08Pྈi'&<  'ྈiVP''`''. '.ྈi'&P@@<@T 08Pྈi'&<  'ྈiVP''`''. '.ྈi'&P@@<@TU ྈi`''.yAྈiྈiྈiQ$f ྈiྈiྈiRAྈiྈiྈi]Aྈiྈiྈi^Aྈiྈiྈi_AྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈimKJ%ྈiྈiྈiX`hpx$ྈiྈiྈi (08@HPXS$=ྈiྈiྈi`hpxP${ྈiྈiྈi[Q$ྈiྈiྈi (08@\IAྈiྈiྈiCྈiྈiྈiAྈiྈiྈiAྈiྈiྈim<ྈiྈiྈiHPX`hpx\$ྈiྈiྈi$ྈiྈiྈi$>ྈiྈiྈi$ྈiྈiྈi$sྈiྈiྈi$ྈiྈiྈiAྈiྈiྈim ྈiྈiྈi$ྈiྈiྈi $ྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈi$Qྈiྈiྈi (08@H$ྈiྈiྈi $ྈiྈiྈi$ྈiྈiྈi$ྈiྈiྈi$ྈiྈiྈi$ྈiྈiྈi$ྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈiAྈiྈiྈi5;2(w`(5L_!835ΝGcLأ~h'29>Vgr̈[@N%;AwcCs83$Ƹ(G :vέ`7Bmaya5P%D'. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF@4F%4 (@@**""\\^$^-^-T ,,^$^-^-NetBSDKwGPaXU@SRHffffffffffffUVS( _-9s 9r[^]UWVSeZ(]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*thx]9nUWVS(E@@9s{*3x;9r[^_]UWVSbW(E u C.M <9ME @E -t/tu^-9s 9rEt E$7Ll$)L _-9s 9r z"$LED$E D$E @${x$5F-MD$ D$ D$$1ɉL$K$f[$SW(5u1ƃ5$tЃt$^$k_[SWâ(4uYƃ4t|$$^<$wkt(?t<$ZktЃ_[UWVSh"h"h:.dR 0&1t:PYxOvh:.j 7XZ3h%h:."R h:.j 6jDUEU MsMU HE]vUVS1ۋ݀3&tVP腐ZYu ݄3&C܍e[^]US蝝Ph"h:.Qh:.h"赞3& CtsPhׁ"h:.]QjCUWVSE tuhށ"i2URhc@5 D.}¡$D. t Ph"j褟u#~h#]]ܻ#}~h#U#~h#WVSuQRPh"ME t#~h#RPh/"L u5$D.h="L1e[^_]U5 D.9DXUjhc 5 D.| t5$D.hV"jӞ1USRj EPS xU:t Shd"ju]UPEU Ph}" JtPh"0EEEPhc5 D.V| t5$D.h"j81UWVSSuE H1ۃv>PW&ZYtC`3&uދd3&Eh"WZY1tFEEPhc5 D.{ t5$D.h"j覝1e[^_]USu Sh΂"jU]UVS1@4&tSPuZYtFSh"jD4&e[^]UWVS ]u} Sh}" } ~Sh"/}1{EFE} t!v"H1UWVS`] u~ uh"Uȹ1Rhc@5 D.xE 5$D.h"jB.DPEU ЋU Шu>M9Mt65EE1EEEK>tt,uh"+1}}}}}E뺉t9Wuh"jU9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4@4&5$D.hă"FF }t*}uuuuM9~VQuh؃"j*1ۉ]Ek]lSQEYu h"j1}E1҉Uuĉu܋uu}}UUMMPh c5 D.u u EX@1}WuY5$D.h"jEuPE4@4&h#"]ECE rh+"K^ElU9U|C.<EC.]"rt9U}I}s}u,@)1ɉMMf>hC.hp$DXZCtCPh$D_Xj C^CtCPCPh@"D CtC"PSha"pD Cts؋C4@4&h"PD C$Ph"7DZYu-XXEw1e[^_]UEDE.]UEE.]Uh"jUh-"jUhD"jUhZ"jەUE E EE]Uhjjjuho"kcXD.\D.Uhjjjuh"@c E.E.Uhjjjuh"cLE.PE.Uhjjjuh"bpD.tD.Ujjjjuh"b`D.dD.Ujjjjuh($bD.D.8E.W/XuWh"j=SVY_u Sh"j躓xxuSh("]hjjh4&EP8uu뺋hD.#H t uhB" PhD.WPZ_hD.t(#=t hD.t hr"%XhD.ƒtuh"<t?%t4!t$t hD. hD.ڣh"jƒ xD.e[^_]UVSPD.uX$E.D.(E.,E.D.D.;D.D.rgjD.$E.D.D.(E.,E.X=50E.u4E.E $E.)EU}t 13A}uke[^]Ë(E.,E.ut D.D.Uh5&hp$jґUUh5&hp$j趑UUSË@4URs(PZYts$hp$j諑S4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@u 8uK ]USQ%9s SJZSPEPKƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h"jC4WPs(Xe[^_]UWVS]uVh@D.j3C4uu s(P(R8jVj3$>8؍e[^_]UWVSD.}t D.D. D.D.EUEUEU}uHjD. t?11ҋ}9׋M} ytEU`E.dE.E`E.dE.ut(jRP5E.E.P Bu@u 5E.h"MuShD.Ɖ 19|8uu5E.h3"/-8t5E.hp$j`11`E.dE.utTU܉EE܋UD.D.5D.5D.RP&D.D.D.D.1ɉ `E. dE.5D.=D.9}u;9uu6E9D.u E9D.tD.D.|D.D.lD.D.9}u9utTE.t%=XE.uXE.5E.hE" XZE.t5E.hi"j)u}D.D.+EUEUD.D.5D. D.9uEr uM}u}tURD.)P5D. * D.D.D. XD.\D.ut5D.5D.hD. ;D.C;D.7벍e[^_]UVSˋ |E.yQj h#RPVuVo,VShM$4(e[^]UWVSljӃ=E.t%tPhЉ"h VP3h PV裓 =E.wwVPh؉"_4w$w wwwwh"C40wxw2h"8XGWO_)Ӊ+G(W,ȉ=E.!=E.th"h6&hC=pE.hȋ"h6&hDh"S|uDž6&t1jj@PwpE.tM9މDžs,11RPL1󋍤tM9މDžs,11RP}L1󋍜t;9މDžs11RPww 1ƋG_RPPh֋"/(=E.=E.t w>1F.F.tP5F.81҉F.YX1F.F.F.1UF.t*P,CF.ZtP蜩5F.81F.ZYuUjhhI.h@:.\2 tjF.F.F.F.E.@=uUSUE F.E.F.ME.Ћ] Ӊ)~E.@[]Ã06$6&1ølbXND: 0 &    t øUWVSӃu]1G.2G.G.@ujjhG.hG.thɎ"hp$<Y^G.G.G.G.`G.)G. G.1G.2G.G.@ujjhG.hG.ithɎ"hp$1<XZSjjhG.8e[^_]UWVSƉ׀:0BtjDG.u DI.C1 mCE @G.98I.؁}ULQM5DG.(ZYMUuX i0z3Phn#h:.h&18I.H8I.t $I./t1 @G.DG. 8I.u$I. u DG. KF @t.uh02Phn#h:.h"1ttDG. !uh"FPaY_Vu P*ƒ u$d0.PVh9,&h:.h6"RuSRUǃ Uyl>!u7RrZy4c01.PVh9,&h:.GhN"P,R1ǃ=,I.uWh"h:. tE)؍X؍e[^_]UWVSW11 D:.yh@:.C2^u@:.P@:.s=TI.9 XI.8I.؁}U|WQ"ZYUu[b0M-Phn#h:.dh&m+8I.H8I.$I.tjJ j! =TI.XI. 8I.u $I.uΨu١XI.uDI.1ۉ߉ uG.XI.0XI.PI.uL:.@t?b0,Phg"h:.hr"*f%L:.1PI.-fL:.9t{t XI.XI.PI.މe[^_]UWVSWPI.C{ u)ÃEPI.<TRP Y^tELG.9HG.8I.ށ}VR _ZuZ'a0+Phn#h:.h&)8I.H8I.t1$I.tjtjk 5LG.HG. 8I.u $I.uҨu١HG.5PI.ljD s} us*ExtXI.M| thr")[oELG.9~VHG.8I.߁}WRZY=LG.HG. 8I.u$I."%HG.25XI.NjM}t1s2PRd¡HG._YtD } )s!LG.9|X HG.8I.؁}tVQ@ZYK5LG.HG. 8I.u$I.svHG.Me[^_]UWVSQ]utuh"XZ} 9EueF95<-}h:.h!%^^XP^w<\u7\>t.ˆUPh""ZYUtF-"" /B000CL 1e[^_]UEH!$I.EPhht@jl= x$Efv@-Efv<-U=G.uEG.E G.G.G.~9 1;H.~hr%]&XUWVSH.}t~} t 9H.~[C ~KH.tIS P>ZYtF=DI.tj jvPjjjWuZ{u19H.uh"%X؍e[^_]UWVSP]U u hr%%XU19H.~BPSYX%KMH.uSwPux?]9tWsZu̸1e[^_]UE B.DBuh"%XPt[jH.t P&FXPPj/ƃ t9u =@I.u5!5G. Z PI.뛃=@I.u 5G.5G.WZYu5H.릡H.PP_XuPI.Hnt*ptlt PI.8 tK PI.̃=@I.uu 5G.5G.Y[9H.;H.@H.=H.PRPY[1PI.Hnt*ptlt PI.8 t PI.̃=@I.uG.G.9 RP>_ZBPI.Z=G.1Hnt@pt)lt1 PI.8 YWiSP+ h PI.뻃H.PP[^CPI. Znt1ptlt"PI.: PI.ăH.PP6ZYG.U=G.Uƅ=G.Uu h"G.;H.G.=G.9|9}h"pu PI.PI.Hnult PI.8 tσʃ=@I.uPS?H.PP]^_PI. Znt-ptltPI.: t\PI.ȃH.PPY[PI. Znt>pt)lt/PI.: ^P5G.5G.1 PI.뷃1=G.\Pnt,ptltPI.8 tPI.σ1=G.u7uD-G.=G.H0V PI.wr 8 t ك=10j hPI.5PI.)\I. vD$ptruD C@PI.3c>8"uh"1ۉI.6%I. tBPI.8 V=I.uh‘"Yu8 t 1҉I.x uh"ҋ5I.8I.tt6]ƅu+ 8I.$I.tjbrj9I.9t'tP|5I._X5I.G. 8I.u $I.uutI.ƒ=@I.u!hI.hI. ZYy؃1УI.t%I.S<[t<\t.RfZÅu!h$ { uh"*[1C뵉) K.9=K.8I.Ё}UtVWZYUu[$60Phn#h:.h&8I.H8I.t$I.tj\jg5 K.K. 8I.u $I.uΨu١K.5PI.ljPI.=DI.tj jRP9e[^_]USPI.< u h" XH< u=K.u$h3"XJ PI.R8tڀ u ӡK.PKXu1K.t=G.u PsX9jK.Yu(40EPhn#h:.\h&eK1҉G.50I.S5K.¡K. t+h'hI.PRI&5K.w1K.R]UWVSVPI.PPI.M1ۀx%u8HuzPI.=$K.h‘"[s9}ePI.PPI.$K.PI. \PPI.$K.2<  K.PI.M8 u$K.8I.ف}|WR<ZY= K.$K. 8I.T$I.tj8I.H8I.j$I.U5 K.$K. 8I.u$I.K.$K.$K.e[^_]UVSVu] 1PI. u 1ۉK.UPI. Uu 1q8u@PI.JπwE11ɉj hPI.5PI.#O v18"uh"'1Zgu@PI.됸e[^]UWVS 5$K.]K.=K.}+$K.;K._&M 9}y;M)9 ڋEE8I.}RUuZYUu]00.Phn#h:.Eh&N8I.H8I.t %$I.tj%tjK.K. 8I.U$I.uΨDϋ K.M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEW8I.}RUuUZYUK.K. 8I.u$I.t K.M9u}EMELE B19uu)d9|T8I.ځ}tVuZY65K.K. 8I.u$I.adK.Cw9|T8I.ځ}tVuWZY5K.K. 8I.u$I.K.؍e[^_]UWVS] SZ=DI.tj jsPӸCjPjuLt 1E1 K.}t9U3 98I.ށ}V5K.Y_u[7-0Phn#h:.h&8I.H8I.i$I.tjQjz5K.K. 8I.u $I.uΨuك=DI.tjj ] K.NjEpSP  9~U8I.΁}V5K._Z5K.K. 8I.u$I.=DI.tjj S舶 K.Nj󤋅  ?u9Ћ)ȉË ؍xK.9<t ttjPjuIIo8I.=}tV5K.ZY5K.K. 8I.u$I.~2 u)u thG"HXDžS=DI.tjj S, K.Nj󤋅 K.f Qe[^_]UWVSH.G.HH.1ۉ]1G.+G.9UH.@H.P藯uu PuƃUH.PP[ZK.3E8I.1SȰYu' 8I.$I.tjtsjH.t PFZPPjƃ t9]u 8I.u $I.uuEH.GH.E  Euh"XE tu RR x1e[^_]UWVSH.EH.E=L-t =H-uhb"FZo=(K.t e[^_])e[^_]UPEEjEP54K. US#h"Ph"h:.BjUWVSf@8uVu1Qy$1҉hW3à T$8#)tSWVX e[^_]UWVS} 54K.fDž<Y#1҉uJhPj, u#8#8th#-ÍjjP @u{#8thϔ"j$f8utSVWr yG#8#Qh9%)AjWjRfDž=8K.t fDž9DžjRjb fDž9fDž94K.jSV( @u"8tfu ftR.@ufDž=8K.uK"4K.@uσfDžftv@u KfDžMe[^_]UWVSQ}u VWY[ZÅuzjj}XZu h "j#;s jEPW6?ƃ ?tE8thh"j"!8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19}9xu90u,]9Xu]9XtyB݋EEEE19}9xu90uU9P uU9PtGA,Ck,QMuZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRP Y_}ËBt1UjL$qUWSQ-`K.v=@K.ڞv]=HK.]5TK.5PK.hՕ"js5\K.5XK.h"j[ 5dK.5`K.h"j@5tK.5pK.h"j( 5DK.5@K.h3"j 5LK.5HK.hI"jE$h_"jEPP$hx"j =xK.tJ=u@K.1 ujeY[_]aÃ=xK.tUE Puj UWVS}u _Ph"jI3.K.B9tTK.e[^_]UWVS$ ]5K.t(VC $V臏0Y^ugh" j0Pu =& yW p4$30ZtWVP u WhΖ"O5=&jj0։( y0h" jju ։ƃ A Wh V=&ƒ jjW=&‰ V=&h k_Xuh"j[^jh h R(=&y R}Y߉RfZ=t*w=bt%1=bt" =tu h>"11 Њ Јt u hJ"jYu Vƅ/ t jZV8 jZVPq fjjP% K.2tS SQPR(c%,9kPƉ4W8t t10hb"j+ ^9s1BFu h"j 1e[^_]UWVS\]ƍ}ZE5=&(,%%04u8jEPSUe[^_]UWVSĀ]p$tV9V/9Y^㋃p tVf9V9XZ㍅xP1RPuu߶t5-9ΉЋt}"Q75-VPh"1e[^_]UWVS] }AƉI1RPuuKt C|WjVȃRP<tCuPhė"j*71RPuu覯‹N tvkk ыEe[^_]UWVSTERELIu EEE EE؉1 t1҉Ƌ] ڋUӉe ƉߋEE$EȋEt\EU 1 t1҉E܉UEU}9}}}sE܋UẺU1}}t 9u9uEUẺUF uuuE,P# E =K.E ‹EJu EDEO1 t1M ϋEe ʋ}t}\SQE,#hz#5K.Ãt#EhSjPVHt h"t^S Y`K.dK.E0PK.TK.E<1҉UEt E\]̋u)։]uEEIu E E1 t1WVuuȭ9E #E1҉ t1EUWVRP蓭9E EEEEuűE,|"Eԃ Et8"EL0wEԋPatELhaRuuPh"3CPEԃP2‹EԋXX9t"ERQuuPh<"jE؉EEEE̋UЃE܉U1ɉMMMċEE}$tWW}9t }O]K}9:t ] [}19]9Muu܋E,!EujP1Eă1EEËEt@d9s+tNjuE‹Euu}OEJUEMQRPuEPE]tXpXjuL5XZ9u9]EE@]k,PuËEY^k,tԋUEVFF E܋UFVEEtP4@0P,@(FVEƒEt@P@ltȉF Ek,Dԋup(ut H}P$]GVEXE`1 t1u}tE]9tE}?Et\]̋u)։]uE‹EyJu EE1 t1WVuutPuuh"jEtP @@1ҍMQRPuEPE0ju231ۋE;pEE9shI9uEtpp Euu܋E,ujP-EċE1 t1u}C놨u  EE]k,Pu8XZu E}ȉ81EEE9k,]Kt[ 1ۉX]]u LL\HX M܋]HX]]tK0[4K([,HX]KH B9EutC E@ b]k,D$uu܋E,{ujP`,EċEk,Z(EiB$ t1EUFЋ]EEt  E}U}ԄtOO9M}1ۄt_9]u 9MGEt\ű})׋E?E9Iu EvEEÉ1 t1RPWV,PuuSh|"jQE]ȉKEԋP9Ut,E:uRuuPh"jE}8E}ȉ8}u}upK.tK.EE܋UẺUQEe[^_]UWVSuEP %F VM]_9EEr )ӉM؉]܋Fƒu]uFt 11ENjE9sPu h"j<N͉1+MF@UtR UR)M]E9s )E]1]9؋]sU܋EЋEÍEeM1SQRP艩FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW<}EEPhE=&ƒyERPh"jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QYRPh/"1ɉM؉M܉<EPURvSOE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]P<E1Em}@K.@K.HK.HK.EЋUXK.\K.ẺEMEPh=&ǃ yNTQWPh@"0FPh=&ǃ yN"QWPhf"j 1eY[^_]aÍL$qUWVSQ9qK.K.,K.K.?1|K.K.1K.K.1h"VW ta#DtNJC7K.뷃b$=&K.K.CxK.CK.u57K.e57BK.R57K.@K./57|K.K.57K.X7K.h:.h" YXp3.)lj80h:.h"XZ=K.x8th"5K.t hQ"jtjj)h "h+jj[_@u h"jj h "`hj00h"@P@ uh"t|j/SZYÅu@]@K.׉hjqhjej`$8K.PK.1urh "jj%K.؉8hDj}803PtP3h("jW5K.HOG9=K.=K.tf95K.~WK.4!F_烽(ta1ۉ(,,9K. |K.d=K.tjOK.xrPK.0jK.dh1҉ldPh K.=&à t$8: ha"j1 1ۃ=K.*;,K.,@XRjPjj(($tLPhI"DXP 28rt)rz rz04z('JJ 04zh P&UPK.TK.f8ZY9tFS‰Yt"Ph^"jh jPh"9 Phw"jF ‰Ju tH‰R840Ph"1 tH89s`u[1 t1+049Ɖы0|9Ɖ4}LV 9Ɖ4|9ءK.40K.<0X108014߭0ݝ0y11WVRP袟߭ =&ܝ0W=K.pݝta\PV" ݅y؉RPh"M\`+EU5K.9Ɖ# >jVZY@݅u؉Ph̛"jK.ܝp P>&ܝ0 YLRjP011RPJ$01tZL9rKjQ#^X090Q_|OlaGl막9skQ k4 JHJZH XH J HPW4 |0u|0tGlDhjP8_8xuxuDPh"Y[, 1҉D<5K.K.8Hȉ9r09rÉ014840Ph"840Ph"ju04 41119q09Ћ4N8JZ8<<u 8^9 +4i۷m۶R<8SPh_"DPhK.SW(~JFD\`HP\PhK.W\DH[, X049Ѹ4}u01480Ph"1ۉ8Y98r;D\`j\PhK.W\D𙋍09ΉЋ4}88SKut+4i۷m۶QRSPhɜ"kDPhK.SW$~FJ,TY8$D8tK.11҉VPh"B98~k,D$Aۉ<014߭0߭@K.@K.HK.HK.XK.\K.1XT011198t)k,ȋ0I9Hu0;0Putvt_|TRXR81RP轒؃RP10P @ 9|0,PQpQRPjW'k,Љ1;P}0PTQXQ8)Q t p룋Tșڋቅ}؋ቅ  =K.t 1PK.k,80$98p09~Љt$DPSh"pPh=&ÃQSPh'"j#tV:t&PhL"j,.gPh^"j,G$)08<11ۅt;k8tGpButEK.-Xe[^_]ÍL$qUQ K.K.5K.5-=&EM MuQQ$RPh" MɍaUS]CtS P S tSPSCr s ɢZS¢ K.X]USEPsH) K.K. K.H1҅u0K.Z[9t K.uK.u h%"jjX4CXtYZ@]UWVSu EEE#-K.K. K.M11ɅtJA9~ʳ9M}#tK.h9"ht=&hhH"w}9x4u }9x(u9p$t버tK.e[^_]UWVS]uuu SO trNj@thj"hl=&h1GGWX9w(~6Gth"hl=&hhH"wVw |G [^WYK.-;K.X=K.u =K.uBGWuK.GWtPK.WGtG4WPZWXK.j@j |Vj|G _4E UG$W(G,W0wE #-G8K.tz8GC GtWP { _ Ge[^_]USEM Puh"hd=&h4hH"P ʉPHPPP s E]XPs2H K.K.K.1ɉH K.HK..1ۉXt K.HK. K.HK.P4JH8K.9t!tXYX tAP]UWVSUu }uWVRcËECUtK.RK.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQ=& RPWVQ=&e[^_]US]C%CSjSZ1]UE UMQ1]UjxxUU P L.PYtHJ L.@ L.UWVS] L.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd萜C肜${sn ]e[^_]\UWVS uE EEEE% L.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP/SYY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jElËEEC1CCn]C^C !f1C C$hj lEhjkM쉁jhjkMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jREEpd赏u譏S觏IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPWQYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu uL.EE % L.S0tK0J4 L. L.C4 \.C(tS(P, \.C, \.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"h=&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"h=&h)h"@륋B 뵋EEP#hEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"L}t/EEtP1uuRPh"]9]tSuuuh"uuk} WY[9t$PRuuhO"̨u=1҉U u+XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRP]e؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"֥C(S,C S$]9UrSPWVh"訥nWVh "蔥 Z}t5EtC(S,C S$9Uu9EtPuh0"T EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPkZEuuWVXZ9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWVZ9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi"ۢ.uH‰?9u*_YӉ9u9u :9r 9r}thz"nh:.oZYtFpVtFHuRPuWEU}t h"1uXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"象$\./t `d)RPh"z tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8j!]E1ɉHEMAYAZA ?Z1ۉY Y$XZ}th4j\ËE쉃\XZu u =-ƉE} t h"sX-EPjh WVuh4jn\ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4j[EEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"BrX@Et} t#h"#rXu uuS9u urX SiX]tST_13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhySXZ؍e[^_]UE Puj- UWVS]FHE1RPuu St C|}WjuȃRPVetPu h"\ u~ 1RPuu QtDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuHR€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhצ" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuFt C|}WjuȃRPV~tPuh"u Ep 1RPuuEtփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSX$\.t C0S4C(jj\0uu Se[^_]UVSUE 9| 19[^]US7PPhF"h:.*^h:.h}"N-CtsPhC#h:.]jPUSSE] t$uha#s芜ZY¸tr1EEPhvd5D`.O @u35@`.hfE#j0]UWVSPu }t}~^hx"#SY_DžtFh!A#S_Zt)h"SZYth"S[_t뫿}}uhh$v賛ZYuUEPhud5D`.~ @u65@`.hfE#j_e[^_]US}tQ,Shzd@5D`.0 @u5@`.h"jRP{:=vu.UWVSQ5.At t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$B.1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉M..ÉEE1RPWVI9E)Ɖ1UQh6%,JXZ}Ut.H9u.H99stBRWh"I e[^_]U塨-=.tvPh""I5ą.5.5̅.5ȅ.5Ѕ.h+"I 5.5.5.5.5.hT"~I5.h{"nI Ph"[Ih"Oȅ.̅.5-5ą.5.QRP5Ѕ.h"I,h"O..5.5.QRP5.h2"H 5.5.h"H UWVSQƉ诙1ۉjEPV( >u#ËE8u胙8"u w܉1e[^_]USP赈$#Ph#Ph#Ph#PSh®"h:.K,jR>UWVS ÉM衔-uhU"5- hk"j׉ljEU}jؙ#E#URPQ&xBuAtV--=PuR= 3P5d.R= 9-uNE!5d.}e[^_]UWVSEUσ}u "}t"EU@uSh"fXZff=Ut+=\.t fuuSh"+ff=u%Sthڱ"v+fLJ_f=Ut1=d`.u Sh"I+Y^d`.tSh7"!+XZj(VP4 x0XŃ~X .t\fLJᵃVe[^_]UWVS9.u.5.Y1Xƃ.e[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEa"E$EtEu"11}=-E..U1҉U܉E1ɉMĹEEUԉӋERPSQ3PE؋UEUuuRP3RPuuЋE؋UEUuuRP3RPE؋UEUuuRP3RPuhi"D,"uuuuuuuh"[D h@:.jdh.) u h"jPhf#h.FY[.]슀.< <$u { Ћ B.DQu<-"j EPh.(Ɖ׋]h.&S蠡E؃}Ph"S蝥 tuhP}#S舥 t I =-Ήʋ .1WQRP<2Ɖuh²"S( u` .ω%.ƉuuEt5.1Et 5.Et +5.Et +5.EÉ]hf#SuEYZ؉E8 t,h.Zƀ.uh.hƲ"B 59uE|E9Ɖ]}.uuuuWVh"QBuЋ}u}e[^_]g_USE Puzh"BD:.HD:. yh@:.aY@:.P@:.؃ t7@t( D:.y h@:.aZ@:.P@:.h"j轓1Y]UWVS M -u h"j芓Ɖ׋-ؙljEU}ؙ#E#UƉjRPQqBu @u--uhuP6 mR5d.PI7 9-uUjWV5-?qBu@td.KE!ÍNju5-R5-5 9-ue[^_]UWVSRá.u ƀA Mz΍. S}8PR. . e[^_]UWVSEыEU u1#ˀ Ɖ+5.u}};=.}=.&"EUEUE9 ..}=.Euy.KlE9t 5.tމnʅu+.9UE}M1E܋E9E܋U}t+}t}u w{ƆoK"v"ȃ[^_]UWVS EӋEEh.@Ph.E 5.t h"j֐E9E|E9u|.] }) VRP,5.31fǂU }u@.5.֋M)}CsKSCPKSs FS.Ee[^_]UWVSEU} u }7M] M]9 .ą..19UtWtN}1E9ϋE}79}E }&"=.}u1BuEP.]Ã}!؉˃u=.u =.t=.Y}t. }mhjK.[^u hN"j腎fǀUE.EU ..EU ...t_}t E .Hu.=.hk"YS".=.;..EEU EUEUMxa] .tEV1;uE |9EE}=.}tEt뚃}.E 9.u;]t~.H.1+]9~ Fu%uF PPR ) . *.1RPEU .+E.XZEU ..EU ..>"ɳ" -""e[^_]UWVSË@SuHt+5.=ą.9u9t h"Y^sǹ󥉍1󫍍@u({u "{t"Ph޴"¢XZߋe[^_]Ã=|.u x t!1UWVS|Éסԅ.tPMYj/S%N^ZuS5-h%hԅ.K? SIԅ.Yԅ.u hN"jjP[/XZy5ԅ.hp$^XxPSgaZY@tϋuи 9E} 5ԅ.h"V 5ԅ.h"Ah hd.S. 9t5ԅ.hp$胡Y^4f=f.Ut5ԅ.h'"S~/ZSg/Xtj.e[^_]UWVSád.u1ҸF$d.f=.uf=\f.ut#d..d.\f.f.fއ.U.1tއ.[^_]UWVS á.fE򡴅....11t;f}t.E .16t.t9r $uf:t@9Ezti 9tܻՋ p.t.u$f}u=q.ׅu q.4=.t u)h9"Y d.uh9"h %6XZ=d.t]f=\f.u1f.Ѕԅ.=.tPhn"_XPh"ZYt 1=d. =d.uL4%tX%1gd.tp1f.҅tSP5ԅ.h":=.t!1f=.u1 1f.q."5ԅ.hK"ZYu F$ve[^_]UWVS ˃uu Dž" Dž"@uhh"ZYߍ1jh"Sy t 1/9Cu苅9Cus Pjq6 ;Cuă=.t.{ t(s$s sh"4e[^_]UVSPE-;-u*=\.u!URhmdPd y h#X.11@uhŶ"B=d.u111Hd.~ فd.@uh"貜^E.01C;.}. ...@uSh"lY[1҉U-;-u*=\.u!URhmdP2c y h#/Xe[^]UWVS(ÉEU EUE؉u=.EA"e[^_]811ɉt<u ȉh jhh@@&P+)&tPQRhJ"1 fu1k t Ph#hY"|1WVh#hn"V1u =-RPSQPh"0Y[=.u! .9u )ȃ11ɉ=j-/j)/XZt1.f}Ut24"J "Ph#Sh1".EPh{"|.~uh#Sh"_. =.x@9uHh+&jjPRVERh"h#Sh"-(RAZ)uh#Sh˸"- 6)uh#Sh"- ƒ< h=.[``.Mh#h"[- @ tSh#h3",WVC$u``.vj!88XUhN"j~ "CQh#Sh1"V,RhY"D,=.xx4"붍e[^_]UWVS=.ujjju u.B=.t+5. $ֿ#uVWh;"+ PVWhK"+VWhZ"+ EU RPVWhk"o+PVWh"[+$%PVWh"3+PVWh"+ ?PVWh"+%PVWhƹ"* PVWh׹"*?PVWh"* e[^_]UWVShEUȉM]t'BuUE$1ɉM$1uuuuE.E̋EȉEE #1҉UUE.fE9.~5 .EE̋E,EUE$1}$&E$1ɉM$1uuuuE=.u(}t"uPh")uuUEtuS&}t.Efu ukE }PEP脈 Ex.}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u.E1E EU EU}}E̋@ E1E}.ą.+EU EUE}5.=..E.1҉EUġ.19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡 ..)9E]| h"u}ĉu} 1E} lj}.1҉EUE9EE |K} u}t?1@.t&.19M} |.9M} |1EEUEU U.t4.1ۉΉ.9u} }9M} |1}E}u.9EE ą.|=.uh:"H-^1>E.E }uEEjhjjjщ¸H"E .EuE1ۉ]]]] }t# ..EU...ą.EU11ҹuuRPQUM |%FEU+EU ;E}EE}]u)։]u}tq=..E9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령.19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu hN"}u}tEEM9Ɖ}uM..1RPuuҋMu 9tۃ}u E9uWVjjRU;$EUEPuhm"hv"$h@:.jdh.q u h"jvh.DdYvEHƀ.t'. t9EEHPh.h"# uh.EP\9 EUĉEU EE}tjuuu uUEKjuuu uUE.tuk=.t Php$jSPouN}tjuuu uUEjuuu uUEYt Php$jt}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE .. .;] u1;MtuuEU G_Z .UׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }P+7 2=.t h" YuEft=.|=.h"Z\E̊@EȋE̊XEȍE@‰.p1WVjjj" E1ɡ.p1WVjjj2"Ã(Uȃ?1ɋ5.1WVjjjA"}̊MO_U? ˆWGEȊ_EȍG‰.p1WVjjjR"xE(1ɡ.p1WVjjjb"QËUȃ?1ɋ5.1WVjjjn"-}̊MO_U? ˆW(}t/=..t Kx .u}ˍe[^_]UVSá.u h|"%X1ۃ=.u Sh_#+Y^jjڸ.CXZu҃=.u=.th"%X1L=.th"u Sh˻"Y^ .RP1҉XZ=.tC.9.A=.~hѻ"5.j5.5.RP믅<f=.t3h"$^hػ"[q.t=h#r.Y=uh""k Ph"XZ hv"Xh%R$X=.nPh#"Y[=..PPh?" j=l.t>u Sha"bXZ9.} hz"#X;_ .RP1҉u Sh"$Y^jjڸ.XZe[^]ËUlPh"h:. jUWVSĀ|xtH.wSh@"h:.H jSG(EZuhX"+xƉjRP|L9u9thj"24jSu| 9t"xthu"h"3XjS1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4F&h"`.fEEE . .19E~[tP9}u1M;u&}_PaR.4F&h"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaR.4F&h "w }9sf}wfE@f.u4F&h<"5Y[|}tFaP4F&hh" ttt111E}.}....fŠ.E]9]E@ƒt<u.E}tхtu|EZE]9]uuT-XEe[^_] :.yUh:.j XZá:.P:. UEU 19s f3P]UERPZYUSBHBy;B| X RQXZ]UWVSQ]u uh'"S*F fw4G&h"Ph."S FPjh8"SFPjhD"S Sh&iXZFXt ShQ"hY_FXt Sh\"hXZFXt Sha"hY_Sj sv(hj"Sv,h|"Sq v0h"S`v8h"SRv4h"SD$vS6EXZEE FEe[^_]UVSSPPVu ujVShr%=w,@uLct"t"}c0-Z"t"PSh"jkdjxUVS]u VSRYZu Sh|"jjd;/t"Sh"XZu E"e[^]e[^]UaPh"h:.wjUVSPh!A#P[^t,PjPuVV4t jPvZYS/Xe[^]UWVS EEu EE}]EEE1҉.t"&1ɉ ..h"VuA NtJb$I&1=..ċ...뗡7.jWhJ&57u h"jbPYYȋ.Jp3.4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjPW=XZt1hʀ$9}PQZY uċ2jWShx%t@uLj`t"t"T`0*^"t"PSh"jBat@t.Z=.HDž"=.tDž".t "$P=ȋ.t %=ċ.t "=.t {$1ۉXP^h"h &j`Sh"h'"Vu h "jc`j/G P'#ZYt|#!Sh"h?"V;tj/C P"ZYt|!XjUVS]u VS襶YZu Sh|"j_;/t"Sh"5XZu E"e[^]e[^]U\PhW"h:.j@YUWVS]E1҉ 11ɉtp1h"u u\= athg$@K&57ECpXDžp57CtX57=CxXDžt뀃K|wK|njuhK&57u h"j^PV_:p3.P;UtM |u4uWEp ЋttKxPWZY@u Wh$jG^ptECpNtECttt E%Cxe[^_]UWVS SVpPtWu u1hWpSh"o,@uSVh"jGv]r@t@1RPh|K&hS\ Sh" (jUSP]jEPSQyU :9uySu h"j\]US]S* Zt@ h$#SZY]US]S Zt@ h0%SsZY]USP]jEPSxU 9t :uy Sh"j3\]UVS]u VSYZu Sh|"j4\;/t"Sh"XZu E"e[^]e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RPY^CSt RPY^CS e[^]UWVSӋEU ΃tt RPaY^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]UWVSEUˋuE $EE tH$HD11E ~E}ufCRVڋE E lWVڋE E }t}t#RPS_Y`}tDɉ"%XZ"t9t h\"$X9}+uh"$^_ދ9|<t h"$Yh5.h"WDžx ;rh"%$XZu8u t h9"X 11  ˆK1<1P1HL@DK@#_tM⋅9t Phl"#Y^Ht2{{ @D0{{@D}"Zt⋅9t Ph"Z"_XzG1t{${Q!^t&XZ$t CpStCH\Ɖ)ULƒu 1Ҋ t1҉RPL@ȋ+tC@SDC,M)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t Ph".^_@ tFC8SSQRP%à u1Ʌt )Sh"؍e[^_]g_UMt,1Ҹ9~u --H-1|..|.1҉...1ɉ ...-Px. -Z19~ BUWVSE9-9}C-P0E^19} U1ɉ @񡸁-Ex.E존-E19U~FEt9tpqpp$p4}!p8}4>8tGpBu Ex.-Xe[^_]ÍL$qUQ p.l.5h.5-=&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s ZS t.X]USEPsH) `.d. X.H1҅u0|.Z[9t .u.u h%"jw%X4CXtYZ@]UWVSu EEE#-x.h. t.M11ɅtJA9~ʳ9M}#th.h9"hS&hhH"}9x4u }9x(u9p$t버th.e[^_]UWVS]uuu SO trNj@thj"hS&h1GGWX9w(~6Gth"hS&hhH"wVw G [^WYX.-;t.X=.u =.uBGWu.GWtP.WGtG4WPZWXt.j@jVjG _4E UG$W(G,W0wE #-G8x.tz8GC GtWP { _ Ge[^_]USEM Puh"hxS&h4hH"P ʉPHPPP s E]XPs2H `.d.X.1ɉH .H..1ۉXt .H. .H.P4JH8x.9t!tXYX tAP]UWVSUu }uWVRcËECUtp.Rl.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQT& RPWVQT&e[^_]US]C%CSjSZ1]UE UMQ1]Uj腽UU P.PYtHJ .@ .UWVS] .C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${s{ ]e[^_]i UWVS uE EEEE%.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP<YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jRËEEC1CCaCC !1C C$hjEhjM쉁jhjMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE Epd u S IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPdYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u.EE %.S0tK0J4..C4.C(tS(P,.C,.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hS&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hS&h)h"@륋B 뵋EEP0EԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"/}t/EEtP1uuRPh"]9]tSuuuh"uu } WY[9t$PRuuhO"uJ 1҉U u8 XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPe؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"nWVh "w Z}t5EtC(S,C S$9Uu9EtPuh0"7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPxEuuWVe9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi".uH‰?9u*_YӉ9u9u :9r 9r}thz"h:.|ZYtFpVtFHuRPuWEU}t h">XtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"Ġ./t `d)RPh"] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8j.E1ɉHEMAA A 21ۉY Y$XZ}th4jËE쉃\XZu u =-ƉE} t h"躸X-EPjh WVuh4j{ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4j詠EEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"OX@Et} t#h"0Xu uuS9u u X Sv X]tSa _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWh4SXZ؍e[^_]UE Puj- UWVS]FHE1RPuu 褘t C|}WjuȃRPVetPu h"\ u~ 1RPuu tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuU€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhצ" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuu躋t C|}WjuȃRPV~tPuh"u Ep 1RPuutփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXĠ.t C0S4C(jj\0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RPtY_}ÊtBRtUWRPstY_}ËBht1UWVSӋEU ΃tt RP2tY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRP觊 e[^]UVSuE H$X(1y9)tNp1SQRPP e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDž Ep 19}5uWSh"j EzBD1H)CNjE_dE@ EDžpā-pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G``E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hDT&h("j$EÃd$S\DpTtt RPpY[B^UEMhSQEjXZSbdtuuoY[EUEUDpTtM]19 }9Erp@dxÉ1 t1RPuu|1E URjW1RPVEEtH`Xd EH@E_Ή)׋EzEtIu EEu1 t1RPWV |1RPh"E‹EE@ EEEJEtp`xd @@ƉEӋE‹E"EE.E؋EE)߉ЊM1ҊM t1RPWVS{]K!E؉wEtp`xd @@ƉEӋEB‹EE܋EcE)߉1ҊM t1RPWVz1uk]ӃK 1;{E@ r EFE@4uPEBHEMQjPjjRqt Ph"k[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋E1MIdQ}u}u E M̉H}tZCr{<uX.C`.d.C@CC sh'"hpT&hCh"jS1[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋENUr,z0 t1EtpHxLp4Ġ.6AM̃HEEЋE1RPuu)hƉ׋EƃEۋMtEPjuރWVQtPuh" EEЃE̋]s E1RPuusf€}trzuЉ}#Evkk BEEԋEMq,y0 t1}trzrC4SPZ}u }u1dE ]Ћu)։]ЉuԋE‹EJu EjEu1 t1WVuufEЉUԋ}ЋEFHEËE1EURjS1SQV]tPE1RPh"PEf‹Mq EJu P! 1k}t)؉}u"}uA1 rEF1ۋA r EFA4QPX؍e[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVoFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh@"h`T&hhe"$MЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuha"hTT&hh"GuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQmbӋEE}tEEPjuȉERPu"tOPQh" EE@ EEH1ۋEtGW SQRP`*EEG1SQRP`}vkk ]Gju蕦hDuVuhDuVuy(hQFuVuehEuVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jLeƉ<WeFYZuWhx"1= .PE fF81FFSKZSrXZ[5.t[^ tO{uDf{t h#SVY_=T.tSPh#h:.B>SYSXZ[뭋v$롍e[^_]UWVS=P.th:.h#4^_.1.t#{ t{$C$SXSFY[مuȋ.th#SU[$XZe[^_]UWVSPP.=@.Rut6h:.h#變#th:.h(#虊^_5<.uY[jj3RƉס<.EXZ(.9..,.WVRƉXZ..9ƉsIWVYXuWVh=#T S1PhM#h:.<fcWVQƉ׃9u9tRPWVhd#h:.<DRWV5XZu h#SYCu h#STXZCt S XfcXSPDfcY[<.U9Pu}@De[^_]UWVS=P.th:.h#(Y[f.j+C jjPEU(.,.RPPEU5.5.PƉXZuuoPEUuuPEUE9EEEZE;.E.sff.j1+OCd [E;.E.rj9<.uB95..rC$ <.S9u<.9(..9ƉsQWV`XYuUhc#QXURUPhM#h:.:UfbWV^OƉ׃11 9uEWVXYuUhc#aQYURU~PjBUfbXZ9<.t *B_WVde[^_]UWVSjjY[u=P.tQh:.h#[^>Ã=P.th:.h#ۆXZCtSPNfc_X[u릾1;5(.,.WV ZYuыXtCtNPP xu SbjSXjPPiPfc[룍e[^_]UWVS=P.th:.h#XZ1;5(.,.sJWVKYXt3fSЃfC{u ЃfCft h#SPXZ[Ƀ릍e[^_]UVS]S^uSh#h:.48 1Ouu Y[19Åt 9t@uu hC#$O ~u}t h/#V!PXZ؍e[^]UWVƉjhRP.t9xu9pte^_]UPhX#MZY8u"h|#h#5.h#h:.b7j)UVS@fC5.=~D.)fĬ.5Ȱ.jhh.IHt -X1.1CPS.P!5.C𣤬. e[^]USjjj0|c+CC]UWVSƉӉ9tR)ySh#h:.v6 j%RP60c^thF P6)F e[^_]áİ.t#UPju uHHt -kUWVS =X.uu 9uEfftcB1=.tf҉jEPWGWPrYf E1;] }߃=.tȉGffG=.t?t=.uGGG%)ƋOu9rG9=P.th:.h#XZGt=P.th:.h%#YXGW9s=P.t+PRh?#h:.4=P.th:.j OXZ?te[^_]USjh -+'Y[th "< Zu S'Y11҉P]UWVSX=P.th:.hg# ^_5.5.5.h#hh -.@.߃ XZu h)#IX5.=.jhWV..s{C İ.5.=. .. . .=.5.=..ĥ.....PjjLPjCHt -Vhhh;14H.)fĬ.5Ȱ.j5.h.CHt -5Ȱ.苻̰.15.+C C_5Ȱ.K[u.u}0G PhH#h:.0İ.tPJY%h-FZu hY#FXe[^_]Ã=.u =.uU塄.%=@u7=.u=.u]UWVS]{u6hC P3,"C =T.tYh:.hx#{|_XFC;C|1s뵍t Vft)9~ =T.tRh#h:./ 1VC>uFh%PmZYt1;=(.,.r%=T.@ mVZX=D.E}tPuPuS  uS3 EZY~/9jPuSjSh #h #h:.(EPSEPSE=.tPuuuhCd%S#E PSY[ff~ u8 Z5İ.CXe[^_]UWVS}E U9ÅuWuu h #!?hhWƃ y@Wh!"h:.'h:.Bu0? Ph#h:.' 1S ѡ..0Nj[Yځ~RQW @u55Х.5.5.h #h:.'zt0> Ph #J=D.uURQVy @uG5Х.5.5.h #h:.&.t0> Ph-#h:.&$j@%W{VuXZe[^_]UEU ]U:= -#tjjh -h -蕧= -#tjjh -h -qUWVSƉ׉˅ut;5(.,.rWVh #= .RPWV .s{ S$=T.t [$t9{ u9suh' #S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh6 #P=XZUWVu} u1tC;5(.,.s..RPWV4 .t;x u;pt@$e^_]UWVu} ut;5(.,.rWVhW #; .RPWV .t H$9x u9pu 1pp P$WVht #; e^_]UWVSujj[_ÅtJNJ/t tF@PW3bZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P_Zu1,VeY/txtEVh #:XZEe^_]UVSu~.F.9s%)P6Shjj&9tC/vKSh #:XZ؍e[^]UWVS}u h #j:[u_YƉ<.uE5.&+ Zu h #3:X). .9r ...uS)؍e[^_]UWVSu.uE5.* Xu h #9X.Lء.19r _$(uËC$. 1ECIDžuQ}u} ujjY_t Vh #@9XZVV^_C[ٸ1Xj/V^Z@PP^C{G C_ Y^Et5uu YZYƅu h #8_E UCS FC^5}u} t)uu ZYt h7 #8XًE U7؍e[^_]US]S]Z..]UWVS]f{t hH #SG9XZ{u&{t h[ #S.9_X{ t hx #S9Y^CS utcRPl_Zuh #S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h #S8ZY3.C$.Xe[^_]UWVS]E 8ƅu h #Sa8_X9stsF C^ j/u ZYx3WƉW\C$19VP^fSЃ߅uЃ fCe[^_]UWVS`=P.th:.h #lXZ=D.(h"u^_u,l037 Ph #h:.Juh #g6fc 195(.,.rIMWVZY‹Mt,AEJSBPj2U1UR̓1E1}E9(.,.EuuJZYDžttj$GPEPl uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP0눃EUU1 .9~(.1tBESjjEP0G΋E E̡(.,.EUMԉuС .$.E؉Uܡ..EU8.ESjj(EP-0C @t,j0S5 Ph #h:.juh #4S&8Xe[^_]UWVS=P.th:.hG #ZjY[}uXjj5,.5(.M.jP) ._Zu ha #4^jjjh%fHwjjuƃ y,j04 Ph #h:.uh| #3xPVAY[y,i0@4 Ph #h:.Wuh #t3EЍXjSG( XZu h #Q3YSWV y.ui03 Ph #h:.uh #3j(PPV xV@.ZU0 PhX#h:.jjؙRS58-4Bu@t…=P.th:.hq#U[_=.u <.@1҉<..PYct8. PVh# +hh.5.VL .h5.u,..@ .e[^_]UWVS8Ã=X.FC=TtP=ltIʁlt=Tt1#=.u$=P.th:.h#S_X.t=.WȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPZYChs,s(^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC#{u"$Phd#h:.sht#h:.S8E E#]UVS]s s:Y^1t 9tF@h#SXZs sVh#h#hh.j.e[^]UVS]C t h#ShXZfK SnPVo3S\PP"C$;PV$e[^]UVSu~t h#VXZV X=D.u8hS萟ZYy'fN@20` PSh#h:.v=P.tSh#h:.X e[^]UWVSuj/VZYDžtDt>PG .^u h#j...0m[t.j@S ZYtR B.]}t5xDyu$-E_„UtSh#|jE@.jh#SV.@Ph.Pã.Vr 8. =~E.=]UjShh5.zoEj]Sjj5.^oE(jSjj5.Bo'jShhR*oyE-q.e[^_]USu uh#hS4.MڋE]Ã=.u U#{#e1.]UVS u h#j]Sڸ#/Ã1x19}-)PEP5.G  h+#j+ω؍e[^]UVS u Vh#j]SaS$S5.Vu5.(9%e[^]USPu uh#jP]Sڸ#c]USU x.Ruh#hSڸ#]ËUEPh#XZUSf(Ph"#h:.Zh:.hH#~)- CtsPhC#h:.&h:.hq#E)@-XZ CtsPhC#h:.h:.h# )jiUWVS]} t~C7hx"#VkYZt:h!A#VZYZt-h"VIYZt#h"V8^Zt1 @uhh$w ZYt|1j}Wjj5 .e?E? EEEPWS5 .5$e[^_]US}thjEPjj5 .].?wPh#XZ@ڧ"@t#RPh# ڧ"y#P5.h # ڧ"}y#P5.hH # ]UWVS(}tE 0iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5 .e[^_]UWS}t&]U1E5jh'jjjS5 .e[_]UWVS ]} t~7hx"#VYZt:h!A#VYZt0h"VYZt#h"V^Zt뮾 1uhh$wZYt|1j}Wjj5 .e?E EfEEEPWS5 .$e[^_]U }tjEPjj5 .7M.ʃuPhu #XZB#tڧ"RPh #w ڧ"Et#P5.h #S ڧ"}y#P5.h #/ UW}t?U1jh'jjjR5 .}UWS}t]U1Ejh0ujjjS5 .Ve[_]UWS}t]U1EEjh0ujjjS5 .e[_]UWS}tc]U1Ejh'jjjS5 .e[_]UWS}t]U1EEjh'jjjS5 .me[_]UWS}t]U1Ejh'jjjS5 ."e[_]UWS}t~]U1Ejh'jjjS5 .e[_]UWVSEEu +EBU܉EP XۋUu h #j#1ߋMEfEfS1j EP62 U:t6h!#j#TTdDG9}ujh0uuSjEP5 .]e[^_]B UWVSEu h Zu h*!#j #1 1ۋ9}J jQh"\ ujQhI!#= uCu 9}OjSh«% ƅtIjShO!# u'jShT!# u4ƅ7fDžjh0uhj P5 .ƅx9t h]!#V蠴YX$t h"VWXZt#t h!#V9YXhI!#V,XZh!#VYXu h!#V XZV5.5 .5.5.h!#@t6t`f@fÆh!#VӳY_ \f@fÆh!#V褳XZ-f@fÆhE"#VuY_u hv"#ZESh"VVhp$KpރV׃X9uEe[^_]! e[^_]UVS ] }t%3hh#VMZYthw%V<ZYu E'j EPVK<E U:uy 3h}"#Tshh#VZYthw%VZYu E-j EPV;E U:uysh"#jkEPhU5 . t h"#joe[^]UVS ] }t23hh#VZZYthw%VIZYu E'j EPVX;E U:uy 3h}"#Tshh#VZYthw%VZYu E-j EPV;E U:uysh"#jxEPhU5 . t h"#j|e[^]UP}FE 0-EEPhQ5 .Jt h"#j2U}tjhQ 5 . t h"#jU}tjhU 5 . t h"#jUWVSEE܋] h E^u h"#jkU 1E1E9}t3Vh"# ZYtNVh##r ZYtAVhw%a ZYt4jEPV~ U:u=v3h ##j1EGEEjh0uhuj EP5 .C E=vhP5.h'##mE1E܋}9}t}E܋E}܋}]܋TʉȉljщÉ1Љ1 Ӊf11 Ӊ1 SQ5.hE##{EEe[^_] UWVS] }~j PW5 . Rt$Nuj@EPjWU0PhS##j|j$pPjj5 . EЃf=t Rhv##,XZ91׹󪉍,ƅ8fEf;}~lj 0P3vƒ 08t3h##jD,ƅGʉLj Vj5 .p ƅ9141}u"jh##s  u ƅ5jhtj4Pj8P5 . <h##$h:.[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5 . @u h##jE<u 5.h##<u5.h##h:. ~<tP5.h##h:._Pu󥀽_y-`9`Z&CSh$##h:. j RZ<h$#Xe[^_]USUBBPJ R Ph.$# uE7$#]1ShN$#XZ]USUBBPJ R Ph.$#T uE7$#]ShN$#1XZ]UWVS } 11;]}#j4hT$# uCPQ1󪍕JƅPƅTJjh'jJRjS5 .QjPj!gW,jPjAPjRjVR VRPW5.5 .5.5.hX$#' oQƅRjh'hVjS5 .ffЃf=v1RLhWF HLRhW+ LHtmQƅRjh'hVjS5 .ffЃf=v1RWhWh$#Whm#"LgQƅRjh'hVjS5 .fff=v1h$#[X1G9 5Ct9C LHD04Z&h&h%f {y0L%`vRh$# 4Z&h%/YXD4Z&h "XZ1ҀHu6C9s!DLPh((#LBYXj XCPShSSHe[^_]UWVSEӉʋ}EE] [&qtE8uE8At;ˀ}@utQhT&#WR"QEPh{&#WR WVRE! e[^_]UWVS@EU u}JvXuW4 a&V  u.MP @ j@MQ4 a&h%WVW~xPw(t|f@Ph&#qf@у@t%&#t3#RPSh&#WV׿T&#t3#PRh&#WV趿3f@Ph&#WV蛿JuP @ W.X1e[^_]UWVS]hpVjSPh'#{vTh'#Y {yj h#'#iXZ,C@tPh8'#QY_,C t PhH'#9XZCȅt Phj'##_X{w j 5VCȅtPPh}'# S C h@Vh'#ؿC t Ph'#¿Y^hpPjSǃt Ph'#蘿XZj 谾X}it;} } <;u GVh'#UYXujh(#BXZjh(#-^X79tR;U }MuRlh(#ZY1ɋlhlPhם$վhAlBXXh?#NXe[^_]UWVS] }uh (#藾^X1C9~D3Ph'(#{FZYj 落X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`uA @u h##j*EtU.<uRh># <uRh?#h:.O #<u jSRPRh?#h:.*j足e[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt32uBIttyt ut< }]9t` y_v4m tN\ 0H2N0H2N0H\um tf\\M t@BX[^_]Ur Ph9?#h:.fjUhw?#臠UWVSÉ֡.P.uhh.uY_.h?#h?#hWh"Wu_Zu h?#Ph?#jF <.u ?#t#h.RPh?#萾1X9ډ}Hh8.y; $h?#^ .Pjh.k;9}4u #U=$.u hr@#>XjUShr@#>h)jh)jh)jh)j$hhhr@# xVj"h@#Peh8.9j PSOjh%SB(h.u$h.S'S聰]UPhB#h:.jUWVSыB.:֍RD{@u1ҊBuIT8t9s B.DY@tJB[^_]Åt`UVSËHuJs8tCS8kC4`9s `RU 1ɉK0K4K8CX^t tP7 Z1CXe[^]UVSu] EPu36}хx9s)ʉe[^]UWVS`ƉUUP 1ۋE9߃u*E|fE|ShB#j EPPEEEEPh((#j EP,UfT ȃB.DJu.D=uURڽP U_Ce} t EP趽YuhC#XZe[^_]UWVSS1}11#tAEtSWhC#P.Sh#P @u hd&hC#6W }YCuEu#h#zEZuhd&hC#je[^_]Uh"C#Ph6C#Ph?C#PhIC#PhSC#PhtC#PhC#h:.ǹ8jSUPh!"5؋-褹X. t5\.PhC#5؋-聹E Pu5؋-1L. USÅtLtw8s.. T.ta0 Ph.hC#S@. T.t\0 Ph.h9,&%u=X.uja]UWVSEEEEujj}WjVP @u,e[^_]ËEƒUt PhC#jPq ZtjjWPVuQ @u ]=p.u5Ћ-uh%致 ms#M;Ms"VvvPhD#^E %#j hX]e[^_]< UWVSEE]EEjj}WjPS @u7u藿 YtjjWPuSw @t̓=p.uuh!"迳XZv<9t's sss ssshD#膳 ՋE荞 kT؋U9u FE1}h.h4D#"ZYdTEM9Mt?Sjh"& :1;{s֋TM4PhGD#G ,j Xue[^_] e[^_]UWVS΋]M M=l.ǃ=p.u=h.q)}o=h.tEh:.jSVP}u5Ћ-Rh%Z }u Rh!"DXZ`.EH~}tj KYډe[^_]0ƒtot/U׉U}u' r2s4Rh&2U׉U}t RShLD#\ sRhY$Rh#袱XZGU׉u}}tWVShSD#z s WVh$WVhL$Z }uE\D#e[^_]>E e[^_]L}e[^_]Ã=l.tL.URh.4-haD#UWVS=d.uhD#jj=PY^X d1Dž\ Dž`hj`Ph.\PdPSp\@uډ7=X.jlDž`1DžNdX@DŽdj`R`PPVdPg @u!0, Ph.hD#Buh.hD#iXZ&l. p.uPh.h9,&e e[^_]UWVSSE}u =l.3˃=p.u=h.(=h.tBh:.jWS;u5Ћ-Rh% u Rh!"ѮXZ`.~tj ٭X؍e[^_]u E rM19}V=`.tUPh((#uYXUt.=`.uUPhD#QXZUBSWh"= NuE\D#e[^_]$E e[^_]2Ne[^_]UVS]=X.t EhD#S$Y^uEEY1҉jEPSEUE 9u%SuhD#\ =X.j蘣8u[8u̸]1PSEPuVuu @u1_t =l.1h. `.u}u}tPjUEPj D#UEmY^tFh. `.u}u}tMjjUEjj D#UE#XZe[^]UWVS]=X.t rEE218jjEPEPuu @uuhE#kjS薏W u%Suh&E# =X.xjjtuV|W]8u|1PSEPxPuu @u1t =l.|t1ph. `.txpjUE1Y^ExURV襱EPVhCE#jduV膩pPUEf$tkh. `.t|jjUEXZEURt7EPthCE#jd]SjPًUE$e[^_]UWVS(ԋ-8.t f ./ ..SV+ZYuVh .ʯe[^_]É)@E̍EӉljDPh .衯h%h .蒯uUWVS`Eh .ZE@d&1]M;>r2jPRU Utj@uVRP)V3hME#[GjEPjh .RU\ Uu}u7}u1}u+E9Eu#/tj@uVRPV3h]E#j GM1EEe[^_]UWVSVUu=l.ˋh. `.u'. T.h.hmE#hY[=p.u %tDh:.jSu茾u5Ћ-Ph%7 u Ph!""XZ=`.~tj ,XڋEe[^_]1vs9}E8Ph((#ԧGYXt VhE#XZE e[^_]̦N@e[^_]UVS]EjjEPuVuu @u e}t ShE#jj`. h.tjYY2=p.u Sh!"XZuuuuuhE#e[^]UWVS]uEEU E$E䡀. T.=t.J`. h.t}jjEPjuV. @tdMt]QM" XtMMMjjEPWuV @tM;Mt WN _j.`Y}e[^_]- }tuh.hF# = t)tu*ShTF# uShF#Sh(F#Sh~F#XZe[^_]UVS]E jjEPuVuu9 @u} t ShE#jEUEU `. h.tj sXP p.u EP%P5Ћ-Sh&#&IuRPhg$ uRPhF#e[^]UVS ]EjjEPuVuud @u}t ShE#j`. h.tjC=p.u5Ћ-Sh%g =p. h uux t PӪXuuhF#+ e[^]UWVS,EE̋}uu<=.t3EjjEPEPhF#E܍Pk((U܉UȉMQMW XۋMЋUuwM1Bt(jjURPVW @uEԋU1Ƀt();EtuhE#jUuދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhԋ-uhF#jUR`UUС`. h.t6j(EYU܃(t Gt9|]e[^_]g =p.uuh!"LXZv$v vvvvv vv6hF##,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|PhF#|<Dž|tW" XuCxjjxPVph߹ @ult9xt ShE#j/l%EpuEjj_X=.t=19|Whԋ-ShF#jURd EjjUG ŋ=`. =h.t jL=p.u4Sh!"kY[%t h%#YZt4Wh.G#FG9|j TXue[^_]( e[^_]ÍL$qUVSQ$EjjEPuVqq 脸 @u}t ShE#j`. h.tjYd=p.u Sh!"茟XZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h8G#?eY[^]aUWVS@]=X.t /Dž S\cXuhd&hp$j$1h%R:Y^t{18jPS,{ƃ t 9u 8"uShHG#8uv ShYG#j{ h%jx 1PSPVuu谶 @u1;t =l.1ǡh. `.tW EZ)P<$PUEIV袱 tRh. `.tj ‹EX+aP$PًUESL e[^_]UWVStx|h.pp.$.SYl.l)ȉp)ȉt lt|uH1ۋx9t担t#t%RPhH%PPCC뿃} t~|P#xvԋ-RPh%PP|P#xv%RPhH%PP Dž|-|-Ã=t.=p.th.h!"裛XZh.h.hoG#苛 EP0l$wc&PhyG#f_X}uC|@0|9hsPhG#6Y^P|p4hG# |p@hG#|0.XZpu hh#h.hhG#0pt #6hh#h.hhG#h.%ƀt2hWh.lhhG#h.X%s2hWh.4hhG#h. % s2hWh.hhG#h.% s2hWh.hhG#h.% s2hWh.hhG#h.x% s2hWh.ThhG#h.@% s2hWh.hh #h.%s2hWh.hhG#h.%s2hWh.hhG#h.%s2hWh.thhU%h.`%t7Vh#j VhWh.*hVh.(h.|h%PhH#|@H t PhH#ݗ_X|p(hH#ȗj  } =x.=.u }y|xXDž1DžtxThj`SPPQt謯 @hu\t|@9uߋ|@(9uΉdQhf ^dtNjh󤋅|@XPwP艪 Y|XX=.uE t|@XhHw9=p.uh.h!">XZ|@XPvh$H#P賜X}|@t E iUE/Ã}tP@uj-B Ph.h5H#js u|xtjh.h.|x@u^jjPjxt @u<. T.=t.h.hLH#|@@EHs$c&|xt臄|@8dx. dul-t.s j|xtjh.h.S . T.=t.h.hgH#btx \b|@4h踟 _)jjPRhx@Pt~ @ht*|h`t5|@4`$R諧 ^K8 ]kЉX1ɉh`9htkh`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT豞 ZPtރ NjTCXhsR X1T.d1ۋ|;X4,F\s. T.t%xQuujPtAC`jjPSxt @jjjjPSxt跪 @UjjDžjjVSxtw @uI8 u3f XjjVSxt: @u jٺ.|^_9Sa [DžjjPSxtũ @tgjjٺ.|8u覜 Yuh.hxH#5؋-~ KjjPSxt^ @u jڸ.S蛤 XZlƀ.pƀ.e[^_]UWVSƉLHT.j=PbY[ƅPt9sx?u @ƅPGh#V菑[Z.tԋ-Ջ-8 8V tG=^jhfa$So T F<=t:ԋ-  ƃ=d.u hH# 41Dž81ۉh 1tpƅY1j,VMZYDžtG1ɉLPDžH1ۉ<1ۅJj=WZYÅu 1l@llh#W ZYDtj,SģZYDt @Dh%WZYLt6H#Lu%PVhH#2 =X.8jn.18jlPSj-u F0j PV" x;3ue[^]UVS@Ë5.=X-tjtSv謾ZYuFl6j j5SHFS胼$PFSh%P.5.F PhOQ#j@]SzSgee[^]USQtP՞=.uS<Z]UVSÉu=.u VSuZYe[^]UWVS׉΋]Uu E E!UuUW%t#[^_]USt<0„!1=.uS(Z]UWVSLEӋu>h_Q#VIFZY)ƒ?EljDUhTSP_EUDEj URPEU:*u%jjWSRPEP{'tEuj>uB E9hTSV e[^_]9`-t3UVSRPjuVx`-e[^]#.t ú(.=.u,.UWVSƉӊ>uuV.HtB1.hf5<.V)=.1҉.hf5<.S 9=.~؍e[^_]UWVS,E9.L.];S5$5/Y^y#P.H.D.=.u. .S}Z=X=&wAKw2ifƎ7[nRfƎ7D=,w$==!fƎ7=XfƎ7=KwJ=w$==` fƎ7 =%fƎ7 ===fƎ7wfƎ7lfƎ7afƎ7VfƎ7KfƎ7@fƎ7 5fƎ7 *fƎ7 fƎ7fƎ7 fƎ7EۣP.EݣH.EܣD.eẼEfE1E. 5$5/mSj5$5/fE.e[^_]USEPhht@j谦 1ۅu E]u+hgQ#_ZtPR<.Xn%V~<.hbQ#_YtP"Zy<.<.1ɉ \-=<. <.t@.0hrQ#T_ZtP֘@.['$~@.hmQ#$_YtP覘Zy@.@.=@. @.P]UPUE`.1J$g&(f`. UzQ#U}Q#g{UQ#UQ#UQ#ۍUQ#эUQ#ǍUQ#뽍UQ#u.f`.UQ#uf`.`.1UWVSVhQ#^PL^_ZX-h%]Yu&1҉.Ph`.Y[Ht .Q#t .7#X.Q#T.Q#.&.## .Q#."…y11(.$.4.8.,.0.. .t1 '/E`.]ڸ^{%tĎ7ڸ#u#.ڸq#u#.ڸQ#g.ڸQ#VuQ#.ڸQ#u L/e[^_]Ë<..}<..m=.tg='/t =.uMU=`'/t='/u<..(='/u<..1҉.]1.á.t 1=.úD.<.@.<.8.US='/t =.ul='/u<<..u.8t.8t=.u.='/u<..0=`'/t.='/t9<.~j CX]6]Uuj54.w ='/u.8t <.Ã='/uUjXË<.0.,.qUWVSu }1+uG}-*u:Vt3st!dt1k1uUE 0e[^]UVS h#jHr hcS#Ch.h.h.h.................h>S#C1[<=:tjhrS#jq FWZPÃ$g&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=`.tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=`.u~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US].1u7.u'-zu='/t-[]_[]US].I1u7.5u'0-%u='/u-[] []UE=`.tE] .]USS]uhS#h.6zw2SYt'؃@PZu@ShS#S5.S-YtS5.j h.O"E.ySEPEXZ.]US].-uH-[][]UU 1}DuЃ=%" ]UWVSSEIuRP^X[RVZY1uEVLXt SŐY-h.jEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhX#9hX#9ShX#P&NucjhX#VNǃ u.hX#P9ShX#PMu0ShX#VM ShX#PMEWc Ete[^_]UVShX#8P99ZYu3h#V謑ZY1t=hTh%V藑Y[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPV Y[{%=eh!A#VRVb GShV3 #jhX#V  1҉p1ShW3 t t u@hX#WZYZhX#WEYZhX#W0YZt<"u5vptp~HpSPV O tu QMƇZYMuGCQXY WRY _Xu s 蘇ZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á4.t);4-t!Ujh.P4.@ UWVS]=`.u(.$.uD .(.Àu$.Шu[ШtSS$.%uF .A .(.9~1Ph(.ZYu'1$.P1$.:Y=$.1$.=T.t 15T.s-f]4.9L-  PS.Y[@$g&e21҉P.51P. 1P.\.t \.8 1P.\.=.vx ugx V\.=.w1P.X.+5\.X{1=P.\.8eu15P.Q1ۉP.e[^_]1ɉ P.e[^_]a1҉P.T1P.\.=.v6x u0\.=.x ߀x z\.=.w1P.1P.\.8 u\.8 \.sT.]1P. 4.h-y\..h-Y[ t9ىM{ RUWh.袂 UMuʉY15X.zWh.%\.._X\.8=P.t L.tPT 1ɉ L.[V<EP܀ZE\.t\.tp..<9s; u Ce-Ed-E11E쿀.9stub}t6E9s-M܉UuuW蒁 UMuE|1}t8EE18Et < u_ 1EG눅D.H.tPS Xj\.)@PvH.\.)RSP U\.Me-8uCS;XuS%AL._WAL.W#S Y[\.ML.txt/P.Ph8.-1҉_Z @.@.\.9D.si@.u,15P.H.1ۉP.pu5@.CYd\.=.v d-8HuhX#'Zu%1P.(.e[^_]e[^_]UVSQM1uu.EQЀ w[jjjj uuuVtjhX#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1$.9 .|.á4.t @@@ Ã=.uUj11ҸXUWVS.t`- 0- @!/1bDž{P(}@$j辿WP!V}DQ8QuZh"V@XZ$fSftxRPHeZYx,E%=ufSfthP6YXhY#%Zud P6_X~P-1Ƀx tA -x t tlphX#hn#Sn?|1ɉx =.u:pl)ыt)PxjjxPohX#SSYWVD4VdO W^O XZe[^_]ú9P.t9L.t 19H.‰USR/t>BE/RO XE=@u$/t t7tut g ]UVS=\-u='/t =.u$t/..u ujjj5.RP*V PT/u =\-u>5'/H.'/1҉H.u 4YX5'/H.e[^]UU]飪UWVSt eYƉׅt‰//H.=5/u0t;5//}jjjG 1H.5/ld2t8e[^_]UWVSVEj)ơ/u/ǁt#tj11u|%/Su5/á/ƒ// t?x1 rjhY#FY[t j0j1ZtՅtVk1V(Xe[^_]USTá/$N   tw #5/jCP7tW6%I/f5/S5/5/ߟ1/?E4/؋]a//PSy<+u C< u.tPjK Z;u 1.Se.X5/jPCP9=.S0X]q;!t/tPJ XS5/Y=.ui/uh.Y#h#ȀXZMh.Y#P=.u>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉/YYu/ ыuUS]t CPX]UPGPEEUWVS@/<.@.e=/t1//1///=5/t[=.tj3_/t x@j荭//苝Yu*P:t!u5.BZujǴ_='/t*p:t!ku5.AYuj蔴Z1'/=H/un1H/=/tjhY#訣[1/:at h#耣Xt?uhj:Ģ_X WrY.=5/weu:{1/1/&\P菕Zze=5/+ej//t.7iCЃ .jSP_Zdteh///^=/t1ɉ /_=//uy/u_uh/ƒ@+t t;!tA-Ҹu u ‰/@@/3=//  =trSZH?E|a</1EЍEPEPEP/ tD,EĉE-=/u Pw P_ E@Ƀ}}uEЅEPhY#x 15/Y=/S/YuS艒EЍEPhY#6C//Ht!5/h#5/5/s 5/MZt5/Tj1ɸ/&C$h&*t@tS; u݃=\-u ̾J5h-j+Y =/t)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=/i j1ɺʈ%i0S{ aFcx $`h&j1ɺ#n /19/}'/1;//|//='/t5/5/LF^_j/19/}'/1;//|莍//j1;//|/1ɉ /='/u+;//}5/5/EXZjj5/1;//|/1/ jjjj5\'/Vjj5\'/v1;//|/1/='/;//}ze1;//|/1/|jj5/1;//|//F='/u5/5/yD_Xjj='/t5/5/TDY^1 /19/}.='/u5/5/DXZjj5.6 /19/}.jj5.7tköUGA5'/1;//|/1/'/5/5/E5'/f//y 1/,d9ѹ|u$du=/t/d1//5/5/G_X//19|,fFhm//19| SGFRP0EB//y15/5/115'/RPFg8EȍEPhp$=.uEtEP1Z9t䡐///'//'/j(Y{j8('/('//1;//|/1/ / ///1;//|/1/s/15/Ѓt+Ѓ$5/ t /1;//|/1/e/1.5/C1FP踳X/b"'//15/'//1='/'//1'/hP#맃=.qj 4-Y# =.M5.6h#Pf u jhZ#5.6Ytjh8Z#XZj -MV%@5.ѣjP/19/|/1ɉ /PZ jhZ#45.V1_PrYt VV1jPb1//j1ɺ" =.u) -#uMV%j}=.jhZ# @j1ɺZ#;_ ƒ 1?PSmp?Zj1ɺZ#>^ ƒ Sp`?lj1ɺZ#5LY ƒp glSp"j1ɺZ#%RZ/ t u.S}o_/j -MV%% j1ɺZ#^/ /19}'/('/ @.‰/ //EƉ9Љ}5/=/E)`//19}'/"'/ @.///T/1ɉ /`/XZ='/t/_UE=`.t@]US]SjšZY19} B]UWVSu}t UE  u ^ZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:=`.HE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt QE MUuBBCe[^_]UWVSu9EPC[E11EtSC8e-t18d- MUURP4ZYMt}tEEG맃}t1ۉ]utV?CYXjSԅE_Zǃ}tKd-PVe-Ph^#SW_3SPY[tuWEXZFFGuEe[^_]UWVSRh#P'Y[unVXtaWBƉ$BT$RUSh^#Whd%URP S h!A#VEV E h!A#VZYe[^_]UWVSuu1k>tVB_u A|$W6 XZtu h%Vh&WS#}tjSY^y SY ZPX؍e[^_]UhX#juPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'.<%t.tRFP:AY^CGjCSȃXZutKH݀u=9us8Ft38Ft1 .<%t .tQPSS@ÃCFe[^_]UWVS]S臡^u1jjjS0Bu@thVSx ~ˍ19=`.t)RPZYu FSWk_XSjWƒ ='/u9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=.!8u#P^h"^#PEZYUt^#RUO?Ɖ$E?YP7?kL$QMWd-Pe-PURh+^#MQVP$W XUV>ZUtRhB^#PAoG Sh#P/oVO t'iWY>u V- Z S$ X؍e[^_]UWVS}1ۃ=.u\WT>X$SWhJ^#SPVuPǃ VP@ZYu S Y1W V XZ؍e[^_]UVS]h#S?^Zt(hP#S?ZYth+]#S?ZYƉe[^]UVS]SYuVS?YZu]e[^]'V!Ze[^]UWVS u='/h.Zj!hZZ#TY_?|uC؉E-uEh#V>_ZEXHtjhN^#s[^Vu<Ɖ<$<T$RUAWuURPW3 V! YtsfGftjEPVO Ht-WZKtcu_E18E h+]#~XBEPE8E 0h#~Y^W0Z;u S X1ۉ؍e[^_]UWVS}u =.j蟒h}^#ZY~1E E^#e[^_]qVWS_;E4$T;E<$I;UMT$RU}EWVSURPs$W V E@u t]e[^_]-e[^_]U|EPu輷XY1xE%=@UVS|u='/u1V[t&V:$P}VPh-\|PVKZYy VhXG1ۃ='/uu!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+= '/u=H.u '/u$Pk/RPWVWVځƉ׃WVʼnZYuu؉}ܡ5/Eut u EU<uu uuqE؋U܉EU9uE}}5/!nEuuP)&ÃEU ~'='/t(} t} uEU' t tؙ)]Ur'   E5/Em tuTi'}Ɖׅ}t(/EtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉU5/ t uΆƉ1ɉ '/E'/Eu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI='/t' t u}tƉECuЉ}E}t ='/tƅRPj # j}]!Su%uuwW='/t&WVuuRPE؋U2='/tH}tBy u5/t t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1=/jjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%= '/uk/9EE}11S '/uEU)juuRPQEURP[^y='/tL,'83 t u, u5/< u@)5/ u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@5/Ey} u#"Å>H /-CMڂRPu à Hu =/~1'/u}E='/u~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ='/t!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU='/tWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5H-=L-4@w Hr5P-=T-e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S='/Ee[^_] pWV9EZYt1E E^#e[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuE<.)HP6WVƉXZutE21ɉ P/ T/E)SjjWV<.HPx<.H9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2='/uts1T/WV]jjWV<.HP e[^_]UWVEU EURP)ƉYXBut1WVYZu$='/t WV XZ5'/WV hM9ȸ}|6Du-5'/(~VRP[ 1ɉM E^#e^_]"XEUEUEPh _#XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjh+_#W^_~}Ɖס<.HP[Y9u9u e^_]d0o\WV <.IuuQjjf *QRPY<.HPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃='/t WVmXZ]u} e[^_]|USZtjhF_#VXZ%q|9} <.IQRPa ]UWVSSEE] wBu@ujhd_#V~ZYwƉ׃uu1E E_#e[^_]VSuWVO9| 5'/RP e[^_]Ê t u@UWVSƉ5x/5l/h_#hS=wWV)RPt/SXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPh_#jR_#"j PRM 9u#`#; p/<=t#; p/|:j; p/; p/9 p/ 9 p/҅5-,1 v#u t|\u@r;yj=S+ZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=t#H`#;8F1< t#uً1V‰8u$#i`# t tu䋅t3RPYZűPx`#Pd(8u‰2ʀ‰w8t1lߋ1MWqt/Ze[^_]Ë/;/~~/ l/ /‰/US/X/p//[]É19-t @uUP?kYt,.t4.t.t$.UWVS/UjS EjS }tUuu YXtP5`/} ljE5d/5d/ 5`/ E`/Ed//XZ1e[^_]UWVSÉ։9/~`/d/< +t[^_]UWVS׉ˋ5l/Vl/Љ[^_]M=H'/tt*ttt t XÃ='/u[USjm5/ZYQ#t:t1ɺNC=/tcc#t1ɺ*C]Uhkc#/PUYZt /"h|c#/P0YZt /c#jh9W`/jh(Wd//hP/hD/h /h,/ h8/1/ZU1}]á//Uh/1/1l/9h/~"`/l/d/1ɉ l/@1//////////// ///hP/ hD/h /~h,/~h8/~1҉/UWVS='/uu uqƉ[X11'/ @'/u='/u u$ZYt  /@;P- T-9U] |%!ʃtM9 H-L-U |  /@='/t /u aP'/9/h1Ҹ WVY[u1ۅtj ]SRPlDSGÃ1T'/)9~1Ҹ F19tD5ݺF1Ҹ //e[^_]á'/tP'/='/u T'/DUSh/9l/~$d/<u`/PhP/}XZCԡh/l///]UWVS]u }Eu@0tj$zYEe[^_]M=`.tWZ=`.tw/Py_uS[ۃl/~K1S ~YuSW_ZVd/t-fZYul/d/DVe_tWl/uVd^ƒt 0.Vd/teZYt t8.t .t(.Ӊ؍e[^_]UWVSEUMЃt/} u}u=/tG}EPjEU RPu ueu=@'/tV /tM E졀//U#U ;E} „t!؃tEU ///]=/tT1ۉ/1/1k /9{~%8u u1ɺZYGFu1ۃ}tO`/ l/ E1~RjEP{ l/1҅~ d/TRPuuCÃ='/u}u9EEEE55/+5/E;5@.'EPw_/9/uY=/u=/uEU //1=T/~+9=T/~P/81ɺ>GhP/yY19}E81ɋUG衠/9/|1}uEPhP/yXZh/9l/~Չ19h/~=`/   d/<<@B)5l///9/}1ɋh'/ Kݸe[^_]UWVSƉ׃='/tCP* [/+/-;@.~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ19/~ /t /)C1[^_]UWVu} ='/uщu} 1^_]^_]nl////á/l///UU1wR5/ZYUS]1w%SZ1uS5/ZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;&9tu&ـuH &uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} /E='/u#=/uS/Zt /1//_SPEZYtIWVM^_t R/xt /ShD/%vWVMZYu5/ 1/ShD/uhD/k/  /PvhD/Uu/@}/$`//9/}%hP/PuXT/T/=/9=/| l/l/؉ESjEPuU$ t9r)ډhD/t5/ 1=/[^'/t '/uuu} Ul/~7;h/ `/|t d/D0te[^_]uuu} 1ɸJt1tq`/ЉERj]Suƃ `/E9s=)Уl/RjStNjd/l/?4WtV)/~뫣/z}l/`/=`.u/P8rYl/ d/ M9u3_u(t M./t EMMb_uM`/UL_uGMAt?S~tZt /E*l/`/PqSPuE u1ɉ / '/t ='/uuu} U e[^_]g/+/4- /~9|0-)ș);/}s/)WVʈ%U KYZK=`.tv ='/tT)PoZtu} UK=`.t+SsYtStZu} e[^_]u} MU؍e[^_]e[^_] UWVS]u }/t4 u t`5/5/1ZYt 1/ ud'/t '/uR=// 5/=/1^//@/1ɉ /4뷃=`.t/ub//ÀuWV1҉"[^Шu%ШtS'n/5/=/Yf%ul /A//90Ph/Ln5/=/[Zth/nWV/ /1ɉ /<//vP/1҉//=`.u]ue[^_]Ã=/~U塰//1҉/]1UWVSQu} EE/tt t5/5/1XZ/tl=l'/tc@.;////l/h'/@.D;/~ Zl'/G=@'/u@.;/~1N= /t/@@.9}Թ ۃ=X.tt =T.u ='/u 11Ҹ *=T.t&}t 1Ҹ 1Ҹ11ҡl/e[^_]TUVS]h/ d/ށ9l/~tu ډ@[^]UEp/E /]USEM =/t)='/tu ~JH1҉ ;/9~/p/h/)Ћd/`/[]/1/UWVSQSMQyq uu RPy^ZYu]ƒt1ۃ tt 5/tI]8/H9U_Ut )]`/@]C뮋 `/t `/teY[^_]UWVSQMQyq 19| RP]ZYu㡤/X`/D_E t$5/u}tjU/Et d\L`/UL/T1;`/r H/E)K`/Uz11҅t `/ىt /eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQ-lPUt!SMQPEgEP E1jRjV)E뜉+E)Ѝe[^_]UVS/1/utFjjP$ t硠/@11ҡl//e[^]UWVS5@.@.jM9Y119=<.~"!уtRP /9}G։5@.19|)e[^_]UVSu Eu=VVY@ w>uV-SڢXZ1jjVsP u뾍e[^]UEo1҃t -]= !/t& !/tUSJZ P+JZ HX[]Ã=/y-U='/u T/1'/jhc#3ZYá/xW@d/UWV1ɉ /5/=/+9Ɖ}jhc#=4/XZe^_]ø/ @= /u1 /!/// /$!/ !/ !/ !/1҉0!/4!/(!/,!/8!/1ɉ -uF"4KhMV%'V'h?#z' Ej5YFR&jh"~:t>u R^8_UV輱Xt̋URUÉ<$xL$QM8*WPURhd%MQS螳 W _usV7YSS j9uQu)jTj;}t&uA&hc#7&*j %% ET/uGX1҉Ue[^_]SUWVS]EEEEuu QZYt jhc#h"S-YXujhd#*XZ8IhMV%%S%h?#~%oDh$j:jSjj }u}uCPÃtNO@u,E UM;M MM|E UƉ!@tt t OÃuVۧjj cjSj:DT/j`Re[^_]UWVSu6EU_}u }tcj-Ɖ[u u11j-Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k`!/GPw'k`!/1X&/'t'@&/#tUEEPhd#(YX1ÉUS.w$tXX&/'^.H!/1P!/T!/X!/L!/tP X1L!/D!/Pt jh+_#g<.N . H!/P!/T!/X!/jhP!/-.H!/L!/Y[뉉txux ujh0d#'XZ1]UVS`!/1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP,UEY^u uB2M5.sS CKCtPI Z1C@!/e[^]UEt*xu x u]zB@ @@!/]U Su]jEP>,UEYYut@ . \&/d&/h&/El&/`&/tP Z1`&/@!/UWVSPEf=X&/uJ=h&/uA=d&/u8.\&/1d&/h&/'/l&/`&/tP( _15`&/{u#j;PsiCs 1ɉKs {SC;.u RWV UPGZUte[^_]UQMt.9Ptjh=d#.%XZP@ UVS]u .1k9d!/u$9p!/u9l!/uPa~#4t P'@5u1҉[^]UU19d!/uǀl!/ǀp!/=u]UWVSu`[1h!/t:P葰PV- uEd!/h!/ 1҉h!/YS Xue[^_]Ã=X'/UWVSu hn#u`!/ C Suup&/ue[^_]j }WRPsu s蔾Xh#VqZYtVWsPhVd#u蓰UWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=<.E8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtP9 Y1Cu>/CZe[^_]USE] =.t1E Eed#tS..XNt1ۉ] Ed#u=@-x1ɉM Ed#^S-á.ZtP苿 XS!P].Sq 5.]B=@-y1ɉM Ed#]!.EEPhd#!XZ].-x$Ujh@BRP<.RP?'/USEtzE 8.MU u4@E QhH%R%- }t jhd#}QhH%R }t jhd#k'/-a-y'/EEPhd#>Phe#j ]S٨S}~P|0uD]EPh#e# XZ]á-x$Ujh@BRP@.RP"'/USEtzE 8.MU u4@E Qh#R- }t jhIe#}Qh#R }t jhae#k'/-a-y'/EEPhwe#>Phe#j ]S輧S`~P|0uD]EPhe#xXZ]US] }u!jS萏YZt]EPhe#BXZ]US] }u!jSXYZt]EPhe# XZ]UWVSUE t tP]+p&/^w=.t1ۉ] Ee#e[^_]P*PzPMRZYt]e[^_]ݠPƉ׃utS;5'/WVe[^_]USEU tXtugR*س-YYR)áس-Z=ܳ-t tP{ XSPMس-YX]]Y س-EEPhf#XZ]US] }uC='/tS3*.Y,&/h%sSsXZE@]?s]UVSE] m$EPEPu F]h#Su l'/Du>l'/Eh'/*l'/#tRRJYEEPhh#XZ]UEtHw1E Eh#].]U}u=`'/u]i1]S1]UEu=\'/ K\'/]UEu*=T'/~!EEPhh#T'/XZUEu*=P'/~!EEPhh#P'/XZUEu#=D'/t=.tL8Bu @u]]UUE t#u?-^u2@t+-!-PHEEPh i#N US E1ɉ <'/ 8'/E 8,t)EPhJ$E P }t jh$i#3<'/E 8,uf@E EPhJ$E P }tjh¸d#u1]1='/U'/EEPhi#ZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM'/tFPtu)QjP_XA'/ZjPEPH 15'/1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr&/j+UjEEZY];+u$.tPݭ _CP.YSJfh@ fXZEn='/tz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPhj#@EɅu&M}EuPh+j#}XZPhdj#1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u'/9{jQEP C]tSjZYPS XDe[^_]UWVS ]u }翅u jhj#Cu@t:EEPhj#lusEEPhj#JƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjhj#5t)u9EPjEP }uSjhk# Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjh)k#X Y^jCtF XZtC tT/te[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á'/='/tUShDk#n~P~Y[u '/@-;t CtS C t jjSXZ$ۋ]UM@-t9tBt 9t$1҉]UWVSEE1EE111E@->~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7<Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uh}#|YtPNZ~-øUS =(/u[h (/hZtL1(/E܉EEEjEPja E9$5/u5/ۃ`[(/$5/;EMMEEE=(/t=/t=x'/u-=T(/ttPjEPɈ EufE=H.u);P=-9u 5/&Pi^Xʃ=$'/t ƒftըu1(/uu u3à 1ɉ (/=H.tx*It 1҉(/(/@(/~+jX!8h}8#ZE9$5/tt T(/؋]Ujh (/?gUQEPEUUWVS0茬 ukÉ4$a|$WVuhfE#WP蔏؍e[^_]US]S[ ZuSh}#h (/ (/]ÍL$qUWVSQYq AQEU}WRPq1rwӉщE؉UM܋EuƉeWuuRP7wu؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEPXZUS-(/t,-(/Sh(/5-H 9t T/]UE-]Ã=h(/t 1h(/B$U=-,/r|-P-M1`(/E]UVSP5/t T/E1d(/EPSXZt'u $Ed(/XuJ$VoYC"e[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uMQWVRPxEUKEЊ}#EUu҅u΃}yC-YSurXZeY[^_]aPUVS]1)EM}I}#uyA-NQu 8rXZe[^]ÍL$qUWVSQ ȋ1I@E1҉UUUEEPЀ wPPwP PwMP9UU~BMjjuuuu}W9jjEЙRPuuW8 ]F8M뎅t1ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPPwP PwLP9UU~AjjuuMSQuV-9jjERPERPV8 E8댃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPPwP PwJP9UU~?jjuuM1SQuV8jjERPE1RPVa7 E8뎃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%!hWVSjubu Z Dh(/e[^_]U4tPw @rP:UXUWVSu} l(/cuWV3XZE e[^_];=t'/uldh(.WVh-T$.\S%g9@. T/e[^_]WUEU E #E#}#]UVS]u Tuu ]e[^]-P1ZE }#E}#؍e[^]\USQtu u>31YZt[=@. T/j ZQujA X؋]UWVS]uE %='/u>t>S $PhPj jjjSPh$9t|V胛 Xsuojjk 1=4/1҃=. PSW軿 t"W@ _}u)jh}#[^tP6 ZY>1e[^_]US]tP3 ZY1]U1}]UWVS|}ue( u ZE E'/x9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWu ƒ1Eun؍[|yu19E E H]9}/3{yMu$#[<:N<%<.uFu!1E1ۡ<.H9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v V ZY1CCC 5/5/5/ 5/e[^_]Uh4/XUS]4/-t-=4/ujh}#XZ]1=5/5/E]Uh4/'XUVSu] <t1ٸ4/t;pX[^]UWVSEUE|E x@.p+l<.h5'/ duu8EU =0'/t4 <'/ș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1t5/ixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x='/t )ؙ1)=~WVuuuu [Zt}뚃=0'/tEPEP58'/轮t 4/t ] '/t '/u='/t ='/tu='/uSuNPEjEURNESEPuuuN4/(Eu05/ 5/9EM|!ЃtE;5/E5/|lUsjjEPEPR`us3^$`t2EUEUu}9uEbU4/P[uC<ujj]SMQuu54/54/$ EMt%tEUSQuuMM}= '/u(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ /M1ɉ /M)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E//T/}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xu~ u~ [^}t}EUW1ɉMu~ u~ XZu4/tWsS| Zjj1CCCj @u]e[^_]| 4/C4/T/e[^_]U €u1=4/1]UWVS4u}5/ 5/EU5/5/EԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUC5/Eȡ 5/E@u}t0E9ƉU} !u5/5/]9؉ӋM},#u k/׋E܋Uuu  9}%k/]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}k/9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU 4/>MjMQjujuWVY 75/ 5/EUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEK5/ 5/!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEU5/ 5/EԋUأ5/5/]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU15/= '/u]]USj5L-@'YZt4jٸ4/Zt = '/u=5/uW1]U=4/u '/4/4/4/]|UWVSU EEt :DM@RtE34/ s,jh~#E"u jh}#Ht= '/='/= '/1ɉ 5/E]3Ɖ׃u}5'/P"ÉXZe _= '/='/jh6~#_XE+j,^@=5/@1ۉ5/.EPM4/Z@t '/ '/j15/X= '/t ='/U.}Ɖ'/u1Ʌt1<.H'uM@uu5'/cX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; <.| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujj& HP5-P1^ZtbShV)5 Nh.&P#^Zu @׀8 uSmY~#hf#P#ZYt @׀8 u SmX8t%8,t8 t@Ћ8tH5;/Rx5/PY^t5/t S,mZ@x5/P #u|#e[^]U jh;/5 =Ye[^_]UVS hVh#_ P߭[th#,Åyh#WMYhVh# ‹ tP >>j SZ=}P=hVj 蛔5|-Vjj 耔 PZ9t<6j衬=j臣Vh#Lj,<e[^]UWVS]ujh"5E tPE X+u}f= -t WVh9#WVh# jh;/5 uh`uUVQP U-Euԃ=;/u h;/hF$P2 @u ;/%h;/h&%u @u ;/=;/xj:h]#u( lj=;/;/uSh`#!t$=;/u;/=;/u Shx#jj:hJ%u ;/=;/u3;/t;/tR5;/rZY;/;/j:h/&ul t -j:ht$&uL t -j:hK#u, t L-j:h#u  t1L-j:hb$u t \-j:hu#u t l-j:h#u t |-j:h_#u t1|-j:h%ur t ̸-j:hi%uR t1̸-j:h"u5 t  -j:hJ%u t -j:h#u t;/j:h$u t L-=;/u ;/h-=;/u ;/`-;/t Ph"^_;/t PhD"|Y[;/t PhT$&fXZ;/t Ph}%P_Xh;/hi%u @u15;/h;/hH#u @u1ۉ;/h;/h=#u @u ;/ ;/t:/x:/t:/tj,SBZYt@;/t:/؍e[^_]US9}Ph#h:.+1Sh#h:.1j#U=;/th;/htj] j| D:.y1Uh@:.:MZuj=/FVtI)~@#t8u\Q ^@P u f^?봈@=/[^_]UEP^v=/^?<tP@=/=/ =/=/=/]UVSEPh#*XZ@-;t[Ct =/ @{z8u h #E9%e[^]鷒e[^]UVSP-EÉ/Aue[^]Uf=\-t=/tPFXjUjh;/5!S 9X<uY8C L{ t VW$fZYtAEPuW7 YVC Zu h#2*Xc9s ts tC Ke[^_]UWVSƋ?/C!wK?/X?/"8:.H:.y;:.|:.P:. h:.j )Y[뵋>WlcZÉ?/F<w <tj<t<f~ u=C?/:.H:.y;:.|:.P:.!h:.j!(Y[6hp$"XZ|Why#~"?/F ^_tbP<?/v Wh#P">Why#C"?/F Y[t'PPb?/$hp$" =?/"~1?/hA#(Ze[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@ #t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]hw%Sec^_ug@-; CtcE.ƅUB@tUQMrYY9MU~ 8#QRh%h:.Ã%#h:.j SXZe[^_]UWhPPPh}#h:.Iw$@/t@th @/XjUWVSSt Éֺ̬&"h}#h\&hh# cu :u!USPZZYUu=$@/e[^_]VSh#j:UEuh#hP&hh#b@0h‘#1UEuh#h@&hh#gb@0h#q1UEuh#h4&hh#1b@0h#;1UMuhx#h&jTh#a11f3A@=uUVSEu ]uh#h&j`uhx#h&jah#at0ffPh#fPh̒#fe[^]Åt$1ɀ8u"UJRPRP 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4&7XZYtdG (uh#h^{%ho$h:.E4&h#h:.'C uh:.j _XF&EsR@8t54Vt@WU$WVVEPMU1e#sj@HEPt susuh#uh#uh#uh#uh(#U$19&t@ uRh# 4&h#iXZ}tEPh4#S[^h0)uuhT#Y,01e[^_]UWVS]uh#h&h{uh#h&hh#^11{ u.h#h&hۋ=߶xtgtEWVhPs7u s h#n=ts h$#$ZY1uh# X䍕uu-WVhPsus h=#P|럸"=thPs hJ#xe[^_]UWVSSljUQU ^t#u uSuW Ãu V& ZHWx u uSVW*9uSuVY u VU& XVL& ?c벉؍e[^_]UWVS@]uh#h&h8C@uh#h&h9h#\{ uh#h&h:߃uh#h&h;ŋuh#h&h<몋1 9Ɖ} PQh͔#9|(Ɓ tPQh## 1jjh V = tS h fUtts hj#_X1jjP 9u 9t-uRh#yyPRh6#u to@u h#qmu h̕#S󥍵Ѷx Զx9t PRh#\)e[^_]Ë :.Q:.y ;:.|< t:.J :.Uh:.PZYUMPPh#h:.j F/W|$wUWSˉ1҉F/M]m =&h}fU fUm]mURp pSQh-0hx#h:.$e[_]g_UWVS]E }܍p(}p4EPSY^tSh#fXZe[^_]UWVSP]} CM% CSCt RPW# RPh-U 1t)M18th-h# f^XcCt2PWZYh-h#eY^}uzPh-YZu΁}ti=F/u\SlU8M1҉UtRWZY@u\M8-tRh-)ZY@u"{lth-h#KeY^uSh-l XZ }ye[^_]UWVSF/Xt.h-腀h-Epƃ \h-!jjEp\ @Euphp$d[^xP=(F/t,F/ 0F/t1=$F/ƃ}  =F/h-h̤#h:.D:.HD:. yh@:.Y@:.P@:.؃ t+@t( D:.y h@:.Z@:.P@:.Ѓ߃Yt\^jxt6Ph-$Y[@u8h-h$c\ E *Ph-n[Z@uȋE%=t[jhu GPhh-à uT 5 F/u"h-hp$c\5 ih-~GPhh--ÃtOGXW\`dt;`dE@hDžl-`dpt`d T`9иdT`Pjj\jjPjTjwXP|[ `1ɉ`dvRLP)TPSh L9th-hp$aXZDžX7)`d=F/th`d rPTFY^1`dhh`V/\ƃ ~aVh`V/S 9th-hp$`XZDžX;`d=F/th`dOtEp뭃=F/t#S\VFY^th-hۤ#\`XZ\q^Xu SaY5F/t SWXZ=F/uh} tbG tY4F/9GuOxPSwZYth-hp$_Y^$E9GuF/#G%PSYZuSZth-hp$_Y[=F/tWh- XZe[^_]UVS]hVs0 u sh#'Ƅ} t'h-zZth-h#_[^.h-VZYtVh#١F/t jsPeZYe[^]US]} th-MzZt h-h#sh-_ZYth-h%#^ZYF/t1E ]]]US]} th-yZt h-h#$s$s sh-Yth-h0#^ZYF/t1E ]]v]UDPPh:#h:.jUCPPh#h:.j}UWVS|Ӊ΃=lV0u\=pV0tpR|Y_u%=@u"D|hp$3]XZOt#h|VR =vQZVSjY_u%=@t=xV0u^VS°_ZuQ%=@u?VQ^uID?XPSh%hS=΃=lV0=dV0|8/uVP9ZYti|hz#UhSWQWMt=|Ph%hWPVWt|h#[_XVSCpY^ lV0uS|4_ZuS|h# j/|džY^|tpj/S谆_Zxt@xxVQ4ZY|)x)؉t=9|u fDž.Nj|ƄPRȮ^_x9Íu fDž.׉ދt󤋅tƄxPR|ZYu<|9u(;xu 9 u ;p=V0t=tV0h:.IShƦ#h:.>D:.HD:.yh@:.X@:.P@:.0t- t( D:.y h@:.P_@:.P@:.΃߃Yth:.hӦ#@I=|V0t%=@uS]TSt^u@=lV0tS|;ZY#1=pV0 PSj|jtS=hV0u1#|`V0PSh#޸e[^_]UE TET]1UE MQTU TE]1UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]61[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_]0[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_]/0[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]/[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_](/[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_].[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_]H.Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]-Z[^_]USU EAHtRSHtG t uF u:] M[]9t=V0uyDutJt] M[]%W01 []UWVS(UV0 V0 V001d@DHLP4TX\x|hlEE8à uj\jP*1=V0XZt SY:=V0uFHft&wfHtWSYuftftTVh?#SXZv PvhfE#9V0멃~Dt~T.u =V0tm=V0u7=W0tvh#'}~vh#W0YXWS1‰EXZ=V02U'jVSW 40S404Z8t h#j5e[^_]UWVS}E 0h#j j t;EPhht@j uEft-V0V0 V0WEu V01۹Mh:#u Wi M1G$&V01V0V01V0V0V0V0땃=V0t V0V01V0V01V01V0YV015V05V05V05V0V0&V01҉V01V0V01V0V0V0V01V0V01V0V0V0V0 V0}1V0V0K15V05V0V0JV01҉V03V0$W01V0 V01V011V0V0V0JV0V0V0V0V0aV0uV0fV0WV0HV09V0*1V01V015V0@/Ph#h:.j!5p3.)}V0 V0 V0t!hrQ#HZMtP-XM=V0u1=V0V0V0UV0 V0} =V0 =V0 u} V0u=V0tɀt*uMhW0jXZMW0W0V0=V0tftt&W0?W0=V0t W0{=V0t W0fW0ZttuLW0.@W0o4=V0t W0a=V0t W0h W0Z =V0u/~ =V0u! =V0uv =V0u  W0}t E E -V0e[^_]UVSƋV0tp h% XZTV ؍e[^]UVSƋV0tp h% XZTV ؍e[^]UVSxDPTuRhp$hVR@ph%hVhSVR u".0u PVh^#h:.GƄh\D#^V0 V0tS =V0t S< Y Shp$XZe[^]U=V0PTtRph% Rhp$qZYËzDV0 V0UWVSHX=V0t>jj h# SQj]S@u h#jO.Sh#XZ=5W0FډWVRPx#=V0tk#RPQ e[^_]Ë :.Q:.y ;:.| t:.J :.Uh:.P_XZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPV0tvv Rh#Ã=V0=V0tBjj h#v\vXjUR@Uu h#j,RWh$zà L W0AF`VdEUQRuuE#=V0t#RPWQ,ÃV0 V0Et*=V0tU]Ã=V0u=V0tF%=@u FaÉ؍e[^_]W|$wUWVSEUEP@ZEZuE䭧#EC u=V0tECu}EUE؉U܋=W0} W0ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut({u{ tNV [[^]UWVS(]jBW0W0X=V0uEԃ}Eԃxu x EԋpP=V0tvv s h#=V0F`VdẺUЃ=V0tBjj h# RPj}WX@u h#j*Wsh$ K W0AEUЉMMuuRP{#=V0t#RPWQoEPvEԋxvs$EPhƧ#F=V0u7s,hϧ#+ wshϧ# =V0twsh# F%= u9N % 1RPs4%1RPs0h֧#dVXN\=V0t3jj h#QRj}W@Ws(h$t "{(#=V0t#QRWPP=V0tF(V,=V0tF@VDF4V8\V0 V0Et#=V0tNVF=V0u=V0t@u[F%=uEA Eԋ@>e[^_]UWVS]C=V0tS D=V0t=V0tS(SDV0 V0lj?;-(C ;-~:P5W0 ^Zujf>Y]e[^_]1S -W0W01txux tF@-E-}E}E1҉U}9}~j}1EM9M},=V0tK(KS W0k‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=V0tS D=V0t=V0tS(SDV0 V0Ɖa -69~] [^_]șEș}E31tZ~u~ tIE9| 1=V0tK(KS c9U~U UBGv뢸 [^_]{UWVSP}V0tG X=V0t=V0tG(G\=V071Etn~u~ t]}~9,EEF,;-| 1ɉM =V0tO(OW Ev뎸 Z[^_]UVS RPuV u1 ~ )ƅte[^_]UWVS] }1WSuǵ ~ )ƅte[^_]UVSUM (-0-=X0u;QRP蹶à ~GX090tn0tb`W0VQRP~à ~ X09(-5,-tVh֫#0jOVh#jD ؍e[^]UVS] 5(-Su50-ƃ 9u$-X0~1(-X0tH~Wjjj50-)RP50-) 1(-1t8u 1(-1 8t8EuL8 uh#j(1ɉ (-[^18t8t8u%{xv$-X0=$-u ChB#_u5,-h#j誚 y,-(Shw#0j肛,1Ht u h#jhЬ#jZXZe[^]Ã=W0:=(--UWV-wh#j_XX0t X0X0 yPt 15X0(fEEEPhm50- xr(-yX05W0ujjj50-kx3jWVRP')WV50-@1ɉ X0=(- h1#ha#jXZ1e^_]ÃUWVSPE1҉P1;EE (-X0jjj50-Ɖ׋ X0xoEU uW0] W09É}EjRP50-oy% h#0jO(- )}Wt1e[^_]ÍL$qUWVQ1y(-rX0u9Dhŭ#90jjj50-y(@ h#0j蛘(- )y11҃=,-~h!#ojRP50-a hF#` (-롣019MQRPWV荥U}uthQ#j(-XZUfEEEPhm50- y)uN Vhg#0j託(-(-1eY^_]aUWVS:.=-t:.Pr#+5HW0=LW0Xu u1=1=-Oh#WV5050肨RPVh#hW5050h#hV0WVh#hV}}t^=$X0tU5|05|0h#hV褷Vh$X0hЮ#hV舷(V)$Vjޭ =-ubhY$|01WVRP菧RPVh#hV+V5|0h#hP0h#0000WVRPRPVh#hR蹶5050h#htW藶05050h#hVrRWV5|0,-HP10h#hP?8}uV5D1hfE#S%V$Vjr }*e[^_]Ã=0-y1|0X0X0UP1 |1t@=X0u7=l1t 01R5D1h(#501v501f=\W0tLhW050-ZYu6W0%=u%=W0u=W0u5TW0m;1\W0X=-w=1t -~ jP2YX50-ŭ -Z~jURPh 1 |1t.=X0u%501h'$#1l1501 0-X0 X0u 1|01X0X0=1t,-1 |1t̃=l1t011l1=1ti5D1hX#ZYuS00utjhRPJjh50500RPh]#501軸j5011|0ZYUVS Sh41j_ yhj#0j/ jSj3 yh#0j 5W0=$-B 5@W06=1u5D1h#R[XTW0hD-SZYjh<-SZYUX0C,-uPShү#h#PSh#h>#ۏ-whh#h?#躏[5D1h#詏h#蟏h۰#蕏h#苏h S褏xh%SZYu5W0(-5D1h&#>1l1[^|tFu=#0jԇ h|0Z|01UuZ@t8h[#0j蓇 US]SZ@u Sho#0jf][UWVS|uu Vkg_Z@uSt< tNu38xPVfZY@tE%=@u18؍e[^_]UWV@u 1PHx꡸1P xjƉX)|0Pw8URPh X01P@ uˋEU|0|0RPKYXh X0VZh X0[Yh X0UZjh X0HWZYuE=$X0/u(7uh$X0$h%X0h$X0 h:.WVh X0 2:.@t>h#0j虅 '|0|0|0|0RPlZYH1P(jh41jmT 1e^_]UWVS:@u 1PHx꡸1P xmhxjƉX=1t-5-蘡[toh#0jʄ =1tbbyY|1ɉl|0PwMpRPh X01P@ u!pt|0|0RPMY[th X0TZt|0|0|0|0h X0YZu؃=1txPh$X0VdY[t1 1tkxPh$X02d[ZuT1=1t/t/t|09EEx|0|/|09EE|0|Wut|09EEx|0h X0RYjh X0T[Zt0h X0_|0|0|0|0RP =$X0/u(5uh$X0$h%X0h$X0 t1 p1tgxPh$X0.cZYuP=t1t4=p1tt|09EEx|0|+|09EE|0|St|09EEx|01t101J~PWVh X0.Ph$X0G0l1[X<|0t@t=P1uPY=x-t1|0 wlPh X0XZ h X0 Ylu_|0|0|0|0RPXZy h X0;^X=1"=l1011l1=P1uSlh X0Y[y;501R|0|0|0|0RPh X0]pPRhh X01P@à =P1hu Rh X0ZXZ=1t=l1t01 1l1u!pt|0|0RPgZY<|0 x5-X1P(jh41jGcd]O 1e[^_]UWVS1@t 1t!9t30h#j~]PHx1P x=1u1X t []y!^x1 |1tW5D1hڴ#501誥l1 2h X0TZt.|0|0|0|0RP0 ^_Ht#t=1t4h X0ad_y#1P(Ɖf\WVZYyuth X0]^yơ1 |1t"=l1t501h'$#,1l1ZY-u jh41j蝖 e[^_]U=1u y  \y1PHx1]]UWVS Džlh 5L1W = w u}/t 5L1h#h4~/t/CFtP5L1]YZy"L1JSh&#0j}C|%=@t5L1hM#j| yX i$`=1u )؉h&'n[yDžlh X0}RZth X0%Zt1 1u#h X0$h X0XZY )P1=$X0/$X0PVW 9hsh$X0ho#j{tPW\ZYu1=1t:t:t|09x|0W|09|0ut|09x|0jh X02MZYy'jh41j7`J$ 1oth X0mXYSPh X0N xסt1 p1u+=1501h$X0r)l1XZ}tPh$X0[YZu=t1t;=p1tt|09x|0||09|0t|09x|0]|0=1t h X09 h X0"Y+|0 tEt@wpPh X0ZYZ h X0uZh X0"WXjj50p0荓l y80p0ddRh$#0j$zh X0V jh X0oXYy#lPh X0[h X0V Rdlh X0a dy Rh X0 Rh X0@XZlPh X0YX=1x=l1k011ɉ l1Te[^_]US 0 00u 1@0=~~ h~Ph#ÁthPh#jwK0T-5TW0Zx&100 00‰00 Dy밉؋]U 0 0=-u>0t5=~~ h~Ph#thPh #jYw@5TW0XZx%0 0001001 y 0 0T-~0~UWVSX1t hN#jp0=0T-u0yS0+0EU EUT-EEuuuuCu})׋E9ƉM}u}WV!ZY+u} 0T- M19}k0U0;0s#50PY_00+ 0RP_Zxk 010T-щ 0}=000EU)001ɉ 0 0o-h#j\uXZ؍e[^_]Ã=P-US=-uh#j%uXZyx1ۉ0015T-5 0ZY~% 00‰0001+P-~C9}Ph#jt Iu뙋]ÃUWVuM 0)ȣ0^_]UWVS$]CDž$$ x$|$x $=1u15xPu Q^_y狳aVh#0jtPuZYud%!h #0jvtۉ15T-5 0u ?ƒ  09|Ru -WQQRuk9uUy%:Vh4#0js79|$u9x$t hY#j\rZPu 贾ZYyVh#0jsNjE49}u;0th#뗋9}3t)1;x$|$}Ru ye[^_]Ã=0t1US5T-5 0ZY~' 00‰000=u.=1u01$x100X1]ÍL$qUWVSQ Q1ɉMMu u150=0)9}Ή50)څutċ0]؉}܍MQWSRPƉ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u}001970+0щ9|`tt%u؉}9}M؉]܋E0+u}럸eY[^_]aUWVS] ~E0+0 U )څ~'#9~؋50}50)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu 胻Y[uEl*Džlhh #0jo֋ltE1҉Pd19} 0+ 0 } yjș9Ή}hlpPtPQ50u ƒ2E0x} yE} Gpu5X0=T1 td@9u 0Й).1];x$|$}Rhu  19x=T1t, u&Ed9$thh#jm 1e[^_]UWVSV 0019|1`; 00}h#jAmZY1ۉ00T- 0‰0;E~ 1}}])1u5T-5 0ZY9T-uG00E 0~$50lj=0T-90~?E00 0E)։׉=01Jt[tTA100x,T- 0‰0;E"])X1EEe[^_]Ë09 0s.UWS0)105T-EXe[_]UWVSu] ~;0+05T-Zx 9~‹=0=0)1e[^_]UWVS1;EE }P0+05T-Zx5É9EE }]u 1=0=0)]u 1e[^_]UWVS]x$|$ $=1Pu _ZyzVh#0jok[0+0~b9}P50u ' )019|5T-|^yt7h&#0}94tVhG#ji 1YuxPu ZYySh#0jij;EutSh#֋U Ze[^_]UVS]E xz$usP ZyVhs#0ji$tAPdYy$eVh#0ji$P 1$ 1Ze[^]UVS|]s|PVIXYxS=1t1F $M9$$u0;|u(,$U90$u;EuVh#j2h 뻸e[^]US|]EPSlIZYy1=1uOE%=@uEh%SZYu\SYy} tJShָ#0jh/SZy501赩Sh#0jrh̋]UVS]EUdh1ɉlE Upt1x}=-t =-|PS_H^ZuZ=-u#EUdhEl=-uYZy+th #0j3^WVD>$u! PVXZ=d1u ($jd1 - -t[j $P3V%A=-u =-t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSu{u h##E18}t}t:11E16SVu{ 9+u hA#i11E1ҍCtPR辏 XY P蜊 Yuh3#jP[XZ>CPVЉUPEU 0j\̍<+E e[^_]UVSu] }u1NjjjVy fShY#jh$1Vps yEShA#0j[e[^]UVS]u x@PuX=1t*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu s ~ pt1@9uNjt9|$up9x$thp#jY xPu ZYySh#OT$9X$u;t h#jjju 3y$Sh#0j Zp1$1e[^_]UST1tPR1ۉT181XD1um1 D:.yh@:.IYu9@:.P@:.9-uu%1S H1 t뭅u oډӡH1<<1u<1 B<1tϋxyRZV붉H1j5P1hH1ԦT1 ,1]U=1uP1=1tP1=x1t P1@=D1u'h H1Yuh#jWXZ1Bt1t9UVSut>uh#j 苆 Xuh #j?WY[FV!ZH~ 8/u3E ؉C1C=D1uD1@1X@11e[^]á<1t@=1t 41=1u4=1t+UE$u81tjP5T1誯 US=1t8D11t6{u+uh1#jVVXZ3hn#h:.p} [Ƌ]UWVS]=41u =T1<1541 @u=1u95T1譩81Yu @uЋHHQf $<&@PURURpp p0]9xjjuuuu81p ph^#jfUph|#h#p jDV Qph#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=1L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPm y$81p[Vhȼ#0jTƄ  ǃ$h 81pCP3h 81rP5D1hX#A t1<1@=e[^_]W|$wUWVS<ÉUMMQEPBbu}j 9ƉЍM}Qh#Qh#j@Sue[^_]g_UWVS\]u=1CEuPhn#Vy ue[^_]韔}W($|ET$X$(j8$VEj<$+Uu#u#PjRj4$Wh#V4y$ w'@$  R%Ph #|$x$h#VxuEPhߴ%Vx$Pw Sh#u Sh3"Vx Vj s]ZYV耓Xe[^_]UWVST]}T$X$uV($m{SWVh$#Pe[^_]UWVS]u fVfuPZt%t0SRjP}W.VWCۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=1!u%U1h-#jLXZ1ø1UWVSSu] E}MM1҉7=\1u)S\1:-uX1 p3.=X1uA \1Q\1u \1X1UWPZYtAU:uC7tMM}E] ue[^_]iE] ue[^_]W3hh#(x:u9p3.9}7@p3.W3h#h:.r?e[^_]1UE E EE]nW|$wUWVSjEPSƉ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uh#P_2_DžuBh#jPJY[8zx1҉P= 1uf 11tc߀?t\j,W輂[ZÅtj=W詂ZYuhս#Ej y YUuh#jIVa 1B1e[^_]UWVSQÍEPS f^_uC 1%Ƌ]| tC]Sx Zu11 KDe[^_]Uh:.h#葽jb-9t BtU-Uh:.hs#]h:.h #Nh:.h#?h:.h#0 jbUWVSPuh%SnZYh%S_ZÊEhV(YXu Vh#0jeI }t/1e[^_]UWVSlj/E 0j_ZD1t@E D1h#P77[^bD1#\111҉U11ɉM11Ejh`-h#u uKzX$&7!057h#f 0렸1P-덡78-uxu1TW0EjTW0[1QPW0#B13x1$1-=-u#`@}1`11=1u `1d1-c1T57;_11p1a -HPW0L%9`171$1Ex9~/pPu$z EZYuh#jEj|_EMȋ71P}PW0Ş$1\11|157,DPW0*#gTW0-XTW0-ITW0-:TW0-+TW0-TW0- -7PW0$11=x-1ɉ 1575CZ411p3.E 4-umu}t 01:.01:.Hw49Uu }uj5 CL-11t HuP11E`h/#jC$hv#P螩[_h#S臩ZYF1`1}tE8MMYEh#W7ZYE@:.t&h!A#WjEZYuWhy#jC1E1EEYE}tESrz [h#u趨ZYu`1uKz XEjh#uɧ u@`1t EtSz [EPj*uy XZ1ɉMEHjSu E&EE]}t EtSy [h#WZYt u[=1lW5E.j51Ss ^E6~t1C}11ExM}h#SLZYLFLjP[_}u'hv#P[_u^ h#SZYE@:.ur1҉UE5DžUuzuh#S貦ZYt u贂_=1tSh#{E@u}jPZYy!h!A#ShEY_vS6tj.h#W8YZt2jh#We ujjW_Z*jS1ɉ P-}CTW0t 81h#TW0Zt 8TW0"D1"11jh`-h#u uz$l&1-ă뿃7057h#11x7TW0f1 TPW0#E1@31΀1 7@7tjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh#j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 5D1h#5[_Vh#5h #5hB#5h W5hC#W˛ZYuhK#W踙[= u hm#:5Y덊uh##5ZX<.uuh#5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDh#j2|tHL@t<uDh+#h:.Y WDhA#h:.Yt@th WD0 1e[^_]UWVS]t K΄u hK#R<\u FFu8uShd#j1 Dž~ja Xuh#j1[^GjQP袍 t5hVP֗SVh#ji1 Wh YpV֊t\uF8tFWh Shd#yRZV1u,Wh h#j0GBGtVuh#ji_ Xuh#j0[^C31CVZC 1ɉKECE C= 1u 11X11e[^]US 11t6Cu+uhC#j/XZ3hn#h:.V [Ƌ]UWVSu 1t$tS=1u S1u=1uSu $uoFPYuhm#j /C_Zt/1s\Ct/1ɉK;WҒZC Hǀ?/uC C$l 19tP@uh#j.Y[CS&f 1$Z-e[^_]UVSu1ۉ$ 1u,=1u1=1wC |/t[t0CuPFP3L KVPYuɡ1u #$tV^Zt 1$e[^]UWVS]=x-tes{.u{.u Ct: =\1\1h-#jL,Y^5\1u1p /u󋃰$w倻 u ƃ .% W$ PW> N\1h-#j+XZ둸e[^_]UVSu]FSM Yt/$P1w SM Z@؍e[^]US]l11uh#h#j<+ZY 1tPX~U=1t S jDUWVSQÉסB.1 MtMDHu }.ueuaBWZ9Xt+UV觎Yu@F0k NDоU11USvZ) w U$&0k KDЃD=d80k KDkd-lBK0k sL1ȉBB0k KDωB0k KDЉB 0k KDЉB0k KDЉBR:Ӊ‰_Y!1؍e[^_]UWVSM51t!8$=1t4;t@51t+<$=1t ;t@11҅Pփ Ӄt] t)8pX$9T$}d$9`$XP ;T$X$}s;`$(td$89`$X|ItOP `$9xd$.tX$89T$X|tP T$9pX$} @&1҅‰[^_]UWVSQ]t:t4=1u3Ujh=C[ 1_ZUuh#j'[^#t.\u{#uCS? YuSh#j' ʋXj jCS'à D? =11<7t 9t&@ujV Zt p h#b1e[^_]UWVSQ]t:t4=1u3Ujh=\Z 1_ZUuh#j'[^#t.\u{#uCS: YuShK#j& ʋXj jCS&à 9 =11<7t 9t&@ujU Zt p hs#b1e[^_]UWVSut>u h#j/Vn[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh#j% RE@jU Xuh#j%Y[.t;u GM1GtAt+@uVh#%O}tgE8t_W@uuh9#j$W\ bGƒWt+G 9OG}VuhU#j$WT\ 1G=1u=11x=11 hx#e[^_]UWVSM=1tPÉֹ=1:t9pt@9u9U}tjcS ZUuh#j$[^1p1ɉH xe[^_]Ã=1u1Ujh W 1YZt1h#j#XZ1UWVS}1$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujWR YtGGP Zt0 $$$CSEC ECECEC1~SiZ Yh#j"XZdUh 3 PV $Uu-$CHCwC3Z SZ [^̍e[^_]UWVSM14$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3RY X]e[^_]BY e[^_]UWVSS=1t51ۋ4t#1ɉ v0E Y EPY XZuC u͍e[^_]Ã=1UWVjhGqT 1_Zuh#j!Y^CB#=(15,1-5,1Z@uzVhP#0j! VLX1e^_]1Ã=1u1UjhS 1YZt1ht#j XZ1Ã=1u1Ujh=S 1YZt1h#jP XZ1UE$$ $]UWVS(}u=10 $$$EUE 1҉ẺUЋ,$0$1!!ډEԉU؋E9uE9t1!!ډEU 1EE11ɋEUƅt6@ ]9Xu]9t@P @ $$$NEU#E#UЉE܉UEu1Uu1  O $$$ƅE] tYE]1؋U]1 uEjN X1ۉY $$$AQ F AN tX1-t"1111uϡ11M̋]!!9ur9unt`11utLUjqM Zt=UMHUPX N HF $$$EԋU؉,$0$Wh#jh#j1e[^_]Ã=1u1Ujh=P 1YZt1hI#jXZ1Ã=1tDUVS110tjjs sss3[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ 1=1Et#؋M9Hu9p u M9Hu9xt@$uj(K X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RS XE #Ee[^_]Ie[^_]UWVSEEE EM}1tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3JS SDS XZ1e[^_]1UWVS]}E=`1t,;/t'PS^ZuSh#jT |j$J Yu#Sh#j2 tXue[^_]R SZtGFG4W8F VG(W,FVGlFF 1F51e[^_]US1tvC1=d1u{ t s3賴XZ- -tjjssss 3=|-t s3YX3Q SQ 1XZ놋]UWVSE @~}DE@Eu119}1Ҋ LBuEC}t#]1ۉ]Mэu9s F^BE1uZY[^_]UWVS u=1FhGSPG <9tjww 5-Qm;Wu;G t Ѝh#*SR5-{ 9؍t褍h#0j SR~ yT$X$G9__W1jG Xjjj5-lG WxNS5-J{ 9u)T$X$GW1W8Ռh+# ɌhK#0j$ WO Xhj#jZYe[^_]UWVSQ1uh#jXZohu u Eޅt6u}Y_tcvj F ^t;uƉYt#uvGZt _E81QVN XWN _h#jN[^0^Su*}ZYtSN u!F_Zuh#e[^_]UWVSu} 1t=h7V t&3V|ZYuusVw [֍e[^_]UWVS1ۉ]U]u tu} 1҉EU]t} t} u^ <^4^F (Ku0CEUEU}t9s}u9rKC0E}1 ۉZY[^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=B.ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh#h S;7SyEVh#h S7Sy=Vh#h S6SzyVh#h S6SZe[^_]USSˋ t%RQPE3K 1U1ɉ EeveRu P ]URPh'#j Ujh豨ø1҃=1t1UMU111<u @=u3} u( A=1t1AH]UVS]} ~;uqjh#Px u%=-u -hQ#j@ZY1-jjPƺ 9؍e[^]UVSZÅ3h#VxZY[uh#SxZYt)SVh#jh#h#h#j -vSVh#j1o1e[^]UWVS]u hV_Z@ub- 1{ǃ4$K<vCVh11 | Rh11 Y jjFdP(%($jjFlP8$jjFtP<$$jj F|PdEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1҉$$$$ 2t8,1ǃ$ǃ4$($Qv`ǃ$($ Kt $x$|$ށ1$$$$w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%1҉$$$$1|/uDe[^_]UWVS u$Hwv$&=1t_h#j h=#hb#h#Ń d~ Ph#뮋XcV~Rh#땹1jdRP1$$$ u#EƄ/ojj 11#Y[1u9E2jd PEPgojj 11wE1Ex$|$ƅz ӍynHʃ0Pu uo9uh#9rH@0%1҉$$=1u =1t 11 T$X$W($1jj_Z_8$1jjZYg<$1jjY_{jj _Zud2M1jjhZYuDhSV[_y>jh虡ZYx鋖$  Ѓh#'e[^_]11UWVS}} ?jh#Vq Åulh#V]rY^¡1 1 u1h$#jE XZjjP虻ƺ- 9tPVht#j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPWJz/@E K<vM E)Vh11Mȉ Rh11  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)PbyjjFtP<$ Ɔ(8$P P9ZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2h!A#V(_Xu$u0? PVh%#j[@:.1EPSDZYt/G}vEVWh8#jEUt@:.u1 SBXe[^_]á1t UU RuP詟51BUVS]u F51tRPS)  tD3j S8ZYu1e[^]US]}t X1|1 1t=l1th:.j 1l1ZY5D1h!"h:.&Su h:.h:.j  ]USjh_#Y[xEh"P=1YZt&h!A#So=1YZt13513AZS<X=1th_#hY#j ]UVS] u}t X1|1 1t=l1th:.j 1ɉ l1XZ5D1h!"h:.%Vuh:.~S= Ph$h:.%h:.j XZe[^]UqPhu#h:.}%j  1UcqPh#h:.W%jUWVSƋ=81tPh#h:.+% =01u ЉˋQtjPYZtKr8tɍEPs'XZ=41tVh#^Xjswjsʈ%} u#VWPREPh#h:.z$h:.h?D:.HD:.[yh@:.@Y@:.P@:.؃t- t( D:.y h@:.@Z@:.P@:.΃1Ylje[^_]UWVSAօu"VP_ZtDžF%=t1jh @txPHY[x^9|u,;u(^9u;F u%=tpWƹkZ<jjjO  ׉NX^\19ȉ}{ 9}Dž 1P 9+{}ZcjjjNG? NX^\19ȉ}{ 9}Dž 1P 9+{ZjjjNnfNX^\19ȉ}{ 9}Dž 1P@ 9+{Zjjj8MNX^\19ȉ 9}Dž 1W 9PPW& +^_jjjDL~\vX19}p1҉ u݉19} 1QP| 9u#)[@ @1hp$jZYuoXe[^_]UE @E E@E]%]UVSutYS} u C tC01@01R. s. S. 01H01 u,1te[^]UVSu01@01`1؃8t VPjZY1u 01u,1t e[^]e[^]UVS`11؋tJ9tFjPZY1uԉe[^]UWVS01@01ƍPxY11ɋ`1tx?tBA'u9t ha# 01u,1th jVS3&19}Vphs#p-HQP yP-H Z J GSjXe[^_]UMtA'1`1]UWVSu^Nj7t#vuZY[Åu jWXZ ׻؍e[^_]USh%JZtaujY1"41tP{ Ã1X؋]UWVSP}U UWRW"ơ01@01$TW舩C1҉S URwC01H01u,1t e[^_]Le[^_]UVSuV[t#sVYZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY118u&S;u0h}#5-qXZ1P1uj=CP+Y_uyjS5_ZDžuSh#5- Shs#&w%-xWP yPl -H YlJ ]@PS3XZKe[^_]UWVS5 1B.DCtVjEPV1N11] &8KȉMA&uV)PRh#&tK11C&u)BUPg1NjU1Xu,Ƹ^ À~|tH;= ÊVθ(,)%%#$Ƹ Ƹ^ 1e[^_]U51Ph#UWVSQ5111PIÉ51^=F-t <#uKt;u %&4d1҉jEPSRKƉd 8uE8t+d8tM#`& tBUUue[^_]W|$wUWVS ÉUM7Hw$&q# uu }#!uME5 #tރ uWVuu WVuuJ MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=1%1  UU6EU=1&t #2E11MQ  mWUEaYutu]ƉӉڍe[^_]g_UWVS(Ɖӡ11EЉUtUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh"j]S{jSuA e[^_]US7=1)u c[]W|$wUWVS4É։MЋ?E1EăH311V]ЉE뭃$" "tCك<E4EȉU̸#=1# wEУ1tV!EȉŰEЃ'wF^1ƒ}'u1EURPh"j}W jW6 EУ1 11V]U]11VWEnY1 M1ۉ]11VWE7҉EȉUX}t # n1t VEȉUU1Ɖ׃ƒ'u1EȉURPh"juV jV51 #닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sá11EUUV01Kw\,&8,&}GVQ1YYuRPUMY_Kw#,&9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ 1AZwSjƉYX=1uRE11MQ  SUEZ  !1e[^_]UWVS}USFƉX=1uQBE11MQ  SUE щX 1e[^_]ÍL$qUWVSQ q}W軝51XjLP ZYt5xIu,xNu&1҉Uj PZYUtB@)։51@뽉1 1k1=1t #EЉUWԝEЋUԍeY[^_]aUWVSRE} #_-- 1 1HO;t( 1sx&軞P ωʋ7 1tx BM菞P M҅xJ sH+ -Q舛X51SƉRPhg$ e[^_]Ë1Ѕt /tt@11 @1US]u1Z;/uPh%iZY@tEPSZZY@tҋM9u;Eu3E3U ]UWVS}V蚚VP  tS[ 1Y]e[^_] SYZ8"u뺅uqY0# Ph# e[^_]UVSu= 1uE=-t.1҉-h#pPYZtSΙ 1Xue[^]3e[^]UVSu3t = 11tP Y01@01 111 1jR01H01Zu,1tG = 1t,j51h#j5 1h#jh#m[^1VG@$1VP%-- 1 >/t[5 1>t' 1H 1FxFC蟛XVԀ~/u# 1KhC#V!IZYu$-9r :ƅuh 1K;/u>th%VHZYt 1x/4)X/ XV>t 1H 1FxފFC9-u 1x/C ܚX/= 1uȚ 101@011tP X 115-舗 1j51h#@j5 1h#.01H01u ,1u@e[^]UWVS} u01@01ukYy 01u,1ttj;á01H01Zu,1ttt h# Y0t$=-u =V-t5 1hn#gXZ1ue[^_]UWVS-hƅdhE#葮Yt =l11=P1u 1P1=1tVW=1tVW_X=1tVW8=1twww*1ɉ P1zjwXZ1=P1P1fjw_X=P1tQP1E=1tgWfY(jSW Rh#:h-V EވE1UR脇ZEPՇX1t=-tP1t }tPtje[^_]UWVS} E E܍uV׆51ju\1jY=-tKt>=-u5tUVUt E PuRXZ=l1u V袆X\VZu1P1tje[^_]UWVSWE} _-- 1 1HO;t( 1sx&ևP ωʋ7 1tx BM誇P M҅xJ 莇H+ -Q裄^`1PS|ZY1P1P1e[^_]UVS]h11jshXZ=-l1tKup1Hp1t1l1up1Hp1W1ۉl1MwE5P1=P1; ut-t)E Ps5P1l1ZY[x h15P1e[^]UWVSu=P1=-u1EPiE؉E܋^Yt$hPS.M =l1b[E؋E1҉h1]؅6F1=-P 1PP[h #Qv I-xWPyP-H =_ J=s--xWPYyP-H X J 5-W_jsv E Pvk=P1=-uJl1t:up1Hp1-1ɉ l1Hu p1Hp11҉l1 h1=P1EPpXe[^_]UWVS]uV趂E؉E܋S 1jPs{K[tt=l1uk{t_G1EpWPZYt@1=l1uA=-u81; u{C1u s ]P1ZYt‹띋[1P1V譂Xe[^_]UWVS]} 3EsdX=-{51 1P褠Ph#Stj RU5-UR h#Xu h#X-HyP-H X J 5-(Y01@01u"jS*fEPSRUztUt,uveuu 01u,1tjsKWs$UuR\e1҉P1 RpP1X 01u,1tjtJ=-tA{t;51 1P1Ph#-Ee[^_]e[^_]USD81EE1EEppX=-tlExtc51 1P赞ZYEP($#[EXtj S5- [h#[5-tXjEPZYtlE8141j7XEuKt&:EP$#X5-XԋEtP1j58101@01Eģ81j EppXZ1ɉM 01t5u EpY[01@01E81jX 01t,1t뻡,1txEt"EP$#X5-LZ]UWVS}] 1CCC =-EP~01@01E^@u h#VjWbjWPwu31ɉ 01,1tuvju(jWuYE؉s 01H01Zu,1tpEP ~Xe[^_]UWVSE ,1@H1X1(1$1`H1EP}X1L1E@1ptEXt7u!C1hpPSE 1 sB_tҋ[ŋt1ۉEp ^x|EXtC1sYu|1҉4pjxPS E [븅t4B4닅4P.{_0pt0J0H 䋅010T=-t"=d1u4~0@T40)Љ0=-u 4}fEE( 51 1PAZYP[x1ۅt--HyPd_-H J ~j=W`Y[Åt?v{Z-HyPX-H = J={=WAX6 ept@t--HyPX-H J vX6 뼋Ep -tRVPK t vHyPhX-H J 5-_uxsjh &V( u Xԁ}( ``041 Huw)4)400toX4t-X`0QRUR0of}Zf}tJXZ:-{z-uzu apu CSu>E `tfE=1u Ext,AEftfwE=q t=( tgˋE@ft501@01juo][^'8t4'8t*'8 uxPW'ZY@t 'WPiX뀃 h u tCƒv~ 1PSP6hfE#jUWVS]} Cfsftf$ftgSH1$jV$PN P|hJyӅtsh|#`XZ Xth#_t h#YVhp$"XZt h#XVhp$Y^tq01@01sP$P`01H01 u,1th#3,P'h# PVh#{ t--HyP-H *Z J*-HyP-H X J e[^_]UVSu@&t"8u%uCVPZYt؍e[^]UVSu&t8uVPZYuCݍe[^]US,-1ҋ1tHft fux@ |u[]UWVS}01@011t,Pfu9x fu9=,-| P X҉΍^1t 01u,1t e[^_]%e[^_]UWVSuH1XE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVh#qZYUtU~:uBC렡,-U҅y E,- !WE,-Xe[^_]UWVS01@011t!f{usSz XZٍ݉w1t 01u,1t e[^_]e[^_]UWVSutA%<11tCVPOZYtdߋ} tX01@01V,$=cÉ1fCC VCP襶01H01 u,1tB=1؍e[^_]US&tjP)f@SPXZߋ]U01@011 P/ 01H01Zu,1tUWVS] j/u ^_t[EtFxPu!ZYy !8t!8t!ffCf1CrƋMH19tMEth#QY_tM ju_Zt@HftftfuEu6Eu E u=,-yƀx u1E\tE Dž\u =,-yuGYDž5DžXt,-f~tFXDžTDž`juEP` Wa1Zu?/ugX9`Y@Ph#KnZYtuYDžt51h#!nYZuzX9`hxPW:YZy.8B84T"E%==1tlEWLȉ`+-$Q`WU_ju+ƃt fx`tWuh#dQWBcXZ01@01d\ujuY_f~udfF`FDžT BtEt$jTPuh9,&5-"f`z01@01d\uju=XZf~udfF~ 01u,1tF FfF CfF fCFCe[^_]UWVS(EE1E11E111Eh#vEZtPE܃bw$(&1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEE1: E؈E11tIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5-s^-@h#[EjWVZYtY@ft8*fuu<1P18ufHu("fu}}t̓=,-x tH1fMfMPu̍EPW EfEփ}t f@ E܃}xf}tjWY_t jPlXZ(OE܍e[^_]UVSu 01@01jucË@ZYft&fHu sXfCFC fFC FC 01u,1t e[^]e[^]US ]01@01fEEE-fEu EEPSL01H01 u,1t ]]UjuZYtfxup)kX1UWVS(1E11hT#s_t'ptvtV EѾʋE ct ]tPhX#nt hj#^1ۉ]ԋ 19#cu1#QPh#/uSY &uwjSbXZh#j w tmh#ſXwhn#0_XuY1P1x 8u SP YZthh#h#XX1딡18t-HyP -H YwJ h}ujSXZtGfEGE<H1f}f}U؉UPjEPSEfEEE؃1f}f}t f}f}j/SZYu^H1}tEM؉MjSEPEPYMIy߅u#t?#Ph#蘾[_uljS-ZYuuYhX$u_Luu0F Ph L#W %u%h#uh# uh #譽Shn#ZYu h*#舽XEE~Eԍe[^_]UWVSEPY@1+-P X -^_}GE܊_tqtg}tb} C<v8u1:t* t/t<EP4Y[=V-t"E u 1xA gZH}낃= 1uOZ 1-8u(hX#YYu'P脺 Z1t p P EPXXuEE %E1F^t\}tÊ& <vC< w 1@1yYH @1 1@1yYH @1AE@uF9utm&t_U9UčvsՉ‹EĈ@ȉƃEM9MMP YPEP EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQ%NZYx>EE1EE׉E1҉UURMQMYZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=1Uqxvtu@r t@;}u51[xP513uZYy9tt1t9s'@ZxvttE]S@ϡ1;EtP9Uu8/t]C %%PX E91t@/Džp>t F1ptJxw@tu@o,1tS)YpF/SZt؀x .u o.ux jWtJ tptWu(51@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu$1sk^<*P@1@1+-uuuuSuu%@1+-ʉ@1)@ 1uX uuuSuYeuXE)؋1 RhR#u܊N#uNQSHPRhm##u E܃EEPSE)HPRh#ëW@1+-Pu }tzM]u EMEtZ|wt<1<1׃uY]Qt@뿃uHus독tEe[^_]UWVS]E %E1ɉME tE-1u 1E@1+-E;~uE t u S=XZE 1Es}B~< O$&:=J{s{u{y{@u{=uz1D1E} t 1@1y;P@1e s 1@1y^;P@11 1@1y8;P@1 t=D1t"@1+-M9~xuH@1 uE uE 11 1@1y:P@1҃}u C< w 1@1y:P@1S 1x@1H @1Us:H @1U߈ ts1E#E PVu R<1p<1<1VvXU 1x@1H @1U9H @1U߈E {~=u}1Eu V[X u1 1x@1H @1Uu9H @1U߈EE Ru跹ZYE @1+-jPHP pމe[^_]UWVSEu ]=&-t1҉D1P <1-@1- 11ɉ ,1 (1P1Sp 1_Zu#u8@1 1@1H 1@1ys8P@1@1+-P}5$1 1XtXZEu EL}tzKyS]P _ P KyS;P|^@P|4M}tVhpX$S荅 iEM0EKySP Y P EEESqEZPe[^_]UVSMt0t"119};ivuC⋉11tJiD} u&ƒu=t uă[^]UWVS utF>%~W,[tW,XY#*Ft~uH<-tB<%t<+u:-#-i 1# 1 1E1MxdtS~J~?Hu(UFPQMWYZMUt UQW"+YZUu뗅uV+ZtjV+ 1 1XJxRt~i90tM΅x29 1~*i 1t"# ##1ۃ} uVP萎؍e[^_]UVSh#K5X= 1tYh#r-HP&-H YwSs1Z8P1xj10Y^u h#BP+ 1i5rO@Ph #) 9DiPhpX$FXZՋJ ;1e[^]UWVSQ111Uh(#-4ZUt%jtptg Ժ;ƍ7H~h,# 1tyt hT#UjPYXUt 1t+ 1i5rO@Phr#t"Ph#XZ1tnHi0i0h#Հ-HQPFY_y/P#X 9~ -x99z 9~ z8 ܉e[^_]Ã= 1u!UjuZYu11á 1u! 1 1Jxu 1øUE=-t@= 1t7uR+ 1i5rO@Phx#5-UWVS= 1t.5 1 1NxtSX1 1 1 1J01B01uh<ViP)Ë 1 1i߉_19~i9uFPo ^ 1 1iƄDŽIu 1 01u$,1tЉt 01@01=N-1ɉfǃ 14؃} ~iE PZ 01u,1t:؍e[^_]UWVSu]= 1u1ɉ 181 1SSrwXZu1 1}=-tpt u K8Wj^X}u-W5-jZY@u0C hPh#SjpSjp*}u$Sj^wSjVwtAt8t$=-tSjpSjpSjpuI 1=^uj|jhTh%{ thTh%h.#?}uke[^_]US]U M=-ut u1uEM E[]UWVS}tE1ɉEPu EPE t!01@01 1E1ff81tt;E܋EEEEi}9r(}i 1M9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉tcu tQ= 1t1=-P;u uEt tEu- 01u2,1t)h"}upuEe[^_]UWVSjjjà ~ jjj=-tQCtN5-6GG^9t7=GP5-讃ZY@u0肝 hjPh##1 195 1|btPu= 1u>SKX5E t t&tt M ڋEsF떍e[^_]US1h#h+Zt$ltptZu⻀ۻԻ͡1u t8t Php$Ea^jt h(#X6jsjs u7{t1h#Xh$jsh&1~[(h,#js u h#_h@h#js { t&u h#f^h0#[js T u h#@[h7#h#h;#$XjsZYu h# XhC#js u h#Xhk%h #s h#jswhB#js hH#Cph#zs t=jvih]#\jv U; uhN#hS#9_vhX#s!h]#s#1#%1`Q#1#1#  #S9tRh#j}WlWVC [w*yh#:Ph#j]SlSvjPiZYhh#h0l$NXe[^_]UVS]u t3u hʈ%XjSZYt{t hʈ%X[ɍe[^]UVSEX 1=-u=-u25 1ju XZ= 1 D3... 1e[^]UWVS}]5 1t/1}t3=-tޅttVS[YX}u-t?Hi@@} t u P XZ؍e[^_]UWVSP]u }]Ytu,EjWVSE#)0蘎 Phn#>vPWVSe[^_]UWVS]t P 1 =P 1dPXX1u \1 p1`[1\\9P 1~jh\&`PΙà u\P 1dP_NP^؀;18t@x/t@xPSj/ZYy1EЉEԋ\ 1\u94 1E[ 1u#e1:tt@u= 1h#Shw^_19-T!T-51߉Sh-xWPYyP@g-H X J EЋUԋ\ 1 1\ke[^_]UWVS}WY}E11tb=-u5}t/j5-4jh-Xf-1PaHZ=-u;1u{=-uru=-t`=-tWh#qgXF+t'=-u1҃= 1‰ 1jPyY^1WZ*u@WTXe[^_]UVSU:01@01jRgfY^x jPXZ 01u,1t\rx=f-t01=-t -1ۀ=-t-11jjVj =f-tt-t-e[^]he[^]US]01@01jSeZYxjP01H01ZYt Sh.#q,1t~qjX]Uu}~E p P:ca1Uu#z Zu h#qUu u ZYu h#rqUVSuV蚮@$VP(S؍e[^]UVSEX9-}]ށ}01@01FPb-P-5--01H01Zu,1tip01@015--)- 01u,1t4pe[^]UEuj h#jvb;-)--UE--P-P 1P  1P 1]US]01@01-9t-P XC-C-C 1 01u,1t ]bo]UU01@01B 1R~01H01Zu,1toUWVSW -\ k01@01=-5- 1thG9ua-CPW¡--J -+- 1- 1^^t5;8u1H+pp X@MSNjM󤣐--X 01u,1t e[^_]Ine[^_]UE01B01-)- 01u,1t]n]US-- 1-[]US-+ 1-)أ 1-[]UU-)---+U У 1]UWVS,ME 11˅t MPZMwDGƋ܃}tE0v h#mFPKE0u _E1t0wLG V褪YMVu5OMM̋3XZ̋EЍe[^_]UWVSD`111EE h#E_t/}pt}rt}duܡ1EЋ1E뿡1E؃8u h#lj0E^tt S`c[Ejh<"nEZYuE.&EP5-- 1X1EEԉEĿEÉEjMQj_ HMt EU߉Ӏ\uA}\}u:jQjK_ HuE߉< uO}tj/P_[X9UtltRUu}ZYt%URh.&}ZYR}] 1xF $p+-E1!= 1u  1}NE-9r,>Wu9}ZYtWh.&(}ZYuuƃ}tjuh<"ki j5-E0Vi EE؋jh\&P݅tT}q 1)Otދ 1E؃xu*EJ 1xF6p'ljUh<"E0蠩ZYUu.J 1xV P+-RE^,u 1j5-E0gh E5-- 11ۉ]*EP EЍe[^_]UWVS1hIX$E[t01@01j+P#01H01ZYu,1ti11rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPha#]Vhq# ]Y[ ȃ0 wF1҉U1ҍpЉvShw#&T1 EGuԃ}t{Sh#Dh01@01SHXtҁRW9GWx 01u,1tguʵ09 PSh#gҁRfY5-SZZ-@th#[XEEe[^_]UWVS$f11h#QEYt(}St}at}Hu׃Ҿˋ]E&E؃8t@9tE Sh#1Mԅuxt h"fuhD#u!^Z|u1ۉ]܉]k] EډӉM܉]FFHЃ w!̋U9и Esuh#ft uh#EX 1RShjMu9UrMˋEÉu&11EPC PPsCP3h(#gZtWEUE܉U}uM}uGhD#2ZY t Ph%ZXZu ;u EUE܉U1C 1RPuu0LRPh>#Y 띃URE@ POZY@Uu0} PhD#G}t]u]u ]uuRE@ P7[^yͲ0<} Ph]#dE؀x u_j7d 1*tEUEUuu hv# YY$}O 1SQRPEKRPhg$X 5-WZ-@th#[XXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPSۘM 9t#t9uƉׁvSh#Sh#ce[^_]UE0 w @8u1]UVS]1tS薠Z1tpVh%S" ¸tVVh#S ¸t<uh"SCx Y^¸t0 vSZe[^]Åt2US-t1:-u-Au-[]È-U-PPR-PXZ=` 1tM=6-uDP\PW` 1eXY%u#jPh#9a UWVS}] Fh#U_~%1ۃ<-u,-R-U#RPh#8V%#Cuġ-HyPT-H ^ J 1ۋ-t#c#<-t"RPh&#U Cuh0#:U[1-:-t2-U#t RPhM#-RPhf#uU Cu-HyPS-H YJ vu&hYi%W^Zu-@uK1-tPWZYuډe[^_]FuWU#Ph?#Y`e[^_]USMU 1-9u ]R@uQU#PhX#`UVS]Ct&st Pp XCEe[^]p e[^]UWVSP]1ƍ@uPXtUP0UBX1h1r151=11҉1Ye[^_]UWVS }t151EE519N 1BE-uB<-uzu+t 511ۉ؃EEE@tcu}t11ӃouUE8t E!Pu"Ft51U!RPuSjGY[+U#Phl#W^ru"}th#`Ph#Rjf^SPXZDu)--u~uMe[^_]e[^_]UVS] C}أ1V-1-@uV-jMX18u=1un-=-u*=n-u:j^tj܂Yt - =-u=n-u-=-u --1=-ut :-u-1 -u - - -@uـ=n-uC=1t 1u<@1X1P11jPV1X1XZ=1t6뻋u h#\H 11Pt1111111ۉB9tt 51 1e[^]~U}ujjjjVE01@01jL1Z8tPX 01u ,1u1U[UU0 wj jR Hu111UWVS}uEt ]uQ t9-u Ayu+UB1ۉ1ۿE?5Y]-uyt͉:UtKu5?:u$EEEjEPh#Yà EPh#cQy:u벉뮍Py:xuWڅuU?<:u!EEEjEPh#Yà tEPh#h-Njh#Z^1H9ujRh#LYà 1Ujh#h#/Yà U+E@1?1ɉE11ҋMPh#j URgNhURh#X ÊEEEjURu X( t1E1҉PjXe[^_]UME  h#pYP u1=1u11ɉ 11h1h1RppUVSM1tuA1u1:-uztC1B<-uztBu 1˅tǍr8tuPh #9Yy:u܀y:u.zu 1J 12u Ph#{X51151e[^]UWVSj*1^Qzth2#:8-0E 111j1Yt8zt hC#W8-u @P51P)Xu n19\x9}hU#벍EPYá01@011 1)<}_߉ƋM9sω9s x19r )ЍpkME)9s 151 01u,1tVSo[PY19} hl#01B01)أ11ljNx=1tE7g ZEy1ۍ1)‰ Lu11 01u,1tU1e[^_]Ë-z8U 1x@ @-J8-z8]ÃxuUSt Pf XK]HÃ8uU1҉P8u]UVSƋXCF~h 1A1Z1f@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P-JHR P UPUSUJtXxv-u~u C $t h@#-B0+B8PCXe[^_]UWVS4-EX=uE8t h&35-- 1} t u Eu P9!E@EŠt 9u u4--PP GӁt uu ljE)WPk 1H}t 1R\uG 1x\F p\Sà u! 1x F dp 4-> 1xF Dp u"4-@4-==O A94--PP 1xV P-)Rx-X4-M)ȍe[^_]UWVS@} -B ]urVY wVhN#Vhf# 4`&h#j"S?FSZ؅tWh#}xM4`&h#jP FSUWVS]S5-M EZY9-ulPu_H=`19s<wDu 9rMW5\1^ ZYt%\1=`1M܋=\15\1 ##S e[^_]ø#-ztLUS`1tt#u*##41 154-P`1ZY]UE`1jZEODU謳\uH袳 u"4--@8xtjjXEjjh"D _UVS-Xt 1ۉXX8x tjb-1҉P Y1p84-P0 1x 1P 10ƃ)c t,~tŁF $& 4--PP @\ |td;Z=t g u,?&u-@1-@d|u-@Ǯ-@)&t;u,-@ -@ q-@-@r-@_a=t0 u74-@4--B0ztjj`Y-1҉Pjh"&Vtà ؍e[^]UWVSSá-@tuy =-,uyGEt7 &t,O8uQPiZYu &^_8Et2jwV2Y_t XS,4$PS- Rt -1҉P؍e[^_]UVS-p$ t jj-ubX(x,u{ upVDZuh#P: uBPVg-BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um-B]US]V9tjS]UWVS3t u%j _8XpZʡ-@؍e[^_]UWVSS-@}%11EuCPw C u j X1҉PYt8uj 1~^Xj 1҉VPXFYƉ}t'}ugEwRu D}twu}um-@-@}t_Լ&t<}t jjG-@#61ۀԼ& r؍e[^_]UWVShEӉM-@E1E81E誰E+-]jEPZYtxcTd*"t~L tgF=.H#"$& Džd't+pЃPЃv;4--Yt藧PЃw tPd@d_ƍ@;w`u hc#<\u<\uhz#ރ?PDžd Džd11\PЃ \w t0)Pw t0Pw t0脣 Ad9ud(=w h#0= 1 á 1HCw6 1?ʀJ R 1CC@wj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1Ywj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1;wj 1?ʀJ w 1CC 1 ?ɀQ vP 1P@ 1 ?{ 1?ʀJ w 1CC 1?ʀJ vH 1H@ 1 ?ȀP vQ 1QA 1?ȀH vJ 1JB 1?ʀB< vA 1AA 1Xh#}€ u 1 e a]tW t)蔣'~ \u聣=uh@#%4--xtjjX븲Š& <w 1C 1fxt @ 1C=u 1s\谟k u%4--@8xtjj^GJtujaY>uVZ0VXs;5d 1};5h 1~5h 1}>uIy>u |u &u y1tm&ups1ɉK-djdB(-@(X4-Pj¡-@(Y-u @ 1҉P  躚s-X$-@ 荚-`H,hP S-p9-@ Y (\u: 15 1VXO"D8 .lhjډU 1H\^{t & 1\+-X 1d\@{1#Tþ}Tty&uh B.DYu[tJ}Tu@Td1e1jjhd1 T1Tۘھ &tJ 1xd@d\Xd\ &uJЃ wK 1xd@d\Hd\ƒt:@Ѓ v0t' 1\d\P 1xdX=d6X=d%:t #u&¾Rdh&SIYZ߻&d 1H 1tx:C X:xCdXdt\dd9‹\uADdd1 u#}t 1x#C $X#踖1Gfxufxt΀Aw@ ȋ-X2dVNj@f@f@dr@"&1҉Pa'uAW|"&u1 1\Nj@@&f@ 1\$ו 1HNj@@&@f@e[^_]UWVSS-1ۅtXC1-0x tj-1҉P YF8Pv vS‹FP U8tSj-p蘚7jh&P-HUJ@ B Κ]e[^_]UHu+]UWhPT81ld-`(1\}1󫡨-X1pjEP*ZYE81(1E-Tjh螙 :jh&P -B t$Pt=^- hppDžt1ɉxR|T}E-jjtP‹ -pnX-`-dڙZl81\(141u jlPDžp#u^j2Džp#X-`-dlXl81\(1pu hpp}UWVS -@1ۉ]}¡- u@$xm@4$t&jj}CjjlCQu;jF Ej@UBjj,UB뻡-xu j F Y1҉V @jaj 3^ -zu jCjUjCjD-@C u-x,u p [u h#Zj诿 -PS @0C>-Yx ubx,u\h%po^ZuIu¡- up0-pY1҉US@PvjjfHu? 8j@-1҉P P-J0HCBHYvB-@ttjjjtCV-@^Xj蓾 -B0+B8C j -p0EC 5- ~ uh%vnZYt h%CEF-xj ƋE0FEY-xu-x  jj p0‰EEU表-@^Zu UBE밡-xt jj@0Fj:F -@Yt-Pv jj u -@FEM1҉@{j jC1҉SY^tNjjX=V-tt3j"-@X&}t-@uWf^_VjjJ¡- u@$x@1ɉutt;tj aXZÉs؍e[^_]UWVSP} uE E1E1}-X- u+p0ƉxXtӡ-p^[뼋H up$E0FEE럋]K9u}} uwj- 4-H4^SZYuh+#Ssj/v> t hJ# -4-+A8FF-1x4M@u} u jj\1E1҉j 1ɉHEFE F -@0F[e[^_]UWVSS-@1tu=V-tt h\#LGܡ-@nAuWj 腺1BUjnËUBpXYUjU$C^Ut1ɉ ֡-@tj")pZƉe[^_]UU-1ɉHHPtjjX-1҉P t/Ht3-@jy-Ytrrho#*-1U11ҋE]DUU Et 9Pt]UMt1tPt9JuB]US]jθSCU PUPUP X]UWVSEP [y h#9*u;5-~5-ExWTgZ=w PWVI `jjjr uNuCjjtjjtjjtjjt$jj tSEpuj-vuEe[^_]1=p1UWVS}u ~}th@VW蚌à VW謌ZY}t9u9t:WX19t-yw0tA PVWhC#SmSVWh]#)9-}-؍e[^_]UWVS]{tN7Gu p1} t} t&Wxjw PR+GxPYWx9 Z1Ce[^_]USt101@01uSwt1S;9 01H01 u,1t ]']UVSt1t/}u jS$ZYstFxPTX6͍e[^]UWVSu] -9}5-9~-9t7SjjSV+9t}u8VW? PShy#'؍e[^_]US - A - ~.CPjjI x9-}-PX͹ؙ } l1]UVSul1 ~;d 1|p5l1j Và x9-}-9t0tVYYwN9d 1~>}u}1ɺ<ƒu,EEptVl_9h 1}Vh#0sssru>i1UPjS @Uui0@4 PSh#> !9t'VjS @ui04 PSh #}!ju܋MZh(#rXe[^_]UVS]u M1P1<@&t#KyS PMX P&<uFtPh#S+ S4&VZYt vVuQShC#MSh<#EF y)KyS] P-Y P-Ph#S Sv XZۍe[^]UVS]h01u!u 1u01tX=1uOTuZ1tO18tCt>11@1=-tu01uO ,1g0[^]US]SYt ]]鋵h%S. YZtSfZu]US]x#t%SVZuSh#j h11]UVS]} tKyS P ^(P ?u3Sh?#q ZY?tH!VmPhp$S  uKvyS~ P XɋP 뽍e[^]US01@011t8t PB) 1҉Y1u11 01u,1t ]]Ë1u1t9u=1u 1UWVS]u =1u1t8t= 1…teu`tM t$tAW؃u>=-3=-u,=1u#=n-t=-u1uYEPjSc @}t tD1:=-tt!Sv=-<uu9ujPSaZY@t^u1u jSZY1E܉EEEK>v `d DjEPj e[^_]UWVS] }uh%spU^_t}shƗ$VMUZYuhx# j5- xh#V U^_Eur1tF01@011P& 1ɉ 1[t jVXZ 01u,1tF@u111Eq}sh"$VTY_th&"VT_Zt CE1#~puM} CEh%E0>TZYƅFMEu}}(th1ۍF~u1u6u h}#XV?Ph% C ~ h?#oX1ۉ@ut h?#WX111tB18u6u h#-_VPh%C ~ h?#[1F@ut h?#Y1ۋ1t718t+h#1PE SlPh#-C@u91tLu==1tE0Zu)E0>-u~u1}tE1 111ECh#RXECu\1t1Phn#Y[E PaÃEX?vEph'#5-6 h#1Zu h# 1P XSCPh# zCuui01@01t VX1t1P6# Y41t jSJXZ 01,1EO111Ee[^_]UWVSuu 11ǻ1tB8t;01@01W-1P01H01ZYu,1t1uu e[^_]e[^_]UVS]u 1u VSQYX1<vjSA\XZuƃ1e[^]áP1=1u t8u1UWVS11ɉ 11u@@u 1e[^_]1҉1=1u‹1t1}W15P1S!jP+Sb! d1t }wWk15P1Xe?1uHuUS]91t$jj1jj(jj1]US\1ɉM=1u'=1t1t EEP111P11tjEP[Zu Eģ81jEPZYt01@01jEPY[uO8Eģ81=1uы1tǀ;tH11jSXZ몍Eģ81bjcwX] Cvv1ɉMMMMEPjoXZjSYYX1EEEEK>v \ DjEPj wSP@XZ51[U1E1YUWVSh &P ZYj'V: _Zu <)ș19e[^_]á01@01-t,UP 1--Z 01u ,1t 01u,1tW UWVS]~;1Wu u ~ )Dž~E u F ~) Z[8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu1CfKS u>01@01s>C CC01H01^uV,1tMV Ffu9s01@016CPRC S)S01H01ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9-u]e[^]e[^]U5-uXZU5-u~XZUPuu EPE u hA# uPJu UEPu u UE Pu5- UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'V_Ztt~tnhl#VeZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h &V ZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9-u]e[^_]se[^_]U5-uXZUh-Ih-?XZU8ruPhq#Ph#UWVSSEPE X85-- 1j=RUKZYj=S?ZYU))9~߉Ӊ 1I 1<=t$t xFU蘙p UCɅxUzU] Ue[^_]?UE1@u,1+1Rpp h#jh1*1UWVSu} ]t t9u t1141&Ft9t&!@t)[^_]UWVSS11ɋ 1tZuA=u܍P訕EY1 1t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#SaZYSCZ9u;Shp$j'S=Y^ƅu+Shl%XZ/<'uh#sXuS)Ph#o e[^]UWVS]} sSt"CtS҉XuEs1Et Whe$Y_}t5uhe$XZ$-Jy R[ -z9 _F>=u y:Cu}th)j#FPZY-HyP-H X J e[^_]UWVS=1u1 h;1Y11 1tJG} tE t8tEt.19P511%1XZ1ZUR蜏Y M@9Ex FNHy1f=tWDUPXZUu柉u Ue[^_]xU@81E1EjEPZYt EEȣ81uu u E81EUSq01`u 541d Z#t #P41%01X%u#jPh#Q ]U E!E}~U t :-uE-E=1u0@=1tc@=X1tf@=-ti@=-tl@=` 1tp@=n-ts@jEPh# UVS]u 01@01tsVP 01u,1t e[^]e[^]UWVSQ&ۍEt?~S RPW" u%EWZCFσCF CZh81Ph)# u.E,1,101141e[^_]e[^_]UWVS 1t?Cu  u sf YCuSY ZӨ@tsCcX뻍w1t묍e[^_]USjju' u1+ËPu@t s SZuۋCS D]UWVSuT1t#{VWZYtj=WY[XIjjVƃ t2@u+ƒ U t!Vt s VZu FV \؍e[^_]UWVSE :rtE11ۉUhk#EYUt*}nt}ptڅu&}u Džu뾅t18u(Iu 1ujSVRu1E1P1EPjSMM у 1Ҁ9=uBtHt !H)u*@t$USuh-#O EUu0넅u* pxtuS0ZaShL#VRSv FEe[^_]UVSQujEPV Ë@M t 01B01tCUKS |uujh\&V E ucCƒSu u sJ ZES< X 01u,1t1҉Ѝe[^]UWVS11su s --s ZYVCƒJujvXZ=StuPF K DPY_F u v ZCFC FCFS| Xbe[^_]UWVS111Ehb#EXt1vt%et1f EփxuѾ뾋E E=1t&}t P- Y}t V7 XZԉ؍e[^_]UUE  E UKt hg#jpp 1UWVSUUu 01@01jXU:-u0zu*5-ɇ -Ǿ-C 1s_1*jEPRU<ǃ UuSj=R+ ZYUtR贇VPVjRe E81s C1C@C O u 0Eu 0E% uKOKE tGG <=uRUVP tjRU\ZYU w1u1<=u 1H111{11 01u,1t e[^_]e[^_]US]tu s,XZ]US1ۅuh#NtxtIuh#uYu 1P1t SPXZ]UEU )]USME )u AR)[]W|$wUWVSD1҉j EPS-EUD 8t1D8"u'EU9sSh# E9u Sh##B.U8@}DW@tE9tфu͋EUe[^_]g_UWVSQƉAukIe9Fu[~6x9uJjjTxY_UPsPUR+x Hx N9 uW XF!؍e[^_]UŠH8-u>1tfzuh\ jjh&1zuHhq jj h&BR.uh\ jjh&h4#P4ZY¸&t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&P~_7;";f xuWS萯[^1WSZYuNf$ &)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!]Ȼ]u9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$t&SV2Y[SV2_ZYSVy2[^SVh2ZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PV薬^_xPSZY04]E9uc9u_E98PV=^_uWxPS*ZYuD04MU9u9uE98f9]PV^_t1oxPSϫZYu鋅|9u;xu͋3E 3U $&~t08u9ut1u u# 9uM(;8Mt#y޸$#uPhy# ECSW YZ@u';"}*#RPhߴ% E}t jW XZMuUVS@# 11 11W5<9t j=SYZt hSXZ> Ph#j@]SjSh#j h-h<"(j hs>$h#ƒ %u#j Ph#mj,h#h#\j hs>$h#K$e[^]U=41t 1 1 1R- 1141<1 1=t1t jY-----tPP1-ZUj1ɉ P1~>R-1 1-Zxt@~j01@01jXZ11uƀ1@@u 01u,1tj UEt]UVS]u tVs XZe[^]UVS]u @&$`&Vs [u CEe[^]s w'VDF4$VsJVs Vs[Vs Gs7'VDF[ ]VsVs C[XZD[*uFEEhF#V#Y[EEE8.u(px*u EhF#V_ZEEu uh#EffEƋE@xWBtG,%A[A< $&CCA<2hIEܡ1tP^u$ǣ1YE܋E܊@<<~8Hw0$p&b~<'tz<\tv<"trflnhrdt`v\ru B.DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС 1tP`Z1 11tPIX11$11ɺF E5$1FP£1XLx׉2Es}t"tRSuuh 180RutRSuh 1Ruh 1 @ 1 1j Ek5 1hp$`11t11҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPub_XMƉUйjEV}t uWVuP(hWVStWVSWVN1th؉EM܀"t'uEЉUmЊM<7)1҉EP10}С1P1UY^MmЃ=1t^}ѹLE}mt(t <$SuPX <$u t <$SP( <$]EЃ}t%tPP$Suu LPP$rt PP$SeWW$u%}Nu 1Buh#C[^E@EEf}f815--fBYt*fBh #jK1}9tǃ8뼡1h#XPeY[^_]aUE E EE]UWVS}0uh j jh &MQÅu$Mh j jh&QÃHxu Vh##Eh:.h# Ea6Wh#h:.rvWh$#h:._F (twu1h&SY_ujh&V &t"VP_Zu&f81&uhP11҉zY[th?#vVh#Ė f81hY$S2_Z1ɉ>ÉhR"V_Zu h]"VZYu6hb"VY_u Vh# e891h#Sj_ZDžum>jP11҉(Y[th#葕XZ <91G}Ɖ듍Wh#S: HuEt9d1s(h#.d1fj91Y[fj91uƅhG$Sv^Zujh81h%SVZYujh81 h#S+Y^uAjW11҉_Z91Ph5#SY^u.jW11҉_Z 91hC#SY^u.jW11҉t_ZL91hT#S[Y^u.jW11҉5_Z 91h"SY^u.jW11҉_Z91Thd#SZYthr#SY^u.jW11҉_Z~91h#SY^u2hW11҉d_Z<f(91h"SJY^u2hW11҉!_Zf*91~h#SY^u2hW11҉_Zf,91;h#SY^u.hW11҉_Zuwf.91h#SY^u*jW11҉__Zu;091h#SJZYu9jW11҉$Y_tVSh!#u491wPw{tSh# F;d1rSh#;~!jSh#‰d3181f‹x9181hf#V舮_ZƉ>uh'#|Y[&;twWZt ucPVWui uT-&Ë91WYƀ>thf#V_ZƉ>1h&tB.DPt7hP11҉,ZYt$h?#蕏[_ Dž"!y v5Vh#\hD#R1ɉƇ8181$&p91|91|9181W8116C-fCp91|91|9181te@81t>16C‹|9181h81Ze[^_]UWVSP1۾&<&tCtg1}jSEPJ ths#zY1@E h jSP|1E4FZ9uuqXe[^_]UEU M= -tMU E]2]USÃ=81=81u1҉Dt%Ph81XZ0 u=81t =81t0 ux=81u=81u7j͝h81hedAS/ tHh81hrdAS u/h#j}h81hedAP y h#j]USQ81WEVd91WEVfh91h81:fh91X=81=81u2h81hfdS y8t8t#rE=81u2EPhmdS? y h#\Z$-h= KX=81t1&h81hgdS y#W]UWVEu 81t 81e^_]Uh81hmd5$- UEU 19s f3P]UERPZYUS]EPu h@:.hSƒt$t< tj S:ZYt1]US@-tsPh $D `E E'$]!U"=x:1u"PhF$P: Hu9Y[u uVh $YI][<1M9Y<}Ph $yY[1jPTU t5h1uh:.=t:1~E1]9^~ t)t;FtF5h1Wuh:.+FGVh $ȖXZe[^_]USBHBy;B| X RQXZ]UWVSQ]u uh'"S F fw4 &h"Ph."S FPjh8"SЙFPjhD"S这 Sh&XZFXt ShQ"Y_FXt Sh\"XZFXt Sha"Y_Sj T~v(hj"S`v,h|"SR v0h"SAv8h"S3v4h"S%$vu8t/j} tu Sh $! Sh &_X뿃} tu /Ph $ 벍/Ph &[^띋$t $PnYPaZ}t E1_jPSr y hw#X7ƒu*t=tR蕥$u hfE#n e[^_]UE(@1E @1]á(@1á$@1UE Puh:.bh:.j $rjUWVS]8ށu= @1t5(@1h!"jYX=;1t"= @1u5(@1h $F1;1XZuu % ZYyW虤Ph$ t7= @1t.j %X= @1tP5(@1h $j e[^_]UE Puj' UE Puj UE Puh UE Pujj~UWVSt1ۉ$@1Ph%E^_y h $YKhVuh~ }t Ƅ1ۍPWTEYZyWh- $NXZ]%=`uz 9u;u$@1Whh <1@ à uWh= $뜍xPSD^_yS끋%= ShW $e= u0t,WhV腌 à t ߻Whu $+WY#0hV?m à uh <1hp$BXZ멉؍e[^_]UEPpZtPRPh $ u uh $hh;1U;1U塄;1tjXj -USuj0h&j{ ;1jjM]US:jҠjj_jjV]UWVSÉ֋x CPww wwփt=@@1~j {X@@1e[^_]UWVS1=4@18@14@11,@10@1,@11 Džۿu/h $h $f}3EE܋Eؙ}E)9EE у}uUuG=B1=B1 }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AExB11}fG18f@@XZtA 15B1xB1C,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=xB19E9UʋMou{5xB1C,)֋C,C,)s$S(;h$SNjCSMEAE@ufFZ[tA 1B1Ee[^_]UWVSu^8C@Pvu uu uhPu uB1 )P@1ɉ5TC1NP t1҉ 91CtCS OtNCSWVQ +QCSLCS >WVQ +CS yP @1t|u!<|uxuxx u xv8|^u |txTC1=B1XT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp xB1TC1H0|Ãx} xB1x5xB1f-sTC1B0C9sjh-VS5xB1 C =B1t@Y @[ JPdh t19}#8@#BLlp>Ãxjh-p+SPh)$j=B1t h=$kYhI$OZtWC jjTC1@0 RPJ P^_DTC1@0Ɖ =B1tL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|21B1 ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jjTC1@4 RPjjWVv f-xB1Hɉf- f-f-f-f-E-=B1tE-]E]C WV XZ=B1t CpSt C(T1ҋ TC1I4 xtWV`([^11tjupEO xB1f-UJ TC1@4B9s$Ujh-QMOM xB1 UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_#f@t|#PhP$$\=B1t+=B1tC CC C u#hZ$eYhi$ڰZu1B11nu t3f@^_`@1d@1jj ¡,-ƅDž Dž1 B1X[tBBp tBBtPR^_t`@1d@1hs$Ӄ[=B1t/5(-jjjj`@1d@1uh$蘯Yu5,-RPjjt0C1=B1toh$db5`@1=d@1ut(jjX@[ZHfAWV$1`@1d@1XZ=B1tj F\_`@1d@1ut!jjRP!`@1d@1uu h$RPof%[^f=@h$sh$臮ZY5`@1=d@15(-jjjj`@1d@1utRP5,-jjEhjj5d@15`@1YƅDžm WV}@@PP WVaf@5d@15`@15d@15`@16^_8th$x1ɉ B1[B1B1tCjj RPpE u{C9s#Qjj RPXB N0ӍS19r)#u 5d@15`@1iu"h$蠀h?#ua1B1XZ$fH^_f@t !5d@15`@1hC#fu8!t%hC#5d@15`@15d@15`@1#@Z[@fAs5d@15`@1gf@5d@15`@1h;$$u thR$Y =B1j XXeY[^_]aUWVS}u w wN@fEEZY9ucB1t=B1t =B1tj jjjw wuB1jhe$W[ w wNYXG d@19O u,-;`@1tOf%|#f=@u#Rhk$d~w wE)Puhy$zX=B1us=B1tRyNj {Wh$~XZ=B1t2h$^_=B1tfE)fCe[^_]q h$ݩZHt1ɉ B1x밍e[^_]UWSáTC1p8ѻSYu1ۅt$ TC1q0RPkáTC1H01{ ؍e[_]Ƀ=B1tf‰Ã=B1tÃ=B1tUWRP-Y_}UWVS,u} }B1B19]KM])9ȉЋUTC1H8UUE9|"A!!EUM]9]}=B1tuI!QWVh$VTC1MȉẺMuuWVrE EMEЉUԉE؉U܁\TtCЋU!CEUԉE؉U܋CEU܉EUEUEUE9ƉUCEU܋]9؉Ћ]ظ=B1tduuWVh$U TC1EƉ׃\TtAЋ]!A׋ARPuuh$}UZEȋUEUԋ]9؉Ћ]ظ};=B1tuuWVh$$9UTC1uuh=$U$럍e[^_]ÍL$qUWVSQ8QEU}9Es9=B1B1Esuuhb$y@1@1TC1sx1u؉}܉Ɖ׃uЉ}ԋ}9}Ћ}}sEU9E}(\1ҍMQRPuuP; EЉUԋEUEUċ}ϋUEȉUḾTt$+ =B1FSQhR$q+ =DC1t4hg$[+DC1Xtssh$@+ j S*X=XCP'>1C1X=B1t =B1th$OD1X=B1=B1u h$O_=B1t h $O^zN0Ph%HY[u70t-1҉,j,R Ph%h}%t=B1u h@$OX& e[^_]UWVS]s{{@u(EUE9E1s WVE܃ WVhHLY4DEUE9ƉU}4Ѓ1B1뾍U1Eg 1pB1tB1hB1lB1ETC1];X,W}}1Euu TC1U׉e^_\Ttq֋}!qSI SQhC1To5C1TC1}󤡤B1=B1ttt5TC1u5C1脜 =B1tE@x TC1E1E=`B1t7TC1p,kEd1E;SVuPhs$h:.1=`B1=B1=B1ExU t1U u E#uh$;[^ExU uۋ}G\M]ȃ}tgu EUHu}u}11ۉΉ!!u6u2EU}9}u܋}9}uԋEUEU}uE|C1ËE}uu 1ɉK<}%?}u}9t uuu EZuuh$:j; 1}MECEUEUtxu}9r WV[X M89xu9tuËEUtx5D1=D1 D1D1TC11҉EUtxEUtxt1x1 E9EEEEe9׾r 1)ӉΉߋ|C1E]3u us'C1|1҉TYm9}u9utc%?u9tWVh$;9j Su1$YXu Suh$9uEsE)Éٍ1EPE 1B1e[^_]UWVSEP@EUE@ E}juu艻 tD1t`}9xuPu9puHEuuh?$Ep p D1qyEpxu}qy D19@C1u @C1u덋=D198tEUMK؍e[^_]UWVSTU1EE~ DC1D1111ETC1H,9M=`B1t5kEd1M6SMQuPh$h:.Z1ۉ`B11ɉMTC1U;9soWVtXZt`u} B1tCCpB1tEtCCttEWVkZY8tEPSZYuE_Ee[^_]UEU @,+B,]Ƀ=B1tf‰Ã=B1tÃ=B1tUWRPY_}UWVS Ep8=B1t 1Q=B1tt1;B1B1slj}1RPj@F[_DžEx48x0.Fh%PeRZY"}O_ u9ttFPh$s4Y_R$Pn`ZFfSPV whD$>`_tr<Fo)efFYPVWGfSPVE@0P4p pihfH DžU;B0B4wr r@Y[=B1ƅhhC#Pl B1 B1ufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFhC#PNZYucA1A =B1 ~h$Ep pFh$^H1B1EHX P@uuȉh$SQRPVFD9c$>tFPh*$y1_Xr$P][tguE@0P4=B1t hQ$YP1҉P FfPhc$#]_u@@ uE@0P4=B1t hQ$[H1ɉH F>ufWVO C+fFPVS,fWVuDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uh`$ ~ .u)hp$Ep p֝1>h$[EH0P4 19B1B1s h$=B1tuHu<~t6h$1RPEp p蔜=B1uHt%~u븉Fh$&[[H1f1RPcXY,t#B<v^uM;A0A4o h$1RPEp pЛh$ZW1ɉ B1?M;A0A4t!=B1=B1$$R1RPEp pPh$ZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0Ph$Ph$-=B1t h$ Xh$XYU;B0B4}R AAQ=B1tTVC9tHh$1RPEp p™CFh$~XHt 1҉B1 DžfKPRh$>+u Dž 1 e[^_]UWVS\jj`_ZP$&h$+h$W[^u 1ɉ B1}hjjjj8hD$+h$W_Zt5jjhjjjjآu h)$X*1ۉB1hr$SW^urjhejh[$+h$,WZYuh$W_>jj%[^@%@3fs Pht$)=B1tjjY_fXZh j5$C154C11ƅDž 54C1$C19T=`B1tD+4C1=$C1k#)WSPh$h:.1`B1C$w0h$ss xB1A 1C$h$ xB1QC SRPRPhW^ xB1C$1҃=B1tQRPWh0$h$a)QRPWh0$h$b)=B1t h$ _ xB1C$D1C$=B1t/ss CNjC$1~YY=B1u$GW 萷h$TZHt1B1GWڍ@1=B1@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=B1u4C1_54C11ɉ B19s؋{$@1=B1@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =B1th$SQRPOhC#vvvv 蜓fOWh$SQRPh$Pu 1B1,v vOYf@fOFVFV RPhC#vv 訒4C1$C149s$;ww Y1҉WWY_8u؋=4C19s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=B1tUWVSX$C14C1D4C19=`B1tA=$C1))Kkd"VWSPh!$h:.T1ۉ`B1ss WZY{u { <{u{t t&5B1tC=B1t8=B1t/u*CS 9RPWf@1C SCSut+RPWW¡dB1Y_:u9|Css菰FXZ95dB1|)js s賜Y=hC$E"hi$YN /ss^1ƅs{Dž  B1^_tBBptBBtVRPZYu hj$x!_Pss觛tQDži ssvVPtUf@Y[5d@15`@1UfHXZ4e[^_]UWVS EP@EULC1ETC1RVuu EEƉׁ\TtCЋU!CQC RPhC1R5C1TC1}󤡤B1=B1ttt5TC1u5C1 ExU t U tuh$ [^1}E@ EE}juu跢 pEUЃ1EUB10M;DC1Ӆt3}9{u}9{trzs{DC1R Y!}tdExU uEp`ơTC1RPuu E؉U܉Ѓ1EU܉M؃3pB1tB1Ex@t+jjTC1@4 ؙRPEpHpDp p` TC1Ez89x t2}t,E@$ EL@ EEUMW}tu}toTC1E{89x u^E@EL@jRPEppk K` tPuSzch 5TC15 $rXZ=B1thC1GC1X=B1t =@D1uB1 B1 B1d TC1AhdlߋplƉ߁\TtAЋt!AƃdAId t1RP5[^5TC1BLЉ@D =B1uh$ [Huqh{($Y=B1th 5TC15hSP5|C15B1ƃ hC1lC1pC1|C1=LBALt[=B1h+$`h$tY_jjjjjSW;=|C1fGWW:fGC1CJtejPh/+$ =B1uh $ Zu9hM$軸X=B1tC=|C1fGW9fGC1_fCff=v]hd+$Y=B1uh+$Zu8h+$OX=B1tfC=|C1fGW{9fGC1_fCffuih+$AY=B1uh$5ZuDh{($_=B1tjjjjjS:=|C1fGW9fGC1f{f9}zD3<:u8u|S貃 Y랃}tVPUZt8PhF|@SQ yhF S?_X1-tP^}tIMQ3tP赟Yt Zy S X؍e[^_]Ƀ=B1tf‰Ã=B1tÍL$qUWVSQ(E̋AEqy AEȡTC1X0]؉E܍EPuuWVr UMUЉMԉE9މEs C1p1MЋ])jj`SQt ǡK1U4ڃr h/$c_W!ʈEȋxlEHXC1!9tPRPh/$K1u< =B1t h{($运^h$[u 1ɉ B11!EPT@P}̉WE1҉PPPTeY[^_]aÃ=B1tUWRP_Y_}UWVS$EԉUMQƉ׋EETC1H0ș9Ή} EE9EPWVuSTC1J09u EÃxth/$XșRQWVrv CuWVPuU tUB EPE܉UM9ME9u9t)MЋE@ E܋UM9Mt7}t1a+E9Et }tE`M؃PESTCPƉE9Eu1E`e[^_]UWVS,E @XEȍ]ܹ1juȋEpG ޅtPEp[_E P@"EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0h0$n,=B1t h{($!Yh$SZu 1B11)V] CSFV rC8S<e[^_]UWVSPhjjIƉRP 2ÃfCd;EPjjSPTC1;B0u UztWVM_X5B1u  C1QrRP E@ `TC1M ȐȔh P5u6G뭉Eu胃Ee[^_]UWVS}]O,uh3$hP&h` ؙt,h(4$hP&ha h2$ڹU Msu)u؍e[^_]UWVS}]O,uh3$h<&hq ؙt7h(4$h<&hs h2$`UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}K1t5B1WVSh>4$.nSWVu5B101e[^_]UWVS] u}K1t5B1WVSho4$mSWVu5B11e[^_]US= C1t h4$|?j5K1{[Zt!h4$Ghr$[ZYujc5K1xX1ۡK19XL~$K1t@Pp0h4$Dm Cҋ]áK1t%Ux,tP*Y5K11K1ZËK11t z,tUu uuuRUWVu} WVZY=B1t@X@d=B1t1s&TC1f`u131 ȍe^_]UWVSB1tH K1 K1TC1!`t'Rh!5$ۑhr$ "j9batuhlpx1RhW5$脑hr$蘽 th<5$TC1 ǀdƀah P5~jjh:$SjujjjjjS iytWVh:$S~WVh:$SjujjjWVSE ,EEEEEPHME@ uWVh:$S`~0E1ɉM܉EuuuuRERh ;$S EԋMQуt;t6juj1RPEURPS uiMPBtruiu`th<$}u}uh<$SY^,(SG @u,(h<$S EjjEP11ɉ6 @SjjjS1;t-jSYZtW@ P$@ utS9sKjRP jWVS@u/tPbC ZS_X1 $ ؍e[^_]USQ]tdҀBuCu'EPhd@{ @u%h<$SXZuSh=$S E]B ]US]jSYZuhZ=$jS YZuh=$SXZ1$# #>$QM73RUVh>$h:.yLUME9sTQM43RUh#uh3>$h:.@LF MUɋE9t43uh$#h:.LF܃e[^_]USQM$1SQ,(@7 eY[]UWVS }u V 7M19É}uRPhI>$W&EPu ZYy57hZ"WY #UEF9ø| 57he>$ύe[^_]UWVSxu >1;VF|~$u~,u;VV | F_8tZu[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ||t2@|jmURj$O8QpUR|PшtijWR_ uYjuWUu@uuZYjuPUu@v0shu>$u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h>$S? 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uh>$SZY<$E܉E1EuuWVj2 utuWVh>$SLEPuuuu/ Ɖ׋EUutuuuh>$뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^h%57K _X1td1SщU&MÆYZMt/UBuSh?$u h%jJ XZ뫋&&  Vۉe[^_]US1&&uh,?$C`u܋]UWVS ]} Wh#S 1&&EԉU#E#Uut7#;t%#WPS芣W&S}EԋU!E!U`u}u}t;uuh:?$juVA#;t%#WPS&WVS؍e[^_]UWVS]u tEU E UuuhA?$SY[ SZu E@P9sPVhP?$SۍFEPS Y_EtVho?$SV 뭋EU҉EU#G0#W4 E UG0W4SZ@tuSZYEU#A0#Q4 E UA0Q4S_@NVh?$S Ee[^_]USP] ;u:j EP57w U:u1҅u57hZ"uH Ћ]UEUitstau+u Pb uPZYU@Rh?$P UE Qt*u 574ZYt57h?$u US] ;u#57tY1҅uh?$uyXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h@$PY[E1eRPN $RPn[Z@8ZQu%S573ZYQh@$P ֋]UWVSu }jj h#WVj]S{7 yEWVuh,@$?}t Sh$?ZYj >Xe[^_]UWVSQ]M tu E𿥴"E𿵦"Qh4@$SJ'M $jOXZM uWhO@$S 9jVQjjuuSU 1ɅuWhn@$SVS‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_Zth@$6jSY^ujjjjSTEU}u&}u h@$SWXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt h@$PP @9E}}EUuu h@$'EUjjjS@ $u.MY_u h A$jPjuujjS8 uVQQh1A$S p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS,2_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS1ZY@UB߃}uujSr@jp juuuuS u hQA$b @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9p3.tE &1҉Ue[^] ,(hxB$&$hB$:;$1RP,(* RPhB$ hB$AjS\ uhB$AXrX CRPhB$:s,s(hB$s4s0hC$$C8Ph#hxV-VhC$:sPh)C$w: 1e[^]UU E$E8E U]QEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^hC$PWE UEԉU؋E9EE]}5Eu"WVuu uuuuhC$P4(1 AU1]1 u`U3U ]3] uPt3}ut(EuMWVuu hSD$PMEAE A E$A$tMu}t=C$}w } &C$w&QRhoD$uu<1ۉYMuWVE Uà  E C E$C$E;EMu7E;E u/ACKtX EYEUQ#E9Eu0E9Eu(ACKtXYE܋U)AQ qMԋE U+EURPEU?E t]s{ px EUMԉQE܋U)AQ A}G{YK_Gtx)E}䉸hD$uXZ؍e[^_]ÍL$qUWVSQ8EAQE؉U܋A QEUqy19WVuu8" ut-E؋UWVRP# ΉE؉UMWVuu! ut-EUWVRP# ΉEUMEEă}Eăx}PEЉU1M9ˉËMY}u}tE9E؋E܋]DE؋U^9E؋U܉EU}XWVuu-! EU}u}t6EЋUEȉUWVRP Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}u}tE9EȋE̋]9uȋE}uH}uB19}FEPWVuu ыU}ut#ΉEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@^1EċEčeY[^_]aÍL$qUWVSQȋ]yIX P@E؉U܋w yhD$uhD$u,XZ~thD$GW EUN^ }u}u O_ uuSQM؉]I M؋])9]u 9M@E9؋U}SQuuhD$uO_ ȉ+EUEUVFV +EUFV FGFtxM]M]SQM]uu ҋM]ut&M]uuSQM]a M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U# M]uhD$u!XEe[^_]UWVS4]u }E1EԉE؉EhG$WV![ E @tF}pt&}At/}fu:E΃}su+E뿍EPSdZY@uE95p3.th&jEuSẺUjSE t xu8thG$SE@ EjVuuSBu@P EE1uEp@Eă~Z1}9 Š&u Ť&(@=uUQh=G$j@hK1.(K1UUPuhG$S UEt0wwVX8ub>t tN-}uA1h۵ 1h' RXYS}uMQhH$S jHJ8QRUPUr 1B$E1r(z,ꀃEE}SA_@tPSn^@tFUȁ¾1uuuRauS4@uh0H$SZY1EEe[^_]UWVSSÉЋt񾥴""""Ujq Pq qu uSU uWh_H$S &PSZY@uWhzH$VWhH$S61e[^_]UWVSÉu uRP@ }}t}ME䥴"E쵦" UMEE䵦"E쥴"@ Ur $Ep PFVEPF V$EPFHVL1Fv VkFE0S@uuhH$SY uuhH$S1e[^_]UWVS]} tE H&1ue[^_]SEUjS thH$SjSrjSd jSVjSH u uh I$SY[z uhEԍe[^_]UWVSH]u }(,EUEhJ$WVQ t(qtsu&jsEPjjS@uzE95p3.th&j_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuhJ$SZ$1RP,( Ɖ׃uԉ}؋M9ȉЋU}WVuuhJ$SmjSEY^tPE܉U}u}t h+K$Eċ@ EjS_Zu hZ=$pjSY^u h?K$Rx G EG$EjSg jSY tu haK$SXZE9Eu"E9Eu}u hxK$S_X1E̋p GPGTEE܉EME9s3Mjh&Vo MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuhK$EԋU+EU9E| hK$.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u hK$SY^ U܋MHE܋U+EUЉQ}u hL$SXZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uh9L$S9 @ r $󤋃p PF V$1~PF0V4j\VFS0 H PAQPA Q$PƉ׃q0y4AHQLS@Eu}UԋEhZL$S[^MffuSZY@hxL$Íe[^_]UWVS]1uuuuu11hL$uu K btENtoat%itClh&Y1EPSZ&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9p3.uEU t th&jZYWVRPuS1e[^_]UWVS Eu} jj h#RPj]S yEWVuhL$}t Sh$ZYj Xe[^_]UWVStƉP)Zt 9St[RhL$VT ,{ RhM$m$1s3щ¸M$$1s sщ¸~B$Whp$hV (Wh#htS{ SVZ[uhh&Vx SVhM$GPh#hS: ShnN$$jmSj$G8P荽ShN$hN$G0W4uuh.M$X1RPhPwPލe[^_]UWVSˋM} $&E=M$u t hDM$Xh8$X  ׋󫋃VhTM$_8Sh#htS ShNM$khcM$ErM$>EM$2{u;t hDM$/YhM$$C KZ1҉9u9BuEM$hM$_tjmWj$8S~1tttSh#ShM$hWWhOM$RZYwh8$DXucuZE3M$E EM$e[^_]e[^_]Ⱥ3M$uRPh{% #e[^_]Ë :.Q:.y ;:.| t:.J :.Uh:.P{XZUWVSxh|% hM$bh;$x hM$GhM$xà DžpM$DžpM$s3x ps sx p CtPhM$K Cs31F { Whp$hP Wh#htVVPVuhh&PAs PhM$XZ{h L1h#hVfVh N$VhMN$ hxN$jj h#CK x$$RPjV CK x$$RPhv"g jmVj$G8P1VhN$;hN$1G0W4u[uWh.M$X[tVh N$GPh#hVVVhp$ZYeRPhPPEh'#K Cs31H C tYC 8P)s t󫋆Rh#hVVhMN$e[^_]UWVS}u 1ۉ]]]1hN$uVUB tYl`~Wa wO$&ut6xu>ƒ뽃븍EPW EPW[ZY@u떃95p3.th&jY[ujW^Zu hO$Y؃tډE;EE}1WMuZt xuPt9pu 9uU@܋Ut -h|% hM$h;$ hM$hM$LW1ƃ EM$EM$v6 u}v v ui FtLPh.O$@XZ e [N Fv6 ?vXZq h'#Y1e[^_]UWVSD] }1&}EKO$uhXO$uu @ tfitJTt,Lt tShtT$ 2 p Dž@$A 9Y ÅuJ Ykuh|T$h&hhO$PU; tVh#htWVWh&SyB tFPh#hW/WhHT$SRB bv$v h|%SxA Fv,v(h $S\A *v4v0hG#S@A jmWj$F8P%u$S _ZWh$SA uhT$ E hT$ [D ` Y h#C t9h"SXZu&h7$贪S1.:.VSQ_X:.tVw^S Z1ɉ  Xe[^_]UWVS]} U#1,hT$R$W1  @$t&Ftiu57Dž,9=p3.tE 8&1ۉ]e[^_](,$($jSZYt,uhT$*jSpZYujSbZYt,uhH$S赧 1ɉHh#V.BYZuT$V谮 ZuhT$hS$ D Y^uh%T$륋$1QRP~z uhT$S> z 1 htT$ XZth?T$Vߨ ZYtjhPz u$hU$SV$   4Ph#6$V4 F41$1$8PhHT$V= TP8;Y^!1RW($a $( ,10$(+hT$ 藧 _ZOhT$P肧 ZY4P. _u"jh&R誻 umV Y8Ph&W< dR8ZYdt8h+U$S 1ۉ,DPh|%WF2 LPh $W)2 g,9DH0|;LPhNU$S艤1V $@PH , uheU$S XZ:jjj,Bu @u hU$1$ 9sP,QT ;$u9FjRPQ{,Bu @u hU$-hU$r$, ;$uF9$sh8$ T _X h%R7 Y^P菳 ƹ,h5T$R P ZL X+tPhO$W0 t,0Ph:#W1 ,0PhS$Wn1 ,0PhS$WJ1 ,0PhS$W&1 a,0Ph&W1 =,0PhS$W0 ,0PhS$W0 ,0PhS$W0 ,0PhS$W0 ,0PhS$W0 ,u/(~ǁ#,$ ,0Ph T$W0 ,0PhT$W/ " ,fǀUjjjB)Bu@uhU$SD$, ;$u ^u&H$,ȍt i _Y4t 1󫍽@Wh&Vc7 tuh%T$SПR@ZYu(WhHT$V(7 tˍEP@~ZYt@h+U$S耟 fEPh|%V. tEPh $V. mEPhG#V. SWh$V6 tj$EP@,  C XZe[^_]Uh:.hV$DXZUWVS(ƉjzEZuhl&hV$jF H1jvSqv ShIi R#@u hV$jE #e[^_]U E]PUE]?UW1HfDžDžDž\ƅƅƅƅƅƅƅƅƅƅDžDž18<Dž\DžDžlDžDž DžDž Dž$(Dž, Dž0-Dž4Dž@kiDžD W$DžHi DžLW$DžP!i DžT)W$DžX Pu u# }UWVS, ƠL1^ jST6 CjjhWPSw$thh#W$P Wh9W$jS_6 ^11|u @u!|(AJu@#Qh"XZFtY~jW5 ƅjjhSPWȎ$thh#SuO ShCW$K_XF1RPhJW$hSShW$!thW$Y[jLJZsjyAXu@8/VhI&jB H1jvSev Shji R@ux@81hW$X ujXÉhW$,Y_ut 9ÉѺ})؉Rh6%XZ hW$XhW$_ut9ֺ})؉Rh6%ZY.hW$X!rJu|1e[^_]UWVSVu{ _uh`&hW$j@ ƍEP[t hg$j~@ juVENj] t>sVs0ZYu+C xu"t s srEYXj ZuXe[^_]UWV։P Zt hW$j? j-WMQE 0Xe^_]UWVSuE @80ƅ77Ph$#V t 7uD>HVH ,Z3V _t hX$0x jWhP~( Ttg81ƅ9H~(@󥍅8PhEX$jPSx0PhEX$jPuVw VShKX$j> S-[t hg$j> T˅tdS zuW$(,s.ZY(u1$zu%B TSh%V! u <)0xP0hPTXY_ShX$V u <)0|P0pPTXXZShX$Vn u A<+TX0@dy! ȋ0Gdj0Pm0 j0,P\0 1e[^_]UWVSƉ`d$1jvSrv tj+<uh&hV$j< Sh'iP @u hX$j< `#te[^_]UE]ZUE]IUWSD<1 󫍝hDžDžxDž DžDžDž $Dž(,Dž0@4Dž8DžLi@DžPX$DžTiDžXX$Dž\!iDž`X$$󫍅Pu u e[_]UWVƍU1Eȃ^_]À=L1UWVSàL16C jjhWRPцthh#W~G WhY$TCV_Zt%п )׃ tv9t1Wh"Y^CtJCjjhVQP<thh#VF VhCW$XZGuCPhY$Y^CtJCjjhVRPԅthh#VF VhY$WXZC1RPh)Y$hSShW$-e[^_]UWVSVu$_uh&hW$jC9 ƍEP[t hg$j'9 juV>Nj] t>sV)ZYu+C xu"t s s>YXj ZuKXe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u h&hV$u+^uh&hW$jH8 sP3Es WsEh %u肏 t.Pݝ Eh?$ue E tZu軝 EYLEPh#u }Chs@Pu @qhVY$u XZt VN Yh^Y$u֎ XZt Q0 XMEPh#uu E Mu {hE EEEM؍CU`EPu u @Muh&hhY$fEftft5fu6t2C t WhwY$j6 }tC(UhY$C0ut3hY$ji6 t C0sHtS4KL9sщ}t:s@shu^ us@s`uI @u;4481t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\hY$s8sXu @u s\hp$te[^_]UWVSPu Zu1du  _tLVZ Yt4Wt EWu > tPMQSn uS" [1V0 ZtS辊 X؍e[^_]UPEPh$u"" ƒ 1tEUWVSu\PhoY$V t\Mfnj4Zu\VXtd$1jRVVhiS@tt}f1RPhoY$u ! 1e[^_]US]uu S? @t ]]1]UWVSu u胋 [^u 2P訙 Y9Es2?V貙 Ƌ}M)1Ze[^_]UWVSu u [^u i2PA Y;ErL2?VK Ƌ}M)1Ze[^_]UEPh`#u( ƒ Eu1UWVS8uEPhY$V uh}%h&hhY$i+hZ$VM _ZtP詘 ƹ}[E]ShiV4}ĉjSĖ PhZ$u 變 ƃ Sd Yt:EUu؅y1ӉM]! EjEPp XZuVhZ$u O V He[^_]UWVS1Rhiu54 @t|j7RPh$Z$hSfހ>tVhZZ$uVt j7RPh$Z$hS';tShoZ$8S\ e[^_]UWVS]hZ$S诈 Y^tVP ZthZ$h&jVhY$)V ƍUܹRhiS<3@u hZ$j0 e[^_]UWh%1󫍅hPhiR2 t|}UWVS\PhZ$ud uh}%h&h0hZ$(dShiu2 tT\`ty1׉\`! ftShiu>2 @؍e[^_]UVSuV|ZtÍEPh$V uh}%h,&hhZ$(uS#1^Xu h[$j/ CPS萓 ZYu h,&h-[$PhVY$u j uh,&hG[$jE/ S1e[^]UVSSu] EPSV @uh&hhY$j/ h_[$V[ ZYuhQ&h&hhZ$M'VY$Eu?$PRSӆ He[^]UVSSu] EPSV @uh &hhY$j. Eu h}Y$jP. h^Y$V΅ ZYuhQ&h &hhZ$&Ph^Y$SR He[^]UWVS}hkc$W~ [^u,P蟓 pY@vhi[$VJZu h~[$j- VPhkc$W@u h[$j- xtdPhiW/ th[$뮉`S?X`e[^_]UWVS}h`$W蹄 ZYu,rPݒ pVYXuh[$DVSh`$WK@u h[$j, 1҉Uu]EPhiW#/ @u h[$j, SX1e[^_]USÉЉʅu #th#QuRPSh[$V]UWVSu1j+Vhxi Pn @uh\$ UЉUPXۋUu h\$j5, U]Vhxi W(  @uhA\$ڋE9E~E19u~tj YWhp$FXZj SjUVSPuVZt"ÍEPu V @u ShZ\$j+ @PkUWVS$ƉUЉh_$Pł [ZtP! ƹY1@]Shvi Vs-j S@ Ph_$u* à V HZe[^_]UWVS(uEPhj\$V uh}%h&hfhZ$9#MԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EP艎 XZtVh_$u m V& He[^_]UVSuV[th %V聁 ZYuhQ&h&hhZ$s"Pď ^fx PSr+ZYu h[$j) PX1e[^]US]EPhp\$S u ](&juS-,ƒ 1Buh&hp$@XZ]Uhy\$1US]dPh4%S uh}%hH&hhZ$!d|lPhiS8+ @u h\$@X1]US]dPh!%S uh}%h<&hhZ$!d|lPhiS* @u h\$?X1]U1EEpPhiu* t h[$j>( 1Uh_[$u ZYuhQ&h&hhZ$z PhVY$u HɃ0 v+BwBÍBwBU&]UWU1ERhiu) @u h[$j' 1}W|$wUWSÉЄtGjj h#QPj]S Sq z#th#PSh\$ hO!#¸%#@Xe[_]g_UWVSC$E{ uh&h\$j& jLh-_Z#t\$jmh-ZY¸\$u#WPSh\$h:.=h-t VW?Xjmh-=ZY¸\$u#SSSSSPSh]$h:.$V jUEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-0YZt $=CЃ v؃߃Av #h-1Z>u# -1]UE1҃tL1]UUp-t H9t@]UWVS41ۉ]܉]E䀖DR1EԅƉ@R1EPjxZY@u h_$EU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=@R1}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EPV[@u hg$j# }‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEP Y[=DR1tSZusujEPjvZY@UEM9u]9uE9E-9ŰMh##j" UWVSÉHP]ZtP_D 1D1V!LY@u h&hV$&RPHSƃ uh&h6_$j[" R1RPhD_$hWIWVh_$ jVW蒽WhiL@u Wh_$ 9t Ph_$XZjVWHWh~iL@tt Ph_$_Y_j wpHZ@uh&h_$uu =`-j:RPh`$hW?tWh`$W:| j:h`$hW?tWh`$W| tHSW?YXjVW)Dž@WhiLuh`$.XZjS9#jVTWһDžd1hlWhiL8 @t|hXu h`$l@1dWhiL @@u h`$@lh`$y@Rr =L1t%͡"wt&Rh`$>Y_HS XZ=L1u0=L1u'DjHSDP jV`V裺VL1-{k?PL@ue$=L1t*_$Pj h% a$ KR1BXuthf$%#Xuth͡"%#Xutha$%#XutRPh a$ h%8a$JKR1_uthf$%#^uth͡"%#YuthCa$%#Zj c5X-XSV65p-tjHSVv e[^_]UWVS]S^t EPu S @u WhZ\$j u bq SBr YPq Etuh&hMa$j EP8EZt hg$j u1EVtRUW ZYU}tRUu ZYURh$S tFE=MR1tFtj=LR1tFu[=IR1tFtL=JR1uE=L1u+!Hu)}tj Xh:.vtZY U6"=L1tj XS萜 u舜 u3j蔿UWVS,ÉUPb^uhW$@hYd$Sr ZYucU̹ Rh8i(S @u 8t hcd$jD jhYd$u uh 'hpd$j Eܣ`R1`R1u Vhd$j e[^_]UVS։P-VSPhd$j UWVS]U hd$Sr ^_uh=%h 'h2hd$‹`R1ށ؃E u %ERU NjUR$ WP輋tDPEV菨ZYUu z;$9ERE ËE É`R1X1e[^_]UVSP]U Che$SAq ZYu WPf S VPÃt7EPS5`R1跨ƣXR1SQ1FuE#U`R1e[^]UVSP]U hf$Sp ZYuh=%h'hhd$P~ S~ VP耊Ãt7EPS5`R1ƣ\R1S1FuE#U`R1e[^]UWVSS]U h&%Sp ^_uh=%h'hhd$Ƌ`R1%EV~ V9~ WPщƃt1Pu ZYu e$EM É`R11e[^_]UU EkEPhe$u uh}%h'hhd$T`R1%у uсE ȣ`R11Uh:.he$!XZUWVS]h&%Sn ^_u3hf$Sn ZYu"he$Sn ^_uhd$Sn ZYtP`R1 \R1XR1!‰`R1d$1󫉕tVh7iS; @u hhe$j e[^_]US] upPhp$E tPYt Phue$hXZEPYtPSh%L %܋Et Ph~e$/XZ]UWVSuV%[u hW$/VYu1P{4Z@u h'hV$p 81jS8Pw8Ph8i(4@`%1󫍅`PhiV @uh'he$j tWphe$CX'Ht#8tuP9u QXVhe$XuShe$_XjPY^u h "j \8Ph8i(4 @uhcd$H%Phe$hʈ%HH9Tt$h $chʈ%Tj)mj cP4Z,H%(he$ '_1ҋ0t`'xtO(9u 09t4#HɋL #t%#QPh% ,딅u h&^j YjmZti 119X~M%9u>uWٟPhe$B he$5he$4j BF뫃 u]e[^_]e[^_]UWVSӉϋuu}g 0g Zt2tVWPk u3ɓ 1ɉ [u1V贓 ZV諓  Xe[^_]UVSu]}t fj} NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPuBpW$v Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPƉ׉‰ 9иr E8t88"uo);sC| C 9s} "WVG0 Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtP輑 X1e[_]UWVSÉUMU1}E;E t[ztMUj8 ^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1ۉ@}u 'E@u E@ u*PE 0Ig ZYu6PE 00g ^_u獅LPh`#E 0 u 10 L0t 1󫃽0 00_0nuk[[Hh%HP螕H,ZYu Dž, %&EXtj/VPQ[_ÅtC`1DžT0XDž\@PTP,V褌ǃu@xuPq; bTt/0u#xPVKZYHufDžtt,Ttt T]1Dž,tN(j DPS5*,D (t8t1ҁ,v { "1҉(VoX(0tDž,1ۍ` YZun?-uGPRUYZUu{(WRYZuA{ Cu CuHPE 0_ YZtPE 0_ YZu^CwH$'PTs -w70' w7n' XZ1u(7 _uCPhvf$j ȋK 11PE Z@tEF EFC4FCF1n Ue[^_]Ujj$ZYt$'U PUPUP UPUPUjjZYt'U PUPUP UPUWVSu] FtVuVVPX1;}t$jaXt0TQ1҉FNG1 VuVVPXFue[^_]UVSuj(j Y[t2'EC1҉SCCuu SB @u S/X1C؍e[^]UVSj,jY[tDÉ'E CEC1҉S$C$C(uuuMU 8 @u SX1e[^]UWVS}]11ɉM+EỉƋM MM;M}LtHM9rUhUNEM E4PSRWEuE{Eڃ1t0juSRWu{ڃ+ui̋M;1r̋U2MUe[^_]UWVSP]11;}tCSRuSt,Uu 3@u PU҉EV赅 EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S- @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps4 @u܃C4uu P!Z@u1]UVS]u j/Zt$pSuCCC]e[^]e[^]UWVShf$uZ hf$uZ tu'j`h'hf$  Si Wh Y[@8Fthf$^F1󫍅Nv󤍝tJvr󤀽uCU9 t hf$j |t uhf$jP jS PhJiu @t1 hg$zXe[^_]Uh:.hg$XZUWVS, 1=L1u ƅƅF1RhKiu2 @ P XujP Y_VjWhQRPMqpujPK XZpVjRhVpQPkMh %&Wd$,ɍu1h %&R@ZY°,u10l$tRVRSPhJg$覮e[^_]UjhIiui @u hdg$j 1US]D-9t@tu|R1@5|R1ƥ X ujjSPs|R1 u D-D-]UWVS]UUEt ;0uKB.f|JxuEuE } tMPu ZYMtC}t!B.DPt SDPuhg$E9r}thg$hg$)X1vF}tO=B.Pu B.WKAɃ0u B.f W ЃF0C+UE9~)1E؍e[^_]UWVS]u ~;0uSB.f|PxtL=B.119}fTWt0f @u"tt SVhg$SPh"g %h$XY19};Ph((#BGXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s1JuÍKكt :M؍AMPDZt fP׋Me[^_]UWVSQUU} uj[UuhV$RdZu hW$j jPV u} ]e[^_]lUWl$1E|Ru ul}UWVS,E u[u h'hW$j=Y@uh'hV$j P5Z@u h'hg$ݍF1jRv  s^_C xyDž@Rhi, @uh'hg$%ZYq:u]S L1PjjhVPRGu+t"R&&tg$VPhC#Y  Xe[^_]UWVSu FPZu8+u1hI&jF \`%1juS蚖t \vSh iR @u81t8/thg$Xpe[^_]UEU =L1uRP*ZYE E h$RUVS] t4sVuZYtC P;UuPVZYft1e[^]Uh:.hh$XZUWVSSÉ։M1S_u}uJh=h$j jhgh$PE uWB.DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh'h`h$j EPhlh$ST u')EfEVh9iSƒ 1Bu hth$j= e[^]UVS ]u1ɉ@uh'hV$j EPhh$S t,juV E؀8t-EPhlh$S ux)EfEVh9iS=ƒ 1Bu hth$j e[^]US]ڋE6@t*EUfuu uh$SPhh$ ]ËPtB h$Pt8"Pu+h$øh$Pt"Pu h$øh$ËtO-h$tEh$t8"u+h$øh$t"u h$øh$UWVSljӉʋuFEE9s]19tc  ^w@v|USh$WK 1UvAE9s:2UFPh((#)ȉMPM UuRW u9utD7...}e[^_]1e[^_]UVS ]uVhiS @u hh$j EPhh$S uh}%h'hhh$E߉EVhiS uEh5i$Y XE1e[^]UWVS$]uӹ!1j EPh%Suht'hEi$j EVhiS} @u hWi$j 1e[^_]UVS ]EPhfi$S uh}%h`'hhh$uVhiS @uhh$E؉EVhiS @u h5i$jN 1e[^]UWVSxhShzn$uQ@uhT'hui$j DžDžDžDžDžShi$諺_Zu?Dž1ɉDžDžDžDžjShi$ u ؉8 B.DytRx:uL҃0jWVh%Pt;9u8tMhi$j jRVjP\ƒuV;t 1҉Ŕ@|Phi8uƒ 1Bu hi$jZ e[^_]UVS0]juVhhn$Sg@u hH'hi$V* Zu Vhi$j Uf@fEލEPhiS% @u hi$j 1e[^]Uh:.hj$IXZUWVS] }1EPh8i(S @t&E1r r r1ʹ|󫍕[!RhiS @[< v Phj$j hj$负[P\P <fDžLVhiS @t%fNthj$=L1t hj$OXfDžLVhiS @t%fNthj$=L1t hj$XfDžL VhiSu @t0Nf=) Phk$۞_X=L1t hk$ĞYfDžLIVhiS* @t0Nf=) Phk$萞XZ=L1t hk$yX|1󫍅|Phi8S @t}u(j e$PhiS@Gh&k$EEEEĉEEEԉEEEEE|Phi8SO@uh /$ÝXr}uMu u uuBEH~HEB.DJtx:t~&jPhi$l uWh.k$]^_1Dy hi$BY Pt`XZGj,;Xh2k$ Y4t8h>k$XZ hc#Xj _PhiSF @PhiS* @jh@'PZ u ftePhNk$r[^Vf"fP% PhXk$= ft Phbk$"ZYj :Xe[^_]U81EE1҉UUUUUUUUEPhi8uO @u hi$j 1UWU1Rhiu @u hi$j 1}UVS]EPhon$SM uh}%h'hNhh$uVhiS @u hkk$jm 1e[^]UWVSSÉ׉Php$S[)Í6 9})j<X)ЉU~&Ph((#šGZYUJuj>әe[^_]j-ęXUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh}k$XE1e[^_]UPEPhk$u uh}%h'hhh$ME\UPEPhj$uN uh}%h'hhh${MEUVSjjj"^ y hk$\1ɺuBhPS轏 y hk$ZuufiuS觐 Xe[^]UPEPh!k$u uh}%h'hAhh$MIE=@u hk$j 1UPEPh%ua uh}%h'h4hh$KM E@u hk$j 1UWVSƍt1fDžfDžRhiV y hl$j1 h'v 1l)ƍJ(R!R _9l}l' Džl hl$ht%hl$hl$hvl$hi$h4m$llhl$v(pp(dp@!Pd!pP YR1t R1ER1tI@tc@tC@tP@ tS@@tB@yA@pXx@`1ҋpv9}pL9}B\pfP@u uw%k pfx p@tp d#!= = w-g 1u=w_f?v-k 11u?1p%:=$v1"- 1p1p P hR1SW`\VPPllhm$ep@"Xp@!dǃ0X*w'Owt4tov2tW0 Z=L1OGPySPh3m$h9m$諔=L1k$uk$WZdPhp$pXZ`Q#d9s ΃#yh$VRPhF#7C%Ȁ=L1XGPGPGPhOm$hXm$G1d_19d&j>^=L1GPhBm$RKStRTRPhbm$蔓RPhlm$胓 F뗀=L1GPhsm$^Y[Gd<G=PuZh~m$hp$-XZ=L1WGPhm$GPhm$_ f`Wֹl$d5t-\PQh%賒K "\`f\TddTl$tHl$Ptl$Pth$Pt"PQh%*K "봊`\d<"\TL=PuEGu:hm$hp$ʑ^X=L1GPGPhm$觑 t#=L1dm$hm$hp$iY[=L1GPhm$KXZ1t D ҃L dd`#dt!l$VRP`Q4'hm$Cu_hm$hp$̐^X=L1GPhm$讐GPhm$蛐wW ÉTӹl$\t-dPQh%^N "dϋ\fd`T T`l$tHl$tl$th$t"PQh%֏K "d\kT`Phm$萏ZY=L1)w '$'&l$l$tx/l$unl$g4l$`9l$YDl$ROl$KYl$Dal$=il$6ql$/{l$(l$!l$l$l$ /l$l$OG)Xsj ͍pp)hXh'"e[^_]UpPhiu ulhm$Xl$Eu hn$jM EwE11 -USE UUXt=EEEE1҃UjURP 뺋]UE Puj]Q US]S!Phn$j S%R1PR1~ UuUE Pujjۧ UE PujܨШ Ã=R1tMUEE EjjEPEPjEP~ƒEBuhn$XÃUSPs jh 'g jS? uShn$6jPjZ@uShn$j]UWVSd@u~Q1}=R1tC&;Et7EE jEPjjjV踤@uuSho$O 1ۉ]]]]]E}W]SjVSjqÃjh8o$s ZYu8o$Eo$1uuuujEPj E"1}jhRo$h#D EPhS%% hS%%ho$jߥ ju6ho$r[jjjT jWj jVj\1ɉ -jEPj u8tgho$Z(9uV,PhIp$jWjjVj 9W EҀu+=t$h/p$DjSP = -m = -tjWjKjVjA -RÄ = LEEEEEPH Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh -$thD#uR1Zu h "j jjSPjh -u‹ER1]USPhp$h:.貌h:.h*q$Shq$h:.蓌 jUE E ]:UWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9td ''  9$tL ' 0 '11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9td '/ $ 9L$tL ' 0 '11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]d ' $09tuL ' E0 '11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9td ' $9L$tL ' 0 '11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]d ' $9tuL ' E0 '11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]d ' $9tuL ' E0 '11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]d ' $9tuL ' E0 '11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$td '9T$L 'uwy|$y|$L$ ˋL$ ˉ$4$19td '9L$tr$$9T$ts$ 0 '11 [^_]UhZ jjh@-u{1҅tPUWVS jEP豱 Eu_X1E9}2uSPZYt!SPzZY tG1EEe[^_]UVSQË0tRVh`s$EPtVERlrZe[^]UWVSQ1:nuzouP>rX1҉Uh%P ZYt98nuxouSPśZYu}SP賛ZYuE1VJEe[^_]UPPPhfs$h:.躆jIyUWVSÉ} u,PQ , ZY u Qhs$1t VbqXt*hk"W,NZY1u"su4h%,P^_uE"~u M }jP{ ZYt1ihʀ$Kjhs$W uU jZP,PF t% 9|\ 뭋QRS uS1 S1u17hs$Wj Vhs$0Eta#Et#Et"Et6=% 'u0P,P`X ZY@tjj@&p^_,t#jhs$S uht$VieY[0Z"tSht$Shĭ$hV~0 ,Dž@h%,PXXZ9 PWoNjXZڄtVB L<-u.1j=V覔Y^t$S@] $S4Q ,t1|=S1t}t=S1u}uD]h't$~Y19~4h%~GXZj }Y=S1tc$P Z@u hd#Xdt t6hkA#X t kXP^=S1tj}t0$u ju j( @u h-t$i_-,W3h%h,R|P,RE 8tV,Rh $ ;u8uWVWhMt$j8 t }[PpY}u, Ex](t jj ` WS$xs ~)t}u2h:.,PXZj P$/s ~j,P @uhw#X,Ѓu ƀt&qttPPVhfE#9aH}S1 S10SVS Y_@uVh`t$XZ e[^_]UWVSj Phkt${;11to 'tZ 't =S1t> 'F%#u $QPh%V{ !ǃ 끍G#th#F%#u $WRPh~t${tG%#u $Pht$zo t 0hp$ h#zXZF=S1KtSp%#u $QRPht$|z=S1h%#hp$]zsds`sTsPht$Gzslshs\sXht$1z0=S1~chSjjhk"ju.t%j S^_tSht$y h&MY?#t$Php$yXZe[^_]US] 1t-tPuһZYuS11=S1]UWVSEt48nuxou S1P=X1uh#mX1Y,u@B uP蚄_uh "=S[^ljxj,SZYt X1e[^_]U9Phw$h:.-|jnUWVS]!11҉tE1ɉ7p3.111plhPw$u u表 0r=dhWlSh0"O ,@uSVh"j n@t(RPhX'hSsS|jkUSP]jEPSU :9uySu h"jF ]US]SdZt@ h$#SZY]US]SiZt@ h0%SsZY]USP]jEPSEU 9t :uy Sh"j ]UVS]u VS YZu Sh|"j ;/t"Sh"4YXZu E"e[^]Ye[^]UPh"h:.wjXjUWVS EEu EE}]EEE1҉7p3.h"VuM t4ouBjWh@'57Xu h"j PWY붋p3.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh}% ,@uL t"t"0cZ"t"PSh"j jhUVS]u VS YZu Sh|"j ;/t"Sh"YWXZu E"e[^]BWe[^]UPhw$h:.uj}hUWVS]E1҉#11ɉd111lhhx$u uv HuLf$M,9tQG.C|g$ 'UC| C|C|C|57CpXDžlL57CtXDžh.57CxX57Xjuh'57OUu h"j* PTX57YDždC|p3.P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPWr-YZ@u Wh$j[ ltECphtECtNtE%CxdupVQVZ@$XZK|ǃe[^_]UWVS SVdPhWu u&hWdShbs% ,@uSVh"j f@tKRPh\'hSvmShx$n0jeUSP]jEPS_U :9uySu h"j ]US]S8^Zt@ h$#SZY]US]S cZt@ h0%SsZY]USP]jEPSU 9t :uy Sh"jA ]UVS]u VS* YZu Sh|"jB ;/t"Sh"RXZu E"e[^]Re[^]UhTx$jڿ ULhpx$hx$hx$hx$hy$Ph;y$h:.'q jcUVSQÉj EPS U:uVShUy$jl e[^]UWVSuEE@t"S1 1VFe[^_]Pv1_u h#jC VP ZYujc]e[^_]ހUWVSQ]E10u1-hy$u u 2F$ '=T1tT1뷃=T1uT1c뛁K뒺a7C8K t T1hK\cPD7jC@K@2K&g7@P s4K I7C(KK@KEPuh '57Oƃu h"j藽 Et T1tctKtK@tK t=T1T1 s=T1tT1c@tKt1҉,-sc sKsC  sC sh$#VMT1Y_Etha%VMC$KXZEthwy$VlMC KY_Eth}y$VRMC$KXZEthy$V5MCXZu E"e[^] >e[^]UWVS]fU ffCffBCffBfCffBs s/Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssJ.Y^} GWss4.Y^GWs$s !.Y^G W$CDȉGDs,s(.Y^G(W,C@ȉG@s4s0-YYG0W4CHȉGHs$' t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh"jM 1ɋuЋ} t1M8"t$M tM9uM9t Suh4"맋E9ƉU}7=Y1tuuWVSuhU"3uuWVSuhU"?9u؋E}<=Y1tuuWVSuh"@3uuWVSuh"jp e[^_]g_UVSН=Y1tPh}$h:.Q h~$Ph~$h:.Qh:.h"žXZ=Y1t'ttshm#h:.YQ jC=Y1u UPCUWV=L-uHH׉=tY1t&ɉ HffJ=L-u f@ffB^_]UWVSƉ˃=Y1t/=Y1t 1}oQY1xY1Pu; RסY1ΉRPSu5Y1H 9t ǝ06hPWVhj$Lj"Be[^_]ÅtUWRP"Y_}Ã=Y1UWVSƉˡY1=Y1tQuxY1P: M׉ΉRPSu5Y1G 9t 0gPWVh$ Lj$6Be[^_]Ã=Y12W|$wUWVS#Å=Y1uY1BB4Y1Y1 Y1 ;Y1Y1ؙ=Y1;|*9Y1_1)։ؙ5Y1pؙQ Y'JtRz!9t !9t ҋ1҉ؙ=Y1Q ;Xe[^_]g_W|$wUWVS4EU؉M܋ Y1A Id t15Y1/X=tY1tY15Y1PPW Y1xU th$PXY1H xU t@\U؋M܉M؃=tY1tY15Y1PP Y1A Id t15Y1Y1Y1JH,1_9M؋}ruuh·$jI Y1\Eȋ1ҍMQRPuu40 Ɖ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuu2 K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05Y1#5Y1Fx1҉$Puu0 tY1Y1\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu%ClÅt]SuOXZ1EtttpY_DpTtF u1EY_Fu @ߋu%CPY1H05Y1EЋUXe[^_]g_UWVSQEӾ=dY1t1}=L-tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='Sh$h:.I ]W|$wUWVSC s(H1`Y1t ǃ^F=Y1s0Kd t1RP߭ڍ=&VV$h$P( Y1 ؙy8PۅI4X>&WW$q,h $ ( Y1A0= @ Y1Y1=Y1u\Tu k‰Y1jjjhjRj£Y1 Y1uY19uhZ$.j&1=Y1LY1Y19|RPhu$G' Y1Y15Y1 Y1('[t?  Lș)Ou뺸=dY1t?jj5hY1S=Y1Sb Y1uPؙV jVuؙ=Y1VYY1Y1Xlj=tY1t PRCXZY1xY1\=Y1Džh$?,X=Y1~݋ Y1A,XƉ׋ǁ\TtA!AƃAId t1RPhL$jj#f:.ftRhht@PKU DžPu ftY1=Y1tu 11=Y11w,1Y1;x,t h:.C Y11҉牅8^9؉<}Ë\TtAЋ!AAA)uhy4D1ҁTtqփq9Ћ|h$)(u^Y11=Y15Y1FU F )É^=Y1$~O`^p=L-u*VtGx9sЉFx^fFxG,H9ufVNfFFTVXЉF\KN`ȃ$~:=dY1uFh$\^lO`؉Fd9sh$P(%[5Y1=Y1F t/)؋É1ɉ~U uF\Y1H xU u@\€ 5Y1N J~U uv`G`YY1$~%Y1Bl5Y1F=Y1=L-~&_89rOd1VT~U uVTP~U t FX1~JOd1111f# Y1A8P!tm)D4A8)Љ9s?~U tv`у >5Y1F$B1ҋ9r)=Y1O`艅FW897~U uv`G`aY1$~%Y1Bl5Y1F=Y1=L-Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5Y1F$뵋Y1$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹Y1BY1;Y1u^=tY1tY1s4PPF Y1@Y1Y1Z4Jd15Y1Y1Y1Y1H41[Y1Z0 } Y1؋5Y1=tY1t5Y1Y1P5Y1 Y1X05Y1ދvxx Y1\t4TuԵ%Flµ%CPO붡Y1Y1𙋝ڋËƉ߁TtAЋ!AƃAId t1JY1Y\Tt=Y1Ys8Y1){0ƉK`Cx1񉅰69s)9sY1肴%Cl뀡Y1Y19rߋ Y1A01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==Y1j.IX܋ Y1ߋƉ߁\TtAЋ!AƃA׋Id t1#tʈ%WVRh&$9|]=Y1DY1P,t,=Y1t hC#:X1j ;X1x~j X=Y1tj;_u=Y1th/$v5Y104=L-0FF4+=_w hG$jRi Y1X󥋅`1=tY1tR5Y1K[^Y1=Y1t ǃ\8 5Y1x\󪡤Y1RP SY=tY1tY1Y1r4PPG Y1X4HdLH t15Y1Y1Z;Y1sE=tY1tY1r4PP Y1@Y1Y1Z4Jd15Y1aX5Y15Y1KY1@4P5Y15eY[^_]aÃUWVSu]tVh _uVh"jg `1ɉPhd@u F tGRhedAu oE @u!f8tuh"Z~XZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(hD%> ƹ ߋSh"VI CPhN"VK C Ph "VzK CPh"VkK CPh2"V\K CC,$C,PhE"VDK C0PhZ"V5K tP X}!uhzd@u D @RhedAu C @uuhi"je 4}1󫍅Pu^_@4ȋ9'9t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPq 1e[^_]UVS4]jhPjSBuIjPjVSV u؋E ʉʋMQ؍e[^]UVS]u VS< YZu Sh|"jTd ;/t"Sh"XZu E"e[^]e[^]ÅtUWRPY_}UWVSuuuua É֋EU)jj`RPr Nju 1ۃ`9}1EPl@hFVk`EUȃM ~MAhQlCȍe[^_]UWVSP]UpEM1^F}tF^ECS}tffCCCCC 1 :}u: 1҉C(S,C8C1ɉ C Xd1 1( Xd1CX_1=Dd1$`d19$9rPh 'h_$vT^1D 1;\d1si^1tЉtF$9rh 'h$`^1‹ ȋ( Xd1GB돋$9(1҉G䋅$9s1) C0PhZ"V/) tP X}!uhzd@u " @RhedAu ! @uuhi"jC 4}1󫍅Pu輮^_@4ȋ9!9t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPO 1e[^_]UVS4]jhPjS<uIjPjVSV u؋E ʉʋMQ؍e[^]USXu t%؋@+B=&$<$+ Z $\$,$]US h3$h3e219~i-@=B'Dg2Bte2[]U3?PhH$h:.'jUWVSSEӉ΍Q1f~WS ZYt(}t{}h3ujjW tu SNS Zu571 PSh$j%A xtuh$jA PV}tu 0uM e[^_]UVS}h3t!3Y Php$hhd2R4jjPƃ t3% P6h $hhd2d2e[^]UQPȉE($tEnPho$/XZUWVSÉU܍Esu{h0$ EPEPEPVEPhn$fERf Ph$(EPEPEPh$u3 Ph$u Phe$nXZvNE9sGGPh((#Jݍe[^_]UWVS0ÍEčs|h3tEătE<u/|h3FVPVPh$j<u+|h3t{FVPVPhϓ$;uUEع}uCfE|h3t"fUfPRh$g fPh$PXZe[^_]Ujhh3j @u h$jj> UVS11 1ɉ e2\-h:. h:. e2Lf2;XZe[^_]W|$wUWSøthg3h0$XZ5f2hM$5f2hf$h3t Ph|$k_Xf2t?f29} h$L[()=&MMEuQQ$h$$ j ;f2Z0|h3h3EEhf2sH~-`f2]PP$I >&RR$Spf2QQ$SEWW$S h-PP$ShÔ$m<|h3f2f2"]f24f2Ezu`>&ٞzu`>&=f2\$=f2$h$e[_]g_1Ujj6XZ1=f2PU=`-u =f2ujh u6f2ZY9f2~f2|h3ueUSáe2e2xFأe2e24f2h>&wp>&r\-y1]X]W|$wUWVS=g2f2ffBg2@f2=Pf29=Df2u ;Lf2g2]f>g21Ej]Sjj5hh3{ yh0$[jh(h3jjhg2Bf>g2f24fpjhHh3jVP5lh3 Ã9t:y h$oOYSVhg3h$h:.Z1`-f2% f2 h3f2@f24f2Lf2(f2=,f2u(=(f2uf2Lf2Lf2Lf2(f2=v.}fE fEm]mE(f2,f2x>&5xf2=|f2f2]u}fE fEm]mE0f2 (f2,f2EΉ߃ɚ;~ʚ;Eހ}0f2 (f2,f2Lf2(f2Bx>&؉(f2,f2(f2,f2 0f2ى 0f2ɚ;~(f2,f2ʚ; 0f2f2rW xf2|f2 (f2,f2 (f2,f2f20f20f2=ɚ;~ (f2,f2-ʚ;0f2|h3t 1|h3te[^_]g_UWVS<ÉUM|h3tUUEčs}uyMăA}9}fE؍t E;f2uJ1@f2Df2u5}t4|h3u+?EPuh$ Ѝe[^_]W|$wUWVSEU܉M7C]|h3MQURuh$Zt hܕ$IXWh$=|h3Y_t,sE >&RR$Ph$=}h3y"uC:.e[^_]g_Ve[^_]g_US$&=p3u#D1SPh}$h:.7jUWVSƉP¡s3_tEtPh $E s39U|} Vh0$jY3 su4 1C@C1t )уȋKAPEFCCp1}~CpMуt[}D;19Ue[^_]USӃ s31҅w =w"=wj=w:=w R=wA=v=w.=w "tft uȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsCt PVh>$ Sf PVhL$BhPSjPVhZ$\SgPCPVhi$@h:.Xe[^]Ãt"¸$7tw$tURzZø$USљRPQhS2h:.S/] :.yUh:.j XZá:.P:. UWVSDuh:.e[^_]ÉÉh$j@%'a_E1ҿ!Es,s }uCEtHH1ɉ B u1ۋtЅ}t2}uK]1ʉj.ht3EPjC:]1ʉu9r VPhp$j.ht3-ht3h%iXZT5s3VPh%FC 0=s36UWVS$@<tPh$ Y[ C''tRh!"Ph$^_Ph$XZCH<$@#'h#C Ph$C &' Sssh$vC! %'<t%'<t''CTS C ACPh"$7CZYPfwk$#'h4$h1$ X1Zh>$hK$hY$h"_3h^$^!hf$Y Ph9$XZ뢍A9shm$/ 6EEEEEEEԍsEԈEӊEՈEҊEֈEEUMfsfhw.ffQRPEPEPEPhz$%jfuVuVuVuVuVuVuVuVQRPEPEPEPh$$2C(`''(hG$C `''S Cxe[^_]]e[^_]UWVS0É։M1Eԣs3j5s3E jEPEPhs3VS8EE"1EEE1҉U jj}Wjj]SyhP$EЅt?PXu h "j+ jjWVjSyhf$݋EE1E1=s3t#h$ X=s3tuh$[_}H1E92=s3tC҅U% Es3t Sy9=s3C{PS5s3 ub)87tX))Ph$ 9~Phߢ$ ZY=s3u=s3t GaSx5s3jRU Ph$CxUtHH5s3RB Ph$hk%K VX1e[^_]UEt Ph$PXZ'h('Ph&$h:.jUWVSDE։ϋEEs3us30-E s3t<t"t(E}u+E@E'E@EE@E@ E@EX0-UZhYi%V ZYu=Et'}s3u1ɉ[cEXt""}uVY [^1ۃ}uj/Vj ZYÅtUԹ1}EEE}WRh %&V= t-1EԅۍUt/WRh %&V 1ۅtVh0$t/Exuxt VhR$j' p}Pd ju }~tCUj1}^Exux uxuxu xE@E< u2]Ĺ1jEPEP ¸&EE耉E 1}E@1}11FQЀ w0 QwWMQw7u&w$#']@ }@11 @]M9ru)u}1ۉj/VGZYÅurEEPVJ Y[Vg XVYVZHuNp @0u: }u=s3uV Yt- Vug ZtMUCUe[^_]/;}u =s3BEXS>h Z{ X ?}u MUs1 %& s3Uf1E e[^_]US-tuP.ZYtC]UPu*fxu#@Ph5$hh@v3F@v3 Htu DP[ PY ZU}uE u  'h=$h$RRhF%PPhC$& UEt#t#l$v$tPh|$Y$c$Rh#XZUVS$@('E׉Íu 9stMtJ@Sh$XZe[^]UVSYi%}tJE t1@jjEPà tj.0uY^ƅth@u3@PYZuUuRe ZhPh@v360 @v3e[^]UUE Pjjhh@v3PR9o thh%h@v3 @v3UVSE UZ1t@ȅt  )ˉ t Eu7t3jSpZYt%uYi%hPh@v3t/ VRh$hh@v3mVPRh$hh@v3DσVQPRh$hh@v3VSQPRh$hh@v3s @v3e[^]UWVS$u} 5E ~y111119FtM |1t 1} L7tMw tLxw tHuGC@u?6ttxtu#  @@1u "5ω5KtB uhYi%h@v3m[^vth$)YEPjjhVPP|l t h%VXZSVhα%hh@v3@v3e[^_]UVSMQ@t3QAt3يۊ ('BZ ('XÃ@.)օ~=.u3uC@t3[^]UWVS uE Eԃ=4-tL1ۉ4-hh@u3J_Zu(j.h@u3aZYth@Ph@u3J, @u3uhhYi%h@v3$, F<tX<t<u^EԉE FEe[^_]G]ع1}ʉfEu jS ^_uSZY6e[^_]VPFPh$hh@v3%@v3e[^_]US]U MC<t,<t<u/MU ]]yMU ]]q؋]YS(PCPhç$hh@v3@v3]UWVS(uE MMԋ]U~u'ẺUЍ}عjuV _XUЅҋEtt SVZY SPV" }yE Ep$e[^_]ftEEԉE E#e[^_]EEEԉEE E"e[^_]&UWVSXEEE EEEEEEE"1EEEE1EjjuVjj]SgyhP$Et}tSyM9)sxEt  Cy;8-t8-PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth#h#h$8:.H:.$yh:.j XZ:.P:. }e[^_]e[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һ$~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(USPh$h:.ShA$h:.Shb$h:.$Shp$h:.Sh$h:.Sh$h:.$Sh$h:.Shި$h:.Sh$h:.$jUVSƃ=Dw3udPS*^Zy Shp$',밋l%=`ƋTw3t:h3$RPZY h$PRZYu\t_X/tXRPh$6RPh%$h:.\`tRPhJ$ RPhj$h:.gDž`t0P _tPh$bZYDž`9t SzX`tjtj職jUWVS TPjhPjT11ۉ`d`Ph|dV6 @ h;lu\1ɉXSi9dsW`dXZuh"\PY_t X\X;lrt\h"h%hWEPt@w3tWPh$tWPhJ$ lSZh`PhedAV 1ۅ9usCaPTh"h%hW'EPt@w3.t-WPh$tWPhJ$* CiV藶 Xe[^_]UWVSV1}jj}Wjh)' uTEEP~jjWPh)' t S[!hʈ%S$ ZYtQhʈ%je[^_]ÍL$qUWVSQhqAdA EAEAEjjj!! h$ Y1iPEZuh "Suj E y h $j5 E9tSPh$誢 tCtQt_}uEPEP2 _XE#t[OEE#~B$:E$"$@E$"E٫$Ɖ"ESYE܃}ƒ}E ˆotRExurWuZ9EsEhB$hK$h"h"SuhT$uh[$޼$EE1EЉEԉEȉẺEM}dtEh9xE@EE@EEEEEEEou E]u]ű]u]usM] }EݝxEݝpEؙRPSQ Puuuhu$u؉Ep݅xܵp >&PP$E])ؙ WVRP赪 PEU WVRP蛪 Ph$jj h#SQj}W @u h#xjj h#EU RPj]SƲ @tjj h#EM)ș RPjuV蚲 @tWuuuh$Ep݅xܵp >&WW$VSh$ۺ,mE}MЋ] }tajj h#SQj]S @jj h#EȋU RPjuV @VSh$Q MЉ]ԋu؉uEȋU WVRP PWVMЋ]SQ Ph̬$}"Mȋ] }jj h#SQj]SF @Ijj h#EЋU RPjuV @jj h#EȋU+EU RPj}W @WVSh$SM]u؉uEȋU+EU WVRP PuEЋU WVRP PuWVM]SQ Ph$ݸW}MMȋ] }m]m]jj h#SQj]S @jj h#EЋU RPjuV @jj h#EȋU+EU RPj}W讯 @Eu >&QQ$WVSuhH$uhN$|M]u؉Eu >&RR$EȋU+EU WVRP PEЋU WVRP触 PWVM]SQ蔦 PuhH$uhh$職$u{XeY[^_]aUPh$h:.juUWVSljU΃={3u'jh{3 {3ZYuhʀ$e [{3Xi {3}u-WUP/ZYUujtdWUPZYUu=tRhhw3跜ƒ w3uPhp$j K c1e[^_]UVSƻ@-tPVZYt"Vhح$5H4诹G4MC St8tPRh$x Rh$pxZYuj 3h`?4 CD?4@?4 e[^]UjWX=dH4t%H4fPftjh?#P蘪 jh|3 UWVS=G45G4ÉDžu¿$RWh $5H4蹸5H4PhPh@:.$y'1=P3Sh$5H4eB.fDHfn,f?trfauHG4Sh-$5H4 (fptfqt#1҉G45H4hP$!Y[C1P3Sh$5H4ͷ &SShh$5H4谷e[^_]Ã=P3tO=dH4tFUVS5G4G4G41ɉ G41U5G4G4u1҉P3[^]1P3Ư3j9Z=G4ujȃXG4tG4j譃jh|3ވ UWVStEUtj1]ut=tB.TS!@u$EE%@ B.t B.fBuӃ}tghG4![ƋE]tC1ۊG4t8u9s&HG4 CuݍHȋ])=~ E봉EE} Uй 1u1C4tltf$t\uDS8uOCDC<0~2S8u0x tF8tutt 8FtC1DЋEǸ?4:[tL\t$HWыu)@,-x$uvXB.DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2B.DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5B.D^tS@0uU tZBGO])ف~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP EE 5H4h,$EZYFbEe[^_]USEU uM軠ʈ%@-H4tRQh%P蔲(#PhV$ G4ZY2t!h`?4hH$5H4T1G4 B]X]UVS]u9@?4t}5`H4E G4u1`H4@-8t 9XtShj$jg @u=`>4th`>4Ph$p Ph$pZYu@?45`H4e[^]U}u葟G4]ø$]U}ulG4]ø%]lU}uGG4]ø$]GU}t"h>4h$5H4 G4U}th>4h$5H4Ұ G4U}t躞h ?4hׯ$5H4螰 G4UWVSEuEE PPu `Ht 1}6h $E PEP~ uh$E PEPc t}E pj_E څuP$8at$=G4t$1Ʌt1Ƀ=G41=G4ƍQV1M Z^9Yu19ARPSW S G4e[^_]UWVS0 EuOG4Huh#$E PEPm tP3h-jY^_jh|3藀 ZYu=G4E 9E ;u"1ۉP3jju à u=G4tՃ=P3tԉڋƅtō5G45G4 G4yZY9u1Ƀ=G4κ$=G4t$VPSRƒE =P3c=dH4VG4G41ҋtP3G4(=G4t=G4=P3u"C9]j[^1=P3E ƅtˋE 5G45G41ZYU 9u1҃=G4‰ֺ$=G4t$VPQR˂=P3f=dH4Y5G4G41ҋE tP35G4( 14RjhE 4 u uE 40h/$ڍ^_=G4=P3E [Dž5G45G41ɋQZY9u1҃=G4‰׺$=G4t$WPQR蘁=P3u5=dH4t,=G4G41ҋE tP3=G42P Xe[^_]UWVSEuEE PPuy`Ht 1}6h$E PEP uh $E PEP t}E xptYuG41St&1ۃ=G41҃=G41Ƀ=G4111ɍSRtXZ}==4u5H4hK$ [^닍xPS8dZY}uIy,8tSh- $%[^1ɉ pH4 tH4OpH4tH46u2jE pZZutL9¸}9U 9zu19ZVPuWSh{$҇1҉pH4tH41pt Xpe[^_]U=tH4u%=pH4t$Pju uU=tH4u"=pH4t$Pju uUWVSEu/G4:Huh$E PEPM tP31=pH4=tH4th$E 0ZYu*==4u5H4hK$ [^Džth-jp^_jh|3$z XYE t ;u&1ۉP3j5G4u 衶à uK=G4tу=P3th94S6ZYuSh$5H4 멉ڋE ƅt5G45G4 G4YXtt9xPWpaYZupH4tH4 Wh- $T XZ9u1=G4ƃ=tH4u"=pH4t$jVPSWh{$M1ۉpH4tH4=P3=dH4G4G41ҋE tP3G4pj;XZ1ɉ P3e[^_]UWVS u }t Ĕh!A#vZYuvh$5H4蒦 zj h$W > =tH4u"=pH4t!$tVWjVjjhRSySX G4e[^_]U帥"}uc#]U}u hװ$h$h$5H4迥1G4UWVSE]uu1҅‰uTpuCE xh"W4ZYu u0Hhc#WZYu1t/c#F u븥"PVh$5H4!e[^_]Uh$hG4u uIG4U}uG4=`H4tH4E E $] ]UhA$h H4u uG4UVSE] u1=H4H4u{"yt gsh"VZYtBhc#VZYu 1H44V迻^shP$5H4 맣H4H4노c#Phq$5H4 =H4t5H4h$5H4 5H4h$ H4Y[t1҉H4G4e[^]Uh$h`H4u uG4Uh$hH4u uG4Uh$hH4u uG4=H4t1H4Uhͱ$hG4u uMG4UVSE] u 1=G4bu.sh"VkZYuBhc#VSZYt1sN54^hsh{3 G4{3 뷣G4G4t$t:u5H4hޱ$k 1G4ZY454:u#c#t"SRQh$5H4G4G4e[^]Uh8$hG4u uG4UhA$hG4u uG4UVSE] u 萏uHsh"V,YZtBhc#VYZt6VZy+sh]$5H4; 1=G4G4L3t "c#L3PQhw$5H41=G4G4e[^]UEt~G4Huh$E PEP޽ tЋE phͲ$x_YZu9=G4uJ=`H4t5H4h$ XZE ph̲$:_ZYu8>454154USUE G4u 3Pt ]pMYt`P Z@u ShԲ$; H4=94th94h$P覟1ɉ G4 Ph$ XZ]]]UEulG4=Huh$E PEP荼 tӋE ph#$'^ZYu 8>4USSEuG4Huh$E PEP. tP3h-jE[Xjh|3[p XYE tE ;u1ɉ P3jju ٬à uu=P3tڋetSh#$U][Zu 8>4=P3u=dH4tG4G41ҋE tP3G4tujOXZ1ɉ P3]UEuG4}Ht}6h+$E PEP uh5$E PEP t}E ph=$x\ZYu!E phE$a\ZYu 8>4UWVS}M 1ME1=dH4t5G4G41ҋE ¡P3t@P35G4ujTZY1ۉP3EM9t EPRXe[^_]UWVS}u ̇.jj#|ƉXZSx CYujj֔h# à uS%%j/Sh* _ZڅtPhRW =G4t65H4Sd H4HQPY^y Pj gY^ J }~j5G4h^#WS!f  jWSf Sh$G4jV~Pk Z9uWjZYFu h$VX1ۉG4e[^_]UWVSPEEuqG4Hh$E PEP菵 EwɋE ph$"W_X}h$A ^u ]E XSh$VS1 uY}h$ Yu ]E X Sh$VSe1 tA5H4h$ XZ<u}u"E X Sh$[VS1 G4e[^_]UG4}t'=54t =54u#r=54uH4E E)$ h54hO$5H4ؖ1G4 UG4}t鸄=94u#H4=94uE E$ h94he$5H4r1G4 UEt~WG4{Huhz$E PEPx tӋE ph$UYZu9=G4u<=`H4t5H4h$! XZE ph$TZYu 8>4UEt~躃G4{Huhz$E PEP۲ tӋE ph$uTYZu9=G4u<=`H4t5H4h$ XZE ph$7TZYu 8>4UWVSu huS 9}1hE4SN F 9~hhʈ%S4 GShp$SY[Hu j5NZ8>4e[^_]UEu薂G4/Huh$E PEP跱 tu uh#- UEuJG4/Huh$E PEPk tu uh$ UEuG4[Ht}6hz;$E PEP uh$E PEP t}E pph"$R USEu腁G48`H4`H4Hu h3$ORYE ph>$4u uSG41>4UW$=`H4u1Ph>4u uG41 >4UVS]u VSXZu ]e[^]Uhi$hG4u uG4Uhv$hG4u uG4UWVS ]} a}t~Qwhw%VZYtJh$VӠZYtBh$V Y^uEtFw腣ZyyEE̓uw RX1ɿ11jjEjjنEEuue5(>4$>4Wu 50>4,>4}t =`H4t0 ,>40>4c#t"QRPh$5H4EtA뗃}t =`H4t0 $>4(>4c#t"QRPh$5H4؊ujuj1e[^_]Uju uJG4 U}uxG4_h$nIZu2=G4uC=`H4t5H4h$~ YXh-$7IZu8>454154USPE] u xG4==4uH4E EK$hu@j EPsxj xM9tsh2$5H4訉 pH4tH4pH4tH4 H4uuM EP$] RPhk$Q_]US}uMwG4!`H4`H4h$H`H4X]USEu w=@3u5H4h$ XZH~}~hϷ$E PEP u밃=G4t5H4hڷ$ Y[j E pk@33P @3 u  33kPk3B 3k 3D:.H3tzD:.y h@:.萤Zu!5H4h$(@:.P@:.< u$@3k9 3uP{{uPKoC닡@:.P@:.8 t D:.yh@:.Y t@) D:.yh@:.Z @:.P@:.8 u5H4h8$@3k31G4]UWVEu EuhHuh$E PEPm tjE p̗ƉXZutWVE phd$5H49G4e^_]UEu tsHuh$E PEPݣ tjE p>EUYYBu@t)EPmPPE phm$5H4NM;MUG4UEU u$tG4]Hu Es$]DBE Ex$]DUS] h"jSu1tssh$5H4輅]UWVSVEus.Huh $E PEP̢ t݋E p٭[u G4zh$yYt8uՀ"RUÉ4$|<$舧WURP Whʈ%So WVSg (S谌 1G4SZVT e[^_]UWVSEurG4Huh$E PEP th$6yYt8uՀ"S:Ǎ@$ͦ|GWS@P =H4pH4tH4EU`H41`H4H4pH4tH4jjh$M qVh{$b=H4EUpH4tH4`H4(VRZe[^_]UWVS]} t q7h$VoZYt.h%V^ZYth$VMY[t뷻wZttH3tD35D35H3h$5H4A1G4e[^_]UWVSPU} uRUwZUuUE $H4Ee[^_]Ë@t PL1ɉKXW蜥CZ=`H4ttP3h$5H4豂e[^_]USEU G4t tt<]p-t8Cu#PRj h$5H4Pjrr 1G4]UVSu G4}t e[^]pvvXuvh$5H4,Ct PC1҉SY3h!$5H41G4 e[^]US}uoG4B==4uH4E E2$] `H4`H4h_$Q@`H4X]USEU Hv;oG4V==4uH4E Ed$]< `H4`H4Hu h$?Yrh$?XZ`H4]USMU AvnG4_==4uH4E E$] `H4`H4BuPh˹$`?XZrPhӹ$N? `H4]UWVS @Eu} t/nG4AHhϷ$E PEPM tЋ5@3} 19~j k3Pw߽ t*Cu%wh$5H4G4 h@h3P 1ؿk3X 9XrB.DP@tC3<$t<\CFC B.K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP54)PE 4V& E 43߿iu6CDžؿ9}~)54)PE 4V E 4 ƃF;p\30mXu 5H4h~$u!5H4h$= G4^X~ t=G4u 5H4h$΃=`H4t:5H4h3 H4HQPYYy Pj YX J j 6R \3P5X3V =G4t3~t-H4HQPy;P| J PjXZh@Ph3 oX3E\3E 9XCؿt G9}ce[^_]USËt P+1XCt P1ɉKXCt P1CZ]USd̛3jwX=dH4t>ePh%$jd]Spw~!H4fJftPSRm jh@~3N USdj+wX=dH4t>Ph?$jd]Sw~!H4fJftPSRSm jh@~3M UWVSÉ֋:j:W0YZuWhY$S臤 :WXP諗YZtj%WYZtWhb$SQWˋF u FfP HuFf=tPh$S h#SXZe[^_]UWVSQljUR˷[Ë7 <wsBSuRUB u8Uӊu <wrs C <v1e[^_]UWVSË@t P1s_stV.Y1Ct P1CZe[^_]UWVSljӋu\H4u<MP6uEPMQSW脨ju>y8E8 u@EPhm$[XZ H< ws 1e[^_]Å8UWVSH%Pty=B.UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu h$j> jh$W uW1ɉK fCPjh$W uWC fCjh$W u WC _t36 vCvCF C FfC (WuhĻ$=Y Ei$:j/RU\^ZEUu R菚8)ЉUHQMƋMQURP% { uEuVCYj@VZYt_{ u1҉<>4Mq@P&j:Ep҈ t@PMAYE@yE@tj>[urVj]RU荈YZEtH:UttWuVhԻ$)PERVaMVu WuVh$fEPx:t1j:V!YZtP>t3tJj EPRUjO U:tM9u HvWuRh$W?fC*C tt54t54t#R՘CZ{u%{ t%P赘CX1e[^_]USZKJy ;J| t Y RPxXZ]UWVS\fDž1jh$P _1Dž1jPP$AZY@t(t 8tt 8uSh6$U7(8j;P ZYƅhG$P*Y_t>hO$V_Zt4hW$VZYuh_$qU_SVh$Sזj@P脅 t%1ۉ<>4@P誖^j:EZYt+@PtXDž11Dž8ta8tVj/PF [^9u*u+pjh%S ts11ۃu t*G41ɉtf1҉uPt ;th$SpZY1ɉt >th$VSpYZ<>4=G4tjjXZ<>4.hPR u11ɉG41҉G4QPbG4G4YZuu*"#Hu9g uPh$R Ou PjɿPj蚿_Xu1t ;t1j/S肂ZYDžtG9hh;&RY 18>4Pj=8>4u,;u=G4uh:.hڼ$豽 ^_W4t3hSS hh%S hVSz $hh$R 1ۉ=54 tSG41ɉ G4t hh$ hhx$R Pj?G4G54uj/Vi [ZtP1ɉt PjPjXZG4-cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh@~3@? ZY3u PP$Y[@ S ^<$Zffu/t+;:h$S諁ZY%h$*t?u+$u =54uhA$MWeY,,54t <,j/Po _Zt@,PZ P Y54 t 8uhg$c1=pH4=tH4xH4|H4DžtDžx=54t0 tRPq%ZYupH4tH4OXH4$,h!A#P^_44u ,c4P處t$P舐Y[u/txxH4|H45pH4=tH4ut84P51҉$WVP趗y,Ph$_Xj=`H4u=D3D3,PhȾ$5H4j pH4tH4 H4uu5H4j FO[^RPhӾ$QOjhSh@}3 =4@}3XZ?tj:W^ ZYuWY9sFj DPAPB ytD9u9tyPW)PO …Yt)y_ uu1 %=tH4u =pH4t4;xs4h#Vc G=tH4u =pH4tP5H4h $胯 Y[5tH45pH4hZ$V"5tH45pH4ho$5H4b=4>4u&4h$ Zt6Ph$Vъ = 4$t߽$PR諊_Xhװ$h$h$V蒊1u4 $t%#t7=`H4tWh$5H4Ia Ch$ t2=`H4tWh$5H4a CVh$ u<4h#P̉Y[4P,^@u6h$1$[2=`H4t5H4h$Э XZj[X<415-΂`h$ -X,j q^_u41DžDžDžDž@`j lRP lt B.DB@tU`e[DžDžDžDžDžDž1DžDžDžDžDžDž1ɉ1 DžDžDžDž11a\dd$~tej `Pd/? xH4|H4`8\P -Zpf#$ ƅ#d8*u@zj pVP> gp8-X@dj VPa> 19Ћp8/ Pdx*u,j pPR> pd8=tH4=pH4h2$[$tXH ׉dRp^_oDžh8HVRHYtx>j$stdF*t$TtR$Dth$=X$$udh$@$td$ƅu$u}tP4lXV~_Zt:H-,r)=tH4=pH4h$t;u h6$x~3Px~3~ ha$`H41u>u$Pڋ(Y^'Sh$5H4Z ƅu  Sh$5H4Z ҃th$;XZ h$;X DžDžjXu tSjYj_uRh$DžDžDžDžDžDž 954u h#Pc_Zu Dž8:.\ 8|uQjj TZY h"@PE [^88u @Ph$lDž0G8<pH4tH4u!t9Nj}5uPuGxH4 |H4!΃9=`H4B5H4h$ȥ ^_+u t=xH4=|H49u 9t Ph $n9 h% h"PXY[88u Ph7$"Dž0hj-S[^hjjS_Z$}3t9D3tK }3tP hYD3tЁ~=}$}3PyZ }31H4H4H4@tPj~R^_DžjR[4P5$}35 }3U u h5$A1ɉjP5 }3ƃ }39u hW$8"ty-" }3R)Phj$7  u @;u‰Њ B t th#P_Zt h|$=0>4u 0>4șu$}31jPNY[؉|tL𙋍|9Ή| ||=H4F|19=$}3|19||Nj4PWj5 }3耀ǃu4PjZ1H4H4|)ډ|8 }3@DžftSF utڃ#u)uË9 Ph=#}=H4H49H4H4|#6H4RnXb)f=0>4tYjP7[_++y @B19|@B)RwY맋c[1u9V4P5$}35 }3蚀 uj@N$$h#5 }3ԑ_Zt h$74|ft=H4u4P4}^tch$藸Q=H4uڋ H4H419}NjH49|H4 뤋H4#[#jN8$dmY0=xu tjSXZtx1ɉ08R18 $P _Z@u*tP?9$re$h$5H4Q 1;H4H4|xH4 |H4y )jFXpH4tH4H4H49؉|1=H4=H41@u @u"PjLY[㋅Pj wLXZ@tPj^L^_@tPjELY[4t4P{@t PD Z0t8t08RX ;54t t P`1 X,t,P`1,XtP~`1_$t$P_`1ɉ$[(t.(P@`1(Zpe[^_]UWVSÉjh$P jh$S٭ tsh$SVZYDžt$jh$S貭 tS)Wh$j躝 uh$C_u?F t u8t,jh$Sf uVj11҉/ZYe[^_]É؍e[^_]*US1EEjh H4] ZYt-=G4uEE@Ejj Y[h7jI[Xhj IXZEE;EEj:M 4_ZYtw1ۉx~3=<>4u <>4EU 1oE54t%h#S辌ZYt;|tSV^1ɉ 54[E~E@EE@E\=G4uE]ËE@tjj'XZUWVS$} j h$uV uE1ۉ]]u7pÉEP'D4uj=G4t/t uu5=4h$5H4C H4B.DptkG4 DУG4u#G4v=u dutB.DpuTu@)t+ t&_3s4@du (uu-ut1G4uE9@`H45u$  >4uH4 5H4]Xx u@uhPh3Н =G4uЛ3t R^t&G49tt1t1ۉT3j<j)=j==G4t ujNY3o!ȅ!Ѓ„tt jZ3!ȅ!Ѓ„tt jX0e[^_]UVSu=ě3uh$""G4[11ۉ3hoj<ÍE PV5ě3͸5ě3h#؍ 5ě3[T3 hp$VD^ZPƋ3Y!ȅ„t tjYSj;XZe[^]UWVSDžXG4X303jj3Pq3 yh $虥X`L3tjXRjhPv 3<t <=>4=>45`H4=G4u `H4h$VÉ5`H4X~St6=G4t-G4-wD5H4h3$W >4^_9h3hn#5H4? =G4u}H>4hZ$[=G4M=>4= >45`H4=G4u `H4h${É5`H4Y~It,=G4t#G4-w:5H4h3$| XZ/h3hn#5H40> =G4uD >4h$_=G4=G4t 53/5H4h_$uڀ=3u5H4hv$ۊ [^1;$h$SQ|ZYu1lG4-w 5H4h3$븍RpRRRPh$h`3 t5H4h$n:u:u:uҿ33󥋅pff3j3Ph353Zy/3=G4P0 X31G4m=3h3j53]ZYy h0$_3=H4<<3<3P3P3P3P3P3Ph`$Ã=G4i)=H41ۉH4303=H4t f33tPh/ Xjj3P3 y"h $_H4=H4u#jXRjhP @uh$$3Ph353D yh$豠^L3tjXPjh53 Džh31󫍅hPR539 @ h$됃=>4D=>42=>4+= >4<u\t3<u1j j WhStPtP 5`H4=G4u `H4WS\hP$É5`H4~5t=G4t>4_h3hn#5H49 =G4u Zu<if3RPj3P3P 3P 3P 3P 3P 3P3P3P3P3P3P3P3P3P3Pjjhw$ÃX1t H4<uADžXjXPjj53+ 53;, 314G4$ w=t5H4h$olpRPRRRPht$h`3m $h$SvZYG4$ j3<lpRPdPRRRP`P\Phk$h`3ӽ , R\x`kd^31f3 Ћ Ћ ȣ3lp ff393C<vlpRPdPPPPPPPPPPPPPPPPS`P\PhG$h`3} \t5H4h$.\` d31f33@ulp ff3jh3h3 x5H4h$$m=5H4h $r5H4h$be[^_]UWVSD}3=G4tWPrjjP^( ƃ cPj53?( @H3EfEjEPM]ġ\H4ZZ<ډEUjEPгM+M̋EZ[+Ey@Biy1QjEPU u茁8t肁8#th$Pu h$:E03EEPEP53' à u!:8t08#th$~[P53' 3VjS#' @t0}uEjEPjjS@ W53cJZY53B' 3X1e[^_]UWVSu1ɉ 3h;j{.EG4[_tp3 3W 335G4G4G4=4thPBUPE UBC=4 33 󥍺0303ț3<<ț3ě3@@ě3D?4DDD?4@?4HH@?4T3LLT3G4PPG4G4TTG4G4XXG4G4\\G4jhG4`UP j`PhG4 jhG4U썂qP $jqPhG4Ό G4U쉂G4hhC4P蟌 hPhC4艌 $hh?4UˆRm hÈSh?4W uj,3 t13EEe[^_]e[^_]UWVSQ}j/W [^Ƹ%t9u%jP芓 XZt/y Wh$ohWh~3辋 ~3ƀ~3. d1/F09tBEjh~3& XZۊUx"0t$uOu5H4h.$} Y[1~3F<.u1F@Fɍe[^_]UWVSuě3u/hU$X=d3t G41Ee[^_]<fDžƅfPftjjWPt hw$Xhh$5ě3/5ě3J ț3gÃ(t hw$褔X=d3t G4j<Xt(t#fVfthWPe! jYu=G4(ujZjXe[^_]US E1ۉ]h{$u mZYt E{$$=G4t$ED?4u!==4t==4u9@?4u%hZ$Yt!5H4h${ TjS{XZjpX=G4u)5H4h$z [XjMXG49@?4uh`3h$iZYtjS){[Xjh3 ZY%hSj(Y[EpH4tH4uuuuhߴ% Hu.RPh$ tԋEPj;(XZjXdjC $~XE@EpH4tH4uyuuEu Phߴ% Huv`3j 1$51$E$j'XZjY1ۉ`3uu h$5H4A,RPh$% sjh3 Y[hjO'XZ1ɉ `3h{$uj[Z¡G4tt =T3tSjtjrXEt1=G4PVX=T3t(MEu Phߴ%| Hu\j[뼋Eu(Eu Phߴ%O Hu/=T3tjY1=G4PZ=T3tCjX=T3tqjUg 1ҡț3e~jl1$bX=G4u06u=d3tG4 h$uXj7XjVYjN[=d3t G4EPj%XZ]UWVS1X`H4ptXH4`"1\H4H4xH4|H4H4H=`H4t}u=G4tTuu u{ E 8-u}tuh$5H4) u h,$5H4) ʡD?49@?4u:1ɉdDžhDžlDžL"jh3 [^u#jPwXZ뺃=T3jXhjz$XZhjl$Y[hh#u g^_uDžT@:.1H4E 8|u]jj *$Y[lE Xh!A#SL ^_TTuSh$dXZk1=H4DždGh!A#u ([^TTu u h7$DždTfzt T@xRPnMZYxE%=tu h7$5H4( EЋUԣxH4|H4jh3t ^_q5pH4=tH4uh$ucfZYth$uPfZY@?4twCTfxu TjWVPKT@jWVPTyu h$Y[X5tH45pH4h$ 6DžL$}tEuuhߴ% H 8>4LZ\\uOuhp$^_뽡3t9H3tK3tP6YH3tЁ~=}3PHZ3j!_l@ujj m!Y^l=H4t=H4t =|H4y H41ۡ@?48\fxt \PTfyt T@S5(>453 3 uu h#5XZr8 H4H4P ta\`RPPF @\@ @H4H4TXRP4FPY^@u|u\`RPj vF @uc[pt95H4H4|ȋH4#5H4x?_ptH4pt륅u!J\@ @uH4H4pt9 H4H4|H4 T@ @t0H4#FqXu h#莉XZ\@ @t"q`IhN$dXGj%XdtdTR^1T\P:>1ɉ\ $[zhPjXZDžh=T3u G4c3xP X3\t\P=^1\jf[G41;H4H4}jYh@u l@u"hPjXZ㋅lPj ^_3xP` [3du \u)TtꋅdTRY؋\P=XHH41҉pH4tH4H4H4e[^_]UWVS1ۉ,4(0H4PTXH4Z$15H45H4LxH4|H4H4 G4h{$u<`_ZDDu =G4uVu=`H4t}t}u&E 8-u}tuh$5H4! 뺋E Ph,$5H4! ɋDtE uPu} 1ɉ8Dž<Dž@1=G4uDHjh3; _Zt=T3tzj^hjXZhjY[<}tWE jPo Y[E j/P: _Zm8tNm8 tDE Ph$҅[^G4 E h#P^^_E 8|utU %9t %tE jPׂ Y^t/x=G4t l8 uW@l8 u"E hP _ZyE Pha$P=G4t 뽃=G4tE PYE .D@?4uJutY jjlXZD?49u&ju/^_xH4|H4G4ujPlY[=ujh3_ $_ZSDu}u/mpH4tH4utRPh$t vˋE8t8Puhߴ%P HTh!A#=^00uuhp$Y[ȃ}E h#P\_ZuDž(:.15H45G4E 8|uXjj !_Z@E h"@PE Y[((u E @Ph$A15H45G4Dž8G=E uPY[((uE Ph7$XZDž8(fzt (@xRP`B^_@tE%=t1ۉH4G43t9D3tK3tPG-YD3tЁ~=}3P?Z3j'X=H4t=H4t =|H4yH4$1$@?4DtBpH4tH4ut/(f{t (IjRPQH50>43 3(fxt (P0ft 0@$VS u0i8 uH4H4hr$:^ڃD =tH4u =pH4(jjjPr?11y4E Ph$ڀY[,RPY<[Zt׃ t;5pH4tH4(|jjjP ?yv뚃 $H4H404RP;XZ th(,RPj (< @tv(@ @uju04RP;^_tA gL@L Hu (,RPS; @um$uwPT95H4H4H4#5H44YPTH4ډPT롃H4H4#PT95H4H4|H4 H0@ @tNH4#*f4wf8 uH4H4 hr$~Y݋(@ @t>f,E Ph=#~XZjJX8t8(R^1(0P_31ɉ0 $[LuH4H4y3dLPh$5H4G 5H4h$ge XZ뾋D(uu=G4uj# _苅8=ju)[^X\Bu@j`S#^_X\lp1tE SPv ZY@XP$+‹E $Ph$5H4_`jh3 ZYt$G41;H4H4}4jE Y*hjh^_=T30PH[벋<@u @@u"1X H4G41҉H4H4e[^_]UWVS]{uX{uRSzuIz uCzu:u1}BEfBfECfEC[^_]UWVSPDž3103󫍝Dž54DžPSu u t: ub0-PG ZPu uh$S G4@thPhuh3jp =43mSj j VhWssc t hh"Wp j h"Vp =`H4t6xt*H4{u VRh$VRh$PBs js yVPh$y <=`H4u 1{Pss1y X[sK3C3 13Ph03p @uGu uh)$(y Bu uh$ G4y 1.03=3u%DžjPjj轣 h!A#)ț3h")ě3=ț3tuh]$ ț3^4=`H4t5=4hq$5H4 j[~"ț3tP@-Yě3tFP0-Z=jSjh jShh =4(G4 Xe[^_]U5H4h$_ XZUE }utG4h$WNZYEue[^_]P2ø#=G4t($Ph0$5H4 -t$=G4t~ tPH2PS2 S%%YE ]e[^_] QMZƒMuQWh_$5H4*KSu QWh{$ދ}u#Uj PMQ~j MMEPjUR rPj h$5H4릍e[^_]á3 `3!t$uCP4tJu6P4G4%P4P3-8!u-UVS t t @P4tJt P41&P4G4 tGtBB@"u\uXu@!@B؀"@tՈBut B1`33u/P4tHt P41P41G4[^]US33`331ɉ P4\31ۉX1X3P5\3/XZtX3@ڋ]UVS =dH4t2H4SP6Z 0^Z8tPhe$5H4  5H4'jh@h3h@:.D)y}uB5H4h$t.=dH4t H4Hy Pj Y[ J z=X3?\30ZÃu 5H4h~$+u 5H4h$x t =G4u5H4h$=Y [^1ɉ G4j 3uVpg \30P5X3S =G4t3{t-H4HQPy;P| J Pj XZ{ (qh7jhj e[^]UEt]1]US]u h$jY SZu Sh$jY @]U=-u S -H4fPftPK Z9-ÍL$qUWVSQ0`H4 H4 XjP+ P4P4Z^+P4y @B=&ڽ߭ݕ H4H4XH419}l؞vK߭ٽf f٭߽٭؉Ή߅u#t 11h#RPSQh$hPٽf f݅٭۝٭Q~DQh#u#RPh&$)PP-Ãt Ph(#)PPÃ<RPh0$)PP؉19}t  @~4+'%y)DžkddʉӉف1 Q%1 RPh;$)PP8H4H419݅xH4|H45pH4=tH49Z)߭߭ٽf f٭۝٭׉hO$)PPà t!Vh(#)PPoÃ<RPhW$)PPBË+P4P4P49}9}&ha$)PVà h?#)PP؃ uH4fJftPVR eY[^_]aUSR1;H4H4}6=dH4t%H4fPftjh?#P jXUR]UWVEE왉U1E}ujEPjd e^_]U0E E1EԉE؉E܉EEEPEPuPƒ xEÍL$qUWVSQ@@u5jhP4覃P4P4pH4tH4P4P4XZjPopH4tH4H4H4+P4P4_XP49}\H49=P4P4sEP4󥋵5P4=P41~x9؋}lOPhm$hSH4fJftPSRg jjj%jh H4 =H4uhQjjujjj =H4|NihA#P hH4Y[tPhp$hPBxxH4|H419߭y=&ݝ݅ =&߭ٽf f٭۝٭y1d~dVh$)P=PNjH4~-hH4t P>Z)Å~:ùdh#)Sh+'Ph$)P=P*ǃ119ʉst  @~4+'SQh$)P=P+P4P4+ P4y @B=&ڽ߭ H4H419ظw ȉ߭ >&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4+'%Ƹd PSQh$)PPáxH4|H419‹H4H4)ލ 19‹݅99}h$VQRà +pH4tH4߭߭ٽf f٭۝٭?~~h$rtPh(#VQÃhȈ%VQà <ЙRPh$)PP`Ãuh?#)PP6à H4fPftSVP~ eY[^_]aUSGJji9JX]ádQ4@ `t1USdQ4HyPYu1ZJ ƒ,uɍPv"u|Q4dQ4HyPZuJ"\u%dQ4HyPZuJCCdQ4uh$: YQ4Q4dQ4HyPDZu ZJ ,„t@Pv8\u"dQ4HyPYu JCCdQ4uq-=Q4thQ4P:ZYuC ߸ ]UWVSQƉUhQ4P[_tHj.V [_1ۅt6uPZYÅu#)WhQ4VPY u1ۀQ41ۉ؍e[^_]À=3tUWVSh!A#h3 dQ4^_u"G8th3h/$@`Y[1$hS迼_ZyƅEj.S [^pu Džp#1btH uuzG uҋp=4uSpEƅt1;4 3*%u_3uGE uhQ48} hQ4P 8ZYtE th`$P8[_tBdQ4fPfttRPYZYx|?th?$3 hh$w$xAE85hQ4}X dQ4fPfttRP[_x"|?th?$ h$ E8hQ4}z=G4t5dQ4PYt u dQ4Hy t u5H4h$Jɋ@3u5H4h$Xk33 3dQ4HyP Zu@JB.DB@uGG9u u@3u3 33=dQ4HyPYuJkPk3B 3k 33dQ4HyPdZuJ< u6@3k39 3u@@3 {u@@3KZChQ4h$ _XdQ4@tR[[5H4h6$C XZ5dQ48Y 5H4h$ۍe[^_]1US]B.uh\$S ZYu=4DB@tCjh$ScT u =4Uha$S ZYu =48h%S ZYu =4hm$Sd ZYu >4]USZKJy ;J|< t Y RPZY]UWVS`H4=G4u `H4h$,^tIhr$h3YO ZYƺ9¸} 3.uh3Vhw$5H4jh$h3/S 5G4tjh6s$h3S uSt =4 =41D?4j h$h`?4O t\h`?4hH$5H4Y Bt 1=41=4t*j h$h3-2 u5H4h$GA ^_=4=4=4=4=4>4Л3h_$躲Y1u<=4u 1҉=4@u=41Л3`H4e[^_]Uě3tP@X1ě3G4=4=4=<>4u1<>431>4 >454tPY1҉54=G4u1@3Ư3jX=dH4t%H4fPftjh?#PI jh H4 UVS]@0jX=G4tfě3t-fPftjPY 5ě3> 1ě3 3x jP3 53( 3 1G4jX=G4t>ě3t-fPftjP 5ě3 1ě3 1ɉ G41G4j芾PZt Sh$j@@ ?0e[^]UWVS ]uG4=P3t =G4u$u 1ۉU4U4Pu+U4tÍCU4C1ɉ U4U4h5>4WL /thh%WUM hh $WBM WLryWh$VXZ1qP =`H4Xأ`H4H4H41H4H4} t1=G4PX"t!jjRPPhR$5%֡G4-cvt3} t1=G4P豼X=`H4H4H4h!A#S7U4SqU4 uuh?$ ^?$PhhQ4Z u5U4H 1ۉU4j hQ4ZYuQ4e[^_]UVSQQMq`H4=G4u `H4==4ut95H4h_$4< Ph$YZuBj h3`^Zuj UR@Pr M te5B.DN@tVu=G4u==4u1ɉ =4t=G4u5H4h3; H4 XZz`H4eY[^]UWVSQ4MY=`H4}=G4}=G4u `H4==4u}5H4h$; fPh$Ԭ^_j h3GZYtj.h32^_th3_*Y3uKjh$V+ u7Vh$5H4mf320h3h$5H4O3 }1V)ZtVh$5H4 EPh,$V4t ,>40>4(>4tK$>4/0>4t,>49~)У0>4(>4t $>49~)У(>4 Ph$j7 UPEB.DJt`j URP0SM tFtyu= B.fTQfkt fgt"ftfbfmt yUS]=H3~/jhH3hhSx @u5H3h$nMYX=D3~/jhD3hhSNx @u5D3h8$6MXZ]UWVS11} _]}ϊu;E ;ME]]]t>t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=G4u E#$=54uM=G4MtE54E}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL湅#=G4t =4u#}mډ)Ӌu N ty.uup9swBL帅#=G4t54)؋u ^ tA9sHBLE H9cS%"M I9OS%49sSڋMA[^_]ÃUWS$]؍U1EEEEPSh %&uK ƒ1uuɯ Xe[_]UWVSu] }VuS7 u1N tuU$tc$fN lSZHˀ; uLUJ9uD D:.y h@:.]Y@:.H @:. t@u҅tu$ff t1҉e[^_]UVSQuh3h[áH4?vPh$/ j}uh$PvCƃ3 1҉UUR@)R3Ph@:.yh$uh$5H4+jX319\3 U e[^]UWVSD]} Sj j VhRuW| t&hh"R)= j h"V= 54tzW9Vt vuvvSh @uT.8jjjhSvv| thh"S< .8Sh$FY[4jjS ƃ u(PPhh$h$FPjSN @uPPh $fDž=\H4~"jP_\H4XZuWS, @-8$}u-8A^PPh$E >jPr_+‹Y_+y@Biy1fDžRjP uY-8u=\H4~{,8#tLVjS ƒ 1BPPh"nu,< tQDžPPhhSo @u],K, e[^_]UVS]u SXu ]e[^]4` UWVS]} KyCSXu?C u8@t4+8ufc +8#tt+ P0e[^_]UWVSu }EÃu3F u,@t({+8uff j+8#tt \+[^_]US] hs>$SYZ¸t,h %&SYZt;uEuh>$gCXZ]US]SZu Shb$j,, ]U螭 u h$j, US] Su ZY@u Sh$j+ ]UEu h$j+ PZu h$j+ UWVShuE ]E1҉UUUt PEXt SE_=<>4tIEt P"1ɉM[h`$nEEZt P1EXh޹$-PGE[_EPEPEPVy$G453 ZEU3H4t\RVh#$P1ɉMEPjP]Sh@:.}yhy@#uh$5H4G41 Vh2$P Sj=G4tVRUaÉ4$W|<$WURP6 Whu$S7 WVS7 E(tPX]Rh$?^_}u-h$^ Yu]SES1XZuh$ËuV1 uq}u-h$ _u]SESx1[^E8uh>$ϻ YPh$聙ËuV@1 uŋEtPh$O_Zuu54G4^uxG45@39~Lk3Ph$ZYu0h@hڿ$h3t5 p\305X3YC54154Et P1EX]tS]_1Et P1ɉM[]tS4Z1EtPXe[^_]UEuGG4=G4t%5=4hK$5H4G4fHh$E PEP7 UBw G4t 54u 54u)E @tG4t:u hv$j' PRPE pZY=G4t"=`H4t5G4h$5H4[ G4j h%h`?43 D?4@?4j h$h>43 >4j h$h>43 >4$j hV"h ?4a3 ?4j h7&h`>4F3 @>4=G4tjjE p UWVS0u=G4uue[^_]=]ȹ 1SjhV u}uVh/$w S 1E0ESw XZEče[^_]UWVS,EPu EP_ Uȃ uP$ ỦEЋE0ufEjEP"V\H4EUXZ1ۃ=\H4~yjEPUE+E‹E__+Ey@Biy1RjEP u#8t#8#tu#<_#1҉jEPV{ u p# ya#8ES#8#7ËU9} )‰UEu2X؍e[^_]UE]UE@(]UPEx$tEjURjj0Df 1USjuo [Zxj0jjZYu S2 Y11҉P$]UVSPuEj0j4ZYt,0@$jjV jEPhhVe ؍e[^]US]t&S13 s4s,S&1]UWVS(]=\H4~jEPS\H4EU_XEE E̋C t 9EsẺEЋ}s)C C)E0}1u&uW3 t}R)EEЃ}umu!8g!8#tw]!C(S!8uE9Cr">uC,'/!8#usZYCEЉC{uMEЉC 1{UԺufU؃=\H4~;jEPRE+E‹EY^+Ey@Biy1 1҉VjEP] u e 8t[ 8#tQ C(95\H4Phm$5H4! <C(<1EЍe[^_]UWVSQ} ]{uhCZC{({,C;C C1s sSjjEPu{(uT{,t Cu`E^KSBCEC9Cu3pVs ZYuB C(1E2Cs} z뙋s )9|Gs}UC Ee[^_]UWVSSu] }VuS u-~,tuU$tc$1ɉN(YS ZHˀ; u9UJ9u1VjjEPat} ut$1ɉN(t1҉e[^_]UE PuAj^UE PuAXZ=U4u U4UE Pu XZ=U4u U4UWVSSƉ׉ˉʁv )…tRUWV tUu؍e[^_]W|$wUWVS||xˋ7GEGEhE_u h$hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}t }}uetWuu= EE)PEW| u h$_XC1Ʌ}lj}EU1EMu9}uh$A^_EEu1ɉMCw$,'E8tJ1M9ȋM}uh5$XZFhR$U4XEE@EO}jjjE 1}Ett hl$O@EO}E8t h$+@EO}oEU@EO}O=E.E0@EO}E @EO}jEu E8u$ Eu E8u @E"u  NEO}~j8h$jEPNu [h$1RjEP*PEZYwP$@,'}tR}uL1Eh$XEE'h$h$h$uh$_X+}t?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuVo t VP^P5Hh45@h4h$j F9p4sp4e[^_]UWVS1ɉ /t,$Xtt+i9~d\@1ɉÅu5Hh45@h4h$k1Ҁ8IuC1tOFH@>uj RP荓 F 5Hh45@h4h)$j ؍e[^_]UWVS ÉUE9C#u~nu Ph4h4@ p4p45h4_1,ph4=@h4u8#uxnu Ph4M 1M I tph4@h4t]Ut @uKf ph4-tph41ɉ h4=p49G p4@h4t1BJM pЍe[^_]U`h4@ t=h4t/=p4t;HyPYuԋJ 5`h4P] XZ1UWVS|u=`h4uQp48u==h4t h$j` `h4@:.Hh4$\h4:.Dh4"lh4`h4tQHyPZt@ J5`h4P輘 5`h4hdh4hhh4 Ã]F`h4=@:.u 1~1P[=l4tdhl4j'hl45Hh4ʛ tKh!A#pY_t6Vh jWMt5\h4PjWV#ZC{\h4@ @t1¸:tPP5Dh4hfE#j 1p4p4e[^_]UVSup4uh$j^ p45p41ۉ^] ^1ۉ^ 1ۃ}up4CQVSRP- t 1҃t5p4P_Ph$j Ѝe[^]UWVSEp4p4z %&\u.rEB.Dpt zu0y_<\t<&uGq45p4V9r0Mq4P5p4Uãp4p4p4XZM p4C1p4xutyPx utkq4)ʋ p4L 9r2Uq4P5p4ãp4p4p4YXURUp4M 0QSUp4 q4=p4W9r*q4P5p4oãp4p4p4XZe[^_]UVS]uCP9SsCPs'CZY}u1CVu CPuss0 e[^]UWVS15@h44jhq4BZY91ۉ q4U41ɉ p4CSuu xK u @h4)9BmuB5q4j1ɋq4_Zu @h49B Ht1s p4C8u @h49Hs1ɉK 1tu*@5q4j1ɋq4a_ZtЋCu,u @h49Hu׋@9@h4pu x_@h4C \u@5q4j1ɋq4Y^u @h49HNCt t P H C=<>: $h-'p49p4rp4kP5p4p4XZ=p4k 5p41h q415q4{u5\h4s_ Y[ =p4uu = q4 q4t5q4CPj V׷ u q4p @))Ӊq4SPV蜆 mj5 q45q4hq4;jjh?#hq4j5 q45q4hq4Fj5q45q4hq4 jjh?#hq4ej5q45q4hq4M 5\h4sG q4@q4D=\h4:.uY-u[hrQ# Zt8tPG -_9TPhht@j` uVft--<u -t 11@tR@DPPLt%tv$DP 1DžLP u?F;5-r5\h4h!% Y^5\h4j$~ 5\h4j ~ 1WZtHWNX;5-r5\h4h!% ^X5\h4LjDtdW}YtXPhd.'ɪ_ZDžtE;5-r5\h4h!%W Y^d.'$Ph$5\h4 _L<;5-r5\h4h!% XZDL<Ph$5\h4觘G 9tE8tTD1:"u#C؍e[^]USPyYt@Ut‹EBu Sh-$j ]UWVSÉk<`-AfEE19E~6Q@94:u9E~֍~@kt~UCuBEsD})EKʋEC _9~M{fufSf9} z)f{)MS9|M9~fK)y1fsf9|MS9~/E9}(CPuyRuFYXCuE9}ys(ulXZ1C9uf{th$uQs**Cujjs腆 uCuS)PsNs"e[^_]UE @]UE @]UE @]UE 1҉P]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE 1҉]UE 1҉]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]"U1q4jA1U1q4jA1UE uU]U4 -1]U4 1]U4 1]U4 1]U4 1]U4 1]U$41]U$4p1]U$4U1]U4:1]U41]Uh袧41Uh茧41U4 1]U4 1]U4e1]UL4q1]U 4l1]US] 4)thkj<XZ*ƀxj3P?jj354Y]UWVS ]u t/{u)P.vP= t6vWKC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P舀C ZtsPVs 1C sfs1CZY]UWVS`-1AfEE1}9}FQF @tf~uߋ}9}֍~@ksCf;ssfF ItgC,t{uu S_XC0tu SY^{hC E{CE܋Cut 1EEuECutiPEZt[8tVU1ɉMj RUSxYZNMUt)9M}MԍPuRjZEM9}MtFE1ɉ u1uE$CЃEЅy 9}NjC fsfufu EfC  Lq4M)U)9~(f~CDuEԋ}))y1E+E)fC M΋U9|C@tSf)uu5Lq4WuCPC Ph$$"EU)E)9~fS }}E}t'E܉E;USBu2ZuEC9E|P!^9E}EEM4Hq49~*u5Hq4uuh$h:.ejW}u)MUʋM9})EK uLq4}))ȿuWVEQ`PCu3luuWuuuC Ph$h:.d$j!WjPp谜ZYths hsCtuuWVC }POC EdC tOP5P7PXZ?S{B99fSs C9|)BfSU sV_#@$,/'2=.=9=R@Kщȃ$|/'C*h:.jH Y^\sF "HSB ufCf;CfCs$uh:.jG 5P7l65P7I6jjWPRNEtbu5P7N5L7MV ƃ11Et9}} < uEF5L7xh$jj5L7IVjj5L79$jj5L7~5L7O5L7Y=5B.DBxqz>tKdtF<-u(=t5=t,-v3=Rt=Su%t!+=Lq4S>tLq4|@h:.j_F XZV taCfS K)y1fK)y1fC\{f}}S׍ MQ9UK fMU)y1s9~fSUʋMM9ULfKswXxut fCfCjz `~x~Ja (EC99C@ 'fS?u ? =St=V(Yvt1ҡB.DPIh:.jD V! oesuC Zt sPL_Xs)\Y tVF t!u S_Zt Cs~ft^F uMsuC ^tsPKs 1ɉK s[s 1C@q4XZu W_XF s0uC Yt sPQKXZs\[XCt2PBo1s_$uCD0tP#oC1҉T0YEC9E|ӋC4tu S_Xs= 1ɉKC ^tTP* 1C ZFu#uZu 5L7}teE9s$[ Xe[^_]UU@q4U fP]UU1x9Dq4~@q4]UWVSP.5Dq49B  MP5@q4jY_Mu11@q46Dq4@q44uj .t.t)9Tq4r!DP&t Zt;Xq4s  . .؋]U5tq4j1`q4\q4ZU5tq4XU5tq4$XUS]uTu PmSPjh]US]u+u P}mSPj?]UE Puj& UGuPhp$ UuPhp$ US ]uuPlSuuu jPQ$]Uh#uuu uUWVSu5tq4&5tq4&XZugu,u4u(PlVPjjMƃE}t'E8tE$9}u茏YtEE$t9}=2}Et,~(E8t PRZU$DE9rE} u)@E }y$u{[Ej PcZYtE@M}})ȻEE9~)ω}u uVQM5tq4:ÃMu$u uVQh?$5tq4U11MQS<XMtW5P7=ZYMM5tq4QPS!5tq4PSjjSg$SrE @PE@PVMQ5tq4,:P0S P5tq4迉S^P5tq4u'u(PyjU,Ru$u uuP$t6SgXtSW(=Wr S.MVP]SWe[^_]Uh#u$u uuuuu u3$US]uuPiSuuu jP/$]Uh#uuu uUS]u5uPiSuuu jP$]Uh#uuu uUS]uu P7iSPj]Uh#uXZUS5tq4"5tq4"؋]UjAUS]S; hX#i PC }荄k =4t7S诇Pha%54 O54i54i14=`4t8SoPha%5`4N5`4i5`4i1ɉ `4=xq4uh:.h b%ě XZ]UWVS h!A#PN_ZuohRjP譋Phn#h:.8NS^ j@hf#S?M _Z؉Ph#_Y[/'tCVhS/ uW蘊$W# t ;u뵋Ct{ tዅhf#RL ZY€:=uZhf#SL ZYh b%S蒧 ZYWS迨 ;VhXe[^_]UEPE 4UWVS 1ɉJ P ^蜣 Zp j h%b%V uՃ{ uC W- h%WN VWN WujƋ;7P" yC9C u=CPW`Y_Zu5 YaCPs;Y_ZtۉC{ CP GC V Y^e[^_]Ã=d4u U4t uP XZj.>UhX#謰 YtP聮 Zt h%r Ygjhn}YZ hZjXUWVS$1ɉM܍}14j5j袆[_ ]߉j jPM =4u:S<ZxEPj w_X}`jhz[^14j`zlj4PgZY~>jh8j4Pfyjh_X= 49SE^ujhY[SZu41$Hu_k4Php$jXjc4)t]SU^/}EEjPUY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEP.e_1;}s7klE@0 t(Pdt!ztHhr2p8p4jG19t4EPZYvGVX_}kSlY^u`S[Ohj]jYju8j]SZYu'lڋS踕Sjj^ڌEP蹚Xe[^_]UWVShPVG hhWf%V hVW% $hh%W Vu1EWZt/SSSSSSSSSSSh#h4jj.Y[ WVXZ뷍e[^_]UVShPV藢 hhWf%Vg hVSu $hh%SB SBt VSXZe[^]UWVS}11u܉54jj7_ZyjVPHI e]4$*u u^)uYjhbY[,u>tPZt4$PX4$SX^_ES9bSZYS^]_^f%if%S^5P7fjj5L7ƍ5L7[5L7fEPj  }tChj_jZj u,jSZYu^f%if%Ј贒SʗXe[^_]UWVS}11Eܣ4jjfZY=wjSPyG xpuࡠ4*u$tPV_XEV[[u4EPj ZY}t!hj`jju ޑVXe[^_]UWVS1HH;E E8u EH1LEL0< t tLEL8PuY$}1ۉ889E SLZ9$PuSu O]1<%rA <%t)B.< u"DB@C8Cuj PPS P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uB.DP@tC8u$C<j<11]UVSƉ5L7Tj5L7m!5L7.n`hPjj ghqPh\Pjj9Vhp$A h%CPjD_5L7@jPSR)R5L7&$uh:.hf% jJ0jPa@uZYt'5L7\wPS,v5L7PSjjS…S^؍e[^]UWVSӉVjbVj(P$P@  d4hd4hpt$i =.h.hbt(ri ud=.u[jh&j$. h.hf@$?i=.t"1҉.h.hbt(i .4tPAWX`4tP1WXt %1d4^*g%8g%u j/ j/ jjhTh%. jj賞 $/ 󥁍 Pj(˸ (4t#u hIg%Ph;54/V14`4t#u hn#P<;5`4V1`4h;&3y^_uhXg%syZYu s Xe s h4XEt28t(P1 _tSPh[g%q S3 3hmg%X j蠆41ۉd481󫋍$88EDž1 $tWDž1ɉ Cc81jj P+ 9AX8󥋅 ,014,PjjXPh+ c 8uE 1h % _=4t 苆0PPhwg%549hVS+ ~IƄuSPV$S* ud#Xh#Q ^t@ ?uz4tPWp 54-S 8uE wh#P ZYt f W00Y Cxg% 󥡤4xt SP7XZSj ƒt=$E+ (:+ 4^_tPBR[1ɉ 4F ƒuhKu $=t th%M Z1e[^_]UShhjhNjjjjj jjh .h4y.h:.hg%̃ 4Y[t Phg%趃 XZj)jP0Sv ]UWVSEPuhS1}u=xPSY^tE 1҉Nh!A#Sk6YXu;h!A#Sx" XZ1u+4tSh2'hg%P5띺tVRp=ËE Xw1ppWr Zpt\B9rOw wtSEE 1҉Y>lRpSQBËE YXۋplt 3F늅t 3}uWOW% Xu#4tRh2'hg%P4e[^_]l< UWVS0u 1EEEPVEP6 ] 1EԉE܅ukVhg%E܍t0SE)Ph"V$7 h)h%SG ƒE؀8'uE؋E؀x*hʈ%uE3 ^_]EԊk<'uMCj'SE^_E؃}u SpY؉E؋Eԍ4Vu@E_ZRShh%jk j 벋E؍J9d<%u<@Q)IB*B6j/V ZYDžtVts EXuЅt GE/}!u p_HEu M܋}ԍYtqUĀx .tx uuWq uˋU;2tEԋEԍRUu@EZYUWVE)Ph,h%E܍DP5 y;2tVCXuf XtE܋M1ۉI}Whht@j6_ f}ufEf}ufEPEt|e s+L7EjP5L7z5L7aS6Et55L7NHj5L75L7TL7EEKEfmEURuuUjh@:.m ]u uAE@ uEÉESESXZ9L7thPjjL7t-9ut h?#_SuY 9t5h?PyXZRtE@tEEug9L7tS.jPx t h?#z_hPiRD:.HD:.ZYy h@:.L@:.xRjuG y_ qLj9L7tS[}ter+5L7fF5L7j5L7 Ruy@Y]܃Ct Pe@ZuZ@Xt EtVt"e[^_]UVShV[ZuYtPEj.VAZYÅuhVh@y4 'hVh@y4 hCSh@z4ފ e[^]UWVS֍y9sjʅta}t7E t/t,B.DHuUQMu@ZYMUtC)؃~Qh3h%PS)F1E ؍e[^_]UWVSƉUMjjj-à @t5$1UVjh@{4V VuS-[SU" ؍e[^_]USPh@{4h:h%EPjh?#u1 [Xh?#j1 ZYttjh^h%Sl u؃hfh%S ZYuhph%S ZYujh{h%Sk t؊t t@hShr4- u >X]UVSh@y4Mj$@z4?j$h@y4hq4 =@z4tR)~?y4.u@y4Ph@z4AZYt+hh%hq4耉 hh@z4hq4l q4e[^]UWVSd1ɺ!iu$xtxͽ jPh y48 1ɺ%iu$xtx藽 jPhx4 jjjà < 1jh@{4Vȇ Vh8i(SXS ugL8PYhPhv4苇 e$8PXt*hVhv4@ hShv40 %Íe[^_]ÍL$qUWVSQ-Tq4LChh%(Pj y,4t Phh%x [^h:.hh%~x jhF3Ƌ(Y1ۋ(?RXgZX9hD%W: YZPWV谫 hD%W" |B.PDžX@.XtIQDng$HDQVh uHPDAu&XhViP؅ C iƄV:(:_Xujrjn[^TDž$Hjj$V(Whh%+g @u"Dž$ jjVWhi% g @u/ ;Tsh"i%jPZYt,뱸 ;x|s:hAi%jPY^u(hdZtq4DžLh jS>5P^_u5 4[DžL9 P‰f@ @ 9uhujjjjjjjjjSPjuH41ɉXTDžhjthPH;h uHiP8XZ{ q4hiPh@{4覃 jhh%h@{4ft(jhh%h@{4e h%h%1DžPhai%j@$V"jjPpPVd $@t puh42'h@{4h%h->jbt8DžpjpPjj$Sd @tShsi%]^_1@1ۉX=@{4su%=A{4luB{4B.DPX(Ph% ZYu7hЩ$Pe^_Džu\DžTX/1jv$X󫍽p!1󪍍pi[@u 1ɉ$Nhhxi%U_Zthhu4hu4j=u4thht4ht4hh%hdj%J&ÃtϽPhi%j[hi%S[hi%S[hi%S[$hi%S[hu4hi%S[=t4tht4hi%S[ hi%S[Y^h j%S{[hj%Sp[S@hj%j^[h@{4h j%he(h@{4h5j%h$S S4.hYi%hv4c_Zh}j%hv4c[^hj%hv4jcZYhh$hv4Qc^_hx"#hv48cY[hʈ%hv4c_Z=v4hv4h@{4hj%jxtnh@{4hj%$Pj~ $-^$^4[hhv4hv4j~hh%hv4bv41s4hh k%qSZYt/h"__t h@{4h k%hk%ht1i s4h$k%\Pj ~h\hw4~ \3j hw44 thk%\Pj ~h\h4S~ \.3j h494 t=4t s4hl%\Sj( ~h\h@z4} \2^=@z4u8hl%Sj ~h\h@z4} \2[j h@z43ZYt=@z4t s4hh@y4C^_u =@y4u s4,hP$S6} hh@y4h@y4jx`hh@z4h@z4jwJ,PS;`Y[t%s4Tujh y4h y4jyXtjhy4hy4jz_h y4@ Z=x4u=w jh#m%"P?w jh.m%-wjh9m%hx4\| jhx4hx4j{hhw4hw4j}ms4u:1ۉllPjI^Xluhh4h4j|*w4XDžDw4u DžDh$x4=x4uh$y4=y4uh$ y4= y4uh$v4=v4uh%4=4uh$DVSQRh@{4Ph@y4h@z4h#h,w4uh$x4=x4uh$ y4= y4uh$v4=v4uh%4=4uh$VSQRh@{4Ph@y4h@z4h#h^(jjj h%x P Yr4Rhp$h( heZZ?HP2/hDm%jtj9q4_V=4h"ham%Y^u>=4th54Pk hvh:.Puk jhrm%j\TpV VVPhm%hm%S9T =@z4th@z4hm%ST =4th4hm%ST hj%jSj8S8= y4"Xhy4h y4h@{4hm%jhn%hs4 hhs4hs4jjFj jh<u`hn%$S hs4SZ dhʈ%dP( _Zt 8tV [^^jj`RPu HTuB=x4t hx4h y4h@{4h+n%jh y4h@{4hPn%j=@y4th@y45Y$h@y4 ZYTuY=w4t&hjn%hhw4hn%hwhphn%h[ TTq4j6q4LXXLeY[^_]aUU#w2']UWVS] }Vh^%DZZYuu ƅ?jhn%@:jjf@Mjhn%ZY9t x/t/@?/uGjhn%MXYR4$SRPhn%hue[^_]UWVSƉˍPh^%>YZY#un%t#VQPSS$4t4PVSWhn%hie[^_]U幀4E]UUS]SUZй4؋]4USPEEPj耱EZYt= 404=4/u4萱SPh%hh`41]US]=q4ujXE]EPj EZYtt 4F44=4/u4SPh%hh 44=4/u4ݰSPh%hh 41]U Mh +$V3M=v4thv4hno%VM hj%jMYXs4Ltd迮SPhNo%jL=v4thv4hx4h y4h`o%VLhx4h y4hxo%VLhj%jLXZh%ho%YX@Pho%jdLhi%SYLhi%SNLhi%SCL$=@z4th@z4ho%S'L h y4ho%SL =@z4t_ZExN1jSEpje S}WS}Wttg`PR][^tEPPR跟ZYtU6V8t,V8u"E@t$RP]^_uh}%EPGY[tEXt p$l(h,`d04t:$VS\_Zt'EPV4Ph:q%hSEpFjhEq%Y[@wphQq%h`q%SDVhoq%WDWh{q%S$WPh}DS6S?Phq%8‹ t ?tPhq%PЭ_Zu/[hq%P训ZYtލRh&P:C tjj h#04,,RPj$W2 SDB. tHLDJ@tSPWVhq%hFPs @|41󫍝DžƅDž@|4DžDžShQVZ  @|4f=tfyfv|4f=NE1f=FX!ʉ׃11Ɋv|4w|4t 'w4$@'w'$@'wt$@(u$@| uu1Ƅ$jj h#04,,RPjSs $PSVhq%hFP4J1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VLX j!?jAm.jUjj h#04,,RPj#W' (S?PWVhq%hFP= Ljj h#04,,RPj$S SVh $hFP 0E@8@ue[^_]UVSPjjuVjjh2'@tbu XtSjjVSjh2'm@u SY2hʈ%S0 ZYt PuU ^Zu S[ hʈ%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEw1hs%w Y[uF h%w 8A[ZÅt#h2'6$AZYG辟t똀\t @BJu Xt@w44$t)tVP҉[Xt4$1҉94PSb@YZtXP,40Sƒt/t#VRЉXZuTRY8puo$uVP҉XZtً$HjjjjhSQRPx jjjjhSQRPx ۍh1%S h4PS\ h"P h4PP\ W(R<^pT`~,a9fhGPSR\ hwVP=\ ;h1%S- hwS\ h"S hwS\ (uYhq%V hV[ hwSZ Ph%Sِ à ƅG1ɋÅth"S=ZYu!Ph%j艐 à uhZ $S=ZYth#S=ZYth$S~=ZYths%Sm=ZYth"S\=ZYtt hhq% hh%VZ hSVZ ƅGw PV謙à whp$jj9k؍e[^_]UE1҉UMU ].UEEMU ]UWVSQ]} E10$hmj6Su Eq%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVSE 1ɉ1D󫍕D1҃=45L7|h@:. 8 5L7A=4 GuujjRAXZ1Ҁt,DžfDžDž Dž=v Dž1ۉ11119tD5fDŽ5DŽ5 H5=fDŽ=DŽ= BC8[ty1t1DŽZfDŽDŽ DŽBt1DŽXfDŽDŽ DŽBhjjjjjjjjjRPj轜Ã4uDžRuhp$j@DžPS(tuiu5hjjjjjjjjjPj1ƃ4t@DžPV轑ZY^Hy VXSڜ_u?t6hޤhPh.'U 4.DžM=4yu4Dž&1ۉ49i8511ɉ9=4t9i854t(~SW7YZ[ڋ44ƀy1҉LPTXjSPT hCP4"PT jSh4S 54,, 0$4(804DH$u"u $1҉DHQ,RPFP$4()n,, 0$4(804DHu u $D1H$ 4HpuDH9jj h#RPjV jj h#4$P@ RPjP} 48t$4VHDPh.r%Rm 4$p~ơ4$0hRRVP4Pjj:5Dž1ɉ$Pj躍^_u654h_1Z7$P1$Xu@P4P54 Pz^4$HXDH-1ۉ,048DHƂ(48<=454\44Ytu 4h£4a1X@_yuƆy$tP,40Wg$͋e[^_]UMw1vB ]UWVSDž1ɉ4*)Phr%hS }%#t+hf)/ZShr%h豾 ju藟h%֋4Ph:%hSK h%Shr%ҍǃ(h%ShjlE0pO11R ZYtsE;klEX{41 Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQhߴ%hǃ&YcLu۝XZ=4CLSSRVǃSRjj\0jj!6?$@2'v=IC`,tPhr%hV Vhs%P C`,tPhs%hV CXtPhs%jW WVC\tPhs%jW WVST"t^:%ts>$VPh$s%P CH@}%r%CX,tS\tPh=s%hV VhCs%P x%r%hVs%P| _Xbs%r%hhs%PZ Y^ts%r%h|s%P8 XZs%r%hr%{Tuhr%PP ^_r%r%:13}%r%$tt1=161e[^_]UWVS 4*Pƅhs%>h"h $;蠆Phs%j$=4t"4XzSPhs%54l u6h艚4Yt Pht%y; XZjj3_Xh+t%WQ$4Y[1D)SP-B^ZmPdR= P,V* dRhtt%W#TPVAL$TH\@H1ɉD@9DtUh"ZEZURuh4PVSuhy%j¸$KEtVSע V1à E)ËE9thy%h3'h hy%\Ee[^_]UWVS EUϋMMjW$Y[tK1MU9t FRlSVPNƃtPEVAXZ]e[^_]0e[^_]USj$u.ZYtD1ۉ]XEPjhjjj EPS-U Vt;M rj$S뱋]UEPM UlXUEPM UXUWVS Ɖ1uP$kƅXPhYz%W- tPkY&z%t z%Phhz%kXZNz%tz%Ph 4 Vj&4W Hv|=q4uj{^1.Dž.Džjhh% kPj(Vu1h 4h.V #=.u3h.h^%ZZY#un%=.t#VWRhsz%h谉WS =q4uj膒XDžjhh%3jVj'U(=4+=4= 4hz%V- V h 4Vh%S* Vh4h4hz%jڈ$WShf%jVh%j讈V" WS踞 Y^DžVj)TXZS=4tZ=L4tQ= 4tHhz%Vd V h 4Vh%S* Vh4hL4hz%2;e[^_]USڸxtjS ZYuShz%jʇ ]US18tjSw ZYuShz%j芇 ]USSJ=tsg1EEPj%SEZYtt`Huȃul"h%hX t&j h%hYXKuhz%jTXZ1]Ã=@4uiU@4"K4{%<$4{%-4Q$ 4d%4r"(4]USE] tP:gYSjR{fXZ@4E]UWVS18Z1Dž@DžDDž<jjklCx4uFtWXF 9sklS9z4uB4@s XCEe[^_]UVSjhPju胩t)uu P @u0S%0Z1 SXe[^]UWS] 1Sh|duw t#S;S t%iSR3ZYt3@X1e[_]Uu hzd@u)UVSujhPjV詨t(ju jPV)STy 01e[^]Uu hedAuUU EHJ Ju BM+KQsPR` u&y ;tTOu )|tfa EfxNA t @fFFf9ߍe[^_]UWVS] u@(D=D4u jPD4XklhNA0 y841RPq1luƉ׋lAdP9QhslhPPlRWVh;~%Ep裨EXfC u>4ufC ;^Q8tWRPQL }E84u.XfC uVhD 0 tfC txPT41҉`dRPTPPHL|]d`SQX\lppX\uX\lt4PTd`SQX\tj2 t j3ZNXtj4uu赗Y_FhD8L`}Du/E t)E8u!@4uhM@4ZE}`thMXGFhD0 thMYG@PtэL)QWNht18RЃSZt49sL}uFEt8u:Spl\XLHhe~%Epߥ$f#`tEt8u#PEPp4PSRRpl\XLHh}~%Epw8e[^_]UWVSXu} ]=x4hLt4P%ZY9x4}x4hsLp4PZY9x4}x4hOLl4PZY9x4}x4h+Lh4PZY9x4}x4hLd4PZY9x4}x4jGK`4PtZY9x4}x4jHK\4PSZY9x4}x4jIKX4P2ZY9x4}x4jJKT4PZY9x4}x4h_KP4PZY9x4}x4h;KL4PZY9x4}x4hKH4PZY9x4}x41ҋ;Q$s+k UA(0JPsZY9x4U}x4Bʃx4F@ t_u {4 H KTOE#U;tEUt()|t h#5x4h~%v t85$441RPs$s HRP5l4S4C8u%uh u hI_hPR>Y[P5t45$441RPssىRP5p4.5$4C S$CS 41SQRP詉RP5h45x4h~%vP G<u1C( P/IP5d46<u!SH1BLPIP5`4U<uSH1BLPHP5\4lau'CHpX5P45x4h~%vY auCHp\5L4ρMCHP`u&hoHP5H45x4h~%vOEERh&jP. h5HURjPcà P5H45x4h~%v趠SFcfx5X45x4h~%v脠CH@Hth~%vkXZCH@Hth~%vSY_CH@Hth~%v;XZCH@Hth~%v#Y_CH@Hth~%v XZCH@H th~%vY_CH@H@th~%v۟XZCH@HE %FEe[^_]鳟LuCHP5T45x4h~%-+{jPMQKQWsPRdk B(0F}WP5x4h~%vH0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4WJ8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhI SPXZ1e[^]UWVSu jFHP}W jWWjjjjj IB.E܃,11ۉt}DW@uu@tA~Ht҈Uth#SZYUu GFH`L+/tG/jSFHPjSW0 FHHL1e[^_]UVS u vDh&j ]S蔔 j SSjjjjhH0SFDVHB`1e[^]UWVS jj%G[^8hLDC W=h9DCCW=h%DC C,W= E1҃t^tZ 5'tOE4F W=}Ou/UDEjh3}EZYUMB"t}$vuhCF W=X}$th %h`4'hh%Xjjjjh<hjj jjj%SjM+:ƃ4xu P/V ;See[^_]UWVSQE @4tt3t.t)=t" u E x8uu u\XZjj 襣^_x 1҉j45'UG >UBXYu؍{sheBhYBChLBC h?BǃMjjjjh7>hjjjjj SjM8ƃDxu P.V9S/1e[^_]UWVS] B({119tuklKI0΃@jj h#BJJbRPj!W2 jj h#CKJbRPj'P 8uth9AjPPV E@ tPAjPPVF #u h@Xp@0@'QWMQVRPpjjA)$4,jB@SPh $j -Py $4jC}@SPh $j :PW $40j-X@SPh $j GP2 jD<@h,@ YÃst4Z£p4Tٰ-LƄT 19~-@VhJ%jPh 4袏 j.?h 4P5p45t4GP:P-Ph%hh4T Dh%DXe[^_]UWVS] 4$DV跲Y_(V胵0(C<@8jPڟ@ x 189}gG+ u CP@@<2<9s SklLT<R+A<Q@+QP$@ 09ȉЋ(}fF돋<@} EhujjhAjjjAjjj8@h4E4URP*u5@4}j8H轞<_Zj 褚$^DPRH04EZ1ɉ(,~!klSLQA<Q@(,1@8048;HHD88`VpWRLV7uVP 9jj,(40EU+04RPjPPQ,PTEUjVP @V PRLk@8< 󥋽 x08x4@u}u} 40WVlz)׉(,8E@@PEp譝_Xs$Ep@f E@fx@CklPsiZYVCU<8kl4@0E@)Ћ@)P880PzCUk@l( 9s)klPVPz 180(󪋅<18@98tNH0N8HV@8 QPWRL B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhEhY@jj7jjjjF,ƃ4PVH"V-E)PB89B4<PZufLW WPF8PP8 WRPQLP $A u %hPV$ jS ZY}t1BtVShx%j0e[^]US] uZ] E]e UWVSRuƃ$AmY tLCNNjuuPu uh%jI0tES\uXE44e[^_]á4t68u1UPh%j/ u54 u14Z?UWVS=41ۅtwuV4ZYt ?6VVPh%j/ƃu9=4u4WtXe[^_]UWVS}u =4ue[^_]fj4joá4jWCP^ jVCPR 4 e[^_]á4uqUS44t(4SRPh%j.Ss΋4t4SCSsZ14]UuPhp$u u,UVSu uPڒSh%j,1e[^]Uuh@UuhUuhUuUuUu1=4UWVS È@4jjjjhWs8PRx  {thCPV製 hs%VsC XZCLt#hh%V[ Vw1ɉVVdVWh#?tPQC jQ t7@DžtG<6'tWZ맀tjVW| VWZYt{t1hs%Xe[^_]UVS19tklqFLu@u19t$klq~,t@9sklA[^]_[^]UWVS<Ɖ4t/)t&jh%h% DžjjPPjh0.au@tDu/u'@.Pj臅[_@t .h.j*4Php$h =.41h%h%UZY4t )uVo}_uǀtPPP So tҋNA4jjjjhVq8PSx 5..4`6'h %hS>Z WVSh%j_*(WsoYhC%jXZe[^_]UWVS|jPQ_Zx1ǍxPWY^xu t WmRZdhVW5Q =uWERXf}uйfu󤉃EfǃU1e[^_]UP2 XUShEdjjEP]Shj%) @t2hL$S莜ZYu 4h}%StZYu4]UE]|UWVS41ɉMԉM؉Mܡ4f(S$}ЅjjjPOÃu14jjHDjjPEЃt̡4}Љ$KS19};DH} DHEȃ=4uajj]Sjjh(.qy1ud4Zuh:.h%豩 ^_jjSPjh(.gq1ۉ]54Eā 19U~UVuZYËUBTtUكup4840h{%hEPEPEPuCxtuuuh{%h154EPEPEPuCC~4wL3Mhh CSEȉUjheRPAPusss sh%hX (hdMĉ 4h4j, 4u/EEԋEE؋EE܅t+EPEPEPu&APUԋPU؋@ Eܡ4$tuuuR4,jhPa4$tIytCf(u9PG[Ht'4$P41҉$Yh.hT ^X]9_~GL 4AEȾe1Puqqq qSh%h EX$뱍EPj-ZEZYD4D4se[^_]MUWVS54t/uwjPZ SithjXZe[^_]UVSE X(uNpƋ0VPsjh{Sà uhjjs ؍e[^]ðUE1Ҁ=4t]f]UE} t=4tA1]U Dh%茎h%j#EjjEPEPjh0.m$@t"EUu=th%j?#XZøøUWVS,]EE15454uCSEUCSEUURURSЃ tԡ4@EU 4;\`|.}t1hkjؒZYuEP@sKut9։}ȉ44 54 4EEЋEE̋E E11E܃}E,1}ԊEZuVhp$h`%dSbe[^_]UWS0]}ȹ 1E1EEE =4ujjS)@ jP4E܍EPjS@e[_]UWVSM 14f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuhn%j]UWVS4}=4PklUVE 0m`ZYE UlVSClP >11CC,C0CLCPCT 4$p( u1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC hf#VmO ZYS$S( t hV1 uE<=uV詌Ƅ<$SVh%hPJ 1jXu5WSh%4 tYWSh%PO 54sj<4tSh!%PXO 54HjShp$h\x%蘀 1e[^_]UWVS]u Cp}SYu 9F% :<%B4tWh^%PN 54iWhq%h%VS1e[^_]UWVS}u E03%E2E윃%1E4ÅujEPYX9uG@<5hRĉZuG@<KtG@;1e[^_]U1q4jC"Zt%61UWVS]u 1j "Yt5DžPj[XZuC@<=4uh%jYXh4h4h@41h@4h%hzh@4h%h%}~h'%hXtWhD%h< jhMőC@;XZ1e[^_]UEJ]U(EPE 4P1]UVSU E0pVSPhe%Ep7Pe[^]UVSu] hqj軇ZYt,hq%hoZYFu @8@V1e[^]UVSu] FPjFph%htF@V1e[^]Uhhq%h UWVS\]D1t=u41ɉ 4h5xjP!N gSbZX@.1ۃt"tu舀4d.)4tP[[_th%h4js Ph%h4jW4x.nthڄ%Rj) $}vWPh%Rj=4t$R$Rh0%W7J W<$ZYv .8..="FtPVZt F9F:Ch4h4h@4. 1@.Ct@t!1C F z~uʃ5P7vjjj5L7苑5L7\_5L7QjhKjjhhsj&jFjjjPjÃLPSS e[^_]UWVSQƉh^%)h"PI uA=4th^%Phn%54H h^%Phn%* /OuPh%Ph%耕 _XVh%S?H S c]th^%h!%Sj h^%Ph%Sjh^%_P:4ZYtuVh1%PG 54bujh"V貅 VXX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝu1ɉM] u]u]܉uu9u]{ u ;}}w1] 1ۉMԉ]M]x(Ã}t*M 1]1 uM ]M]U9uU9u {;u U| 9u܋U} U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á@4"UWVSXE؉UȉM]E EUE} }}$}}؋wu}9UM}։lj]19؋]| E1ۉ];EE}LuuWV:/ut4EUuuWV/);uE}u}]؋EUCSE܉U1ɉM̋EUEUE9ƉM ]9]E؋P@MAQEUEM])M]EE1҉UЋM9M+}EԀx EEԋ@1҉MM]]1Éً]1Ӊ]ˋM 9u]9ƉE9Ɖ]E9E܋Eu};EEEUuuWV-);uE}u}E9ƉM1EEO)]9؉ӋM}EUEЃEE9EE]|Eȉ0xUMPH EE̋EU׸;EEu}uuWV,);uEu}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UVSQMAQuRPRPjjjjO IuEU11ҍeY[^]UE]US]sh?%ji ]]}RUWVS]} j/W ZYƃth)PCDPW ƒuMV`~Dr9s6t'19ty u9t@e[^_]Uju EDPSUEvPEDPu ͜ UWVS]=H4u J)H4K$9C |b5H49s sW}jjjjRPRP t39r,1tu{(u t @9|1e[^_]UWVSU}119y u 9;] u}t uz(tt}h~t[nЃu"9uǂǂ1J Z$1ɉƀJ C@]tO%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS41ۃ< 8't,jS3FFXZw6'C "uʍe[^]Ã=4uUx4]øx4UWVS Uu}E EE9E saE11ۋMy u9t 9] tC9] r;@EM9|ۃ}tMa}w}uWrV 0}t.1HR}t PRh%PRh%WVs9 R}t PRhdw%PRhiw%ԍe[^_]US]uh%h7'hh%&smNX]]`NUWVSÃ=4un419t/@ "u @4D419tp4x(9uB1[^_]UWVSu =H4u %H4E1҉U19~\UE]FPv(,uutu Ex(u}t!C;H4GUfˉ}FFN(1tF$1Ft 8tjPkMP kMƄF uF }th{UXEEe[^_]UE>U U]UWVS]u=4u1҉U1ҋM9bx u 8D;U +}ߋE싃E苃E}t }u{(u1+FV C S$FFlN(1tF$1F,MPFtk9t jPR薖 F tV"}uM9MuǃǃFt$9thن%h6'hdh%ǁF t'uBK 9M sM 9rE1e[^_]US]=4u!w k 4"1;@4s k4D4C([]US]=4uS1w6'E[]UWVSSÉU=4uv!v=@4 D41k 4B9tp4;u(}u1BRQFZYtD4@4k44B@4V 1Sh&jRUq4 F hst~ SPh%jWQ4 F'F(UV,~0F((e[^_]UWVSPu]=4u1E1M9z u :;E  1}1ɉKC1C CkEt CCEC S(‰C$EPC,}u uK9Su;u tK }u0~(t*u!K @N 9M sM 9rE1Z[^_]U1ҋE ]USR] j EPu U:tt htX1 k]UWVS0]{Tuh%%h6'h{Xuh=%h6'hh%>~{\uhV%h6'h߃{`uhn%h6'hȃ{duh%h6'h뱋CjCDPVD u h%V  XZ{4uD1ttʋ5B.DNuT4@׀{4ujhf"C4PH ؊LD tB:u JN Ph%WJ h"Wl6 ƃiWh%jlPh͇%VlsXs\s`h%Vk,Psdh%VksTh%Vk19aW 4 8'PwP7Ph$%VqkG P u"OQPW RPh<%VDkH9~h!%h?#VkZYZhj%jkVOPPVhK%h[%jÃ(VXe[^_]UWVS@E PẺUЋE @EE @ EE @EE @EȋE p@ E1ɉMMMMUjjuujjjjE u}zhM]EUEԉU؋EP@9ȉ|YtTtOM܉]}ىΉ߃SQWV/)׉M܋]))EU؉EԋU؉E܉UU9UEU} EE܋EEE̋UЉEU9M̋E}M]ċEԋUڋM̋]M]9ȉ} +EUĉE܉U=H4u H4E1҉U19~W}]Exv(*uutu Ex(uthujjh0jjjAjjjRVhE4URP腵uV".}51Dž<Dž@;us<`RVSPL t$hl`d<@FjHO)4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DPU1]1EEPVJXZ}y1Q1҉Tu1Hùxt%| q1@ 4SG0|GEE;xrB;Us E11ۃ}t E;]sP7/C_P`YV5о4NXZ}e[^_]UWVS0EDž}uElL4jSZYt jSy^_uY13jSR_Zu[^ƅ1;L4P4} tE 9duE(u)tURYu0;$s{ЉuE, EDEHʋ9Ɖ}fjj h# WVjWhpƃ 3WVPh%Vy V Nj8ƅ3ܶPz Nj8XZЉ8@ Vw؉1=uRhnFjj h#EDUH,,RPjWE$hoRjPHViG$[GYMGL9  $}VP V$Gpf $V $SG[f V WFÃ9r$h%h8'hh%QuZ1hjjjjjjjjjPӫÃ4tPSi^X19s 419t4@Y؅ttWZ tS&Xe[^_]UWVSljfDžv/ƅujh%Y^yhh%SOd z躠t&豠8t觠WPh%hS hWS d =Džp!j/Sj _Zt.xv9tH9s8/tQ@k YyߍxPWWYZ%=pu[U>hQW} iƄ/u%谟QPh%hS $hQS c =@uWuj ZuhWPb =hS Y_1Ҁ;/u 1Ҁ{‰hSCp<$CZlhЃpDl=w4uhh%Sc =whWSb =v S?Vr= _y SVNYSVL= ZV5SX1e[^_]USÍEPSݿYZy1]EtjSXZxj `PS t SYS`Z=vf u]UWVSEUPE ^ƃ}t11ɉMVU\ Zt{fx vX jhU%SpC uSuh%EP @u h3#k 3Et}tESWuh%jcu{[zV 9 XEEe[^_]Ujh*Ijo UWVS h%411tY+ڸ%xuڸɉ%tu#WS(XZuWSY^1yahɉ%hPS_ WSo1u hω%蛜PShى%jdSh%j4:hShĉ%ShPP^_ WPu'h%SӛPPhى%jh%hPS _ ShD%jtPh%h%juh%S^hPW^ h%SAPWhى%je,h;%S%hPW^ h%SPWhى%j2,h%SPh-%jMhs%SϚPh-%j*h:%hPW ^ h;%S薚PWhى%j(h%ΚhPW] h%S\ythK%S= Ph-%j_ hJ%shPWx] hK%Sp14!.Ph%hW ttpWhى%jC utjh+bFXZte[^_]UEԾ4fP]USE@k 9't! 9'ShWE 0-Cؾ4 ]UWVS$h.ƍPhW@j-@1jh%_ZRhW@PY- 1ڹ 9'1!tT9u Dž0AVP?ZYu=Ծ4B G jjjjhjjjjjj!ShÃ4tj"PS觗SXe[^_]U辗ؾ4tPPRRRh%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ41RPSQyRPhL$j]S ]С$4Eԃ7x6P URjP91ɋu ;Nsklu ^c0AO0}u}u ]u]uutu9]}UEG0uW+EUu FV}t ]U]EUWE `1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A B}lj;'fG G5GG G, G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{~S(xE+C$PR蔖XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP3YZuk{8ueEC8EC4FV SVCt~8uklHCBVPDXHXXe[^_]US]5L7V5L7KYX{$ujCPC$XZC($h4jjhhYhRjFj jjPs$h@4yC(4ys$1҉S$Y1-C,SP]os(zs$C(1C$C,]UWVSuV[t$V"Yt&jPo: S uue[^_]}hjXZ1e[^_]UWVS4$)t uiVu`j(PjRƃu1O4jjHDjjPÃt͡4$3t j4PLSЉƃu11P;^ s-URSVPL tEuEt 8uPC΋4@u <@TXuuDHTX=4pjj h#,1ۉHL,ËHRPjXPhjj h#jhj^WJ8jj h#jh0jdS)pfH 0T4DP&$WXRHQDjP p H0SWXWHRP4Pjj'm(h%0lppltDžxDž|}1 EPt!EfEEEDžPf@ @ @f@@@ f@*@,PW=L4v~(u@0f@:@<BhujjjjjjjjjREPhuÃ4t#Pu@,|tPS6kS|v|Cwc 4LPdhTXlpF(t|lQdQP҃ fVYexM|AEAEA Q119~.u2FN<uF EuPEXZC΅juɋEtY_1}z 9u}Wڹ[fB EB h;jjujjj(jjjuSjsjƃ4uP`VXkSEEEe[^_]hj XZe[^_]UVSuE ]wi$`='hDs A[4hE2['1ɉ H4 H4S5!.QXZ1EPj QE^_xC$h*jЍsC,:sC--sC. sC/s C 01ɉ Ph#j]SŴ jSSjjjjWi0S ZVS XHe[^_]UWVS(É։5$441RPEp0訤RPh%jURK jEPURjjjjSh4E1EЃ8ju uWVUREP<Ã19}MˋEʋ}We[^_]UWVSUE fz iR$D>' jPPjjjjhcg 4,1P<1RPd 1҃x,‰P,11҃x0‰P04jPPjjjjheg ͍xT@TfxX@Xgtx\@\hg1҃x`‰P`땍xd@diLxh@hj?Plҁ~ @lbPlZ1҃xp‰PpI1ɉHH's hVVjjjjh=Vf { /t jVWZ Wh,o%jV V^| /uD 11ou4,1Ɂ S<1WV> 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph#jSw jSSjjjjWd0S ZS Xe[^_]UWVS(]}h#uVg @4XYu81ɉU?'M`PZYU9‹M}ƒ$uӃ@4} E $>'h4_ Wtjj__h5ku241RP 趟RPhL$jEPY h6&tjjI_Yh7u)tjj_ZPhp$jEP h8t"u h#jEPǮ h9t"u$h#jEP蒮 h:bt"u(h#jEP` h;0t"u,h#jEP. h<2^VP@4Ph~%sǶe[^_]UWVSX1ɉt @@D44t=$txuP1$Xytƃyjh%:_X= 4T4|uÐ Dž81T4ktƒ8C1;8 8/T0 RPh%hW 541҅t4҉uFWPnZYu Ɔyȅ4ƀy1LPTXƀ);T44ǀ,ǀ<jWP hW4"P =4u/41҉4h4aljY t^4tByu/49u4ы9u􋐀뺃:54'xk<ǹ1󫋅PB MsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB M$CsC C8RPL u;x ruكtЋQ__k<y׹󫋅PB MCsC C8ci1fD @9s=4t1>'󥍍P{_>'󥍝PًH^= 4t_Dž DžDžX41҉>'󥍅PًY=4t1?'󥍍PXX31B 8;T3B qJD4y @HfFe[^_]UU J E] = 42UWVS11ɉT4PYZNT418t=suB89J4ƅƅ{@1T4k8|<teD@Ph%jPvT4Ph%hvhh0%Ry hT4PR` F8yT4D(~&Ph8%hW٥ hWV T4D,~&Ph?%hW覥 hWV T4D0~&PhF%hWs hWV PT4؃PVhM%hru1Dž88T4kt1;8 8tuÃuTT4B1L4t5xt$h`3jY^tjjXZǃ=D4؍e[^_]U=(4tuh%jPR UVSuu1r$ugjjjVcyÃtjjHDjjFPt$4KS;DH} DHe[^]UEx8th#hX?'hm h%@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$谛$zuubPCsYtWWPZtNjE@ u WVX_XWPV tjVSnE@ t VPZYVXjjS;ƃxD4 e[^_]UWVSuXYƍ}Ĺ 1uVZt틞$S_xt,jjjSǃtSYt$SPHLPd 1Z} w#jM T?'RjP8x u0h#hd?'h h%\R9t(Ћ}1ۉ1E1ɉ [Eƀ*Poj PEP 1e[^_]UVS4]jhPjSY|uIjPjVSVru؋E ʉʋMQ؍e[^]øUWVSXẺUMEEE EM]E EE$E;EEE̋@8Ɖ}BEUuuSQM܉]hM܋]);ME} M]x 9؃}E̋P@ut 9}Ӌ}}}}1u9u| E1u}GWEĉU+G<EU1҉UEUEUE9؋u}9}E̋@,EE9EE}|EċUEU)ډEUEEЃ}EЋP0@,EԉU؋EЋuԋ}p4x8u܉}}E1lj}U1 9M܋EE9E9؋}E9EE2M܋];EE(M]uuSQM]QfM]);ME}M]E9؋u1EEYEԋU)ڋ}9֋}}EUEЋE9EEu|EXNjEUGW EEEUӸ;EE0M]uuSQM]eM]);MEM]Ee[^_]UVSQMAQuRPRPjjjj IuEU11ҍeY[^]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UM E@,1҅t9t Bx@t@]UWVS}u UG,1ۅt 9t C1J?1;W$sAk W(:u3Q<Ӄt#Q<H<ʃ9uʉP1t4Q,1t9E t @11tt:[]UVSQMp@19|hl%h`@'hh%F9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s8SrY;C K$}'ujjjjRPRP Ɖe[^]Ã=`4uUh:oXUS]=`4u1;`4s k<X4[]Ã=`4uU`4]á`4UWVSSÃ=`4ut=;t6`45X419t$USF P赭ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h%RoZYuj ju~C,S0h%VGY_uj ju}C4S8h%V_Zu0j(uY^ƅj)P_ZFh%VެZYuEh%V辬Y_u j(uh%V裬_Zuj`u@SO Oh%VY^u>h%#EPB XZt(`C'>ttVPLYZuG C<e[^_]USPQRh%EPj6~-h?#u"pEjh@'P5t2u}[1Ehf#EP3B XY:tjME+[h?#joEZYuuH}X]UWVS1jhPjEpiqÍPhd@S9 @SSY`EP,[1Dž Džƅ ƅ tpÃuMtGutЃ ) u DžuЃ A댋Ex@uP@4tPhؓ%P ƅEpPhߓ%j6\E@@Ep0Et(pv0v,h%j6V{1ɉH0X,H{09L;C,P{89T;C4 PCPSL ^_;s@\PV蓩ZY{tރuVtjYj jVm uj jVpmTuj jVOm u7thhʈ%P hVP  shrM$VZYuDG8PW<G4hM$VZYu)+hcM$V膛ZYu)j h@'V} thjhh^Xۋu0lY19ȋWl[j`RC@P蒷 C,S0C4S8 u+t)CQ RPuYZuƅu_, G 1%E u. G1ɉOOO_O _$UWG@jhRjP)XƋG,ÅtjP4tKRPPs0s,Vt'8t"P PXZ@8u ǃC4S8)G W$q1ɉSh|dV iR>bZuujYSh|dV誆 u܋1;s̋tpH,9H0u0;u"H49H8u;t밉jSP BrV7MZ1e[^_]U覝1=4t =(4]UWVSE8}fHfMfMfXf]f]X]߈]X ]P Uf@fEExstExlK1MjQk C'RU  U؍Muu ru Fu1MjQk C'RU U؍MuZu ruų uPEPEPEPEPEPEPSEPEPEPWhO$u uS 8 Fz밍e[^_]UWVSu] t>u1}ZEPEPEPEPEPEPEPEPEPEPEPh"P$V4 uAEyƒt ƒu&UUSCEC EC fEfC1J1VkC'UZYUu$C'}EECEfCGue[^_]UWVS@utcC'CPCPC PC PC PC PC PCPCPCP3hO$j@}WQ 8ssWփ @F'ue[^_]UWVSEUM܋}EEۋM );} GEE1EEƒ< ‹E䋀,uF;E9r+F9s,t }P;U u)9sE䋘0 }t%0tt13t]ƒt<tՋ,E39Et:ƒ}u9r&39s#P;U sxU9sډ)9sу@uEE}t(}tE8}tE܉1 )1[^_]USMU Zyu t tR9Qr[]UWVSHXH X$1ۉX p0uu]9]E}u1ɉMUtj}t}tуtat\@ uуt=t8v1]9]t UrH X$9} 1҉P P$ )H X$EE}u}0]Q[^_]ú=tUwB=tGwH w8RXs.'-v=uUWVSUM119}uP0uQjVRjGуtux`ڃuV]0]}tT1ɉ]Ut4u9}u*uu}7SjQWuPEЃuGAuFA1e[^_]UU 1tEMh]UEUUCU ]USMEX؃< uʄt E0‰[]UE1҉UU ]U EEEEEEEPXU EjUWVSÉЉʋuˀ{u,C { K?H} K.C { K?H} K KI1ۋ}_ik?19Ή[^_]UWVS u]}1u܉]EP+U Zu tXޕ%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EMȍEPEPEPUE_E @/EЙ]u)։]u]uEEMԍEPEPEPUE @Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋEԉMϋUeƉωؙMʋEE)׋EU t2 t,EPWVuu2EE}u u}tE}}4E؋EؙRPuu):EU4DH~1ERPWV9uuRP9EE]ÉUӉыUe9E1MȍEPEPEPEi @tKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9[YeY[^_]aUE]ÍL$qUWVSQ1A1҉U1҉EUF0E؉E1Ɋ t,}uÃt$<t ,}u9]t@u0Eu1M]ƒ< RWvWڋEy11AtE1ҍeY[^_]aUWVS,M$](u,}01EEEEEE1U9ЋU| E1E܋EE19M}M9Eyu1EEU ẺUЋEH9M}GE;E]UE0juQu@M]E@E1;EE }Vű}΃Mu uWVX5);uE M}uu)9s ])] 1҉U111*1҉19]]܃}MM 1yAQ Eù19Ee[^_]UVSEP$9p |$1jjjjSQSQjURP),1҉Ѝe[^]UVS]U M1k N( u4؄tfEB 19EtJ @u,1u.R E@M,9du 1dd[^]UEUUUUUUEUUURU UEUUE1҉UP0UURcU }UEUUEUUP0UURU LUE1]UVS]MU2U k V(u؄t=&ukE U1uQЃ<![^]UEUUE1҉UUURU UWVSÉ΃8t2$41jVR_ $Rh{dЀ3|ujhPjRE@ue[^_]UEP0RPfUWVS]E EC0E1xp@u4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@t 逌}WuS yуtu G{0Ea;hhZYohS*ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]t}ttR<tNwtw A,<vxP6W/=u7sE@,9uQVP3U &=t1skE P3- e[^_]UVSuE =d4uhd4X>y d4CFU,U9u d4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU PR 1]UVSUEu Nt+t6uXE@VvpSQFD.4t(vtvPS e[^]USR] =l4u0j EPu1 ƒ =w uE8tt hCX1kD 4$4u]U U1vEEUEPU E_ZÅt*UVS14OFZuS OXe[^]UWVSQu>xp19|hS%hF'hxh#%y]9|@89@|ue[^_]UWVS0uU=4]ډ@E =~Mȉ\1ɉ`}ډ1@8;FF| FP1RP|~ tlURjVPL tYEċUȉḾ1ۅuBu>dž9|Ӄ!!ut9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E }uthT%hF'hh#%膃hjlH^_`G'u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RPJ'@ǃEPu^_t!ẺEЉEԉEȉC1҉؍e[^_]US]=l4u]1Ҹ;l4s)=w9t kD`4B1=w kD 4[]Ã= 5u ^, 5UWVSƉ $41󫋅 EU RPVhF%h4P5 E jhPjV7xShydP)g @u VM.X1VB.jSuו e[^_]UWVSlu] E EE$EEPSV EPډXE8t%E8hk%h\F'h h#%1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}u }t#1A}tPh:%%uPu艔 "}tPh'%Phr%uu3 ؍e[^_]UWVSHÉ1jhPjS5J1Dž11҉1ɉډ1ۉ؉!!ׁuO1 RPh/=fU?XqWVS/9u)9u!V!ʍ4󥉅SGX99;ƒ<<„t <uh0101ff=Uuf=u#(,D1ɉKu1󫋽{w%RXuX tHtt7tqiEt,EPFPVC,1RP4P P~ 돋t6t%C,dDž $t tx9,sbthjo@^Zt31ۉ Dž1ɉ1҉Jx 'Xu&1󫋅fǀUe[^_]US0E }uthT%hF'hh#%zhj?XZE u8 CEUY~11ɉKKCSǃ?ǃjh>RP@ECǃ1҉oK0SUE Z@u SWCX1d3{ uUC$9K }DURjSPL t1Mt* 419t @D=u=u S뙉؋]UWVSUMtQ0t),0Ut,]))111҉XZ[^_]UWVS}UM] A<t <t11É1uvB? ڈ49'fDžU1 WV)Ӊ1!!ډuAWVhP$x30 14^uP$ƙ9uK9uCH!؍S#ƃS~<Y9k9_'X؍e[^_]UWVS]Euh–%hF'h .1uEE}lj1Ʌuh?%hF'hh#%rs{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{ 419tBDu3{u}s{ u}u}u}v}t 4M1;})ωxMH PC u h"kE UP XZ܍e[^_]UWVSE }Ĺ HUMx}}t}1҉H 41ۅuh֖%hF'hh#%)q9tCDuu}E%}}1uuuuE1} u}w2t tu'}\JM1ɉMr1u}}}E}u}0}}u}t7}u }|ڀtu(}E}u }E}9}}u1UMUMUM}9}}u P @|UEUEUE9E}}}pEbE`Mt:EUu9֋}|}9֋}}ً0‰EU,Ɖt1xtx}9ЋU99uE|{}EE,EujSUr }4u9P7u( 4XZm1hjN3E_Z EfǀUƀEEl1ɉpplxt?}9}u|H1+EUẺUЋ,E,EEujuUs }t'4}9ttP6u5 4XZE0qEHEUȃƉplRP)׉E9Ɖ}ME,uȋU)Ћu}ƃu}|U9E}}EU+EUẺUЋEEEUEĉUȍEujuUx }t'4u9ttP5u: 4^_E9uh0u_E,9EE}KhjC1ZYuEb 4}uu,fǀUƀ0Ë0}00UMыE`M]}v*}}u }t}iuM9ʹu}UUpx u}EEMEjR}wR‹E@vM1ҋu9Ћ}_EEE1}$tuVME]1uCu}ƃuuWV )׉u}9]EM} EUEUE1ҋM]M]9ȉ} +EUẺUЋE\EUEĉUȋE}EuuW< }t2EED4u9ttP3u }D4ZYEu0hYjjPP,1}?t;_u}E@Eu1EE1}EE1Vt_}9ti@уtuH}0t;1Ɋ_]ttt}t9}t#@AuՋ0U9u1e[^_]UWVSP]E EuEE}t:C,u)C0E1҉UĉUȉỦUЍMċUPX{,4}u1( 1}jjjj1RP1ҋ};}ERPjEPS,tE5EUEĉUȋEUẺUjuVSUEaUċMȋű}Ѓ uEYUċMȋű}Ѐ}u.h 7'sWVQRUMs7'C,UMtX(C,u 9}8SjWVQRs7'C,tPC,e[^_]UWVS}Ĺ uE0xE0EEH 419t@D=u€t E1ɉM1Mtكtu‹]9] uEE@uȃwE9t}h=E]1ECƃuuWV1 )9މ}u}1E1҉EtqE9E E˃tuSE`tF1EM t}tȃ<ttE9E tw̋E0h#jP]SN jPSSj S8 ƍ@[=wʡ4EHDEU}~ E1ɉMRWuu9SVRP(މؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]4480h{%h}WuVEPS$xuuuh{%hWVEPS>tuuuSЃS\e[^_]Ujj Eaj j P USbPCS$#PShi%h:.i j U=(".u (".H55fPftPZ9(".UWVEE왉U1E}ujEPj3v e^_]U0E E1EԉE؉E܉EEEPEPubƒ xEÍL$qUWVSQ@@u5jhd55ݔ X55d55(55,55P55T55XZjP覔 (55,55855<55+X55\55_X`559}9P55T55s7X55󥋅P55T551=D55uhjjE.t!jjjP =D55uihA#Pw 55Y[tPhp$hP x05545519߭y=&ݝ݅ =&߭ٽf f٭۝٭y1d~dVh$)P=PT Nj@55~- 55t POZ)Å~:ùdh#)Sh@I'Ph$)P=P ǃ119ʉst  @~4(J'SQh$)P=P +d55h55+ l55y @B=&ڽ߭ 855<5519ظw ȉ߭ >&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4(J'%Ƹd PSQh$)PP á05545519‹855<55)ލ 19‹݅99}h$VQ à +(55,55߭߭ٽf f٭۝٭?~~h$rtPh(#VQp ÃhȈ%VQ] à <ЙRPh$)PP$ Ãuh?#)PP à H55fPftSVPB eY[^_]aUS \j[X]UWVSPu ]Ett v9s[71;uuߋuE9s$;ut:GFFPhZ%jWK ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=B.DWtDOt uxu [1!tjjEPx  FCE덉뉉؍e[^_]UWVSujuwZYt&Vu P$W<9uZ7؍e[^_]UVSu hu(à @tuuSS؍e[^]U|EPu ZYtM EUQ1UWVSEE 0Vj S( DžuVjS( ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v UD&0Ep V<Yw{t)1 E@ȉC,ub Ex txj(Zu hL'3XYǃ,f@S(P1.1;,s$k(рyus1(D@1u e[^_]UWVSSƉM׋ttZ9t<{ t6 1ɅuufujuP< t[뷃 S VhS%2 e[^_]UVSËHt2L~tHHHZR1ɉL^Pt2T~tPHPZR1ɉT^`t2d~t`H`ZRj1dXt/tVfG,X11҉Yt/tV-G,X 1Xt/tVF,X 1Xht/ltVF,lYh 1hZe[^]UVSNjjjVnD@PjV%l8@t@4%1҅ut 4%1҅ut 8t48SVlXZe[^]US]E ftPhK'h%0 jP t(@t [IhK'/YE u1҉U E](ShjP#@uE K'E?%]i/]US]E ftPhK'h%W/ j|P  t@Hv|y H7`xv | xYZt>1҉ShGj"@u;E K'E?%].hK'.XE E]d']UVSĀptQPhhxVԟ@u hL'8.XV Sh~%- e[^]USË4%1҅uau]h%SXZ{PtS 1Ytk%1҅utSLt%Ju#PSXZ]UWVSÉ׸r#u2%+1u%PSzS_jSZCt PSXZe[^_]UWVSÉ֋8 Phɚ%,1ɺhXZu%VSSjjN%1ɉK 4%1҃uuj%XZe[^_]UWVSUM8ttY@@0tM~ tBEU  1ۅut1҉FXZ[^_]USËltu;RSlZYt&hvRpPaPh%+]Ãx tpUSË%1҅u:u6S]% Y u=uSnZ S.YuS\X]US]S͘Yuj$XZIpQpcvPh%+j#Shjdj#]UVS]E ftPhK'h%* |)RxPq uhK'*X;|t xD8t|xh:.DH 1tf :.yh:.j q Y^:.P:. Shj @uDE K'E?%e[^])jXZu Ee[^]y"e[^]UVSjhTh%ZYuhTh%h4#-)[^"VPLXZY@u Vh%)ZYS4Xe[^]UWVSMy t %1 EU}u%1҅ut6`u,QM3Y}Mtu1ۉ1@EU}u#%1҅uZ`LQ.X}t u 8 ى%1҅u1` 1e[^_]UWVSM48%`uu %t%ti utSYt %@utS6-Zt %`ut[1҅u%u! u@uM1ɉȍe[^_]US]'%P'jjVjjU4]UWVSQ]4Ɓ@1utg%@1҅u\uXt0t(VwZ%t4@K' Vh%&NvSq_%t4@K'h %%[^8th$%&j( Shj4Ɓ1uguc%@1҅utTS,1ɉMjEP,f@u hM'%Z,ǃ,Xe[^_]UVSuh##%48ӁYt:tt{ u h%SkYX[j+XZe[^] @48ue[^]-UWVSD]u Ctt,PCQPhj@EPt@uhL'$E_E{ VEPW3bƒuVWh;%:$ st#Ej@VCxP-L VWhM%?$UCxU3`UXYu"D@RWP_׍e[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3=_UM  {Mut';xu;0tQhe%n#11҉Y^{ tFEU   t3"Z@uhL'3#Xe[^_]UWV։ϋD@WVXZe^_]UWVSu%1҅ut V%ZuF Ph%z"Y[Ӂ u% 1҅VGEj EPju^ ]PSh%"M1҉-1;,sYk(jQMu蚨 Mt5j EPjQPMAPuh%! MQC럋 V4Z@uF Phɛ%![X ~ u#V3%1YutVdX~ tV#[ӁtK~ uEӁEuEuEuV蝢ZY@uF Ph؛% !Y[t ~ uV<Ztue[^_]We[^_]UWVS(]} uS#ES|Ẻ{Ls$S# { }u }s uJS0Yt?Vh% S SdSj3poE %]e[^_]@Vh%h%S*11҉fs$t jjSa" S.#Z@uJ98t hL'X1}E A]e[^_]"}{ tC uPh&%PhG%(Y^{PtRStCQEЍ}ԉƉщUS&CtZU9uPEPu该 t{ t11҉s{ t411ɉh#SSFS8]e[^_]e[^_]US]C Pt$ZYts$sLP ]] UWVS];1{Ly)tC$tjjS 14%1҅ututEC$u?tSp!Y@u hxL'ZjjAS @u hxL'X]e[^_]US]][].UWVS׉΋;M EU K 9}!E4UQMi(YZMUtBu }{ t~EUh\%SYjjMtuuSD tSޟZSOSX+9t'C jjMS [e[^_]UWVSP] 48%@1҅utjZE1t6HjEP, @h$L'h5%!_tm@h%h%hx%@t+XRDLtzhh%hq%hx%I Ehh%h%hx%& 1Eh%h%hx% 1u1h%h%hx%t C[h%hȜ%hx%<@uuhМ%Yhjjj| TPh؜%Ep55u>p554%1҅uu u_p55XZe[^_]USS]E uPhK'h%R jEP, uhK'jYuZ8t$hK'h %j,,ǃ, _w$jPhK'h'%ju6M8tu hM%YuESQXZ]US]E U{ u)C щ‰{ t][]t[]UWVS ]]} utSEtXZu V2w{ tC Phb%Ky%p^_CStP }tQSS[1pEPjEPu] Euh`L'WYASuMXZu1~ WEt YXt3{ tC Ph%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh%$11ɉddY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu^ ؍e[^_]UWVS]DžPPhhs @uhLL'h%1XZh%Y^1hP]F1׃ u Vh%AXZu/87t/8 tt Vh%^_\XPSǃuhLL'[ttlHp VWZYu VjS ϋFVt=PVF PtZYt%VhRjj 7u7W1FtPV2VP~ t11ɉ#VhEWtSPtSttPSP e[^_]US]E ftPhL'h% S虡Z@uDC.87u ]]-.8 t#.8Vt.8tEL']]UWVSD]} uMMtFMPVZYt3Mv/-7S UE 8L'EfE#e[^_]EC(f9t { tQPC Ph%f{(K>:Mu#M}tyEPVC*PN Mt_{ tEj<}WQC*P9K PQMhB%Yjt S*ȉe[^_]UWVS0EEE EȋEEԋEEЋh|%S_ZuEE %+h%SY^u,Eȋ@0SZ@E] EȉEe[^_]uh%S^_E܅h%SY[u EȃHg1E9}E4mZ\FSX}1ҋE9}?EЋ UQM6Ɖ$MQu9 K)Eƍ@E UB 뺋E@Wh%W1p3.E 1E111E܉EEPhP'h˞%uu1ttktA(NtR4tU6uE뾃UuM@밃ptxtn 뙃M듁M늁M끾wEkp3.E%@1҅uE䁈4@EԉE1}11uE䋀t0tR~ tGߍV }9}~E4RUZYGUu9]uuVj-v EvjEPEp O uoE䋀t0tL~ t-ߍV E4RU\ZYGUt}9}9]tvuVuu @uE䁠41E䁠4E@t)E܋Uu9]u)}u#U܋MEtNf}fC(ffGfJuj@ ȋuFZK>s*S>+Ee[^_]UWVSu} lhy%hPV@à t1=whlhy%hh% <&8thy%hp$_ XZh}h[u hdM'> huPY1l>uZG Ph% tXZt{>u[C Phʦ% _Xhh% YhuPWhQhnRPhnRX =nwHƄn ƄoPRhhy%V舆@u-hdM'h%, XZhtjWhà ppe[^_]át55tUt55Pt55Ux55]UE@]UWVS]u }uh3%hM'hG}t}uho%hM'hHhA%tu $:t 9ptUC tHtJKHjYYu<tBCXCpf@up MH1҉PfxCM1e[^_]UEM uh3%hM'hhA%u 2$t 9Jt$BH@MUWVSM Ep}y1yy9s)}_+Yyutʚ;1Ƀ}t}[^_]UWVS$Ǎ]SjIx EPGPSfEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uh3%hM'huh%hM'hhA%Z}ʚ;vh%hM'h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;v![^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuh3%hM'h|hA%B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuh3%hM'hhA%'U PH@LUEuh3%hM'hhA%@L11UEuh3%hM'hhA%U P0UP4UP8UP<1UWVS(]}1E&E@uh3%h|M'hYhA%j1҉ỦUЉUԉU1;s4s,C0 I>v  DFu EPj @u11EEEE1;s4sjEPC040 @tF1e[^_]USjPj[ZtÍ@Pjs ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tP>E t9VuFt9t,NtJKNt PKXV^Xs@Q1s@sDCMYC t6HtJKHP!ڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]UWVS ]uCh3%hpM'hhA%2t55t,t55Ht55x55C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t&zLu1t]UWVS\u~>u Vv7EEEE1]Mu_ EMQUE UJHOuԊEEjPS蝹PF Ph%F>PSVD}(u V*N>׉e[^_]USEtS,jSV[ ]UE t E] ]USEtSSG[XZ]UVSEu Ʋ9t t !ʉ11@u1[^]UWVS}] ?jWS" s jWV" wmj:V ZYDžt?EPjhjjj jGP C8 }t6UC8jVCP0" B. DJu <:tFu}Wjhjjj EPV} C0E t/it.u#Wjhjjj j@PJ C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPZYt[u{ 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjjURWPVsu ju(C*WtE84%@1 u/t%SrZ@uh_%SO qSnC@SCvfCDCCHSu @t CPCHC pSuCL1s@CX_Xƅ2e[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[ ؃4[^_] UWVSƋ tC1ۅu)u%O Ƅ  1ۅut1ۅutӃuӃ u %1ۅuu[^_]UWVSljQL} Zuh8P'RÉEh%#EPz ZYtfP} Xuh8P'S[_LUj@PV? Uuh8P'SsURj q7SQXe[^_]UWVSljӅt΀9u113j/Q( ZY…tH@EEPjj jjj ju }t uhk%-t SPZYuUUWV ZYUuVh|%0ZYtB/1t7!Xe[^_]UWVSÉUQ YE>"ux"MFGVj趬XZt7t9}s7VS耬ZY1}u>t tCEM9tHM9MsuN\?~Vnt>0bt!# tt:xtBrt#   C  E B.MNMߋUDJt!U߈U~MDyu~~U}EjjEPe$  tE1ҊM΃0wGMLBu}t?jjEP#$ t.S=~ttCEE}u$@t9E,1}XFe[^_]Åu À t t @ u1Ått u@ t1UVSQÉ֍EPjjjjjjR }uȉjDZ~~1CtCHuCЍe[^]UWVSE։M؋ERx EYuh@P'j=ui _ZEu Vh@P'h%u1?E}uh [E܋EE1CEE8j=W ZY)9EuuuWk uʃ}t'V#x ^tOWE[uXuFW É4$ EBU$W.ZYUMuh@P'u[} DED1u3Vw _XjCPu\: uh@P'yVY[41҉TMe[^_]UWVS]s {X1;s s WF,Xs1s s{$X1;s(s WF,Ys$1C(C$Ze[^_]UWVS,ljU؋E1=b$$ N'E*@1$} $t uh%$;@".tPXjM 11rXu 1#u1ۉhLP'6Y#VQZtjM !^@t;thTh%S ZYw#So1ۉ^c#@PYO#} 1# U -#} u#jM ZuhLP'hۨ%t.u h%u%" "} t% jM _u h%1 a"} C"H"<;"u t <P[^""} !h#u M ZYudž!EPjjjjjju  }!u h%!} !EPjhjjjju 0 F }v!u h2%]!} K!8M!jhN%u u/E܋HL@ư`ijhR%u u/E܋PTư$E܋@DFNPpMju PWSuRUSu=ju MQWSu܋URSuju VWSu܋URSD u hY%+ }  8 jhN%u u2E܋HL E؍`ojhR%u Y u2E܋PTE؍'E܋@DNF0E؍FpMju PWSuRU~Rju MQWSu܋UR\Rju uWSu M 1'1} tjE 8tbj/P Y[Džt@j/P _ZDžtM @t/O1!t1ۉ/ } EPjjjjjju ; }u hl% )jM EYu h%  T } luh%} Uj,u t _ZDžtxu u h%89E u=E H j[u h|P#Q 1ۅut%Ɔ EPjhjjjju X , }t hЩ%ZO )ǍEPQM訪 ZYHMu-\ 7: U艔) jY  T } E <4t E x4u  E 86tx6u @E @E 묃} zEPjjjjjju  }cu h%} 8=LHM *L} j,u  _Zt u . P $Uj[Uu h %RPY 1ɉW藼}}} u Ƈhkh%u ZYu ƇhLh.%u [^u Ƈh-h$u u ZYu Ƈhu jy[^Pl裸ZYuhLP'iXlu P>p^_} u Ɔ 1hx"#u Y[u Ɔ |h&u _Zu Ɔ  ]h2%u Y[th7%u _Zu Ɔ +u h?%} t% jM n[u hV%1   ~o} Q8SjhN%u u/E܋HL ư@ijhR%u u/E܋PTư$E܋@DFN0PMju PWSuRUJ?ju MQWSu܋URJj} <8>jhN%u u8E؋HE܋L @ư`xjhR%u v u8E؋PE܋Tư*E؋@E܋DNF0^PpMju PWuuRUIju MQWuu؋URlIju SWuu؋URKIju VWuu؋U} j=u ZYu h_% @Ej hz%u S ud}u11҃uM6Sj h%u u}u<1ۉ$jh%u u0}u 1ɉM1jh%u d tFjh%u N t0jh%u 8 tjh%u " }u(jP%U XZTEÅu hª% @E؋M܍UE@u WM1ҍE@t WY#X3EPRU1EPU܍BP1EPU܍B8P1WURP)%$1ɋU jhܪ%u  }u(jP$U ^_MM1ҍE@yW"[h1ɉMEPRU!1EPU܍BP1EPU܍B8P1WURPY$$1ɋU 9jh%u K tjh%u 5 uB}EPjjjjDjju贺 }duh%Kj h%u }uߋE j/u+ _ZDžtGSuj< HuNt>EPjhjjjjW }u Guh%ƆtGuh1%!11Ƀ}U jUEM j/u _ ZYuEjPm& PJM JM UEM j/u ۳ [_uEj P%  J M J M b} DITPM 6T*߃  % Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ2Ɓ&E DžtGEM 1?j@P 1$  JM E } u} 8jhN%u  uHLHjhR%u uPT@Dju ƐVWQRP7A 8u hF% }  $ɯu #` $ZY hLP'm}  4%1҅utu h%9FU m@u u ho%N K < - ! @   uh%F EEӋ4%1҅utu} t h%\ڀE Lt @Z} t6j/u w [_DžtGEU N@uu hȫ%/ 1,E؊EE19MtIk(P} u*t,]f9Xu#U8uU8PuU8Pu U8P AjE@P( ! (,P,k4EfF} FEt'EEFEFEFF}t uF1~FH j/WU ZYÅtCuWjf HtWh1%1~_X f~ EPjjxjjjjSF } Sh%QF[^  }    @EԍD1HEԍL PEԍTXEԍ\E؋E1҉E1ɉ} u^ }t EX]ԃ E؃}  h٫%}  EX$]ԍX(]؅uh%}tlE ƅu u h% EPjjjjjju ˱ }t u h/%j FVE tMh@%1E̋E ƅtFj:u L [_t8URjhjjjj@PQEЃ 1ɉM܃}t)hO%j=u  [_E1҉UЅt@Eh $u ZYu'E uhh%qp3h%u [_1ulE Itčph%u 诮ZYu. 5E uh%qphO$u nY[u&E uh%뽍ph$"u 5[Zu&E uh%넍ph%u ZYu πsh%u ޭY[u @Uh#u [Zu Qhе%u 袭ZYu hO!#u 脭Y[t1h%u q[Zu hi%u SZYuhp%u 8Y[uhv%u [Zuh~%u ZYu|h%u Y[u ah%u ̬[Zu@Fh:#u 豬ZYu (hõ%u 蓬Y[u $h%u u[Zu h %u WZYu @h%u 9Y[u @hȵ%u [Zu hb%u ZYuwh%u Y[u\hյ%u ǫ[Zu[h޵%u 謫ZYu@hE#u 葫Y[ t u hά%}tu h߬%uXZ1E s!t@uh%NXs"}uh%1[uu h2%urBsthR$SZYtSV Xu 1E؋Eȋ]ԋ }t&1ҋE9tE9S{IB,j,E@PQr uhLP'V]ԉ]؋J k,1CC C$C(Ẻ{EЉCs }t"u" _S׋u܉)1S׋E}t5E-}t }pEfE\} >hS% `<"- } u 聀^udu hm%@d} E aDžt @kh%u Y[M܉]t&h%u [Zth+f%u ZYu E܋U  E܋U%h%u Z Y[uGu h%Åt @Í0PWj Ht h%|hA0&S _Zthĭ%S ZY@yj[B 3}  jM _u hέ%> @} EPjjjjjju  }u hխ%} tyEPjjjjjju 貨 }tfu h%P} tBEPjjjjjju { }t/u h%WPT[uh %ZY@1 S Xe[^_]UWVSEu} EEEE1ۉE싀P'tM܉UVP ZYUMtCnuFE샸P'uu u E##EEEEE} P'EEe[^_]E8uu EY%e[^_]e[^_]UWVS }]u1p3.} t[%`EUh% jjSǃ t:jWSƃ }tG9Et G99EuWS1W* e[^_]US]t"jjS tu S@T06 ]US] UHSuZY9tSI X1ۉ؋]UE PTuh%hW'hh% 2PuUWVSSljӉMBTx t41҅utSWYXu'S$ZtCP^1t<CT9FTuwFt ;CtulSVZYu_FttCttC8PF8PZYt>CPFPZYu+֋CT@$uFx9Cxu$%%}u5/&ٸt[Ftr0tCtt&SjK6XYBuc 8t h,%>XVj%6ZY@u 8t h;%XSj6ZY@t 8thJ%X1tEVWV Ee[^_]UWVSP}tDjjSƃ t)jVSE 9~TuVSvVo uӍe[^_]UVS E uh,&hxW'hPTuh%hxW'hh%q 2uhY%hxW'h߃}uFƈPVXZt1SVuhq%j uV!x ى1Se[^]UWVS8uhW']ShX'EPhX'}Wu WV8$thlW'h%w_X14SV萞ZYujEPjEPe[^_]SVRZYt1xjjS~à jSEPeECT x t8jSYtC8PsT!<_Z@u h%豯YS;U t2C9t ;E !SEP_Z CTESPNjC|ZYtwG|tEuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWuW /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh&hHX'h{uh%hHX'h|hIJ%謽 Fu#<u;FuFPh5$WSq @u612WSPFDPgÃVWSPFP" Ã؍e[^_]UWVS}] uh%h@X'huh%h@X'hhIJ% GS8t)R78s<t<t1&vvRS Q/ e[^_]UWVS(uuh%hdX'hFE<t<FVU1QF1 G!)JO9txW dB@t8tM9r1=8}1ɿ}tAut]@}9s8 /`1ۀ=55uU}ع1E׈E55S}W<WV-th%hdX'h'hIJ%J 551ۉ؍e[^_]UVS]C<t<td /g S'؉U Y=55t1555S>Z;E th'%hTX'hnhIJ%贺 55Ǎe[^]UEU uh%h4X'huhX&h4X'hhIJ%i fPUWVEu uh%h(X'huhX&h(X'hhIJ% fe^_]US`Y'tPhA%8o XZ]UWVSD1}]S[Z@j0S\1uuuu}WS\1;5 M's/$M'H>v ɿ  DF1;5M's/M'H>v 萿  DFWSM\i 1҉u uSjE0EP}ƃ SD[YEt 6 0e[^_]UVSuEPu V uVjV ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWhI%Vu 1Íe[^_]UWVSU} u19s$@u9s8uhO%hY'hC؀xth%hY'hhc% u1W9s*jCPU~ tًUGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`P{XZ `S~U X4%@1҅ut _t^Fh#Yu%Phij%S @?1 Ph̳%S @uWhس%S @ydhlhӳ%W3 YZu@ltDžplxDjVYZuGDžph%W YZWҫ Z|6h%W軭 ZYuDžph%W蛭 ZYh#W膭 ZYh%Wq ZYh%W\ ZYyh"WG ZYdhy%W2 ZYOh%W ZYpDžp Džp_t@F Ph%SU @p,Y'tPh%S. @7@t pOdTX%u#Qh%S @hVL&t $JuD%Ph!%S @9vHh.%S @!FPPh:%Sr @v$hH%SZ @V舨PhS%S>@~Pt?vtFQPhhtRE@ttRh\%S @~xuF4%@1҅ 1hW'tPtXY#FxPhf%S @u(z u RuARPXQTtP@ZYT9Pthq%Sk ZY@jjtPƒ ttqTjjP T9u-BTT Php$Sk @T`jR뛉Thʈ%hp$Slk @Tu4jPSj1P @h%W ZYu>dTX1҅u%#hӳ%W詩 ZYh%W蔩 ZYh#W ZYh"Wj ZYh%WU ZYth%WD Y_twpuhehxOpu VZ;pul/lxDpjV}Y_#%#Ph%S @Wh%S @VvtZ%u6u_%u*Ph%S @umt:u%u @t>(W&tY%uPh%S @u'h%S}_Z@pu^hh@hq PVh%ST@d%O@ugpll@LlqPPVh%SY#@\puPhtfh@tYhqPVh%SS@d%pu,Vh%S蚭 @1d u{puDt׃8tVYtËlpHpDVh%S}"럃ptpuVS_ZPhp$S @tXd 0uSa SY^u hY'/Z#_tFP`P u,hY'X_Džp.؍e[^_]UVSË2\tPSKd e[^]UWVSQ} utu@GL%t #Ht"}tE1@ۅt 1ۃu4t&xt HHt}tEP@uCWZt!CE}t%EE@t]jWb[^t WYuu"Ep}t%Eƃuًt 8u1W Zt^}t8EÃuˉ؍e[^_]UVS]u tPހ~t9豲 :jhƴ%S8 uS!h S \ZY9rh:. X1e[^]UWVSEE} u |UGƃuhX'蝘Y[jh˴%W誢 uu Ee[^_]E1҉UWPE Phд%ԗEPƃuuhX'hfE# jEPVd @u q 8thX'hs#ܗ1ɉM^_EuƒutSP ZY} -];уM I+ѻ}h%#EP2 ZY;tjhR%S衛 ujhN%S芛 uu1;}1u1;} uJum輪 [EPjjjjjjSs }tG,9uSv ՛ ZYEPjjjjjjSs }u9G,nFu2m% d!umX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9 1E؉EErE,@x  VuQ9uu "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms 茨 7뎉ߋM_.MIE)M܋E9,}vN M}}t ;]tC }uUUt;]tC } t}E[^_]UWVSu EEE}1ۋE9EeEEHes2Y'Y'Gesy4EuyB.DBtes B.DB@tG E\t-x)B.DBte/t M M\u/t#w٦ 7f\\t0v\0G0G0OttNGCt*tesUEu EZY[^_]UWVSÉ׉U7(ƍPS֔YZ@Whp$SX @}uSj=Q= _Z@u$p hG#SMX @u@ s=Vu hV wXPj sVu Sn> Y s Vu Ss=ҁ u V( t.Vu PhV@Vhp$Sshs>$SZYsC1D0t<0u FuM  )sSP; Y_@u|u } 9K;} u@tPh&Sj ; ^Z@u3tPh#SV @G루tffPh&t&ffPh#SxV @c t Ph&@tPh#SBV t%7<Php$S&V @sWj.VWjt tcVhp$SU @tQ?tGuUWVC*PL U[҃VSo_Zu VSo[^tRXZR軏YtPtˉrVSA_Zu VS貎ZYtX՛ /1 ƛ ؍e[^_]UWVS,E̋A tӉ΀ytu莛 x1}ԍVx}W}ԉ}Z@$1FCt}ЉF tCUfCF t&EȀxu xtK|@Ft C8UF t CXUF0CxFftPEt虈_ZF tU tUȋECTt14~t 蘚 hp%EtCTZYuՃe[^_]UWVS8XCtP>YS_[1ZtEe[^]B[e[^]UWVSUu ]8Z>t F1Dž@jB UPPfDž ˉhPhiUpv UJ>r*hPhipv ,؍e[^_]UVS1ƅ@ CtDžC8P.^CP~ƋƒYu9Zu)CT@fCXP_u tt uC| t Cxt(1ɉ,uCTƅƅfDž1󫋅@p׉މ;tHH t2fDž f󥃅 ZupV耆XZtHHt'CstHHt0fDž f󥃅  t'CXsXtHH)fPR,6 @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP4Y@OHuWTY1CPW+QXZ$jjVSjLPX@uA 8 넋H؉@D@9DDx9@s DD9@r׉F u]dEuGuXu hhc'wX?$RuhnPmpPC(PSZ뼋F1,1t zuB01$t$uG4h1 jSV貖fDžx,|Vhi@(g @u6\ 8tR 81th`c'hJ%nY^<< 4R0R,RSjP(e$4󥍽hr󥃽$t$j4PSƃ u6薇 8t茇 81th`c'h[%mXZ31 "4u5uSU ^_u1C YuCtP**ZSFX1ۉ؍e[^_]UWVS(]c{u'ss s(@ S1sSC ЉEԍENjuEEEE؋E܋uЃ9CrHuԋEƋM9MsMM̉MV3ZY{MԅUЉu}ԋEԉC} E܋}؍D8CC;Cr 1CCK%Ѝe[^_]UEEE EEPhgBua UWVS`fy(u}d' d'Xҍ4uVc'DžLDžPDžPhBSZY}艇} u E苀MNjuu؉uUU} t] u3tMNjuE苀E}u ~ Ee[^_]USSӉʍMQM QMZYt }u1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]USSӉʍMQM QMZYt}uȉ1҉Ћ]USS\t rXs\1C\ ]USS`t RXs`w#C` ]US]$S<>XZ]]E@UWVSRË1utOC><vGD&BTtt_9t;t1zT9yTu)1uuU U밋@븀{>v P Sh%b e[^_]UWVSÉ։h,j:ZYt:PǀcScufǀ,1e[^_]UWVS@ÉRiY@u Ph%aXZ.Gw*hH Ph%%a th, Pj9_Xt@dtVWv<u?(9x u1Wt cScuGhu @G @(GH>A<wOw*󤋅% 1҅ut&x utmtdf@ tStJSjjPSU9Ѻrf‹fP@TȋG,D8ǀcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃf@6Vt4L7Pu"uJƃv9nC,m@1ɉ;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃qf9 ffC tHGY u<)9(CM A 󤋽 \ tC)9C= A󤋽 \wr sb@WuM tB)9iC< A 󤋵 \ttWH4%1҅u/u+@t@Zu)؃fPhPIƃ tjt jVC_ZP)9}QC t  CfCtKSVY^>t/t+V,b Z@)9  CKttdt[%1҅ut)@^u)؃ftC t@)9rhC A 󤋽 \S)‰)=+wD@1,w,)Ѝ4? Phh%+X4 hAe[^_]UVS~\jhPF\ uF.q 8u!5l&.h%WY[ She'hfE#tW 1ShbjpK@uhe'h?%?WXZ1e[^]UWVSMuh%hde'hh%Ej Ӌ}S OuO 0u싐1utXt Ctw qjSPC u3BC C^PP S@BSjuME"ZY@u 3~BCXSjuME^_@u C CS j3uMEZYtC Sj:uME^_t1ɉKSj;uME_Zt1sSj6uMEZYt1Ce[^_]UWVSu/h4j-ËXZ1C`CH%1CPsijhV%1҃utV0s^_ p11 % 1Y t/@P( ^ A %1҅u1utfpFPg( Y?V @ QP lpS@>p@P' Z W(P O>w*󤋅Ɓ1uTuP%1҅ut3 t)hRR@PP Phɸ%>@>u1DhRP*PP Ph߸%Rhd'RXe[^_]UWVS$Ɖ1iu1h%7RfN:.Xfth$SPeà 1GiPV Rh %Qh$SP6~Ãuk 8t8iW VhfE#,R!w hd' Vh %R 1d4@1u$u j5SWY^@uƅS%Zu hd'QX랍lj󤋅e[^_]UWVSS]Sj8_Zt,]t#8tCP%Zulj1e[^_]UWVS$ϋEE Eh8%R[ ZYu}WƅPY $$Xۋuhe'PYuQVhRSV-<@t-P膭PC XZuEe'e[^_]=P1ۍj6j4@uƅx,w #j@,Ph@hW0u躬WPh#裬WPh#SVhM%[N$v#t'%u)OPWVh`% N(&PWSVh=%M ]e[^_][+UWVS] e'tPh#7 XZE1E;s31;Et k, 9t@v 6hm% PV|G,1;uts 3hm% PSVF,܍e[^_]UWVSEvpE E] P1}tEu(SPhα%u @tBE^PPh%u @t E9sT;] us< v!0g Juj ZY@u؍CT9Ubf "ujh ZY@te[^_]UWVSuE ]xKt t4SWhS"@u{Shp$VO Xtif S7Php$V @tuuVj ZYVj ZY@u@uf 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hHMЋ@E؋E E@_tE@oE'EPjyMЋU؋E X^XtE#,EPhMЋU؋E .Y[Eu%E4u1҉UMUu X1E1tENjM U)уȉEU~@uCtEPS萣EPCP胣EPC8PvSu  EE9w< v 1d #ЍzD9E7 d "E@Tt 1ɉMEPj!MЋU؋E XZt؋]u1E9EFEtu ƔXu EEU9t M;At;A u1EEIʸy,%=t%=t 1tȉE@uGtEPW'EPGPEPG8P Wu趕 ]E@PEPjMЋU؋E Y^E41҉UU9u 譓XEEPW胡EPGPvEPG8PiWu ]뤋EԋE؉U%1҅u7u3E @hu$űE Phy% HEԁ Ee[^_]UWVS$]ƅj4uM^_@uƅExux uExl!WPu h%u7@u1juMqZY@t+W3ƉP軤Pu h%uڡ@tV)3Pu h%u贡@yjuMZY@t,E#pVTPu hҹ%us@ 3 P"Pu h%uA@ut Ex,u@GhElPhhV4Vu h%u$@ut 1;j@E,Ph@hVVu h%u蟠$@uc;s WF,X鋃@1;Ds WF,Xh1;ls WʿF,X鋀13;⋍T9Pu{@D19t ;t_B,RPMUXZt&}fE fEm}mEЉF8D9r@E1Em >&}fE fEm}mEЉF8PG Ph%k@ V4F0u0E1Em =&}fE fEm}mEЉF4E9V8s@E1Em =&}fE fEm}mEЉF4PG Ph%? ^0>u-Vdt&F$;BuFhuPSPG Ph-%^?v$SPG Ph-%p?E苐84EЉU%1҅ut*FHӳ%hӳ%W蕦jEY8~HuJFt.Fhu(VJ9Hu~<t>t FH%FHJ%>u FHQ%FHX%~0uF8F4eWhyv4jE6Whv8jE6(Whv0jE6v8v4G Ph^%+>$~@u\EEЉU%1҅uY[^hEtGW4ZueE苐84EUt]h$%=jE6 >vHW7juW#*tFdFhӉe[^_]g__e[^_]g_UWVS EEE EEt uujjE5ZEE싀ƃ1ut{%1҅upul ! CiPE0wu@ t@{t:{<t4s$PE Ph%_EHTϻ%ue'rt E:tQVC Phջ%:1uEPLt @v@}GLih膟 ES2>ZYEE1}m5>&EHTϻ%ue'zt E:tVV$QWC Ph%=:MElE@eEEE@ht 1ɉMExdtj$PS& tڋE@$Et͋E@4%1҅uu hD&SY^Sjj01҉UuX}tSuuj@0e[^_]g_U E]UWVS ]ESjj0Ghu/E$t#tShPj/E1u}}{ u}tEfPWhX%6!ϻ%u}%QWh%6 ]e[^_]UVSuF Ph%6s b1C CCL ue[^]UcE]UVS]tVwLShyj.v$薓PC Ph%5 1FL]e[^]낍e[^]UE]=UWVS]{ Wh׼%5F0+F8PWh%5ShcjA.1F @tEi@Eu Ph%0EPjKE1pLp d E1x xE܋ƃ1 utEe[^_]Ɓ1EP E}GG @EjEPuUJ cSc}܋]ԉu؉t t@tQDcScXEp$pEE@@[xYE@ cSctP@ E1p p_!E܋EԉU؁E@ uEEe[^_]cScuE܋% 1҅u΅uʋE;E1{L%1҅ut%u 1^uE Ph%-ZYE䋀ƃ1%1҅ut/s$ъPE Ph%U-EEe[^_]E䃸C cScs$wPE Ph/%,E1C<wPh*PBP* uhx  XTTu ~P1ҋPX#\ًP9 tW9r7\Ph Ph%s TX#\PˋP9 / 9r̍oj5`hUZY@u ƅoATX\th Ph%(Y[ oX< uBHvW`Vh%W`Vhɾ% duW`Vh%%uW`Vh%d1҉PLDžPPPTDpt;jP`h:Y[tW`Vh%PPuDžPXT@6@t:tj6`h[Z@uW`Vh%W`Vh8%`hKƃ tPh Ph%&V:d8 h4%1҅u.u*h%hdiPh0ڠhh6dpPjh;d@Pud@Pi<wPC*PEPR u%C PF PhX%KuMUd[뚍e[^_]UWVS8EE] }uP8Yt99s&}E EE 0e'E{%e[^_]b)WPS@ nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉʵfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMЍE eUfҋESftu-yPE Ph% (fEfu)T3EPE+Xe[^_]UWVS$}E ^\ftPhpe'h% cCubh$RSU u#>t=G Phpe'hfE#EW*sPRWt^\ue[^_]UWVSE 0xjPu( uEe'e[^_]ËOwvwPw Sh%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhHe'h% t @`jVP/ u hHe'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuV4Xt,sss Stttt:uj@苃t$P ǃ tPǃY%1Ze[^]W|$wUWVS }7tu PdYF><vu#%1҅uuF(fu  Ӂt1ۅu uuE0e[^_]g_h{ ÉE1Em5>&RR$F Ph%Vh!Sjt(e[^_]g_UVS]Sh!j|t~ht j3.fXZe[^]UWVS E} w]~tuE9{dfG PuF Ph%`VE1҉Pdh%VV *!GuE@ @;Gu}PnsPF Ph%%1҃ut V[AV%1YuمtӨtW1~E84%u!uG]9C$uSh{dChTE胸,1ۅutEVZ1҅uEpE@]CO W؃~]CX{F$E}uEUҊM]脄tI_E@Ѐ8t HD)у@v . M@X@E}uE@H?%j6cEpHVp{e[^_]UU1t )]UWUBv- 0E 1ɉJI} ډу¸)Ј1_]UE1҅t3Ⱥy(t%=t1҉]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVSdEtE}?Ex 'Eu1E@$ hW'EPLjju OÃ{E8uǀxhtxduh%hPf'h*h%p$ hW'uVLE@dZYx tWu[Xu1RK|EPdB#B E}WS}iE@d@ EWCPgiC9SV]jjEEP O jjEPNE }E8P\d_uqE0@Z^D$NjuuPZC| SEPq\juEPrNEuEPZY@E@$tvtguvZX1uuVSOhVCPEhE@dEPC8P/hE@dEPCXPh SEP[_Xu[jj}WMà SW0NsxC|ZY uC|E@dEPCXPgSu K9tSYS-WX떀{tjSu OMà uhSb_tߍC8EPb^ujju Mƃ t9tEuVdZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E1u}}G$tN}u>}Ghu5j}Ghu5jLZt tSpPx]UVSu8jjÉ^Xu hf'UY1[1҉SCC ؍e[^]UVS]Cdƃ CdC`tChPC Ph% uGuAC Ph%zY^KtPd sҀ(t h%QgXZe[^]US]u:jYt'1҉@ǃǃǃ1҉Ћ]USPE]UURPDRptPQRP>RP*RuM UuU]UWS]U v} 119t@u1 f'[_]UWVSUyv & u1΃y tËAdr@t$tt @$u@h%DX؋UÅtF PSXFP}WWCPXFd@t Kth8~( u} WC8PWY_C9@VCXPWXZ؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PVJXZ?ˍe[^_]UWVSQEp1҃t<t19sAM1ɻ BAt }ut1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}]Cfw EHfv_ f9]u1Ʌtd@w 1 w w w ?w xIÉEU)ЉE9} "uu}u1EEftff@~jVC@Ph ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjS'ƒ ujjS]m ]UWVS} uEtCt=u{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVS} 1EEEE3CdEu u%StVMQS2uCE䋀%u=tuuStPMQSjC@PE0 tK9Ht ESXESut URP'ZYSXu e[^_]UWVS} Et0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UVSEt0t.ttju CPPz t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j]Zuhf'$YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZoECCdUSǃt_{ u Pu uƃ C S@t@sdKQPuR[@u s{ u @t{ u j.EPC K{@u RURY^@s@{ 1UĊ  L @uj.EPC@Pj} tOSRPhα%j.ChP膸 jC@Pu+ tP`S`Cdt  K`(Cdhxf' SXZ1ۉ؍e[^_]UWVS$EEE EEU}uM M؋M$M܋M(MԅuEtLRPEY[8E(uZEЋEt2jWC@Pv uE܉C`}tp}ʃ}jVWu{Px{@u 1C$C {4s(E܉C`1E@CEX}CPt Nju H~(CdE܀t CdtS` ttSX{@t4E4uSu!uSuu}uLSYMCAPu<{*Vhg'Wr tVhg'Wr u    VvEU1Ejj@EPSƃ@$@ 1ɉM䋃%1҅ut6EPSFPF PF@P@u VE䉆F F@FFDf{(uXC><u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV| VFHtVob eFHE8V@?jG@PRU0q UuG`t7%1҅uuV 1ZiEGhPG Ph%>V oj.FhPRj= 1E@F0EpjVt8;Cdt,q PjCPPCP@SF PtjR$če[^_]UWVSEtt?u[0tFdЩu1҉t Pu /Y_6ҋEt^tTCƅtDGPEPn8WRV^t @H KUQjsZYtUJ>t/@}wFH r*NjM;rC 1CUe[^_]&W|$wUWVS ue[^_]g_h= ƉE1Em5>&RR$C Ph% ShKAVj(e[^_]g_UU t,t9PuƀRhGjj&UUу1t.w 1#tRhg'h% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`P EF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS81ۉ]]]E1u1EEE9CEׄCdt\URSTRP譖 t t0u5CPE Ph%+1ɉKd EEt9sEsxF URV4RP; t tlVdtRNh:%t %QPF Ph2%Vj_@u. 81t$ 8t hg'Z1F$F fdEt9sE6NEtXMPF$Pv苕 t t1F0PC PhD%V tPVujSTRPEċCPEЋCL }ffMM9MsC KMɉMMԃщu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u(}uƃEȃ}v1ɺ>]4tuhFDWjE}t?E PhY%EEZjE0"h%u:e[^_]UUt&t9PutƀU]a]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S^ u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EɮEP1ZYtU9pu 1ɺ]GEttu4@t$PǑǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj1?E _X1EE 9CEuh%j uV輗 CPVh%u* @uosXsTVh%u*@tuuVh%u*@tCtPVh%uw*@tC`PC`^E#tE%"t #AuǗ$# tM##@tJB$#y#uRWVQuVh%u) @&sdVh%u)@ C1C;s WAIF,Z拀H1C;Ls WIF,XCPECLE}EfE9Esr SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhi9PB PEPu2E UU)U0sx1t8Fd%u'~ t!GFhPWEPh%ui(@6ċ?e[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09XuƀلtKj3n%Y^u=t h%S4XZe[^]UWVS} 71ۉff}fuEfǀ< 1҉1ЉЃEu.Ef}w i'Ph%j ]SA 1:BUP XۋUuhDi'XߋMDغuf}f9<t >tuă PVh%R蕷SEf]f< 18f}uVh%}ȃlH~(Y[Eċ4%1҅utjXZE΍e[^_]UWVSSƋ1;,k(Kfu{u#{u{ u {u{t]fuCUhPCPVUt1ǀ Kf1ɉHG[e[^_]UWVShEw E@EEEE@|tXdÀuXdBEAE1ɉMM}Ef9UrZ9]s#D E Ph%¶XZu<}])Ӊ]ff}ftftfu f9s# E Ph%Y_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPw< UtLF΅uE4%@1҅u/u+j EPjEPGsPE Ph%;f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPruSVPE Ph/%D(b1ủuEEPM1ҋEPE[tE-Eƀ>f}uEȅEEEPjuWƃiUЍ M))Ufw#2 E PhS%谴ZY%EܹEȉEUʉU9s* uuE Phs%QEX|ۍEtjPS׷ u`jhPuhǀEfEĉ{(u 1ECECdu%Cd{4u EC$U9S tKdS t};sC t u9FhsFhE}{}uuE Ph%6 Tf}t21u~`}W9rF`E̅t}OdMQ9rGdE}uE؉EEe[^_]UWVSljUMu w@ Ph%9 1҉u1ɋUYt E1ɉKhKdK`ǃu uVj XZƃ>VuMUZYuC;u}tG Ph%G[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]J 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύG=DQK wWF(1RPQh%~(WQh%j EPjSuuAtBf}u;8ύG=DQK wWF,1RPQh0%蠰~,WQhJ% e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@d%}tQuЋE؃ Phm%ub18ujjE؋謨EPj$g'8u ǃ8%EPj s@s<Qtf}uʁXsXS`1CdChǃF8u ǃ8%8u ǃ8%8u ǃ8%8u ǃ8%{`tps|t8Fdu.S`F !AtH9sFhPE؃ Ph% 16ċC`tPE؃ Ph%1CdC` u9t.E1Em =&}fEހ fEm}mދEȉC`{duEt:E1Em >&}fEހ fEm}mދEȉCd ǃ8%}Eǃ;uCTt>}t8sLъCDCLCHCPCFd rFV t#tFhPF Phl% 1F$upFhPF Ph% Vd s"1F$F VjjF蝤-NtHN rV裰XVBYHC`;}؍w u PVh%MuVh3%,KdSh tRQPVhK%u跪)uVh%u蠪 RVh%u茪jE0XZ}uA}t;WVh%sHsDhWE0% @u Wh%7^_E؋^|tFCdҀ t ujC@Ps tKd Cd uًE؃ Ph%sw8uE0 E؋041ۅu2u.}؋1ۅut$%1҅uuj\Y[XZ렍e[^_]g_W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@,u1siS0,G$u u iSS0S ti;S0sS0udRM Yd{u1ɋS0)>& ڽ 1$߭ ٽ2f2 f0٭0߽ ٭2 Љ ,茪Z{ 1߭5>&u +t #u¹ʈ%ݝC4HH H¸%݅u%+t%WW$VQ RP, Ph%#,{t 1s,薩Y6Pjs8s4Wf6t跿 ,TVjqXZGu 1a8RPVvljփ 9иr781kddȃ9ƾsff+tST1󫋅,@EUUE E)E.E d}TjEPXc @u, Phxi'h7% C@Cto ?9sS0S9su,S$t%,R jŜP, PhG%d e[^_]g_U庵vE]UvE]UvE]UvE]UvE]U wE]UwE]UE,wyu]zUNwE]i twUWVS 1tx 4 u1ۋM9s3ru2u\tffW׋uUuƅtfC [^_]1UWVS@D@H@4tPH1҉P4YH8 w$g'ƅ< dƅ<;I  ƅ< Bƅ<ƅ<0ƅ<ƅ<D 4u:ƅ<D8%1҅ut,Dž41DhP  14H,X@(fDž11,,9(DPDT19tk,<>98tB9rIpr@uDtDu f,,ht1(4tj(\ZYDu" t\1(fDžD,0% 1҅ut#j@wPB$t @pt1$Dx@1ƋH8G 5bu`(uHX<@D&v P Ph%՜ HP4BbCD_Zu hh'Y#Nj󤋅CH_1҉tjhj|PtP6-sD/j1CDCH| e[^_]UWVS] E1E;s31;Et k,9 t@v 6hF%U PV=G,1;uts 3hF%U PSF,܍e[^_]UE@|tPd(t1]USEu1X|tuu SC u؋]UVSEt0t-uvX|tuu S u1ۉ؍e[^]1UWVS} G@4j.DVCPjw 4wVhN% ~}tE@<"jWu茙< u hhi'G8@Pj48Ƌ<% 1҃utjtHuƅ0eDP< Ph%]Ph%> YX؃t w t u F19tAE9uuUM7Ph~&w> XZUM΃^Ѝe[^_]Uh:.h%jm4 4:5(:5t9W|$wUWVSH:51B(:515x&.% :7fZ7 s fL:5/sfL:5 s/fL:5f95fN:5X:5t:7 erIH:5@:5ffL:5fN:5=:5tijEP> EȣP:5EȣT:5ZYFI:5L:5H:5 8:5<:5 P:5T:5fP:51ۉ&.&.p95l:795U1EH:5uEࣼ9595jh955H:7H2à x9u h?%ͥ XSV5D:5h%`< Z7Hujh&.j`1 :5:5:5=:5u=:5u:5:5:55|&.=&.u؉}mrq&.E؉ :5:5 :5:5E :5 :5=ɚ;~ :5:5-ʚ; :5:5:5$x>&we[^_]g_UWVS4ƉU)'h%A; Y>F h%AFfVRVRPWSPh %: j.]SFPje] uj.h"S Sh-%: j.SFPj5] uj.h"S豙 S!AF^(ZU)ڃ<,wJ<w1tR<CSPSPhm%<+hE%"<:tI<&ݝ@1ۉ(,h:5jP95ZYt"jj菂 b jP*+jw* 95t1=95݅(zt -:5=&=$:5ܭ(ݝ@4:59(:5݅@؞vw:5:5w`>&r Z7t=x&.t#Z7t_:5:55vܕ@݅@z95k &. %|&.ʉHL߭HvݝH:5:5݅Hܕ@v݅@H:7`fDžd >&ٽZfZ fX٭X۝H٭ZHPj`P) >&ݝyz 8hϔ"Džt|1󫋅Tt xDžDžjP5H:7'ǃ y&Ԃ 8Nh% j[L[^6Ӄ w1…{)uj{,ud,u_jht:7CPb uS$t*:7t!9tZ7C Ph%CC(=L 9eZ7qPh%0 $1\jhPdz PZYtuxtZ7h6%,Z7hPPWhG%9 Iփ w1t7t1x)ux/uu@ @u7L 9rhk%^tS~)tD 9r?΅u7~.ƒ  ˆtӋTHT<9h%r T@f8f;@:5 Tf@f8ff40:5 @0:5x&.=:5T@1ҋTI ɋp)ˉ8py$hl8@B8phl)Ӊhl߭܍݅ڽ895vٞv؋ 0:5`95959595p&.vp&.95v 9548:7Ћ44t,:5 0:5 Ј:7Z7 tjh&.j"ݝ P 8PWh%- h%- Z7݅ tYݝ81fDžF Ph%"- [^݅8=:5tQQ$h%- ؃4t h%, ZT\1NjH9s:P:5@8t!t\SQRh%,  B뺉 \ <jh::5T PT 8T@f4f0:5C0:5:7s,:50:5 ڈ:7Z7 PPPWh$+ T@‰ffP ft2ftGfTffRPhS%TfPh-% TfPh@% hy%7+ ^Z7y TXW@<?<j.VSjtM VT@4k'h%* T@f4fftfkfqhp%)Txh~%o* XZ7tKT@th%h%H* X+81%8P4fPH9\H)T@uF=wtyh0l$#f9f4f4P=v 141P 9ȋ8"8ԋTp_Z7t3t uh%h(&( XT@t h%( X  h%]/Y1H1ۃHu ˃j.RVjK uj.h"R芇 Ph%Z( XZHuu h%@( Y Sh%2( XZ geTP\w닅T@P9TX\H9s&$ B.DQt%RP' CYXʻ\J9H4sb4Ph#h%o' 4H9scTH\SHZuh0l$,' [0:utSqg YƄ4\n1Z7:h $& T@Z<t <uh%h(&& XDž8)T@Hʃ8tHj,% XHT@uRh%yRh%Rh %C& YXtj,W% h%,& XZ)P\uj,1% h%& _XRT@9@8j,$ VT@Ph#%% Z7P!PWh$% T <x2<w><tG<T@8Ph%P $j'<rT@<w*$j'h:%BhR%;h{%4h$-h&$&Ph%,T@t <uh$h%a+^ Ph%$ Y[THFh%$ T@Z<t%w uh'%<uhb%h9%h$ _hM%Ph%S$ [^T@8Ph%5$ THjh%h%h%h%h%hy%h%}h%sh%ih.%M*j.STPj*F uj.h"S覂 Sh7%|# j.STPjE uj.h"Sp ShG%hW%<# h%#2# T@f8fZYfw2$j'hn%h%h%h%h%h%zuh%nh%h%" S1ɋHQ t Sh$h%&uj.VSjD h%T" [h%D" h%#:" T@fHfZYfw-$j'hy%!hn%h%h% h%h%! XZ7t-T@<m4k'h#Ph5$! ^_Z7 Z7uh:.@ [g v狝t݃{)!C2t!#t1 h%3th%0! C Yh %! C HC SRRPC Ph,% HlǃxPhQ% XZ h_% XCPhr% Y^19~gVHmYZuVh{% XZCj.RPjC uj.h"Ry PVh%H F땋L 9؋4:50:5t9~~Z7 qm0:50t 90P UWVS]u#Z7tP3^1ۉZ7Z7S_ Z7@$#+Z7Yukp U1҉Z75B.t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSU}tIB<:u1ɍ4 E  8uAu t<@t:u <:tu9uF~@u1[^_]UE&.]USE] u|À:u%u@C8t9EsH:tt @|u1[]UWVS4}!}u[=Z7tQu Wn[^u<5Z7P)YtHWP D3XZhY)^1u?n Dž)Etw}xjjjuM !jh@PE xDž1ɉ1ދ9rqhQu+ƒ ?tu%Zm 0S0m 0HЀ u%V1Iu8:ut+<Dž\t-Dž t t11:uΉ1҉V9r)ډ)ށVSv,ZYu"S/^u[Ɖ‰.1<#kcu SZYPFS7/XDž&.M1j=h'&S ƊtV:t֍HX)ىMAQPuVË tF}t uXWi.^KtF:^Dž@DžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QW_*ZYu:W-Xt uXr-ej _<ljljƉlj )PVQ SRr ,Ymt u-^)؍P9s&PSD)ZYuS,ti XË Dže[^_]UPUjujM EUZ7tP6 1҉Z7Y1Z7Z7Z71UWVS1=Z7uE Z7=Z7uYh^%Z70 Z7^_u=`P5Z7xY[t?Duz1=Z7Z7t=Z7uZ7Z7u@ @uP5 1Z7Z7PZ7@Zu 1Sh^%PAًB.TZ:u#t =Z7t|0\NZ7G|0\u Z7P1ɍt:uf:Y\tAߍP5Z7?Y^u'Z7tB @R4 1Z7ZD돁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u wu ][^]UWVS j=u uy ljd![Edu!Pf l8]EdUru<:<^uFG<:wMu})ߍGdPS%ZYuS([w<\ůG<:HЀw+1ɉMF0MȉE9t HЀvE농w1e[^_]UPEPhh b7h@f7uƒ1uEUWVS} uLu7uuW1ɋU à =$f7u u1Ɖ>1e[^_]UPEPhh b7h@f7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ MؙF#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rסf7EСf7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSU} u]RPI $URjWơf7!f7)Y9sRUf7Z9Uu)@uÅu,f7!1ɉ1ƅtÉ5f7f71e[^_]USX?f79f7rf7Éf7 4t1[]À=|f7UVSh#h#h#h%&.h#h?#hv"h1%&.&. "=}f7tM#H%=~f7tB%%=f7t%QRPh=%Ӌ5&.P$=xf7t %Y$=yf7t\f%`B#=zf7tt" %={f7t &SQRP֋5&.]ڡg7h#h?#PhV%֋5&. ڸh#h?#Ph]%֋5&.ڡf7mh#h?#Phl%֋5&. ڡf7Fh#h?#Ph{%֋5&.ڡf7"h#h#Ph%֋5&. ڡ&.h#h$Ph%h#h#h#h%&. e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVS f7f7f7k(0.hPn'@Plw1ۉ^,f7~0XY1ۡf7E9s6U1h@n'GP9wKGU!C(XYk(|0f7EM9sCU1h@n'GPvf7E؋M)@f7GUC(XYk(|0EMf79U1h@n'GPvf7Ef7EEM)ȍHf7GUWC(YXR h#h#h%P&.=f7t!+ f70e[^_]UVSf7;g7s4>uDC[^]áf7uÀ=g74UWVSS DžDžDžjjPhg7jP-@u g76 f7Pf71 @Hf71t3tShPh%u t!Ƅ9h%jXu ƅކ t5tf7u f7FtB<97$@l'f7}f7}f7~f7~f7볡&. f7Q9}H &.@&.|f7|f7w&.iH&. f7Q9P@&.E&.7H&. f7Q9@&.{f7{f7zf7zf7yf7yf7xf7xf7ƅ P hI#Rh%P&.GXQ =|f7t h\ Y=&.&.9}&.׸Éf7 f7 f7r5f7f7f7)I f7f7Pf7tPf7 &.f7Bf7 f7Љf74f7#5f7t@f7)‰f7={f7t*1҉j Ph ": h`n'hf7rjqf7f7f7h`n'hf7q11f7g7lãf7u&g7 1tg71e[^_]1À=g7u1áf7u f7UWVS@É;f7;f7j¡f7_9u739u0PY;f7u;f7)f7f7jVS` 19Z;P f7PPhf7r=f7XZVS+ Y_@u:N j@}W0^9M h?#Wh%P&.=f7tf% 95f7u"tX f7PPhf7qXZe[^_]UWVSEЉʋf7!Ë f7)){ MA L>D=}f7tMjRP_ M95f7sxu@)lj|| >;f7Fs"J| u| | DT>| T 9Ss$EExSWrED CSWp;sss{uISC PrXZ=}f7uE@,t f7EX,f7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC f7‰ى[^_]UWVS¡f7!9t> f7)su܋tu 9t)D @!u܋D UEPhf7xn@ZYe[^_]UWVSQӋf7!‹ f7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS Eܡf7Ћu!9`x }؋ f7)‰Wt~f7]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w m'wm'"1w4m'1;SsS |C@C;Fu ;u1ɉHt SFPJpXZNZH9t9sxt PFPnY_SVmXZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPhf7hlPhf7o=~f7t KZ{ SC f7f7e[^_]UWVS9f7tf79kjjhf7nǃ t؋_ jWhf7nEWhf7(of7=f7;f7r;f7rw1ɉÅuj}먋 f71ÅuP=f7@u1jNjf7!‰)[9tPf7Y9uō3f7t]EPhf7|kXZt>G 9r7 39s0jWhf7mEWhf7Knf7=f7}뾉؍e[^_]UWVSÉU f7EC1t}9xts@Ƌuzơf7EF}}1U9s1k`;{'t @u-${'{' sjtt6 0@p00uHP@$u1S$0t9(s5 *\p0믋H@9(s(0띍e[^_]UU%;(sB.]UU%; (s44.]øUS] uSh:._ h"S路t5 0Ph$h:. h:.j yXZE:.]| UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt 3 )wu PEPà Et 3 1]UWVS ‹@E졐B.E11 =E}9s%9]D{t}tk Y DFɅt}uzuB g7Bg7 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEPÃxuUSˋ@ ى[]ÃxuPg7@g79Ps=UVSÉjRpg u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD P C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$'sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj=@.t9s?MjC,@Ps(c Mu e[^_]C(S,z{,f P{<tgFB.0=@.u9sB.0=@.u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E '.HuVQM? t uMQ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCCg7 g7g7'8[u"x.u.K9r !f3r9s:.u z]u{uCg7Cg7[^]èu'B B.fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uCg7Cg7{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4 ' ZYuCC u1]UUE ft҉U']1]UWVSSɾ=@.t9rC,E5B.=B.113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh%V u 1ɺjh%V u1ɺ,S j@B@Pr R^ u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uCg7Cg7g7<-t<]u{uCg7Cg7g7CE؋ B.Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ=@.u˸jE@$E@PEp B\ u fMA Q$JuN$f8-P9x]x-t A -f9k=@.vNf9~;{uC g7Cg7ff9UPF΃=@.uމEa~{uC g7Cg71E7* UFup>-uF3-U;Cr{uC P8]u g7Cg7{Ex8tC @tEHfE1@.u9}~Ju9sE8}3G8GEx<t4t fEfu-GB.8EuޡB.8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF B.f tNt B. t< B.ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCCg7g7GƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC g7Cg7{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JB.DJt%9~{uC g7Cg7PU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uCg7Cg7<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $'^[m\p{|;{r{uCg7Cg7S B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)ug7Cg7 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCCg7g7Gu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM B.Dyu},t{uC Cg7g7@}t{uC g7Cg7?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJB.DJt%9~{uC g7Cg7PaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPB.DPt 1e[^_]UWVS} UҀcE tEp9J) W ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEuPDžh1x1DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 B.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNB.DJ_bB.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXB.DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ B.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=hk%qERGPx u )MuMA}dM)ыU9uG PVx @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ B.Qu?f_t9f}fMQҋ B.Qu f}_zftQ B.WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgB.OJf_ f}_Zf_ 8u_CfCU B.DQuf}_f}u2ы B.DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 B.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNB.DJ_bB.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYB.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ B.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=hk%qESGPx u )MuMA}dM)ыU9uG PVh @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRUb UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f B.DAu;f_t5f}E B.DAu f}_fEzftOB.DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡB.DHf_ uB.Dpf}_Ɖ 8uaCf7E B.DAuf}_f}u4 B.DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRU_ U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRU\[ UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG B.AuE B.DAuf}_f}u4 B.DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRUX U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 B.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNB.DJ_bB.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYB.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ B.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=hk%qESGPx u )MuMA}dM)ыU9uG PVP @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=@.lt1ۉ]tMEAEW YE}M9MP F,EF4EtpF8EtfFu}D$ Ġ[^_]Ëhld<D$gD$<$9D$#D$<$ D$gD$<$D$gD$<$D$gD$<$D$0D$<$d9M`D$D$t<$a`u!phD$gD$<$'UWVSWL} uttEEgEEEED$E$oQ…PEtV9s%u9sF?V?r95+ gNv.&.&N9sVu鋽 Ex[gML$ D$D$$wt.&.&V9sNu[Ex̕ @4?⋅D$ ~D$D$$.m &.&.&V9sNuE@D$ D$D$$l Pf.&.&V9sNu;&N9sVu gN&.&.&N9sVuR ZgN&.&.&N9sVu;rEgNf.&V9sFuEx6gUT$ D$D$$]Zf.&.&.&V9sNu;t94gN.&N9sVugN&.&.&N9sVu{Ex @?ውVgN.t&.&V9sFu鋽Džȉ&.&.&N9sVu#1hgD$D$D$D$ D$L$M $.&.&N9sVuD$D$ L$D$ D$D$E$[ҋȉ.&.&N9sVu鋽BD$BD$BD$D$ D$D$ $f Ȅ.t&N9sVuAD$D$hAD$D$ mAD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ D$D$ $e AD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $d B D$(B D$$BD$ BD$BD$BD$BD$D$ D$D$ $vd sit&.&.&.&N9sVu^l.t&.&N9sVuga.t&.&N9sVu{i.t&.&N9sVu;Ru.t&.&N9sVuv.&N9sVuv.&N9sVu{EDžDžDžgoh~@D$ D$D$ $%b .&N9sVu@D$ D$D$ $a N.&.&N9sVu;A D$A D$AD$ hD$D$ $a .t&.&.&.&N9sVuD$ D$D$ $` 1v.&.&N9sVuUE@D$ hD$D$$` EDžDžDžDž DžU1})` UWVSt4 )U11 DrEEEEEEEEEH>U DEED$ED$$UU}ĉ|$T$E$ ƃtdE$x ƃt'D$ED$$hU1҃ډذ MD$|$E$軯 跰 M議 8D$ED$$U苰 8t[^_]z UWVSP ïDž/devDž/XtyDžyXXD$1h$Ut-ƍD$D$FtH4$P 4$oVD$D$ D$D$p$N@Dž!hpT0ƅpD$D$<$TƅtfL$D$<$XuD$<$Xtg$bUnC輮 P [^_]衮 8u)΃wΉ<$;VuD$D$<$S`TEE ut|$E$ BUt#ED$D$ $EtED$D$gt $ 1P [^_]DžUVS ED$ED$ E D$ED$E$tKbB ƃt?uE$SE$6:[^]ËEUE$S[^]þUVS U JL L; D$D$$w t@ $ ǃ L$ SǃLƃ 1 [^]k 0ǃ L$RǃLƃ t7 0ǃ $RǃLƃ  UWVS<? 4uD$/4$o D$@4$GQƃ%D$T$$Pv 4$QƄ=D$D$D$D$ D$D$ D$$迅 tVuw: ul<[^_]À uMq Ɖt$)XD$ :hD$D$4$]X =蘪 ? 耪 UVS ôu 3D$/4$Rn "Lt$ $k  D$D$L$t cD$ D$D$L$ !Ѓ2 D$D$L$ۙ1[^]_LRD$D$%@4$NLD$t$ $4 褧 Ɖt$)XD$ :hD$D$4$V =˨ ?G$S tƃ Q藨 8#u͉4$ƃ z j 0_^ 0UE$]ffffffffffffffffUWVS$q fE@ E։υU };EE EU D$T$ $""""D$"""@9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""?]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""?UM]9ȋEE9EE },EU D$T$ $D$>9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""\>9BMϋEE}19}E UM T$L$ $D$>]u9M΋E eƉi`T$L$ $D$=9MϋEEƉ]u덁݉a)u}T$L$ $D$+=UM]9ȋEM""""9""")Ɖm݉]u UWVSH, !D$T$|$|$D$$[> D$$H*)R)L$L$ |$M $> tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8H 5}܉EԉŰB.ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}ŒB.UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$]] E܍ Ch D$EЉ$] u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍ Ch t#D$D$EЉ$]諏 uKE܍,Kh t+D$EЉ$]4 u}g]܍K$D$EЉ$ t2,Oh t%D$EЉ$]֏ u uE܍L]̉ލXh tD$EЉ$]蒏 uruЉ4$]{ T:sE܍LD$EЉ$]Q 2u݀}u<E]DCt.E܍D$EЉ$] u1ۋEЉ tC.uu#ỦD$EЉ$]迎 Uus5uD$EЉ$]舎 tu#GW ]ԉSG UWVSL AƋ'<'wwEVN)щȉMEED$$X\t_FMȉFD$F$3\t:F]؉F>FDF 1[^_]ÿ'E {UWVSu nD$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$` MD$@|$X\$LD$\D$`LN|$Txq|$X\$LtL$T=qwT$`9 A-D$@tT$T=qw L$`9 AtL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$XFD$\D$`t$\ QT$Lk)ЋT$P ‹QD$dT$hD$t ] 1uUT$$]7tFuɿ [^_]UWVS轵 òt: >t M1uU T$$|7tFu̿[^_]UWVSV Kpt:l>t M1uU T$$7tFu̿[^_]UWVS E $ ƋE%EEgUuUT$$$…plU>t M1uUT$$Y6t1FűuUEEu54$1E [^_]ËUt }1]uЋu9t!$U] D$UT$4$ E0E렃}tE1҉UWVS跳 ìu Ex}u 4t+D$4$5uE)E@ [^_]Ë t 1[^_]Ét$RD$$nUWVS- "E D$E$Pm D$ED$4$NjE8tB|m 8"tn5 uOt$ E D$ sD$$҉[^_]:m 8"u썇v5뱋 t[^_]ÍvҋE D$rD$$mUVS0 %uF$/F $/4$/[^]UWVS$ }E 1t u$'E[<$ E܋MAnD$4$*EMA  EU P8E܍gMUT$${!ƅ>nED$=4$/ HE } M D$4$2uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE j t(E܉$.E$ .EE$[^_]Ét$RD$$k $-ffffffUWVS8 uj D$$sD$4${uD$:4$. DžD$LD$4$H{hF$Y $$D$$D$D$|$ D$D$R4$_1$R$6D$D$|$ D$D$4$ 1|$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $H  $2D$$Y |$$ƅOD$E D$ ED$D$$$AD$E$tPT$$}$+$*g 8[^_]À>/uEt$D$<$St'D$<$D Sg 8E D$t$E$u}뎋E D$cD$E$vuE D$D$D$ ED$D$R$.BE D$t$E$urf E D$*sD$E$tDž1D$ JsD$E D$E$? Dž1ktf E D$*sD$E$ot1;$ 5f t$ 'D$E D$E$ <$ 1EsD$E$xD$/4$se E D$D$E$sDžDžve E D$X`e E D$XUS(蘪 ÍEEED$D$ED$ ED$D$E$,x E([]øUS(, !EE>ED$D$ED$ ED$D$E$!,x E([]øUS( õD$ D$$?D$D$D$D$D$ D$D$D$D$ $+x D$([]øUSJ ?ED$D$ ED$ED$\s$Sx E[]øfffffffUS خE$ Uƨ U\t \]ÍQ\]UWVS萨 Å}|$E D$E$2q9s [^_]b ?|$ t$D$$\[^_]UWVS }|$E D$E$q9s [^_]b ?|$ t$D$$\[^_]US 谧 åE$ t []ÉEnsT$$\EUS j _E D$E$ t []ÉEnsT$$\EUVS u4$Vt[^]ÅtEt$sT$$\EUWVS˦ u} |$4$ t[^_]ÅttE|$ t$ T$$\EUVSk `u t$E$ t[^]ÅtEt$sT$$\EUWVS }|$E D$E$ u[^_]É` 0|$ E D$HD$$\[^_]UVS訥 ÝuE D$4$8 t[^]ÉEt$sT$$\E[^]USQ FED$E D$E$uEsT$$\E[]US ED$E D$E$uEsT$$\E[]UWVS$詤 ÞD$ D$EUD$T$EUD$ T$E D$D$E$9 Ɖ׋D$ u $[^_]^ L$ EUD$T$EUD$T$E D$ ED$lD$$\$[^_]UWVS$ ܩD$ D$EUD$T$EUD$ T$E D$D$E$'Ɖ׋D$ u $[^_](^ L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]U'  U!RፀL]Í]Íf]Í]Í]Í?#]Í]ÍS]Í ]Í]Í]Í]Í`]Í]Í]ÍS]Í]Í T]Í]Í]Í]Í]ÍF]Í<]Í]Í]Í]Ín]Í]Í]Í]Í]Íс]Í]Í']ffffffffffffffffffffffffffffUWVS象 æƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS\m fE}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ  ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s U 3D$L$<$]t$#D$<$1 Dt$D$$yũED$ sD$D$ $ D$/4$ϑtLrtP‰T$|$t$)D$ tD$ED$E$1$[^_]Åt xruS뵀>ruGt$|$ D$ED$E$X뺉}UE$[^_]e{M UWVS辒 óD$ED$$t{NjE88/tbD$/4$轐…tL)JBU=wsG|wdD$}|$M$] Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS賑 è}UtlƍxD$4$u tD%=`u'-$U ytĄ[^_]K O1Ą[^_]K 1UWVS }U)tlƍxD$4$η tD%= u''$U tĄ[^_]t}EE u[^_][^_]UWVS4苈 ÀL78ủt$E$ϣE D$t$<$4[^_]UWVSB 7EE}L70E D$ED$4$=t}EE u[^_]p[^_]UWVS4݇ ҍuED$E D$4$Q=t%}̉|$E$ ED$|$4$ 4[^_]UWVS4~ sL70E D$ED$4$<t%}̉|$E$觢ED$|$4$4[^_]UVS  EM thP8t P8P7@:t1 [^]ÁP8-D$D$7@<$)OH8붸 [^]UEt @:]ø]UVS p e$7t^d2.@:.T$XT$$p4D7tE$/2P7$$L7 [^]Í$SXu뎍 t$S$fUWVS( ö}tG{E{EOEEME EM<$bƃ t tu#E([^_]ËE1([^_]ËUGD$ D$GD$<$CE9E9G?@UB. DqEEmUT$D$<$4:E;E :E+m}EE;E tu}MMD$ GD$GD$<$vhD$ GD$GD$<$UhMAE9O~D$GD$<$9iGU9ut$GD$<$^9u7D$ D$GD$<$gD$ ut$D$<$gt$GD$<$9E;E v}D$ ED$GD$<$}gEHU9_E9G5MzUG;U D$ u4UT$D$<$gED$GD$<$P8E E&OL$D$<$f}D$ FD$FD$4$fFD$FD$4$7}tE9} uD$ FD$FD$4$lfFD$FD$4$77D$ UT$D$<$3fG3L$MGD$<$d7MD$ L$M܋GD$<$eM{D$ UT$D$<$eGU D$E D$E$]U M FD$UT$L7$^]UWVS  u}ED$E D$4$6tE} u [^_] [^_]UMU E~tEU M]]UWVS 蒀 ÇuL78E D$ED$<$5tEu } [^_]~ [^_]U 9 *E L7~"tD$ED$$9]ËEUWVS ޅ}EEuED$E D$<$T5t'~#tuEE }[^_]E[^_]UWVSz oEEuL78E D$ED$<$4t)~%ftuEE }[^_]VE[^_]UWVS0 E}GDEEP798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$]fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]cMEE9G~0W,10[^_]Ã]1^E:<$]~1U| L7$]UVS| þD7p t4$ u N8@[^]ø[^]UVS| yut4$ u N8@[^]ø[^]US$H| =E UD$ D$D$D$T$T$ D$D$E$$[]US${ E UD$ D$D$D$T$T$ D$D$E$ $[]fUWVS{ Ã} uUM=tUG$KUrl7tUF$U5l7tBU$Ul7,048<@DHLPEtE@$wl7  $(EtE@$l7TX\`dhlptxE tE @$A}l7|UUUUUUUUEE$tE$@$^l7U UUUUU U$U(Uċ,EȋE(tE(@$D?l7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉdT|t ʉt ʉ`|Mt ʉt ʉ\UUt%  XŰE@|E@hDž$ */ E@,p1҉,MI, qfL>9<ffNv tv$uMI,4vD> qxf~g$,O HG 9u͋9 <>f|>y_u$F,HfD99f|9y.NDfHD$F|$NuĴ[^_]Éщ$E@,R|)ƍTxDlx9qf+fG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YMQ, rfVAtωp$0V PF 9u͋tp9l9h\T$xy DžxEP$ty DžtEL$y DžEԉH$gy Dž4$?y Džx|Ƌ)΋)ȉpl9^p9dE@,H1҉tvf~94>ff~~ t‰ljv$0u}O, I4F uf~0r$\4W PG 9u͋9 Ƌ9l9|)ȉ9~ht|Ƌ)΋)ȉpNj9p9 E@,H1҉lht}f~94>ff~~ t‰ljv$8u}O, 9I4F uf~k$] W PG 9u͋9lhwDž?lxE@,@xMT6MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bǃ <ǃ ^ǃ vǃ #ǃp :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ |ǃ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$8.T$ D$D$E$o1.t&.&.& Tp=u[^_]USK QM1&.&Tp =u[]UWVS,K ÎQ EƍME$+FF(9u݋uD$$8Cuxu'D$$$3T$$ǃ !ǃ +ǃ !ǃ ,ǃ !ǃ -ǃ$ !ǃ .ǃt %ǃ 0ǃ %ǃl `ǃ %ǃp aǃ ǃ fǃ ǃ gǃ4 %ǃ hǃ\ &ǃ iǃ %ǃ jǃ %ǃ kǃ %ǃ lǃ %ǃ mǃ$ <%ǃ nǃ %ǃ qǃL #ǃ oǃ #ǃ sǃ %ǃ tǃ< $%ǃ uǃd 4%ǃ vǃ ,%ǃ wǃ %ǃ xǃ ǃ ~ǃt #ǃ pǃ #ǃ rǃ d"ǃ yǃ e"ǃ zǃ, ǃ {ǃT `"ǃ |ǃ| ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$8.L$ D$T$$%Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^ $v$ $#t $:m $'[ $#I $#74 $#%\ $- $-L $_ $| $o $pt $r $y $z ${q, $|_T $}M| UUSE K ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0QE FKEU܉MD772EE4E fEE$Hƒ=4M4%y 4 44fǃ EDPfvM䋑f8;@E fWf^fqf$MdU܅47Q)ʉ$ 2E$N‹E@ @M M4 'UfB 49}} 4% 44;4tf 7f1҉Ѓ0[^_]ËE44%y 4f y4D$ D$D$$ 4449)‹4L$ T$U؋MȉD$E$!4;4U}dž4…f 4xp4fǃ 3E$>0t3E$=E0U,)4fǃ E܅U0tE@ U؋4 E44B%y 44D$ D$E‰T$E$p~v4%y 4 494114M%y 4;4)fǃ Mԋ4D$ T$U؋ED$E$赿U؋M~4y 4 49411x4Wy 4 4947ff @}AEE܅U$-E$‹E@ N@FM MtUB.jE@ U؋4  UfB 9 4,fǃ !E܅{47Q)NUm~ 4}} 4Hx6 44m4%x4뿃ߋ 4}} 4%y  449}fG Ef` @:.D$ D$!D$ $ؽ $ĝU= CEfǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX= ÈCuD7MV8у$33`2.EEt\7 E)V8N<t=%G*tE11zE}uAX[^_]Ãt $*tًE$証E@EFuL78E D$ED$<$utu } [^_]* [^_]US8 ç>E$[]ffffffUWVS 8 v>Ɖ$r $豭…t"ׄtN<$tȃuЃ [^_]ÀF$ڶ Ut p@뮃$<UVS7 =ƍ D$4$ tD$4$ 4$ 11t)0tGB<1;NVt~΅u׀>u|F[usVmt2t00uVFtJeNVu1UWVS0t6 i<Uu :uH2tU$1YUF@fu2ML$ MD$T$<$#2M EPJ(N$JN 3t$1D$D$$ FT"t$zD$D$$ FXV  ~$879<7NT47 072P3PB0zp12džp2E싂E苂TEtU܉Udžp2ELɉMEEEUtwD$Eԉ$UiE܋U؉$Mԉ $E܅IH 1$茱t2džx2EE-EED$E$ u džx2EPED$E$k u x2t|$E$J u x2dž|2UtE)dž|2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(EU܋ED$<$ UEU܋ED$<$f Uu p2MU܋ED$<$8 Up22@@,EF@fL$ D$ZD$<$2XE1ydžt2džx2Edžx2;Et ED$E$^ u dž|2EtD$E$: u |2|$E$ |2LMFEidžt2džx2dž|2Mdžp2EEdžt2džx2dž|2E@tg|$E$ uTx2dž|2EJt|$E$ u x2dž|2dž|2E8ENdžt2džx2dž|2ExOAOUK/ D5D7D$E$]US#/ 5E87H$ <7H 47HT 07HX "7Hl X72 p2 t2 x2 |2 2$4P[]U. }4MD7tJX071]ø]fffffffffffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS - Ǎ3}ƉDHfx 4 [^_]Ëf=tyfDN4f>tX$]膢TP.t&ffB9uǀFF [^_]ËEFf\Nu]ED$$]#MME$ ]UMtZf@f@@ f@@f@@]\]X ]]9Eu]P $蜭$]@:.D$ D$D$0 $ȫ $贋]| $C$藋UWVS + é1Ɖ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS+  1Eu^.&9t)fxf8u@$9u׋~1$]S9> $];4$3[^_]UWVS Xt&.&9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS) /}fǃ  $ P.&ffB9uǀ2ǃ ǃ ǃ S2@tL$" =w4D$T$$N2!9u[^_]Í| $2$膈US ( š.E ED7t+2UT$$U(E []ø []UG( @.UM ~*D7t2t _1]É1]UWVS ' -D7te3339}}<31 [^_]à D$$ ‹3t333뱸빋3L$PT$$ 33]\33u-U )' "-ED7t%2UT$$1ɋUE]ø]U& ,MD7tJT471]ø]UWVS& Ü,}<$ƃuOG @tI& 8u?D73t-<7D$87$Htǀ3[^_]UWVS (& ,EUD72E, EE$3= %y   fǃ  LNfu f9q  fmffjMUU$) E$mE@ @ME@ M  %y   LNf    yt鋓  9f  y [^_]ËE$Ot3E$8=DEMR [^_]ÃUfB   9|, <  9f  [^_]Ë %y  ; fǃ  Eu-E$E@ @aσufF 47Q)=  Ef` [^_]ÿ@:.D$ D$ D$ $蝢 $艂UWVS" Û(uD7MqV8у$2c33`2.M MEt\7E%F8V<t|‹FD73t53@fuT$D$$ []1 [] D73ts31 D73tu31 D73tUs3E1]øl eD73tUu3E1]1U8 1D7U31]UVS D7@@fuUT$D$ht@$Ϣ t Efu5l PwtU$Ѓ[^]Ëǀ3[^]Uft87<7UWVS,r g  f}D7@@fu|$D$ht@$ <7 t }f87P7;Pu9HtL$MԉT$U؉$6QMԋUL7;Pu9HtL$T$$Q43@fuT$$) 3@fuT$D$$$$觕,[^_]EfEf87;8t8>LJ3}9t:ǂ3EEEEEEl D$}܉|$$B ǃ ED$$U  ǃ  US[ P  t[]ÍD$$  ǃ []US    u[]Ë D$$躽 ǃ []US$ ú  t$[]ÍEEEEEEl D$ED$$ ǃ $[]US$J ?  $[]ÍED$D$$躾 l 9Et $[]D$l D$$耾 1UWVS4 D73;3@fT$$(   yP7B$,oD$D$ HQT$PT$@$詧7@|U-E؉D$D$ $cUԋ@t A:zUԋ}؉|$D$$+|$D$Uԋ@X$ @$軋 D$ D$D$@$ǀ343@fuT$D$$4[^_]7@|-M"E܉D$D$$x l 9E P7R뒸 D$$d ǃ  |14[^_]-MvUԋM؉L$D$8$Uԋ@YD$l D$$謻 CUWVS, EEEE uԉt$}|$$`EEEED$|$$`D$$aD73tD$t$$W`,[^_]% D73tUS D73u-3@fuT$$f []øUS ÝD73@fuT$D$$ []USY ND743@fuT$$ɒ []>US E U7RtI|t7-T$D$$AD7ǀ3@$ 1 []Ëxt-T$D$$D7ǀ3@$蚇 뵸 []UWVS D 9ED72tQun7@@tt\ǂ2-T$D$$`@$ [^_]7@t ǂ2뮿 [^_]7@tǂ2{Uk dD72$]ffffffffUS]E  }t J;}R ;~[]ÃUWVS }tG8 u^@u[^_]ÍtG~W,EO(G\p;}@ ;~9Uu׋u멉<$G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U091[^_]É봸USEt=H~6X,1".&.&.&9t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًU-9u1[^_]øUWVS}] UG9)9i4utU}t]G,E] Eu pW(9|_9}W(p 9 _9} E E;E 1[^_]É듋uW,G(D$OL$$D9UED$ PT$D$$]UWVS}G~EW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]ta{tZO~[w,1 t&9tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]ffffffffUWVS ãЍR4ր33V,U39VG8 L4U;W81҅ZE1EEEEẺEUMD>EED$D$ E3@@D$UT$M $mV,UD>Mȉ$xUV,E3EEE;4ML$ T$D$E$7ED>$GxEENjE94~-D>D$E$5dEE94ӋUЁĄ[^_]Ã4$ D$t$ ED$D$<$‰ЁĄ[^_]ËED$ T$D$E$ED2Mt$ D$BD$$D$M2$P‰ЁĄ[^_]úsUWVS8G <ƉEЉU̍R4Eԋ4}8<$ ƀ?EEE4E؍EE'E$vM9Er;UU)ր?Et)E؉D$ t$|$E܉$tEy8[^_]Ë}ԋGu܍WMtFȉ׋uԋ6tftE‹u)uƋ@tQuEt}|$D$ $U} UEЀ4SŨ8[^_] EԍPMtыujuE)ƋEԍPCt$D$ $U} U)u}E)9s뷋E9r7EԍP9UtU?$9Uu~X24H90t…#ȋH90utJ$`2UWVS ølj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$,UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS Ɖ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u;u?uGt7@@8tf@1[^_]Ãf@t4$t4$미[^_]US MU L7t%t X@t @@f%f1[]ø[]UI BUL7M u]_]U UL7M u]]UVS E L72Uu0ÁE% úډ1[^]ø[^]US UL7M u8tHX2H@H@[[8u1[] ʉP@[]U6 /L7U]SU L7U]UVS L70tFFX2@Ttf@4$4$7@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]i]UEU Mu]5]USEUu2U Á ӺEڋE 1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]aUVS< 1utFFX2@Ttf@4$+4$7@@8tf@U 1[^] 7PT1 t t t@t̀t(t t8t ttLt 1 7PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS u4$ D$t$L7$H [^]UVS êu 4$襃 D$t$E$ [^]UWVS | quE L7:x<ut&.&9t<uЉD$t$<$ [^_]É4$! UWVS  }L70E D$ED$4$|t<$݂ D$|$4$K [^_]UWVS ëu}ED$E D$4$'t<$舂 D$|$4$ [^_]UWVSa V}uL7E D$ED$$UǍt/Ux0u 9t<uƉt$|$$ [^_]ÉU<$ ƋUt$|$$W UWVS ý}uED$E D$E$6tAxEut&.&9t<uƉt$|$E$ [^_]É<$N UVS > 3u Ex8u9t<uЉD$t$E$| [^]É4$ ffffffUWVSH }EUċEG,4@4E@U {}X E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$藼uH[^_]à zE1H[^_]É$V'EEFEȅE@$VEyEGM+M9E O(U @9~F t$vhF E@ffO@EE %WHUUȁ ‰ЋM ȉFEfFE@EȃvA}$EJMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$gG UMȋE@A%GGfGfwu}G9uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$HjMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$B%UčJ‰Uĉy19uĉ)UBHFBLfFMEy19E0B,4v4BDfFt$B|U$du 4M$mSE u E;GTuO,u u6uč @4PA!EE;GTG8 <$<$2 EE EOT9E M MO(ʋH98OU9U+GHFGLfFfFUO9{UGDt$G|$jcu2 ȅM cUuUȋu6O, 4I49~X}uEFDfG|$F|$bFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 @!78u E<$GG8 <$gEuĉ׉EċE MO(@9/(E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM EG8 3E RW9)ʍBE <$9ENG8 <$n[tUWVS 8uE0E,EP@,Dt@ 1H48~xfHf@fuEfx~OE@uFE@#h2u 7:tx}$K t$KutE1[^_]f~E@tfx~݋E@uD7{uGm뱅t}$K u%D$P7$G}$J QiUEPT$ PT$P T$P$11^]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]z뭉U델[^_]UWVS P7@@Mt7J y -ED$D$7@$,]A@7#A@t2ED$D$@$\B@7#B@~ED$D$@T$\A@7#A@7t $E[^_]uX~t7-ETt-D$D$BL$-\`@7-EfED$D$@L$[`@77[^_]7-EUWVS3 uEӉ΋}$EP, 9u;u t5 D$E D$ |$t$$]K6[^_]èuUWVSĀ裒 ED7Eԋ3 ]P7]JxV HJHUE@8@u B8@U B@ ]-t$D$7E@@D$ZEԋ@@H D$u4$]蕗f8E@PhtzEԋs]sEX78 S,11.&.&.&ȋ ˃9|u 9> Eԋs/E@ Eԋsu EH| P,CEfEE}Ǽ7}]qM I, 9quV2xH uV p92fEuu؋sU;z)R,M<} :MMUQыP,UMUhyEE  EuFD]䉃  FH fǃ   ED$F|$#"iFLf FHEċEԋM؅~E@,}D8uF,}8E̋@E;F\E̋@ EЅI}9|GEЋCEE@,]] R]܋]̋[UЍ.&A@uUEPrLuȅ]URu72@ x]9]ΉMEu FuE܉D$4$]u (]ԋHP}|$E؉$E[E؉C{9}(UEH}ȅt}9}E}89^y1ۋE<9|"E@EčPE9E9U܉bƋUԋSuE܋U9}|:}EcUċE܉D$4$]UCEԋ}U9{tSEM9Hb{E<79UR zsC}]9]EԋEP:xE@EH u;F}F(9~E 3tEu;Cw|MȉE3Fu)F)Ǎ)ƅ~ED$4$]utʋMȉ}yEE@@LEEԋHE@8ZZE8tE]D9FEP]9ډUMUȉ$]6 EMЉÉ؉؍][ )؋])9EUr8^y1ۋE<9U܉[^_]ËE7E}G}WX@#h2t $0]-D$D$Eȉ$SEԋ}uW PEw P,u2 R4UE9x]DFfFt$D U$!UDfF4E9u]䍃*tD$ E@ xkE}G}WX@#h2Et @@D$$];[EH7EE@9SD$$]EԋCB[EEEE܋E;E^]9]#}E܉D$4$]$FNj]ԋSuEƋE9~@9M9CSD$$EEԋKiSKD$B$EEԋCCEfED$D$E$]JEԋCEYEԋsSE@9 EPSP$#]7Eԋ@$a ؃[^_]Ëx}HJHw1 ;G}7ƋW,tGD$BU$]UB;G|ɋELME@8k 79FEЋEP z@tP N][]̅  MċEËM)ˉ]D$\$ ]؉\$D$$]o*U܉M2D$E)ȉD$ u؉t$EȉD$4$]-*EE@ ẺD$$]t-t$D$$N1ҋEeE܋E@vE}E;xEԋuFECFCEԋXE7E@PhE@E$]SK}GD$G$Y3]OEԋE`8@@$]Z$$ ]9EH7E̋QY,E1ލ4}R,z9~uLIR~1ME܉]9uT$U<$]MUuՋE܉EűQpY,ЃE u؋E<}܋4;aUR,:z9~_y}R~}419uT$U<$]UuՋu؋E̋Y,QB}9~E@@%E9u~_})E1U܉M0E؋@D%EU׍FUM9ƋPB%M9uU}}E)Dž]9E̋EًU)E9EEE}ӉʋuEEȋE}EЉ]uċ]9]MEȉE܋ZE@,u܋xB,p1҉]M؉M9}L$M4$]DuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9E@uԋsEEzE̋Y,E܋4mEpuE܋]؋}̋q,"XQ9M$mE@8MEԋPuFD$FE܃$M&:U܉\EK]CD$C$ESPSPM؋E̋EuЉ9}9}}z}ӋBM!EuȉuȉM}ӋB9E܋u9~EEBDu9, tT, #FfFEBLfF9t!BDt$B|$]Hu E̋sE;  [?1ɍ, UL$D$ <$]U€w֍V)ƉL$D$<$]mljEЋE̋@  $ EȉEu9~uE})E؋u])؃EEH,E9w]]]E})uu]9}u܉1}9| u9}9}9}E؅,9E܋u9pwE䍐, E̋@=vm EĉEE܋Hىωָ tftEĀEā =wEဃ)ȋ}܋OωփtftE܋uЉpE̋BD$ D$ED$$]AE؉uE\U܉uk|nd`t$D$$]EDd]-t$D$$Ed ~Mċ]CED$D$ E؉D$\$$]w U܉M:D$E)ȉD$ u؉t$EȉD$4$]5 EE@/]-L$MD$$DU܉tE܋M؉L$D$E@$DBE}̋R, }9}uE]E@,E]EE9E|EH,EE}؅'E@}ԋsE؋}9Ef r uv'E܋HE̋@1Et$qt$ $] W9}u܋]䍓, T$UċE܋@$ U(fv[1ɋE䍸, E䋀$ EEpu@E܋}ȋE)NjE@X0ppuChG}uNű;JHED$ut$$]g-t$D$$eBD$D$ D$M܉L$M $Ht$D$M@@p$BD$D$ ED$D$$M@l|$$ft$1|$$AE̋@D$D$}@@0$]ft$D$$|AD$D$ D$D$E$^t$D$@@p$5AD$E܉D$ ED$D$$tuv`D$1D$ ED$E܉D$E$]1-U؉t$D$E@$]~@U؃9u1҉Ut$D$E@H$]E@U9uyD$1ۉ\$ ED$E܉D$E$]|$E@$e-t$D$$?E)ED$D$ D$D$E$]E@|$$dt$D$$m?D$E܉D$ ED$D$E؉$]1Hz }p D$1D$ ED$E܉D$E$] 1-U؉t$D$E@H$]>U؃9u 1E@Ut$D$$]>U9u HH_ppu;t#t}uNű;JXLJED$ED$$]b-t$D$$=D$D$ D$M܉L$M $t$D$M@@p$=D$D$ ED$D$$aM@}؉|$$]ED$D$ D$E܉D$E$]E@t ]̋ ;qtE؉D$$]Ra-t$D$$(<D$D$ ED$D$EЉ$]E@E؉D$$`-T$D$$;D$E܉D$ ED$D$E$]SE-Ủt$D$E@$]H;Ũut fhE-t$D$E@$]:u0L% E̋u;p E-Ủt$D$E@L$]:Ũu^D$D$ ED$E܉D$E$]g|$E@I!t$D$E@L$]:uUWVSq xw]D719X‰PtFC:uk11ɋCD$ CD$C D$C$rtB[^_]]C9uP7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]Up vL7$]UWVSp DŽvu] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$u>vF9u+P7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSo uut$W$vu[^]UWVSo Úu}GDEP798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$&tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$XtD$D$<$$1EUhn atL7$]ffffffffffUEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSm sU} w ty1 f.&t6~RutF$;u1[^_]ÉU$t8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJU @ E]UVSl rutv$u[^]UWVS l ôrMq~X1Q,zQ~>1҉EM׋q tMv$$uME9xԋEM9A [^_]ffffffffUS] t[UӋE+v.&.&.&.&.& ȉt %1ȃ9u[]ËE[]UWVS]} 1115.t&.&.&.&.&.&.& ȉt %1ȃu1&.&.&Lȉt %1ȃuڋK tBu1ҍ.&4Ɓt %1uۋIuċu9 [^_]1[^_]USj ÙpE t$D$ $}x) 1[]É$91[]øUWVS4Hj =pU܉   E苃 E7E@E@pE؅"7EE싳 tRyF%y }93}Ѕy}Ћ})щ})9uM)9IBljы U)y<93}}Ѕ}}A87L9+~ EЅ[D$D$E$m1ǃ  EE1ҋ u}u!7E8 ; |~)EЋEHAE̅q}؃E9|9;[T$D$Ẻ$0E@p ǃ ; QuJ `7l[T$D$$i0 E8uuE@@l8 } ; MJ Alu  D$ <$l…y )Љ m t}艻 u䉳 4[^_]ËE1"7EEU苳 u}4y yFȉE!7E8`7)}ЋEHAE̅ ; }tM؃99R D$  $J) ǃ  ; y E 9U Ǎ["t$D$$\. ; ~a x E@@xu XD$<$y)  ;  [? t$D$E@$-  ;  uԀ> u)ʃ<7E Eԍ[EișǍry )ƋE9E@M؉L$D$$,  EE89~1$ & _$U ;  P7uR,r@[E؍ E0   } [9 EP, 4v4~}}܅uE@}؉|$D$$+  y}9[D$D$E؉$+ǃ ǃ UN;H@uRFuLf~-$^ D$ D$F $V fI E@$ =   tD$ Eԉ$9…y )Љ 늋@l[T$D$$v*  E9 ȉljM$ gf t'D$ Eԉ$y) $ Aǃ  D$  $.y) ! E)ȃ9E@[D$D$$F) 9  Ǎ["t$D$$ ) ; ~b E@@xuƋ t2D$<$Oy) $ 4$됉Ƌ  t*D$  $y) $  E1UWVS _ äeE苃 <7M19|    9 87E79 9`7E-E)$ Eu ǃ E98.@@ltˋM t‹UT$D$$J'뵉  PBh9}d T$t$$ LƅtDE; t4$x U -D$D$4$&uU1    [^_]Ë `7Eu@@h9ME4M䉋 E;0 GE  7p >u~x`7U-t$D$$%mtGUt @@tut$D$$%@@lu$ mu ǃ 87E 9P))Ή  $ 둋 xǃ U\ bU U U  U 11]Ul\ ebU U U  U E1]ffffffffffffffUWVS\ b%D72H7EP7]19u9uVF,E1҉MEF~`CH1U.&.&9F~59uuS9~S 9}͉9FˋU9VMIS[^_]Ë]S~Cs, 9tɅ~UMڋXCӉu.t&.&.&.&΁9u9uu9u_Z `7BH8~NHD~GBlthtËuu拐tt 1Z `7@ xUWVS$Y _ƉEY7EBH8ˁ=u,7}@D-=}(7LJ D7Y\A`fAdBt%]-D$D$ $!EBt8]-D$D$ $!P7p2!P@EBlhzǁl2ǁh2BxT2@@Tth2t h2t h2t h2 t h2 @t h2@t h2t h2E[A\sfǁrǁt5Wfǁ~ǁ;fǁǁfǁǁfǁǁfǁǁ|fǁǁt[tfǁǁ~>Rr&.&ff@f@@ 9uǁp"ǁt"~@p"p".&.&.&ff@@9u}싇 %ȋtp"xt"LJ LJ 2H7EP7E ItiE9tE9tE싘 ZHB~&zr,EEz9uuMD$$]R[MIu1$[^_]ø(7ˋtiǁl2w}UM܋HQf.&% ؉9u9ut͋UMD,7놋tǁl2]tOǁl2[UWVSOT @ZEM ]fMf]f_(7;7Nftv,7969+D7l2tot"уt>]f9p"t"]fp"]fr"1[^_]Ét"ufp"ufr"ft|WfffufEftoEft\fYfEN}f9r"at"yfufEffEfEfEfEfEu%UVSR ­XEM ]fD7;B`N4f1Dfl2t1[^]ft_/ftMfufft2#ftEfuffuffufffff끸yUWVSQ WEM MMUUfD76;F\<@<UfrftMfv7? tV2vtCL$҉T$ UT$D$4$>-T$D$$1[^_]øUQ WEfx?D7;B\}1@rU f tUf vEf1]ø]P VD7ǀtǀx(7 t% ǂp"ǂt" u1U勀 %1]UWVS+P $V}M D7l2t^ftfvǀx(7 t) fp"fr"ǂt" uI1[^_]fPfftifuft_Bfthfj` %=1[^_]fuf/%뛻늻 O UD7h2UVS N TD7l2tt f@d [^]7Rt-D$D$$ 7M!A@f@d [^]UWVSgN \T tP7} 3x@tOu fD7f9pdt6l2t3P7fpdQ@E % ЉA@[^_]΍N} f_f|SP7UL$2@l$,;-L$D$$UUULf`L$2@h΍N} ff|P7UL$2@$:-L$D$$nUUULfL$2@t$J:-L$D$$ UUP7$UM fxGUP7$fUM f9Ut'PH1[^_]Ë4&4>9Uuك׸[^_]UWVS UztzB EBE wGGtXNjEB_ ])؉ƋEBWU)Љ xыOM9NjO9}_W,9~ ! U9u뗃 [^_]ffffffffffUWVS@-I &OE}E E EE E @$]ÅGE؋E @ uWUXts E07E_E))9~ىL$ED$<$]؃@[^_]à u:G1@[^_]ûkEGy1Gڸ@[^_]ËG,M؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9rTU).&.&.&.&.&AFAFA F AF9sڋUB E H %BfZE @E܃vKMȉ]ĉ}}$]VM \_ XG 9uuϋMȋ]ċ}EԃUt3uމr}ߐ)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]{L<$OH<$]7E9GTG8 <$]h~E D$<$], MԋUЉE E9-]ȉMĉ:BD|$B|U$]|UBHGfG9}s*w tUv$]+uUG 뜋]ȉMĉUSE LKUT$L7$]UWVS )E Ku}ED$E D$4$t} u [^_] [^_]UWVS D JuL78E D$ED$<$Atu } [^_]X [^_]fffffUWVS|mD fJEMu ME $])EMqM$]_EEÉEMAEȋQUċE @U zދ]07]t_ @ U$ ]ÅyEEę)EEĉEċuMqQ)փE9yUċAEȋE uEE07EEkEĉEE U rUUEσ tu[ $ ]yEEę)E]É]EE E  uFE EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9wU@t)G$fE9rFUv.&.&.&GFGFG F GF9sڋEȋUUċuV}ỦUUĉUUȉUUUu΋^,EEEF@ED$ED$ED$ ED$ED$4$]v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(5: *@EUM؋ufUވM݋U 1ɋU EEԋ}B.Et$$UEx}P$u܀G$R Ut}EMU E‹E Et~MލAf qCDXЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wCDXDž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS!8 >UE t\J;A t];tUZ {$u_Z[pۋtC R(D$ t$D$$b1[^]ûu11Uv7 o=  D$ ED$E D$E$1]U,7 %=  D$ D$D$E$1]fffffffUWVS6 <ÉU:GEG<\<^ЍtB.z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PB. Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVS. 47t t~9t $Q EED$D$E $!uI tG@t  Ď7  @x [^]É댋E[^]É @uUWVS(. 4UEtBEE7u4$ UT$ D$D$4$bM踵N)‰),`EีNe)‹E),`Egҍ) nUD$4$F ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$ UuG([^_]1([^_]ËH n([^_]UWVS(, ï2UEtBEE7Eu4$ UT$ D$D$4$}kLЍB)_E܉eЍBE)_E>)<;lD$4$ ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$ MuՋGy([^_]Ë;l@x([^_]UWVS(Y+ N1UEtBEE7E܋{u4$ UT$ D$D$4$裴}-?L) RЍ)ЍYGEeE)  IȍE) GE*SRЍ)<;`D$4$h E܋;`AQ tUy$E܉uv.&9t(~suED$$ uދF E܃9u؋E܅tЉ)43lD$E$ jEOMEuu4$ UĉT$ D$D$u4$TuĹ-?L) @)ЍYFUeȋE) @E)4FU։*SRЍ)43`D$E$ }tux}cur}ulGEEt}fOMrBEER3n$AE'u땋3l$B3`$pCk}t EE$UWVS1# &)E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىUi Uƍp@Hπwx9}몋E D뛉U) UUWVSy" ^(084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0Zt,8C,{0K44y0q 1[^_]Ë0 8a$0ە8 t@0@4$0諕8G,tG0ƅ`%0B. 1Dž$Dž(Dža`,4:~Jwɋ04oʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0oV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0pው,4O&4PD]Em PUT$,0 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$0yF8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0Å8X,4H0@44,-0 1s0 ,40 ,1!4e0 1,40 14c,0_ 14,,09 ,&Gwҋq1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]UH AU|]UWVS. #}u >}0D$$@+D$t$$`‹U$4UtUuE2$ƅ_EE[^_]Ë}ut$` D$$M$E2@ x tbMut$^tD$$EQ< D$$$ Ex tUE9ED$D$ht@E$o tEftUft IA(Q|uEt E1s$t!D$D$$=RB(~$\tD$D$$ RB끍 D$$} D$$_t$stD$$EPtD$$/UVSa VEtD$ E D$ED$E$ƋEt$0[^]ffffUWVS ƉEωD$$ tB4$ո ƀ?u1)9tXzzt"D$|<$m …uۉ<$蟸 9t 1[^_]Ét$ED$<$6 [^_]ÉUt$ED$<$5 Uu[^_]UWVS$E *uEUt E<t] $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%]辆]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]ljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$kmUu$pEE܃@[^_]ËMAOMփ_EtfEtǤ$]pE܉$RpEP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$foEp@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMxn 11EMIuE4$JnE܃@[^_]px11Eu؉4$nѨu2u>M=u$IEUw r}fm밍1u$ E0UUWVS UJEtB9swt$U$jUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$cdU[EfUWVS uVzF9sHtT|$$it8~VM f FHNMLF [^_]Ëu1[^_]É<$cUWVSTT MED$,E$6 D$|$]a: xD$|4$]l HM4$] =M t<$͗ = E$]贗 =n D$$P]fÉE@ t$$Ut E t E D$,E$*E, EEEB.EȋEE u<.tk)ύ)ȍ,D$4$ t [^_]U E=w L]1]UWVS õu4$谉 UT$ D$D$4$5i}-?L) RЍ)ЍLGEeE)  IȍE) GE*S)ύɍLD$4$ t [^_]fffUWVS4 ufF(}ȉ|$$Rq t4[^_]É<$PM1".&.&.&t9 ufV(4[^_]UWVST Iu   Ǝ7fV EĎ7 4$&V(EfD$FD$  $U蜦=UwDE |)ʉM싆t7T$UD$E$[U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$Ď7[^_]ËUыU|UVS utgF$ZF$ZF$ZF ${ZF$$pZF,$eZ4$]Z9  t 1[^]ǃ    @z k  @tÍ'ffffffffffffffUWVS1 &lj$U D$$ Et$UT$U$:9UuED$$ 術 1[^_]ÉUED$$ 聓 $<UD$<UD UWVSdV K 9EEEEƍEE> tqE9D$t$U$:Utˋ$ <$;UDŽa 8Euu>vt1< tHv0FFU$;$;UDŽUWVS< ç 9U1ҍ Ӭt"u Džguԉ@!&.&O@6ƒ:uƅ/nFu$W>$8<( .Ɖ$9D$v9t$t$ D$D$o4$x@E+<[^_]rD$@|$/$r:tW.&P:uVpƅ끋1$a8Ɖ$p;Ɖ$?8D$-8$!8D$/;$8D$7賢$苣趢$8#v$ƅD$/4$/tY1ɉL$T$/T$T$ |$D$4$t$,vD$$h1҉T$T$ |$D$4$u빉ovIUWVS u}D$:4$T t!D$cT$$ t|$E D$4$5 [^_]ËU t考 [^_]UVS ] RuD$:4$T t!D$cT$$d tE D$4$q [^]U Ewt ]1]ì]UWVSh òEu 9M9}xUED$ ;vD$D$@U$U<UƒE9~ЉEΉ )t$|$ʉUM$3MUӉϋʉU$4uD$4UDM !}|$t$$~3uU+u h[^_]ËEUWVS`S HEM 97upUMED$ AvD$D$@U$UF;UD$$ 衊 EED$ML$ED$i1;EUT$$ u>i %!`ut$L$$'1U+uW`[^_]+ U$_3ED$P3UED跌 CUWVS` EU 97t$\pwbtNT$E UD$ T$GvD$D$@T$$T$9T$Mt>$uT$ U MT$L$$jk L$\+u`[^_]ø{UWVS - "Exw|Mt_ƃtAƍU$1ED$1UED [^_]Ãu$1Ɖ [^_]UWVSp s}EU 9u]]p3MmLm8@EUEߺ81tEI}E )|$t$ʉUM$]~/MUЉ΋ʉU$]0}D$r0UD܉ !\$T$$]h ]U+p[^_]ê0f%CD$D$ ]D$D$@}<$ 7mo8뎉f>~%E~LSC9u1Yf7k]  ]uUS) EPw*Ӑt諈 -[]ÃӬu$'2[]US EPw*ӐtV -[]ÃӬuU T$$ ` []UVS w luD$:4$L t!D$cT$$~x tE D$4$ [^] - [^]UVS uD$:4$K t!D$cT$$x tE D$D$4$, [^]ËE D$D$4$ [^]US y nEMPw*Ӑt - []ÃӬuL$U T$$, []US UBwÐt1[]Ãìu$^ []UVS uD$:4$vJ t!D$cT$$v tE D$4$ [^] - [^]ffffffffffffffffffUWVS A &uE1ҋEL xtGEljу1Uvt 2uU@u [^_]UWVSĀ ǡ}E| 9xƋE pLA EL1 E|1E]ELI Eƒx  EB A ǁE9uʋE%u  m EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËUL 1ۍUL @tBE,tʍЉʍI$ wu1묋}LA E@1ۍ,EL1 EEEu1}}}8+tDAuEƃ@E}t,ى%I$))9D E9u }C\uE̮^@] 1҃DD  u̓E9uEL- :*.&@t$E̫Du۸@u܋}L ƇL  }8̮T 8L 0u}lL ], ]Ec M{ }~Et M  ЋU 1ҋMDŽ, DŽ0  r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹E,lt a1v`,tEUEEt @Eǀ -]UWVS` suE EM 9ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EEL- EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEE E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋL ]3L ]3L ]3L 3L! 3L" 3L# ]3L$ 1EEԋL% ]3L& ]3L' ]3L( 3L) 3L* 3L+ ]3L, 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}uL u3L u1E䋼L% u3L& E1ljE3L 3L' 3L 3L( 3L! 3L) 3L" 3L* 3L# 3L+ 3L$ E3L, }m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1L E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEE$ UWVSP譿 EЋ}] ] 9EƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍQv]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝ, }}̍l?tLD$ D$\$$.t&Ҁ09u$?uE]Ј, E؃0 , }ElủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝ1 ]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍTvN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍD ${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]/UWVSݺ E 9EEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]UWVS,[ TE؋U 9E]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSDy rU uU 9‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$: @D$$  @D $9sӉ t׉D$@BD$ <$L$  $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$譻D$$葻(D$$P4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$vtD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*|UWVS3 Eu 9E1D$D$LI $iDžDž4$8$u vt$4$Ɖ$i^ DžD$$8vu[x=uUT$$l D$$: DžDžDž DžDžg|$4$-pt5tmuIT$$x'멍T$$ye뇋$01U+Ĭ[^_]ÍT$$.x+t$`v$^ uDž't$hv$k^ DžOD$$ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$t*D$ |8D$D$p$$.[4$NZ |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$D$D$p$)$&D$pvD$@:.$7(UVSۮ дuv$H‰)Ѓ[^]øh`UWVS4蕮 ÉED$vut$u 4$Y u3D$ ED$$EE8$E $]豳h`)‰UE E h`9t$u+E E܋E$]W NjED$ut$u t$u܉t$ vD$D$blK E$LK t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃vD$D$b}<$WU^D$O O ȉD$$EPU9uD$]^K _K  LK ȉD$$dEPU@D$D$4$E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVS裧 ƈ9Ѝ,PH USM HvH?aЈ>DLf`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂ L $2?ƂL aD L Ƅ L $,T$ vT$D$$7H4$tI `D$HD$T$14U+[^_]Íxƅ?n)nOPEȉHTDUWVS艞 ~u(}  9E14$UH $?$u 1H t $t9u틽)x  @4$$D$(|$4$ D$vD$4$T$|$4$}<$T$D$(L$<$T$T$<$$D$(L$<$v|$0, $}$lj~T$,D$4$&Dž0Dž4Dž8Dž<$D$#,D$<$u։fǃL $1ƃL $ D$D$L $ dD$xvD$ B$et$,$m1<$ʉ)Ѹ%I$))Љ)‰ ;$D$(D$<$ ɋoD$,D$<$|$,$:L 򉓌L D$06 < ȉD$$L L D$17 = ȉD$$L L D$28 > ȉD$$TL L D$39 ? ȉD$$L L D$4: 5 ȉD$$L L D$;T$$L PL @D$D$,$(E+[^_]D$,D$<$ ɋ$D$(D$<$l|$,$y$D$(D$<$6p D$D$<$ ;$D$(D$<$[ D$D$<$ &(D$<$$Dž0Dž4Dž8Dž<Dž Dž Dž+ffffffUWVSʗ ÝMMUu 9ƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$ͯD$@|$<$0E D$D$<$|$$,<$耯D$@t$<$D$t$<$ϯ|$4$E+[^_]Éu4$ UT$L$4$qt$4$膱Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfffffffffffUWVS葓 ÆutJD$ED$4$NjE9t58u0M 8"tE 81[^_]ÃuE M UVS$ EU ]~<Ít&.&.&.&у? H9u[^]UVSǒ EU ]~Íу? H9u[^]fffUWVS8q fƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$et8[^_]É<$uEĉ|$4$2Eă8[^_]Ȗ ½Et'tu-E t:v]ËE t#v]ËM t v]1]Í`v]ÍWv]Íhv]UWVSZ Ou} 4$uw[^_][^_]UWVSd u}$}(E($<EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$<<$ UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$5UtE(D$}<$ E0D$E,$ <$' jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVS薌 Ëu4$u1҉[^][^]UVS^ Su4$u[^][^]UVS# u4$Zu[^]}[^]UWVS ܑ}u <$…uL}wPU>…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSX[ PM $C5 ƉEE$}ljE4$pƉEE EEEED$ML$}<$/t.1EM $M $v4$nEX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS ޏ}u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVSr g}u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVS }u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úU| mE##+0ፂv]Í@$]Í ]ÍL ]Ív]ÍDx]Í\x]Íox]Íx]Í ]Í ]ÍL ]Í,x]Í ]Í ]Í ]Í ]Ív]Íw]Íw]Í,w]Í>w]ÍOw]Ílw]Íw]Íw]Íw]Íw]Íw]Íw]Íx]Íx]Í ]Íx]Íx]Íx]Íx]UWVS " EwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu$0 tffUS o hU T$D$U$ []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVS5 *u Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG Ú ŇUM ̲tt M U],]UWVS4蔁 MU 9ËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&D̲ɋtxD$$̲ҋtFD$4$2Z ̲tt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$G؍ŬUWVS s lE}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$]' [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0V~ K}wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;Hu̲tD$$]E+u <[^_]ËUEU Mt t]%]UWVSXy ÄuU 9E1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS [ au} FEFED$E$?$ug$E D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=uztUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$t? [^_]øUWVSXY _}EE 9UE1D$E$ƋẺ$E]} Kf$OME Eĉ4$ U9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$BYUĉT$ D$D$u҉uȉ4$i4$ ‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$qi4$i 9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$h4$ ‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$_h4$W ‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉf賁UMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVSS YЍ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSLE KuE 9U1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFT#rUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVSB xHlj(UE u 9, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(mUWVSd2@ 'FML$U T$ 9D$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$~!D$0 "D$0 r!D$06 T"D$06!D$0f !D$0H!D$0* !D$0 6!D$06@ !D$0I!D$0 d"D$0qF!D$0v, (!D$0Xa "D$0:b!D$0!D$0|!D$0g!D$0Nt"D$0V!D$08!D$0h6!D$0J!D$0,!D$0!D$0!D$0,!D$0mf!D$0H"D$0x *!D$0Z !D$0g@:.D$ D$D$y$ a@:.D$ D$D$5z$ڙ@:.t$D$$Nt$ D$D$X{$藙 @:.D$ D$D$y$e@:.D$ D$D$5z$3@:.D$ D$ D$| $@:.D$ D$D$z$Ϙ4@:.D$ D$D${$蝘l@:.D$ D$D$0{$k@:.t$D$$t$ D$D$X{$(o@:.D$ D$D$lz$!D$0@:.D$ D$D$z$谗5@:.D$ D$D$z$~@:.D$ D$D$#z$L@:.D$ D$D$z$@:.D$ D$D$Gz$]@:.t$D$$\t$ D$D$X{$襖@:.D$ D$D$z$s@:.D$ D$D$g{$A@:.D$ D$D$y{$@:.D$ D$D$z$ݕ@:.t$D$$Qt$ D$D$X{$蚕@:.t$D$$t$ D$D$X{$W@:.D$ D$D$Hz$%ffD$1ffffffffffffffffffffffffffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS  ]E81}8tmCC tvS(s$taD$D$$ЉƅtoC@8@4?E D$$tt$C($S$C [^]K$C C(1vиUED$ E D$D$E$]UVSEM t]X tVP$tOPtH;uDB-4?w7t-x:t&(r@1 w#EB?EEE@D$D$$]@UBu܉F0B??E E@}EmEE@N?EP B M}]؋u.t&.&.&Fǃu}M]؉uKwE*]ЍluFPFX FTF\FG?} mmUԋE@H?}؃ U E܋]ȉX PUԉxu}~<}~@ỦT$lj$]\/ }ȋPU]ԋ@E؋Fߋuԃ(tftE@t E@ >)UUԋExD})щHDE@uFDF:?E@}W$tB}GDG;?uV$tB$uFЍt&(M9}U؋u.t&Fǃ9u}MU؉uffB " f= fuN9}U؉MuԋE).&.&s9u}EEUȋ]4EuFD]FH?.)W,WUUMЉ‰EE!MUЍ D89U\ uuUԉ}}|;v.&.&.&.&.&.&.&BEME!MMȍ MDM9 uu}؉U)11]؋uvFǃuu)ƋE@DCE@ E@ : t$EԉD$UB$]gUB)uuԅRuU؉]ԋE@$t]XE@t @ E@7?11U؋] MU؉]ԋUvm)E]艃{DE@M?UuMU؉]ԋ}EG<0EЍXu܉FE@Q?EuMU؉]ԋ}uVdFh ^`}mw EЍ E@ E@  t$EԉD$UB$]DfUB)uuԅRAE@G?} EEuFHUVLFK?fM9}]؋u7t&.&.&.&Fǃ9u'm)EU艂zD Eǀ@??N}MU؉uԸЋU!Ћ}GDGDU)]$}}M]؋u)&.&Fǃtu[}wr}M]؋u}M]؉uԋ]̉؋u)}G}G E@O?EpEE11]؋uh}]؉uԋu]^DF$tXVt ]C }G9?EEG}M]؉uԸЋu!]CHu)U[EЍ{EPD@B?} EESz@EЍ`|]܉CE@Q?EL}M]؉ut }1uF$t @0V EB))9EEЍX>tBO)ڋ]ڋ_ۉD$T$ $]b]CU܉B0S 1 EH];XEЍ|U܉BE@Q?EEE)N9'}U؉MuԋE4.&.&.&s9u{EЍ{]܉CE@Q?mmUE}ȉU؋uԋ}Q })EM9MBMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋u}~lbuu}؉UԋU}]Zf]m)uUT$UEԉD$uF$]`FUUQfU_EȋU;B4EE1}}!EED$ED$uF$]w`FEЍ{ ։u!މ Mt M9M]]}}؉EEF&puMu!MM΍ MtM9ou]}؉EKEXL@I?E@l@E?1N9{}U؉MuԋE6v.&.&.&s9'uv}ȉU؋uԋ}Q})E_]MU؋uԋUwHEЍlQ&].&.&.&fDSt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]r|U܉BGQ?uE u5UEP$t EE@t @ E@6?11ɋU؋]E@ TfvPEfED$ED$uF$]p]FF7MM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)u}twruԉփRu=E@l@F?XdPhUuEcE@ y%E܋]ȉX ]XUԉ]؉XEUP<]X@E-UUEEyYEX(u@(D$D$$][uFfED$UT$$[FF5?11U؋]]]EEx@O?]Yf]^}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$] UM.|]܉CGQ?pmEUB(uJJ(vLmEЍ{-EfED$ED$uF$]ZFw9ȐruF1ɉNL$L$ $]aFU܉B0eF??1҉UAE]ԋEЍ|]}GpGTG\L$G\D$T$ GhD$GdƉt$$]V J|U܉BGQ?;f tURGmm1EĉUeE@=?11ɋU؋]E@O?UVS]iu9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0t?t*U UMu[F [^_]=>?u>D$D$$^ML$M L$$t^9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ EԋMM 9E܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$IExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffffffUWVS ǣuMx11D rt"E pt&.&fDU9ux.t&fG0UofxZUWVS4 Ǿ}̉ÉEЋ@,E܋{t-Ek@^S,sutftߤEw uEH,@lu6^};s9sӅz}G8‰ىuFl؉Flv,)9_ʋ}?EE؋})EE@,u~89Edž3)ƃj'E@,uFl‹uF\l] Lus<9S} 5E19믺}O\)ȉ9ۋuVlv}4M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^t]FDVLfDPTT$D$$)dž% @9E,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 豟 EuE E]E}}}}U M$:18FV ~$h}uEMQ~HHtk_} U}KB/&} } M}W} }؉1MD$D$F($V ÅMF0@*x@H0x,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]MV$MV F(d V [^_]øCE`k-@F4$U ED$ED$D$D$D$ D$E D$E$j]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8 C,{@uv@ CL{DMqD-{uvueu^CMQ+QS $ | 0 E[^_]älfbft.t&eft&W(f.t&fu5AfY{8f3f+0f(-f%*$E1E%ffffffff֗ ϝUWVS<輗 EċM uS}׃]f.&.&2A3Ѓu߉׉MEEEE]čUȉEuϋ1EԋM3OMЋU3WŰu3w u܋u3wu؃4E‹EE܋EE؋EU} U E34}Nj<1}}Nj<1}}Nj<1}Uȋ1EEUu} m Eu] 1}3؃uU3Q1к}3؃uU3Q1к}3؃uU3Q 1к}3؃uU3Q1ڸ}3ڃu߃ȋ]č1UM 1ω32P3<H1ω32P3<H1ω32P3<H1ω32P3ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+L øU)9fGHOWGHOW)ULuuJE0uTUU ھ])9 fOY_wWJOw)ًUML fu苜L]u'ME;uMU]u+Ɖ кu)f9OWrwWGpw )щfEDE\uΉ.EuE]؉E$]ˉ]ERD$U_NjFD$U$藎tE 8" [^_]1 [^_]UWVS Vg Km}GtUD$UN_ƋGD$U$1t+4$艦=yarauE 0! [^_]É4$諣1 [^_]UWVS f l}GtUD$U^ƋGD$U$贍t+4$ =tciduE 0(! [^_]É4$.1 [^_]UWVS\f QlED$E D$E$.tSEt4}D<$;^ƋED$<$!tE01[^_] [^_] [^_]UWVSe ýkED$E D$E$tJEtZ}D<$]ƋED$<$荌t54$=yarauE01[^_][^_]É4$[^_]UWVSe kED$E D$E$tJEtZ}D<$\ƋED$<$t54$:=tciduE01[^_]L[^_]É4$R5[^_]UEU E MMM]GUEU E tcidMMM](UVS5d *jE D$E$gwƉ$舣=tciduE0[^]1[^]UVSc iE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS c ÁiE$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]US2c 'iE D$E$dvUT$$c@[]USb hE D$E$+vUT$$@[]USb õhE D$E$uUT$$A[]USb |hE D$E$uUT$$;A[]USNb ChE D$E$uUT$$oA[]USb hE D$E$GuUT$$xA[]USa gE D$E$uUT$$A[]USa ØgE D$E$tUT$$A[]USja _gE D$E$tUT$$PB[]US1a &gE D$E$ctUT$$B[]US` fE D$E$*tUT$$B[]US` ôfE D$E$sUT$$B[]US` {fE D$E$sUT$$B[]USM` BfE D$E$sUT$$B[]US` fE D$E$FsUT$$B[]US_ eE D$E$ sUT$$B[]US_ ×eE D$E$rUT$$B[]USi_ ^eE D$E$rUT$$B[]US0_ %eE D$E$brUT$$B[]US^ dE D$E$)rUT$$B[]UWVS ^ ñdE$D$9t,ƉD$E D$E$rlj4$7 [^_]1 [^_]UWVS Y^ NdE$D$09t,ƉD$E D$E$rlj4$Ԛ [^_]1 [^_]UWVS ] cE$D$8t,ƉD$E D$E$qlj4$r [^_]1 [^_]UWVS ] ÉcE$D$l8t,ƉD$E D$E$Yqlj4$ [^_]1 [^_]UWVS 2] 'cEU$T$ 8t,ƉD$E D$E$plj4$讙 [^_]1 [^_]UWVS \ bE$D$7t,ƉD$E D$E$plj4$L [^_]1 [^_]UWVS n\ cbE$D$E7t,ƉD$E D$E$2plj4$ [^_]1 [^_]UWVS \ bE$D$6t,ƉD$E D$E$olj4$膘 [^_]1 [^_]UWVS [ ÝaE$D$6t,ƉD$E D$E$molj4$$ [^_]1 [^_]UWVS F[ ;aEU$T$6t,ƉD$E D$E$ olj4$— [^_]1 [^_]UWVS Z `E$D$6t,ƉD$E D$E$nlj4$^ [^_]1 [^_]UWVS Z u`E$D$5t,ƉD$E D$E$Cnlj4$ [^_]1 [^_]UWVS Z `E$D$=5t,ƉD$E D$E$mlj4$藖 [^_]1 [^_]UWVS Y î_E$D$4t,ƉD$E D$E$}mlj4$4 [^_]1 [^_]UWVS VY K_EU$T$x4t,ƉD$E D$E$mlj4$ҕ [^_]1 [^_]UWVS X ^E$D$4t,ƉD$E D$E$llj4$o [^_]1 [^_]UWVS X Æ^E$D$3t,ƉD$E D$E$Tllj4$ [^_]1 [^_]UWVS -X "^E$D$M3t,ƉD$E D$E$klj4$觔 [^_]1 [^_]UWVS W þ]E$D$2t,ƉD$E D$E$klj4$D [^_]1 [^_]UWVS fW []EU$T$2t,ƉD$E D$E$+klj4$ [^_]1 [^_]UVSW \E D$E$7jƉ$X=gntst 1[^]É4$'tU[^]UWVS V Ý\E$%%t,ƉD$E D$E$tjlj4$+ [^_]1 [^_]UWVS MV B\E$$t,ƉD$E D$E$jlj4$В [^_]1 [^_]UVSU [E D$E$%iƉ$F=atadt 1[^]É4$kwtUEt 4$+wM[^]UWVS U w[ED$E$iut,ƉD$E D$E$Gilj4$ [^_]1 [^_]UWVS U [ED$E$ut,ƉD$E D$E$hlj4$蜑 [^_]1 [^_]UWVST óZE D$E$gƉ$=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$1UVS2T 'ZE D$E$dgƉ$腓=gntst 1[^]É4$=$tU[^]UWVS S YE$R"t,ƉD$E D$E$glj4$X [^_]1 [^_]UWVS zS oYE$ "t,ƉD$E D$E$Fglj4$ [^_]1 [^_]UWVS S Yut*t$E D$E$flj4$謏 [^_]1 [^_]UVSR XE D$E${Ɖ$"=loobt 1[^]É4$WzU[^]UWVS vR kXE$lyt,ƉD$E D$E$蝊lj4$ [^_]1 [^_]UWVSR XE $yt%ƉD$E$Plj4$裎[^_]1[^_]USQ üWE D$E$sUT$$.[]USQ ÃWE D$E$:UT$$I/[]USUQ JWE D$E$UT$$/[]USQ WE D$E$ȈUT$$/[]USP VE D$E$菈UT$$0[]USP ßVE D$E$VUT$$ 0[]USqP fVE D$E$UT$$A0[]US8P -VE D$E$UT$$0[]USO UE D$E$談UT$$0[]USO ûUE D$E$rUT$$1[]USO ÂUE D$E$9UT$$"1[]USTO IUE D$E$UT$$.1[]USO UE D$E$džUT$$;1[]USN TE D$E$莆UT$$;1[]USN ÞTE D$E$UUT$$;1[]USpN eTE D$E$UT$$T1[]US7N ,TE D$E$UT$$T1[]USM SE D$E$誅UT$$`1[]USM úSE D$E$qUT$$m1[]USM ÁSE D$E$8UT$$m1[]UWVS QM FSE$D$((t,ƉD$E D$E$qlj4$̉ [^_]1 [^_]UWVSL RE $D$'t%ƉD$E$lj4$p[^_]1[^_]UWVS L ÇRE$D$i't,ƉD$E D$E$貄lj4$ [^_]1 [^_]UWVS/L $RE $D$'t%ƉD$E$^lj4$豈[^_]1[^_]UWVS K QE$D$&t,ƉD$E D$E$lj4$O [^_]1 [^_]UWVSqK fQE $D$I&t%ƉD$E$衄lj4$[^_]1[^_]UWVS K QE$D$%t,ƉD$E D$E$7lj4$蒇 [^_]1 [^_]UWVSJ éPE $D$%t%ƉD$E$lj4$7[^_]1[^_]UWVS YJ NPEU$T$1%t,ƉD$E D$E$zlj4$Ն [^_]1 [^_]UWVSI OE U$T$$t%ƉD$E$'lj4$z[^_]1[^_]UWVS I ÑOE$D$t$t,ƉD$E D$E$轁lj4$ [^_]1 [^_]UWVS:I /OE $D$$t%ƉD$E$jlj4$轅[^_]1[^_]UWVS H NE$D$#t,ƉD$E D$E$lj4$Z [^_]1 [^_]UWVS|H qNE $D$S#t%ƉD$E$諁lj4$[^_]1[^_]UWVS H NE$D$"t,ƉD$E D$E$@lj4$蛄 [^_]1 [^_]UWVSG òME $D$"t%ƉD$E$lj4$?[^_]1[^_]UWVS aG VME$D$9"t,ƉD$E D$E$lj4$݃ [^_]1 [^_]UWVSF LE $D$!t%ƉD$E$/lj4$肃[^_]1[^_]UWVS F ÙLEU$T$|!t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSBF 7LE U$T$!t%ƉD$E$rlj4$ł[^_]1[^_]UWVS E KE$D$!t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSE xKE $D$ t%ƉD$E$~lj4$[^_]1[^_]UWVS &E KE$D$F t,ƉD$E D$E$E}lj4$蠁 [^_]1 [^_]UWVSD ÷JE $D$t%ƉD$E$}lj4$C[^_]1[^_]UWVS eD ZJE$D$t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVSD IE $D$#t%ƉD$E$1}lj4$脀[^_]1[^_]UWVS C ÛIE$D$t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSCC 8IE $D$dt%ƉD$E$r|lj4$[^_]1[^_]UWVS B HEU$T$ t,ƉD$E D$E${lj4$c [^_]1 [^_]UWVSB zHE U$T$t%ƉD$E${lj4$[^_]1[^_]UWVS *B HE$D$Kt,ƉD$E D$E$Jzlj4$~ [^_]1 [^_]UWVSA üGE $D$t%ƉD$E$zlj4$I~[^_]1[^_]UWVS kA `GE$D$t,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVSA FE $D$'t%ƉD$E$5zlj4$}[^_]1[^_]UWVS @ ßFE$D$t,ƉD$E D$E$xlj4$$} [^_]1 [^_]UWVSF@ ;FE $D$ft%ƉD$E$tylj4$|[^_]1[^_]UWVS ? EE$D$ t,ƉD$E D$E$ xlj4$d| [^_]1 [^_]UWVS? {EE $D$t%ƉD$E$xlj4$|[^_]1[^_]UWVS *? EEU$T$Lt,ƉD$E D$E$Kwlj4${ [^_]1 [^_]UWVS> ýDE U$T$t%ƉD$E$wlj4$K{[^_]1[^_]UVSn> cDE D$E$vƉ$}=gntst 1[^]É4$ytU[^]UWVS > DE$ t,ƉD$E D$E$9vlj4$z [^_]1 [^_]UWVS= ëCE $3 t%ƉD$E$vlj4$@z[^_]1[^_]UWVS b= WCE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS= BE $ t%ƉD$E$>vlj4$y[^_]1[^_]UVS< éBE D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS C< 8BED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS ; AED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVS; tAED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS$; AED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS: þ@E D$E$urƉ$z=gntst 1[^_]É4$ P$U˯DžtڋUT$D$4$ t U:[^_]É<$1UVS=: 2@E D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS 9 ?E$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVS9 z?E $t%ƉD$E$rlj4$v[^_]1[^_]UWVS 19 &?E$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVS8 >E $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVS8 w>u t#t$E$qlj4$u[^_]1[^_]UWVS 88 ->ut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVS7 =E 0Ft%uFt$f4$^1[^_]Í$M <$fFt<$W1[^_]Ét$@M ${<$3FUSX7 M=D$$M $̝D$@M $1[]US7 =EU 9t8J 9H u(Rt<@t-T$$[]1[]ø[]Í'ˍ'US6 Ö<E @tUT$$[]Í D$ D$D$t $USF6 ;<E @tURtDž D$<$(qwEGEG t [^_]Í$M E$o|$@M $E9t,$pE$Ct4<$}[^_]ËE$듃uE$끋G$UWVS &4 :u} D$|$4$|u 1 [^_]ËED$4$yt|$4$} [^_]UVS3 ù9$ ƅt' D$4$oFF F[^]UWVSn3 c9u$ 蜨… D$$UoUBB BU4$EE$IUt]NjMs"EtfEtBEB Ѓ[^_]׍]}D$ D$D$/ $$Lo1UVS2 v8ut4$m[^]%]}D$ \D$D$} $UWVS 2 8Etw} |$ ED$D$$ ƅxEH $M(…t1|$ ED$ML$$UәU1{[^_]1[^_]Íp}D$ D$D$U $Uc1 \7UT$|8$]UVS<1 17ut4$([^]]}D$ \D$D$} $DUWVS 0 6utb 9uXFt@~ G$…t>FtAD$$U5U [^_]K4$l [^_]1 [^_]Í'UWVS L0 A6utJ 9u@~ G$r…t,Ft/D$$U~U [^_]1 [^_]Í'U/ 5Et 9t1]Ë@ ]U/ 5Et 9uP@tt ]1҉]Í']USo/ d5Et 9t1[]ËU tH Q9Ur@tD$E $}[]Í'U/ 5Et 9t1]@]UWVS. 4}t; 9u1G $ƅtGt"D$4$<}[^_]1[^_]Í'Uy. j4Et 9u @t ]1]vÍ']UWVS8. -4ut 9t 1[^_]ËU tM 9uFtA F EP$U7DžtŋE HɋUtOFt@L$D$ D$T$<$ F~}~ t$Fs'븍'UWVSt- i3ut 9t 1[^_]ËE FtE $8F EH $Mn…tFMtI} |$D$ D$L$$UFFUV}~ t$~o'믍}D$ @D$D$; $US, Á2Et 9t1[]ËM tM 9uL$$mUSE, :2Et 9t1[]Ë@tU T$$[]Í'US+ 1Et 9t1[]Ë@tU T$$[]Í'US+ Ò1EU tG 9u=t99 u5Rt@tT$$b[]Í'@uፃ'ٸfUS3+ (1Et. 9u$@tU T$$[]Í'fUWVS * 0u~(Ft  [^_]D$ED$ D$D$4$tȋUBU$˟DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ bƅt' D$4$PfFF FE 0 [^_]É<$zD$eD$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]USH) =/gD$ $PM $[]US ) .PM $[]UWVS4( .M EpAQAtp}D$ T$L$D$ uԉ4$D$|$E$Bqt2t$E$"nt|$E$7r4[^_]Í14[^_]ÉD$ T$xD$D$ uԉ4$ey D$ D$D$ $:UVS' -E 0t$lM $4$W1[^]US' Í-D$PM $ LD$lM $1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS& ,ƍgD$ $覐PM <$vt$lM E$Et $Eb<$JUЃ[^_]ÉE<$2$ 觛Ut֍lD$ $MbMAFAFA<$t$E$Mt+$Egb<$ÌM $蘣UЃ[^_]ÉL$ME$M9uE<$臌UЃ[^_]Í}D$ D$D$M $UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVSg$ \*utl9u4$`[^]1[^]UE@]UWVS $ *Et l9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YUX# I)Et l9t11]ËP@]U+# )Et l9t11]ËP@]U" (Et l9t11]ËP@]U" (Et l9t11]ËP@]UVS" (Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS" (Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS! ~'Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE US ! 'Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U ¥&Et l9t1]ËHP@txE P]USq b&Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UVS %Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVSv g%Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS $Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U s$Et l9t1]ËHP@txE P]U@ 1$Et l9t1]ËPH9иrE ]U #Et l9t1]ËPH9иrE f]U ¦#Et l9t1]ËP@uE ]U| m#Et l9t1]ËP@uE ]UC 4#Et l9t1]@uP@xM A]ËP@M QU "Et l9t1]ËP@uE ]U ©"Et l9t1]ËPH9иrE ]Us d"Et l9t1]ËPH9иrE f]U- "Et l9t1]ËP@uE ]U !Et l9t1]@uP@xM A]ËP@M QUS Ï!Et l9t1[]ËM tM 9uL$$\USV K!EU Mt l9t1[]@t Xxx3P3H []US  !EU Mt l9t1[]@t Xxx3P3H []UVS ¶ Eu ]t l9t1[^]ËPH@uxx11 [^]UVSu f Eu ]t l9t1[^]ËPH@uxx11 [^]UWVS$  uEEEEVt $[^_]À~(u~-+0u xZIE܉D$}|$F$ugEUщ¸9иeEF>t"D$ooD$4$VJE@U $[^_]E E܉D$ED$F$fEUE܉U}9EXV8"J&<8"0f,E܉D$|$F$ΙEU!Ѓt4MEFcD$ED$8"ut&4fffffffffffffUWVSP <$Wf0vH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$c>_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS<w l4$cB BBB$BBB(B8OwuBfn'"H[v*B|DžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{BJHJx"t_Oxaucxlu]xsuWxeuQHBzB(J1xru+xuu%xeuH̃BB(OP)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{_<$O1USEt&.&.& w u[]US  E ;Et1 []ÉD$ED$E$9 []UWVS ]u}E E $谻VEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]%8?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]}D$ D$D$$f)щN$x>qUWVS, EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$̆prvvxEpD$}t$$t}(u GtLt51E$][^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVS í $Ghp$|tD$D$E$gǃxD$<$̙aEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$1^Ƌt0<$gd3D$L$d4$ollp ȋdE D$4$aNjtPD$T$l4$llT$4$-t$蟃Ĭ[^_]1)<$ft$u1Ĭ[^_]D$D$D$D$ D$hD$l$ ]lthȋtGL$4$],t$1nUD$E$U]fffffUE 9E]UWVS ƅtBD$$~Et E$@zDžMu% $P1\$@yDžtED$<$@D$G$lEG,w0G4G8G<[^_]US0 % |M $j[]US  3D$,$m|M $j[]US D$|M $@jD$M $$1[]US y ED$E $j[]USW L ED$E $:[]US'  E$kE $k[]UWVS( UM܋p4@,EEGEt@E<E tDMUD$E$菮UMtLօuE܅tE܉1([^_]Í}D$ D$D$$蓶ϋE܅t([^_]1UVS Pt@9 u6p 9r~D$ D$D$$KUWVS uFt09u&x<$WeƉ<$Fe[^_]ÍD$ D$D$$ӰUWVSj _Ƅt1XƅtptC[^_]ÉUx<$d1ɋU'ƅtpt<$d[^_]ÍD$ D$D$$8US E xt"D$ D$E$r[]Í~D$ D$D$ $ѯUSj _UB4tB4R,…t8$7[]Í,~D$ D$D$$m}D$ D$D$$CUWVS4 UM@8t 14[^_]ÉƉ׍PU$DcMDžt6pE$6EG4$67E$c4[^_]Í3D$,$6d|M <$aED$M E؉$E܅$w6<$`V09V4E$X6N4~,UEE؋UЉMԃD$E$豥MԋUvA)D$E؉D$D$QEF,}܉8}xF4F<<$`E$HE܃,n}<}ܜ$`nEMD$ $F5UT$MA$GEM܉H<$_UT$U؉$kE܅$5<$l_E@,v~D$ HD$D$\$轫D$ D$D$$蓫UWVS* }Gp4$_Gt'9uG@u1<$/^0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$ D$4$~D$4$=4$<U܋T$4$P tEO49H1gEq<$\D$4$ ?Ɖ0[^_]Ë}4$Z<E$5mD$4$9n}э D$ D$D$$}E$5n 4$;EԉD$4$|=J~D$ D$D$$輧UVST IE 0t$M $AF,v ut 9t 1[^_]Í~<$Vv4<$V[^_]UWVS ut 9t 1[^_]Í~<$dVE 9F0r<$OV[^_]ɉUWVS Åu~<$VƉ<$V[^_]UWVSS Huth9u^F4$I"EFE$UF4tM1;~4sAF,D$E$U&uߋE$UE$)EE[^_]ËE$[UE[^_]UWVS ÝutB9Uu5~<$UU9u/U Ɖ<$T[^_]1[^_]1USL 5EU t$9ut9 u 1[]1[]UVS Eu Mt 9t 1[^]ËP49P0r [^] D$ `D$D$ $UVS }EU ut 9t 1[^]Åt9 uH49H0r [^]T D$ `D$D$ $mUWVS, ut 9t,[^_]Í~<$tSF8t<$fS,[^_]ÍMