$耣E4[^_]Ë}GMWW:D$UT$D$ M L$D$E$!E ]}؉0fuft tpfuu^/Ex }OE@cD$ 9D$D$L3$D$щT$ |$D$E$lE@E܉dU܍cD$ 9D$D$L3$U/B $.fUSEP M TH}[]UWVS>HuE9G Ut OuhM Gt"V T$D$$vG$gGB<$U9}thG tkMtOtD$L$ D$GD$4$wn"?9}tG tUE?9}u1[^_]1G!,USUE @@ @HKYXBP[]fffUWVS <ÆG}ED$E @D$E$諜t7ƅt|$$t [^_]84$V8UWVSD&< GuE 9‹E1k*lt$D$ pD$D$<$ =5DžDžDžDžD$D$$|<$*ƃtI<$)D$D$4$tntD$4$tSD$D$$E+uqD[^_]Íӆ$ L8D$D$$諙4$裛8?gUWVS,d:IE]ƉUM܋ED$T$4$YNjE  &ЉUUD$L$$]̷EGfEf}UBM (9tD$T$$]肷UBD$D$$]cXMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉MEM\$ 9\$D$b(3$E؋M7UE:98uDE܉ufp뛋PUD$D$$];UuT,[^_]ÉUD$D$$] UE܉ufp5UE:98to!D$T$$ZtfGUE]ML$ 9L$D$b(3 $UED$T$$]bsUWVS 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MUMD$ 9D$D$b(3$ZMU.fEEfF fE~EUčMD$ 9D$D$b(3$U'UMMD$ 9D$D$b(3$UMSfffffffffffffffUWVS8]&F1EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋ML$ 9L$D$b(3 $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸M9(3E܉U|$ L$D$bE܉$]UE@(EuU]䍻M|$ 9L$MD$b(3E܉$rE9EM؋UB=VVU]䍻M|$ 9L$D$b(3$UUfEED$E D$E$rUEH(EH(]䍻M|$ 9L$D$b(3$U;U1҉T$t$E$]8UUWVS J/*}u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0À)ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃MD$ 9D$D$b(3$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃MD$ 9D$D$b(3$UMUWVS@Ã&}EpFtD$D$$JF Tt:t@[^_]F(tڨ1EEME؍9EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b(3 $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃MD$ 9D$D$b(3$7MTD$|$$ו럍MD$ 9D$D$b(3$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfEM}Ѝ9}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$b(3$MMԋUBHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍MD$ 9D$D$b(3$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[T? [UVSR7ut5D$D$ D$ED$4$Ot6E[^]Í>D$ 9D$D$5t3$럸fffffffUWVSãUE pu9lE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdr,:d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?h>D$ :D$D$X3$hMX\pD$E  D$\$n8 X9hƋ`,:d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS< Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS gl4$(sD$$D$F $3 [^]UWVS > #}$ L$K#1$KD$$D$<$h3t$<$2 [^_]US ìl$mr[]US, ÆEEVEEED$D$ED$ ED$D$E$諍t}u E,[]ø,[]US l$q[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9t9t,EȋU+u0<[^_]D$$D$$.#ԃ $Zb(UWVS`oEE9E1} w6}̉M UERE9t~9ue $aXM̉MG} EME9tX9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $Ia'UWVSDz_9EE1uUč}̉qMȉM}ǹU7UȋE9r}9t"9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $`U&UWVS8â9>}}̉11҉EE9t9t)E+u18[^_]D$$D$$ ׃ $ `fx&UWVS<:U9E1E x;Uȍ}̉/M UȉEFE9tK9t[E+ua<[^_]ÉUȍD$ :D$D$<3$̭UD$$D$$ 륃 $E_%ffUWVSyV}lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]PMUBfFF F D$t$$]u1[^_]ÃQʋ]C ^)fFfF] H@ L$J UL$ $]lOUBeD$B D$$]rtH D$D$$t&KUWVS$}E΋x!fzfz:EF~ =(M9AfZfZۍ E@ EE@utN=$1EAfBB B D$T$E$]s$[^_]É=ft1MM\A4f9rM됉=w+f81&\F<f9rZUM]MD$ X;D$D$b(3$蚪MU룉UE]ML$ X;L$D$b(3 $_UZEUEMEM\$ X;\$D$b(3$UEMUM]MD$ X;D$D$b(3$שMUU]D$ L;D$D$4$蜩UUWVSLT u܉E։MM  fMEE=EffEFEfE=f}EfE111EEf}u։ʋME@ EǃtVE}TG:z Z]f;u]9fEA)fAfDY|$T$UȉM؉$]MKUԋM؃f}Ef;ErE EȃEȃ]f9]f9u}EE\E9E]9f9u9tMԉU؋]܍4D$ d;D$D$4$MԋU6E}TG:,E}TG:EE]TCE}}uL1ȋMfAE@(t 9Hf;UE f)8EEf;}ǍFEfEu}l&gEHEA ÃW)fW]fT_D$L$$]IIfEEf;uf;uu fEfEE@ EhEHEo}uLMU]܍4D$ d;D$D$4$蚥UMMIUѻEHE E4w(ufFMf9MuufFEL[^_]Ë]܍4D$ d;D$D$4$fEf;}'1뗉@f;ErfAf9stEMA]܍4D$ d;D$D$|4$菤9]܍MD$ X;D$D$b(3$]8M ]K)fCa118a\t&Sv.&CUWVS ƉUMED$4$!YǍED$4$YÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS(  ƉUMED$4$UXEljEfGE}fyUzyAB A u.E B=f9mEU܋ED$$fEUMEABAfAEfAB A BtHUD$D$$hUU}HD$D$$jUED$E D$E$MU܉RE䋆U܉׋usOuCu1u9ut2U܋E$hjEU܉E]E([^_]äu9uuΉUftt֋E$ jEE([^_]ËuBfF] fu]EvUM썃MD$ X;D$D$b(3$UM%f] z>1D$ED$$`iFUWVSpqZ EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN y EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]ЍML$ X;L$D$b(3 $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]ЍMD$ X;D$D$b(3$ϗM"M]ЍMD$ X;D$D$b(3$藗MTME̋]ЍMT$ X;T$D$b(3$\MEMUEEЍM\$ X;\$D$b(3$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]ЍMD$ X;D$D$b(3$nEMċU6MU]ЍMD$ X;D$D$b(3$'MUrM]ЍMD$ X;D$D$b(3$MUԋ]ЍȢD$ p;D$D$q4$贕UűEԉE}EEqqqUWVS4\A }G,EЉME؍|;ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$b(3$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oMMD$ |;D$D$b(3$M:  GEV@Uȉ]ԉuu}}ЉMً}}̉uƋE ʋE؉E  1É1؋}Љ׉}!]!1Ћ]؉ 1Ӊ 1Ӊ]U}1!]!1ڋ]ڋ]ЃEEU}܋}Љ}9UWuE܉]؉MEEԉEE؉EԉM؋EEE܉EU܋uu]41J 1 ]ȉ׃]< 1u1ȋu؉ 1ʉ1ʉы]!ىu!1ʋMċu>‰EЉ‹}܉ 1 1MЋ]؋M1!!1؋]؋M‰}̋]]Ѓ@E}x}x}x H}x}xX0[^_]UWVSӉʋp x$?utm@)M|0(9MރEE} H P$MTUp(t$$EEU]?vIzt @}߉ÉU|$$C S$@9u}؋UM\9@?t*Ux(ރBEtfEtP P$[^_]Ã?vōJ΃|3@p(M}UމËFGFGF G FGFGFGFGF G F$G$F(G(F,G,F0G0F4G4F8G8Fu\uBMEt H(x)Z]fmfm sMM Z]IUWVS: E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀc |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVSjO } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVSî } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVS MDžDž<< ?z DM E5@x  D$D$D$D$ D$t$$(uVD$D$D$ 0D$T$4$jAt0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$@L0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$$'3DžDžEDžDžDDžDžCDžDžBDžDž>Д DžDž DžD$D$D$ 0D$D$$>t0Д DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$ $$2D$D$D$D$ D$t$$#4D$D$D$D$ D$t$$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$$"3oiD$D$D$D$ D$t$P$!D$D$D$D$ D$t$8$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$8RPLDžDžDž D$D$D$ 0D$D$$98D$D$ 04$T$ 1t&=S,vD$c$ `DžDžyD$D$D$D$ D$t$a$D$D$D$D$ D$t$q$7SfffffffffffffUSfK \ []UWVSPJ/ EEEE}|$EԉD$$Ẻ$1u} }Ƌ u%1 uBfEʍ M MM9MMfJM^MHHu u p Puup0@1Ẻ$D$|$$P[^_]j D$D$D$D$ D$D$$ ‰ f@ fN9fE@EU tdM HUPMH Uup 녋uMHx0<@\ uM M  M310t ED$D$EЉD$ D$D$@$3u}u tE E E~ vMiM DUWVS O4 <$t V6uA.j$Et+).t V6u<$E [^_]-t V6uD$<$<E [^_]US$襯Ê t$[]EEED$D$ED$ D$D$E$1t uD$ @D$D$A(4$$d mfffffffffUWVSƹ E }0@DFƅtGFU M U9BFD$F D$ $GEUtRFE VJE}9OT$T T$$EFMAE1[^_]ËM!@]GF MtFuV]SF }WT$|$ MQT$D$E$ u>E]놋ED$ED$ GD$F D$E$LE!@F aD$ $'t̋EUBL$$'t}VWVUVS uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 舫q E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$];%Et͋]E0U=UWVS(萪u E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVSnS }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[Ô ? [̀rS[t ? [US sX EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[ ? [f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVS0 tMƋuA~8t:F4@9s3`V8F4@9r$$F8[^_]ÉUWVS踦 E}}u9ENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]F86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$](NjUN8#UV4V0]MD$ D$`T$ $F4~81.& @rPu B8~8BX;F4rE,yF8$]"F8UȉȍB=]I_8 4U]0_UF8$["_UF8$]F8tgD$`||$t|$ D$xD$E$&DžuUN8]^N]^{]UWVS@ܣ EE M9NjE1lI%;E" = ,9#ƅDƅdHD$$"8BƅC8 D$BD$d<$Ylv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $jt[U+ @[^_]Á},d`@ Džh1Dždd ׉<$D$`D$D$ t$D$$"f 9?MD$ D$`|$4$`d9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$[Ju"dhD$T$<$gFPp @?.T$Ge``697nV4P4~0x0~8x8NFwPRTP׉) tGPǰ9 fG`9u Yt&D$dD$ $gctIt70tfttG1VD$D$$&p8tD$D$ $Zbt"T7d$TCt18S4$D$BD$d<$bFttD$D$ $bat ,S"A!D$DD$ $ at$-B놋rD$D$ $`S$`\ Nj@8@P1q`D$AHDž$`Af$ AjtStD$D$ $_zn4$@\tNj$@D$BD$d<$`tUWVSR7 <$E D$ ED$ED$E$MU E(Ɖ<$[^_]US ڠ EU BJ  D$T$$ []UVS 衕Æ utxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E EL4D$ @D$D$ll4$>D$ @D$D$ml4$>UjS UT$ aD$ ED$E D$E$9]ffffffUVS " EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS(шƦ ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$]ӋE111 ufEUD$ T$ED$FD$$]&;u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVS㥠Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$Åt@C؃[^_]ÉډSu1V룋KT UWVSב u xD$4$HE%=D$($Džtz@@&@9uE ED$D$ EЋUԉ$T$EČ[^_]@1Č[^_]UEU U U$]UVSΐ ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D @J.D$ D$%D$4$U D$E D$E$]UWVS E HMPpt)rP@t6B E$1[^_]ËxMt P@uʋMAUWVS4芄o }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$%U11MM1 MMEԋU؉D$ T$E܉D$AMD$$9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVS ut PtH J H $u4$1[^]UWVS跁ǔ uu2&.&[tCtډu[^_]Ë$[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS 貀Ƈ U EtUM"t&.&.&.&t.ZYutD$D$ $ E [^]UWVS % } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS(=& E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]/E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍ&1D$ @D$D$G4$.u ]܍D$ @D$D$H4$.bf%BBff+E XffE]F3G]33 4UWVSxm utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]&1D$ AD$D$Z4$,[UWVSwí utWD$4$ F u#f~t(1D$4$ [^_]É4$2 E.4$|$Flj4$[^_]ffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVS1v u8tfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉FUZ1맋V0 t~@9t $RV0F FV덍&1D$ AD$D$<5$T*=fffffffUWVSu u}E FftRxT$$<xF0PV09t'Pt($ [^_]ÃT1݉UUPV0ǂT1UVSoy u7u[^]ËF0$F0Tt$[^]ǀP8$F0Uny MU 7u]É]sUVSpnUy u7u[^]ËF0$F0U t XtTt/$[^]D$\$F0ǀP8$F0UVS8mõx 9EEȉD$E$>U+u 8[^]f̀rS[dx ? [UVSbmGx u tt$D$t,@E$[^]ÍED$ AD$D$9H5$$"UWVS4lw D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"'D$ 'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]9&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍D$ BD$D$K$ L$(= D$ BD$D$M$E"UWVSjǎu EU uM] $\$M] ǀQ.}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSit u} 9vtGFfuUT$|$$xFP^T[^_]ff [^_]Í=D$ 0BD$D$Cp5$s덍D$ 0BD$D$Ap5$G9vVD$ 0BD$D$Bp5$'UWVShs u} 9vF t5Fft\D$ D$D$$!Ѓt<F fF FfuUT$|$$[^_]ø"8F 뱍=D$ $BD$D$Vp5$%DD$ $BD$D$Tp5$9v D$ $BD$D$Up5$?UVSgur u9vufFftEȋED$ E UD$T$ $QF !ӃtNPVTfF ȃ[^]ù뷀fF ȃ[^]ÍD$ BD$D$jp5$kD$ BD$D$ip5$7UVSfÎq utO9vuFfu$[^]ÍD$ BD$D$|p5$f붍D$ BD$D${p5$:f6̀rS[p ? [USep ED$E UD$T$ D$E$[]UWVS@eƓp t$(D$T$L$,D$,t "|$GD$8UT$$\$( uL$8ǀ-[+nD$,L$8D$0T$4D$T$ $D$\$(ɻD$D$0T$4D$T$ $D$\D$ T$L$8D$$11҉D$8T$<0D$,9tmD$ \$$9D$8|$e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(OD$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 }1thիʫ|$ D$t$E D$L$T$ 8D$D$4$D$t$$ҩ!ljUED$ D$E D$E$4UWVS8JýU Eu}9E1X>'իʫT$ t$D$E D$D$|$ 8D$D$$Xu(u~E+8[^_]:|$D$ gD$D$4$ND$t$$uXt KH󥋅D$ 8D$D$$uX:!ǃX׫$…X1A<+w,LuىDX9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVS<*HS uE EEEEEEN>wN# t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USFQ ;UT$$L[]FQ -f̀ffff7̀rS[ÄQ ? [>̀rS[dQ ? [UScFHQ D$0? D$ ED$E D$E$[]US FQ ED$ ED$E D$E$[]ff&.&$D$4̀D$̀fffffffT̀rS[ÄP ? [PS[mP [USeEJP 7u '9[]&[]f̀rS[P ? [USEO $1[]UVSDO t [^]É4$buF1f1ø11DO \1øUWVSƅUu't<uF=f t/tv=uF ދF ӋF ȋ t@ 9s0.&8u +P 9rt Iƃ Uȍt8D$ LD$D$P8$FU.D$ LD$D$P8$<=ƋUfffffffffffffUWVSWB@M D$0}|$hu }]\$89D$Ë$1M}D$hD$DD$,D$08\$ND$<%t,P D$,t$h\$D9s FD$h<%uԍWGD$CD$XD$<D$\HZwt$0LT$(D$$ D$l1D$X|$lD$Pt$P\$<9}L$,L$\  \$P\$HT$Ht6\$DT$h.&.&9s  sT$hD$\|$(1ۍHЍABHЃ v\$< T$(D$$D$\0|$8GT$`D$d|$8\$Xd$\t$`|$d D$X\$\\$4|$CD$HD$P$3D$Pt$P\$<9}L$,L$4t$hL$D9sL$Ct$h|$4L$X\$DL$h9s0sL$hr\$`T$d\$d|$Xxd$\D$C- t$`|$d9$D$4\$`t$d)щ1҉ىD$PT$T)iiƸ1҉D$HT$LD$HD$P0T$`D$dL$`\$dc19dÍxD$`0CD$4)D$HD$Pt$X9}t$Pt$H)t$XD$XPF\$\\$4|$C@D$\hD$Pt$P\$<9}L$,t$4L$D9L$hAt$hN0\$D9 L$$N^\$h|$4L$<\$P)ٍYt$DL$ht&9s0sL$h\$ # }E E9‹E&Gbt&ED$ ED$D$$>tD$$D$ D$D$D$ED$ED$ D$D$<$x ƅ u G$@ED$D$ t$L$<$jƅ,Gƒ @1u`$yED$D$ D$t$<$ƋG~U=2D$D$D$D$D$ T$t$<$ƅGD$<$E+NH[^_]ÅD$<$|ȋPu@fffuGtwp fHfHff$衵t$ɉL$ T$D$P9$qPtIthtRD$<$$+xڭ$xD$<$yD$<$gD$<$U4UWVS, }U ME9E1GED$ED$ L$T$9$pL$T$ D$D$$Co=E D$D$ED$ ED$T$<$qU+,[^_]Åx$腰=wttH|.uT$L$ bD$D$$nUD$T$9$oqD$<$9$3UWVS( E E9‹EE@ pc$M,T$$s-ER.D$ D$D$4$KS ,t&.&.&.&DA@tD$4$j.t&DJ@utSFNu tDJ@tEpt$|$<$调7$N$<1U+u ([^_]L1UWVSP u} E9ËE1fD$4$^1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#^8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$HED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$AFDFD`DžDžD$4$虹,fffffUWVSlö u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$TxƉt$E$踸EEFD$ $蠸U(fBMЉU(E,) X}|$}|$ D$t$E$д,Ɖt$$ 0FD$E$FD$$FD$$ U(fB )Ѕ9ET$ NT$D$9$El[^_]ËE$訥EE$ߦML$D$ ED$`K.D$9$fU(E H E, 9(B B U(D$E$$U(BD$E$U(BD$$ U(BD$E $E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS hM U }E@4E)Ѓ FD$$)FD$E=s$VfFE@ uG1T$$ǵF D$$贵 G fffG )~ [^_]èu2밸9u1 [^_]Í$jU *U-$jU븸UWVSN3 M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$GD$u4$说W׋u$ssuXuQ}׉+u9~ED$4$V+E~[^_]äft9}u1[^_]urpUJ$HiUM 9}t9D$ ND$D$=9$SgMAyEtflffffffffffffUWVS(f ljUM܋EGkE8u䍃^ErE썃E.t&< t< tD$ED$4$;D$ED$4$D$ ED$4$)D$D$4$ۢG~$g< t< vtu([^_]À>6F$~d ʈdGtD$e$`띍F$蹃~GtD${$}`iD$ D$4$tD$ D$4$ܡuEO!F $=~GGD$$_D$D$4$ytjD$D$4$[uXO@E܉D$ED$8:$_O]L$T$:$t_zO TD$D$4$t*D$ ĮD$4$Ǡug OD$D$4$葠u O@D$5D$4$gu OD$ЮD$4$=uZUl D$4$Yƒ?v?T$U؉t$E$tEUƄ4D$خD$4$şuZE l D$4$ƒ?v?T$U؉t$E($sEUƄ(D$ D$4$M D$D$4$(u OmD$`*D$4$Kg?UVSTÑ $@it."|xEEE%EEEEND$D$D$ D$ED$t$}tT[^]UVS Et4D$E$nEEFEFh!fF [^]Í UWVSxË 9EEtbUD$E$Ef3EfF}<$XD$t$<$}X|$4$ZFUM+ ux[^_]Í IUWVS  }x$SLJft/1t$RDŽ9Ӄ[^_]UWVSu u4$`t&tuOxu:<$&odžt$ odžf[^_]É$0R뼋|E9Eut$ RU Et]Í5]U­ Et(]Í]UWVSu] }4$sfdž1҅~!1u.&{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVS uD9 E1D$4$PF u uD@@$dD4$U4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$5hF WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$$ w`D$D$4$jmƇ_WHwDG` \Dž01< t/t 201Ƀt&9c< [< uuDž(,D$p$[8 Dž4DžHT,8D$ D$D$H$8;s<;t<#tH8domaH8searH8name%H8sortH8optigxionsZ< t< GcD+<< ~< uvfxinJ< t< I(  t t Dw`D$D$4$"kƇ_D$4$VtDž0]t DF 4DdLʃ Јd8$D$D$ $Kx8$&s,D$x$x}t<hlp ė ȗ DDx`0DpHH`HD@H@`tg.&<.ǃu~DD$. $hDFHGD$.$hDqPALD@3$?t‹DHDH U+h[^_]Áxservfxer< t< 9 < t< tD$4$谰< X1DžX DrDž\DžTD$5D$ D$ D$<$PD$ ,D$|$4$v"MPB=9Dt/RωփtftPBj@D<ЉT$L@$dLt׋$ˆL,D$ $OL <4,LTDD|$@$%d<mFV9xDw@ut;u㈕$<,t$$N<$TDLD 44 K}D$ D$4$!D$.4$2cD$D`$2Dǀtǀx|Dž0Dž(\:$4TDxD@Dt,D$4$}Mu덃!$S< tt< uDž0]L$,D$ $=MLtċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž0)@DDumuT>uvuYLpD$D$1ɉyffL LsUD$E$]UWVSXö }u h3 l3ė t;D$<$t ė Fȗ FX[^_]Ëȗ 9puttl|E9EtztIND$D$ED$ D$D$t$kBt ė Fȗ F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]ffffff̀rS[ ? [UWVSd .,D$t$^M@$UDžDžDžDžDžx@ N L$T$ VT$D$$]T$$=F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$=ut G74$͇@9 W ‹Atft‰)@0Dž'Ztftlj)@#tP4$@9r5‹zV$d@ $cZ#Džd[^_]‹)ʋ;Wf)f f{\ےD$ ND$D$:$蝐$tc0P@~~ 9V)ȋ 9cVʉ)ȉA1҉=tftH<@ lj)99h΃r낋$ib@ $ XŔ@ 4$@9:ƒ{tft‰)‰DžJtftR<lj)944$@9`‹wShf`f% PD$9VuKu2ifM/f릋$_@ XUVSû 08t$J*[^]Í,D$t$5E[^]UVSl 08t$n_[^]UT= Ut]UVS; ut$)[^]Í,D$t$D[^]UVS ut$^[^]UWVSâ u}t5W¸t[^_]ËF [^_]ÍD$ ND$D$|:$eUWVS># }uENH NH,D$t$Cƅu!yH L$UT$@$mtEG D$GD$ GD$D$4$Su4$]G [^_]É4$][^_]ËG [^_]ÍD$ ND$D$:$UUWVS + EC(98 lS.:)lj}싓 u2E D$ $边  [^_]Í.t$E$3t$ $3t{ t1= ;txED$D$E3uًED$LD$ED$ D$;D$$Y [^_]Í:D$ED$ D$:D$$Y [^_]Í?D$ POD$D$:$ĈED$]SUWVS m ''w} )ƉT$U$Mtn  UT$ $MtG  D 1 [^_]ÿ'y qUWVS(ǘ LJ̗ LJܗ LJؗ z 11ҍ,UEV 5 )Ћ ԗ ڍAw OD>ЉD>]T>ӉT>LWMHL>@CD>ԗ Cؗ dU։‹ؗ xztؗ =w ;lOEtؗ =w ;lOܗ tH~kؗ LJؗ ؗ yU) !ȉؗ UeUNv$̗ ܗ ULJܗ  M싗 1ɍlO]MEUtwM<9ErMtu艷 Ѓ([^_]LJԗ 5 LJԗ D>ED>ЉD>]]Ӊ\>LWT,V;D> rU=UsD>HL>PD>HL>ԗ HlV=Ë ; e,RH P H З HLJؗ ܗ lVܗ MULJ D>UMD>ЉD>]T>LWT]ف9lO,RLJܗ 롋З LJ LJ D>ЉD>]T>LWoMUlS.E(9E $µUMjD$1ۀ} ËE)؉D$ D$:D$$SUMLJԗ D>ELJԗ D>ELJԗ D>ELJԗ D>EqMUD>@E싟 ]X] É %LJ ,R l mUUxzؗ Mt ; r tX,R H P H З HlVЋ]!LJؗ }$:fffffffffffffffffffffUWVS0 EЋ( u䋸0 }9E[u؍,Z,Xu썰XuԍZu̍ZEE]]EfLDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$WaDžH V€ʀ UTL@pD$ D$D$T$OM P!ЃLPoo0<$oT$7o01[^_]À Voxo0<$o  PxD$T$ GP^E E DžTED$D$ D$D$$_Džt HƁ Snn0En01  G G=G G !G GD GD$D$L$/PLPP LЃHtfD$PD$L$1H  D$ $PP D$rm8LlPu  P-D$T$6PD ƒ@ u6 h ffffUWVSA& }EpFtD$D$$/F P\  D$4$uc  t$un  T$U4$DžU9B(E kb1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$7.[^_]fffUWVSI& EpFtD$D$$-FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$-UЃ[^_]ÉiUWVS$ }9EUEEEE;E MmG$~4u݋M…tEL$D$<$G7UUD$ ED$}|$4$9uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$$x(t㉇UWVS(˭ð uE䋆EMM܉;E E苷EHMU$H3ƃUtY9Euȋ})lj}苊U|$$'U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$a7u@EE9E 1([^_]D$ ED$ED$$%7l([^_]UWVS$A& M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $Mp6}9} MUu1$[^_]Åt#UD$MD$<$64MU눁 $[^_]ÉT$$%Mt$[^_]UWVS( EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]G5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVS EU EpLB< D ?ZU )ىL$D$$]f}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]jMU ̉EU ]썋L$ \L$D$= $]EU QEU ]썋L$ \L$D$= ${]EU U E]썋ML$ x\L$D$b,= $=]U EUWVS  D$T$$tV@D$T$U4$NjUuD$T$$%[^_]D$T$$o%UWVS 肧g }EpFtD$D$$.%Ft:ta [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSD车â }wFtD$D$$l$F}  8GuD$4$D$ D$D$$%@ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$G;EtD[^_]ËMN$tD$ D$D$$T?Љ!ƒtL$D$$*u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$‹E؃9tD$<$]D[^_]UWVSN3 u~GtD$D$$!GD$4$C uUEu@t*$+u*4${^tME[^_]Ë$tE͋D$$E EUWVSgL uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $U]C1[^_]Ë]C鍆D$D$ ED$T$4$ul}D$$M UtEdžU|$ $tU#DfffffffffffffUWVS ݡƬ EE,E}1EED$ED$$]ƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃MD$ \D$D$b,=$UU]ZE}E9}twu})D$D$$]9utAFD$FD$$]OtVTP‹}u뙋u]RZ}8 [^_]ËEpE )}fG w [^_]fUWVS$葟f uƉЉfMy} ~ϋX9U)ω\$D$M$]BEffEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]39E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]D$ \D$D$X=$ <Mt !EEfEE:M]D$ \D$D$TX=$;MdUWVS$耆e Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$6B…t EME$EPEwD$ |$UDBD$4$A tʋ@f8 $dž ?UWVS,ۄ uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$:UU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍D$ ]D$D$y=$7M UaM D$ ]D$D$=$7M VuM DOƃ=Fu u䍳 ]uDG)fET$UUT$7$%U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$=$5UED$ E܉D$D$=$5D$ ]D$D$=$5D$ ]D$D$e=$h5E@ED$ ]D$D$k=$05D$ ]D$D$b=$4FE!UWVS EE @u E1OftsDPND$ t$D$E$]D<ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃D$ ]D$D$=$(3E@ M]f\Q=맃1fM1UWVS}ò U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$9…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$lUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS|| Eu} 'D$ D$DJD$4$]#9tDPfzuft,ˍ< fED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$UVEZUUT$L$$H#T$ $"GE$<]]fff]D$ <D$D$<$4$ US oy }xsn]f$ZUPKFAfff]2].t&%].&fffUVSxn]y EEEEjuVjZ uǃ d9tj'jj%jVjj'j>'UWVSEE] }3t>u}j/VlZYtpA&t0MPVZYMu}] EEAe[^_]Vh"hU"hJ.<}UWVS]u 6_h"VSX tfu7$T.ۋ=pC.)u}$T.u%h"e?Zt$T.$T.""hjP T. @u5$T.hǔ"j(h*Xu4'hД"j(MUW6ZYMtUBk C&u6h"j((VKSWC&P)UWVS] 3h#j)h#Su@@t h"pC.DP轈DU.ZuDU.6$1HU.TU.E&5TU.E&jjPHU. y 5DU. U.蠋 U.Ί=0-v@U.u h"jE'U.u#U.U."U.E&U.E&hT.HthRPmU. yQU.PhT.HthP5U.ңU. U. y5U.h$j&T.蹊T.hT.u/T.u8U.HTã U.ujT.D5`T.8U.91>Ph"hJ.jU.U.=U.t t7h"Bt U.t+h",t=U.thG"U.pC.jWU.ZYu hn"|;R=U.u6=U.u-=U.t$=U.jWg[^11ɉ=U.u >=U.t =CGi ȉ=U. uh".XZQURPW x%uSh" ,URPWɅ ySh$j-Phģ"jjUWVShu E1E1ۃ}~F8-tEhԤ"T(_th"PZYu 8[.h"*(_th"PZYu h"Xjh"h"Ds!EP耴uh"\0考E_t<1ɉMMMMMMBh "d%! 7Mt&t"Qu+ZYth+"jEhQ"WE)PE @}w}c}6t^%}4E뷋Edwy$L&}8tEKv_7Eh'"57MEXZnEbEVpC.pC.}uCpC.Eu84>tj@uY[t}u U9sUPUxtă}uEE1ۋtPZ\tSVXzEt'U)RPSpSÃ~t C}u"h'"h8%EEZYu ha"K}uEEuh4[.WuuEpEP-u yj=4[.y h|"}tLjuVjhSPy h"%XjVjh54[.Py h"%Xh'"EjuVjpSPjVjw54[.P,uI1ɉM̉MЉMԉM_1M&H>v   DGu΍EPEPjW =8[.t}t.D1}tEjEP4M& Gu褡Ey hkQ#j Vh~f54[.Vh~fSUSMEF}u j u XZjkUE 0NjRZUVSEU tUJ @p.uc1E1ۋ4(O&Vh#޺uUaJ.HJ.Y^yhJ.j XZJ.PJ. Cu Ma1e[^]ÍL$qUWVSQpq1t.x.....p...l.DžDžDž1h<"Vg @I&/0$@O&S'$O&1=---r-cl.jP57ԕ :uy57h"/-p. \....|..14dP&4`P&h"蚸C uD.v.kx.=7j/WsY[ÅtC?t td@tj/S2_ZDžtG;ttOd@tqtj/WZYtA?t(t d@t.t9h"Ot.Ph`.hd.hh.h"57qAu7<t h"jC =h.h.Ph.Ph.h"57 A~!7<u..9sh"뉅.=7j/WY[t4PWs_Zu!%=@u7-Y79rt..6--7.57.-[=~ PPh$"j  pC.)ˋ.=.t . . . x.tcb=p.t t$h\"4t=.t=x.uh"=x.t=-uh"6bKu -n=\.DžtDžxjjVjjtS@t,YtjjVPjS@t=-=\.u4P5-r_Zu%=u \.p. . .1 .t1=.-=\.uRjhhp.PR -y'D8uhp.h">hp.h"--p.-jPR謪- u5-h`#M[^ =\.tRPZY@u5-h"E̋UЉ1ۅuthRP5-h "]M̋]Љȉډ%1 .1\...... .nh.hrdAPn @uX5-h?"fh.hedA5-C@u-5-hQ";^_5-P-[ .1ۉ .ĕ.=.=Е..ȕ..- .̕.?w=...!ȉډ[ ...tJthVP轨- @u=5.h$`5-w- --j-~S螽t.Yu Sh`"j.11k_t n.1q.ĕ..kqt.t#h..d..`..DžDžjjVjjSdȼt.Zu hN"j jjVPjSy5t.1t.X-j/S:E^_ޅtptZYtS_w#EX~ } wt$ t#u t <1󫉝<Ĝ~j2~~Vj~2 9~~|˅u@1tCE 1(1t%@1tE 1v1(,Dž01ۉ4Dž81‹ 3 9r(<,tuxG P/QRh#SV7h#F<57uh#h&hKh#{1k$Q/t!VP ZYuÀQ/(P/kGh#Vh #TFjW7hF#h&hq둃 P/'=pC.u) P/ u=~=$P/u,P8Y@u hf#jDv#= P/$P/Z!Ãt~&t%Ft!á$P/0Rh~#}E  s$P/0h#^EXZ s$P/0h#EE_Xt Sh#0E[^jҀ uh #tth1#Ej^VE uCvBeR0G.f"$L&H $&a$V/V/(V/G0V/1$V/,V/a,V/1$V/ V/?$V/1,V/10V/"(V/ V/1V/V/1= V/V/V/V/ V/pC.)ӃQ(V/=V/t*th#0V/ ,V/ $V/tihͲ#jt:Dž|=0V/u Dž|=,V/t=||)Dž|=$V/tDž| Dž|4²4V/j6V/P+Cx<hSh-m=v Sh#h-莐Y--X/u!-= -vx/uP-@ߣ-1hjXZ=$V/t Ph- Ph- ZY@u賠8t%E%=@tkxtHZxM=V/P6 Y_@%=@t&/h-h##jKDžx0Džx=(V/u1=V/x/lt$PAZPvЀ8/uj|Vyt 1pluv6h$jנlQh- ^Zh-ċCHfuFs iPshfU#3lDžpltP~Zu)wfush9#2Y[ftf tx)-C,--=~TSh-hV#2 o{DsC(huTxtClj/VYZlt)xlhS#>P躏YZlhl>h)8/t z/t/Bс-vPh-hx#1 VPRlǶl- -= -vx/uP-@ߋl=$V/xt Ph-b Ph- ^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-h#1CP@% =@B%=@t,M1@ush-h#1Jl΁@w `||t {DPSsJZY+= V/(h-sh1"DK sH (V/ V/u&fNush#/Y^jSt葀fuV58V/V8V/@V/Mh#hľ&h6kE%=@V豛Bfuk=V/u%8V/H8V/@V/y/h;#h&h?jRmBZY+h&# CPph-;E^XshF#.Y[=(V/t'PR'J=(V/tPRIPSKC{8t h#jtxp?1x=(V/t,V/ 0V/(P6X#x:DžxxUWVS|]u >j/WYZtxht6&W蚋_Zu^h#VSy @uipC.)Ãu]p0iBZY@u jjFje;LtEPtIFu'|f0h#VSBy w~gIfw$̾&1pf0pf0f01tf0df0xf0tf01f0lf0thf0edf0VpC.4)Ã=lf0t`f0-=|f0t,`f0=1=|f0=tf0uf01ɉ df0tt%%V1ɋHP|=xf0xt)SW_YZuE%=u vSWXZt Wh$j蜙E%=@9tG ÃSS=XUWVSu 6('h#jK_j豩ЉÁt1hhs%Vu@w tVmtDžhptc57F*Xu57hN#jјhW(tWZ 딡pC.E%=@t q"st/$tSK@^Z@uStSZYy7h$胮[^DžlOt?t7?ZY@)l;UWVSu] 3$h#j] hX#SV%u tUit)ft5huT8g0σvuC0g018/tj/WZYtPRd蟃Y dv1Wh]#'XZDžplt5>WcZD@PRhn12i p p8UWVS@] 3"01J.Su]Sjj0uEUEUSjߥ^_SjE0ZYuEUEUSj軥^_Sj!0ZYuEUEUSj藥_XSj/Y^uEUEUSjsXZh#ǪH1411=81=<1=@141P]1E؍}ȹEľ uVSj躑xVSj誑 x"}ujVj葑 y}tVSjv xjVjc y}tVSjH xjVj5 y{}tVSj xjVj yP}tEVSj y1jVjؐ yVSjƐ xy y譑h#0j$ ^=-tUjh%%!7-[^y rh/#0jX1 #=-u=x-t Ɗ@h#Yt8u`"VwZÅt @|/tCPK,1_uhU#jtX1ZYtlj؍P(1/hHg0Ah) j- t! ttBGuBٓ@ƌ9=Pg0t h#j赑֑=-u-at X1X1e[^_]UWVS]u 66h#jYW 1h$VSmo tLtPt9pC.th#{_8/u|h#P0 Y^ukh#S _ZuZPSY^@tHxPh%%_Z@t2|9u;xuM9 u;EtjjY^uj SDhJ.\XZJ.@t h"j>j 4UWVS}] 3h#jV 1h#SW.n ft]/WPtwR)dD1벃vtbit6rtxu{$1<1181p1<181Z41K,1<(1-pC.9=<1zu8Quth#!Xt@1؋Ht ʉA?jd01[<1 81u t1=(1t =$1t@jPWfǃ uh8#C =<1t.u)WkXCHHf $0&PDs VPshfU#jZ=<1tC ƒ?uts VPshfU#@1k=<1^KPSC8HjSWHpC 1ɉK +{uD{ u>=<1tCHSft\wlfucKPSC us跞Z=<1u&sh$薣@1Y[Ra28X=41usZuKC1tl=<1t݊8Uϊ8?G8r4,1  1#1 1s+@X舊8t h#jWMh[\xVS-¡(1YYu3t>jTPShfU# @1_uEE%=@u"=D1uShH#@1Y[뱃=<1u=uE%=uS02ډ uv=@uS=41u StZtX< t?=<1uSh$赡gN8@8? 28u=,1S>X5@17.1e[^_]UVS@jj ^X1EĉEȉEEjEPjG- E9u 贼9EE`1j j.Y[h1H h1j d1$#jOZYh#V-1ۉ]$h1x ^Z41tt3Hu:P1.1111E 1P141t.U=-v=1i`C=41tEPX101,1tA:-HyP!X-H J h-!X.EHm811611At)EPXu uOXZu u-Y[}um=-t,Eh#^E=`1u PEuE=-u}rEj諹^=-'7=`1u -hh#^/[u|&jh#Pj薿ÃPi$޼Y|=V-uL=`1uCEP$#/Zu EPqX8tEPJ$ XE"11ۀ=n-t$=1uEPX1n-u'j4&^XC̈́RPX5ZY=n-=14-"15P1hO#{ $-XUWVSpE 07h#jZL1ۉ]tC. 1pC.] ;E9hm$W6ZYEW+t_9Euphs$Su/d tZftatDeuI렃gu=j57*EZYz57h$j誅^pC.E ]Su>\ZYy hy$yEPhBt @umc y h$jX}Whht@uJc y h$GXEPht@u'c y h$$Xt$FvE 8uVEPuWS.[SR^1ɉMME 8URu V8XYZURVPYZuURV-Y^ZuoE 0R.DPt"VLUPS 6VSf6E9jh$Vs uVSYREZYVh$GcE E}tSju蝲 y hR#j}t Whgtua y h$Xj'UWVSu 6h#jI8$1 xo<$111ɉhdtlp11ۉ`jh-hP$VuW`Rtf(LtntMH1һ뮃PthtPdtXfuuDžl뇃vudDžds=7hDžpYMDžt@Džh1pC.M)tIu uapt$t*tt hY$j1 t)ˍ4D$1@$1>=<$1tzj:WDYZt@0j.WVYZ`t!hD$1W_Z@`u Ba>t0<#u@%0aD$1hD$1WZY@u ۉra8xPWZY@u Whh#jx=<$1tED$1E@$1jSV=Zǃ tl`1hy#>pu jSW^d W_X CHHf wg$&s MJPshfU#hDžl=s #JPshfU#>ttDžl  DžlD$1ht)KPt9Qu@$1t;Au A<5@$1RslЃ t"`tsh$;Y[dsU4Z~8t h#jV#UWVSu fH1H1 H1 ʈH1H1[H1 ʈH1H1H1%d$1fH1H1h#Õ[tah$试Y&t7GtPS5oYZu ^`Sh$Wh$j~1ht$Vu] A6$@&H13h$1H1H1 H1H1ˋ=7h[#WwnYZuh$$W_nYZ<_댡7_j j57]ǃ u|8"u 57h'$D=H1Ej j57"ǃ t =H1!z|8"u57h@$j}j j57ǃ uE|8"t=d$157hY$뺸l57J~Z@_PH1H11H1yH1jH1_t9t a d$1v jh$uh$ H1tt h$jl|`$1H1ǃ;=H1u/;H1u"H1;H1uH19rt1= -H1H1  -=H1tuPu=H1tpC.U)…4=H1tt  1LjhhD1PQ*PLy hD1v=H1uJLxPPQZYLu&%=uH1H1w($&J$H1PiJPuh#V^u`"h$Phљ%hS&'SzǃuSh$賑Y[h^$PBXZthW"hD1hH1V贆5h$1hH1V VvFX1\`dDžXhVXPjR Džy0x8#tjVj0hkQ#j9B_jVjωP 贉P莊h`#$ƃu$SVh%TP-Tu h "jjPhn#hu5%hu5%wÃuV ?YSxTPZ9ujVj]TH h!Q#V*LY_uVh$XZH1e׋H󫋅L,hLDXtPBtDžu V?[gh$C&hJ.DDJ.HDJ.ZYyh@J.FX@J.P@J.0t- t( DJ.y h@J.E_@J.P@J.΃߃NP訪^ JPr=lI1u lI1 =pI1u pI1 PhH1Y[JH1H1P=r=H1X=H1t H1],hD1hH1hJ.襃5h$1hH1hJ.hH1_Zxd-h!Q#v([_uvh$jLbf1JPhmdP1q h$jv^~WwYu Wh ${H1eȺH1t jSR9 hH1_ZIPqWUWVSjj]Sjjh&<@u hC$juu/YtjjSPjh&]<@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ;MQh$1#U1G맅u) J.yhJ.j (XZJ.PJ. 1e[^_]UWVS ƅ]-ƅ_1ۉJ1J1J115J1J1J11=J1J1J11h$u uR ycPtJTtgxPl$& pK1뫃 pK1q pK1 e pK1Y pK1M57ExK1Ye57>Vj:V7[Zuh$SHJ1t)XV3dZYXu C[ӉJ1=J1t h?"js7tuhd"1Ҁnuxou-h%P^_t#J1苇֋=7u pK1i#7J1]Owph &Ph$hJ.f$j^]tK1jpK1t pK1t xK1pC.M Tu)tP1ۉXhU hcT 5xK1P藏XRrRh#RL~bZYTLS訌jjLRPV9X}XTPT0VhPà uj/S=ZYuSh"h%hS1VXXu"VXXu9SW^ty2LhVpà LVh$juh"LRbaZYhT$LRGaZYSh$jjhVjSeǃu Vh"$jphJ1hzd@PN uWXPK1`PhedAWN @uVh3$WV^H__9~VhQ$( jh]Y[1ۃ}=R1uP5PEXZ PEX}u6h($+5YXE tKEPjW64y6h,($艃XZ6EuO5UY9ËM}QZU܉9}u%.MXDT1t؍e[^_]ÍL$qUWVSQ`AT1l0#iL΋HƉ1ۉDd 7tPS`ZY@tEUX\f1ɉjpPS(X\p 9u>f1҉jjSX\ \]XP8u|f8u:mf8,ShV$$8pC.`9)ЃPu#@pC.TP`9PpC.T@&@HtPS9WZY@u֋Hxu ShV$Sh-hh\1> h`\1>hh\1>XZUh-3?XUh -hx\1z>hx\1>h h\1}>h\1>UWVS$1t1󫍽p-tT1k8]1u;JDž]1AuRh-_^@uhq$h`-_[@u hq$jchx-^YP-@uhq$ޅtsh-_XZ\1\1\1}t x-1 -ƅh-u ubAǃ z=`Ntu&At/CG$@'Whq$\_Mb1Lb1wKb1k\1-Z\1NJb1Ib16\1*Hb1Pjhjjj j57;Db1 6Pjhjjj j57y;@b1 57h&o\1D9u:ƀ\1z{k Lmm _$'-L-B-6-*`- -ƅ--=pC.=\1uu =Hb1t_;jm'<^+=\1=\1=\1uu =Hb1tjL;Y\1t Hb1t t Dž PPtVSE PE)PpZt蜴Džuh 'hm$PV [ @u hq$_t*HkttWPN*XZuh 'hr$GSVHS,YXuV_Z@u h 'hg$S*Yuh 'hg$j_V:Zuh 'hr$jI_@ uh1r$h 'h*WSй%1󫍅PhMr$SAuhp$S耶_Xuzkh#%SkZYuhs!&h'hqPƍH_v󤍅PhiS a @uhXr$uYSV-jV8Z thhr$h'hihj$VV;ƹ󥍅Phui S`@uhr$Ujm8Zt h 'j)^hU) hPb1+8hPb18 Uh-hdb17hdb18h> htb17h> hlb17htb18 hlb1*8XUh`-hb17hb17h{H hb17hF hb17hb17 hb17XUh`-hb187h-hb1)7hb1W7hb1M7hCN hb1"7 hH hb17h-N hb17hb1I7hb1$7hb1P7UVS8my h$sYh%5:Zy hȀ$sXjhg$q[^]Nu[jjphڀ$p u=jh$pXY$u$jh5$h߀$Ph"hu5%j 7jSP @t-Et Ph$s^Xjhg$epZYtj HYh$rj 7Y -Pb jj hBa v{jjjj j jjjha \{0jjjjh` G{jjh` 9{EEEE jjjjjjjj j j jjjuV*8jVjc1EEEEEEjSjXjSjX$j-j&jEE EjjEPEPjEPF!ƒ$BubY8b1 -te[^]UWVS]} DžhDžT1ɉL11PXDžDe h]$WS^8 ubfFt/RODžPg7$T'57DZu57h$Xu78#t57#Yu[ j dR@Pu d:u&\!XHt`\6Y[WV`\fAhT!Bt*TP\ @u\h$kXZ1e[^_]UWVS ]1XPL1<'1Th@$u S1 Aa$'c1뾃P뵋7:tX8}띃P딃Tt h$jS57蹇T=7XbPVc1KP?DžL+pC.)1c1c1tc1Hc1E 4Tt<}P6m_XPt*u{\uO?{\u<څ69X68X6ho$jQLPG9^Lt 0hM$V BZYuL1C \äS8XuS8XUWh#RTAZYt:h"TRAZYt#hT$TRAZYt 6h$,hM$RT\AZYTu1uz\uz\tٍw_G TRhPƒ uPh$jjjTXP6hPà tTh$6Y_$uxjSXZu3O8Sh"$j9PrjWXZ5hc1hzd@W. W5Xc1=c1NjjjjXPډzÃ&5ƅ ~h#W?ZYt"h"W?ZYthT$W?Y_uTv蠃_ZuF %\yu>hM$WS?ZYu%Fx\u vhX$WhPƒ NFjjLWv XPy j\P)^_1u?h$jNi T\P赂ZYu \$F9|1hSW/W蓐tPRT;$t5 i1i19sSQRPhc$j@ÃtYtUi1i1ȋ5i1RP @u5i15i1h$j@*"0P%_Z@uh$W[^ =j1uj1u h $j(6tX uuh@j1h"$u.h%P$&^_@j1th"Wh`.'j5@j1t(j11RP5j15j1}j1j1j15j119|z<@u t#j11RP؉ j1j119| h>$t0 j1j19sSQWRPhc$j4tOtF j1 j1j1%j1RPy @u5j15j1Wh$j4*0PY[@uWh$fKXZ atjPh$ji}tVSpC.)ƍH3=Ѓ3tjjhvx%輶3 >Ejjj" 3jURh@hPET @u h!%3)Y=3y hk&j ;u=3! . WZ) '    ms / =3t1ɉڸo1ɉMhjE؉EhjE܉EhjEȉEhjEĉE hjEEhjljEhjEMU ʃ} ʃ} у} хuu h8a#E1҉38gtj53ܶ_X1ɉME#E#FEȅCEċS:-%BRUIZH3U$4'3"0-30-30-30- o3dY3J3;30(  @uCEċSEP1ɸ uCEċSEP1ɸxuCEċSEP1ɸSuxCEċSEP1uXCEčM̋SEPECEu$CEċSEP1ɸX3uCEčU؋CjEusuċs t^p3hw$X5']1Rx3F3:3 .3@"33 h3 @3 3 3t `3 d3t13jjV街1s R3uM̍EPUEuM̍EPURYuCh,5&s^Z=ԃ3uh$h$h%T 3DHw*=ԃ3uhɳ$h$h%" 1ۉ3SEP1ɸY]ċu3Ã]uh$1];au uh"$33t]ȉ]th@$j uąu}t }ċ]=3uMEȉE 18E0 1҉31atctguTEÀ3EģȀ3€303@03Ԁ33̀33`3@33tyUU9sHxt)Ј3tKU؊B<w r7ED T 9sJU L }؍W9sIH 833tM}tHpVWh83 =ă3t =3t83X$3tKMtHxWQMV茦 =ă3t =3Mte$:3tKMtHxWQMV8 =ă3t =3Mts$3tKMtHxWQMV =ă3t =3Mt$3tKMtHxWQMV营 =ă3t =3Mt$>3 tKMtHxWQMV< =ă3t =3Mt$3f53=ă3t!=3u=3t3B=3Vh353] u(187t'Ph$Y^9~kPh$њXZu83u =3tH8t܃3 ؃3 ȃ3 ă3PSV 11ɉډe[^_]We[^_]UWVS }h$PZYƅh"u W t.at"t=T37T3þ뼡pC.)Džt>upT3t&hC$S9^_th$S(ZYt2=T3u)U @3ujOuSh$hJ. Sh$hJ.j苩=d3u.d3h,$u W t@A3w$09'z=d3ud3먃=d3ud3듃=d3ud3{=d3ud3c=d3zd3 GL38`3)\3`3 =d3"d3@`3D3H3X357 @3X=d3d3=d3d3j=T37T3h%PY^>P3/=d3Fd35d3)pC.EU)tHt:t#u =X3=L3t =H3=T3tEt hC$W,YZt&h$WYZth%W _ZE U @ 7@tCƀ5\3jj5X35`35@3e5\3jj5X35`35@3c>5@3Sj ISh$j@3W=P3jEPjA @u hB$EUuuh\$ε[h`RPӃho$t S裵YE  1SQ%1RPh$ۮf1=P3tTph%V _Zt)h$VZYtuSh$膮j Sh$wj蠤j虤UWVS u] 1hȽ$SV tRtfu23ֿϡpC.9td1ۉ`XVSWZYVxPV kZY%=`h=@uvmu^Ph˽$U[^Dž`ddPhS荓 FSh$j0hٺuٺÅjhh$hV藫l=3u Džp$lPVP}ZY8t Vh$^X53S谤ZY@Sh$`e[^_]UWVSdGh#jXZE 0d1ɉ ̫3E4n%E4n%1ۉE4$$^u$E4W4W4W4W4W4W41ɉ `X4 X4 W431ۉE4E4X4X4X4150N4,N41=(N4$N4N4N41N4 N4Ы3E43h$Xt/hSh3+ =vj?$Sh$9"\3h#ZN4u N4`"h$z_h$P1Y^u W4h%S_Zu15W41ۉW4Qhn$SZYu W44h%S^_uW4W4 Sh $Y[h1$Pl_ZuW415W4hy$SGY[u W4h6$ZW4t8u W4#=W4tW48uh@$jX1W4h%E_thH#P[^1ۅfNJ.ftPYdX4X4J.fJ.ftPZt!`X4u蠡t X45N4111Bh57h3 =v#j?k$57hfU#jE4U Eh/$RP HP̃D1$0:'E41=W4=W4PAt_PVhV$1ɉ 3 3hh#' ^t8t PZ3uP蓙Xu;PXt߃=3uF t8t P_36{Y3=3uy3uhг%YZ3ghPh3 =v&j?^$53ht$t 3hhl$h3 =w=3tj ~$ h$Ps j h$VC h$ X$xh $ X# $\h$ X#$@h$ Y#$$h*$ _#*$h$m XՐ"$h$Q X$#Дh$5 X#3$贔h$ X#;$蘔V}j谼XZh j1Y^h j#_Xhr jXZhr jY^h j_XEt7U ESRPWà ̫3uSjj踠_XjXE j:0軶[^t*E 0bYuU ERPXVXZGjh X4v^_uhNjP^_hj BXZE 8j@WNY[ƅt @hPS% E @1ۉW4t1ɉ tt1j5e4ehJ. t h"j54芒UWVSP}1ɉMM1hb$u W t3gt!utGu.7E7;u7E85pC.9Tt3S誐Zt@E%URMM@uShi$j1}1ɉM}t EE1}t6h%EP@tYZt"8tu h{$jGRDʋE 46Z@u6h$jh%%Y@ttEPW_Z@uh$}tu裓Y@u h$j>tuZ@uhH$FtVRPfkvh$jh#rXuu5%jh$SS@Sh$jUWVS] 414H44%14h(£4a1X@'lt2Ft&V =4uRh4蟚Y_ RvP 44444h%yZ1u"hJ.hTr%tjGDuG 4hs%Su tsmtW~ԃptXrthJ.hr%+j臏ft$Cuh4h4hr%57W#뚡7KN뎋574w>rxPhs% ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%ubusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGutf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260212162339Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%jx %*jx %*juBKMGTPE%s: %lluen_GB.UTF-8 (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: Long_Type: %s Attributes: %s Could not find index %dDetails for index %d: StartType: %s (%s) None %*s index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]gi:b:luaxAhHpW:wGPT not found, displaying data from MBR. %ju %ju %u %5dshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addresspltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresvvmresered/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: ND options: DHCPv6 options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %snd_dhcp6_unknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completemulticastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s%s%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist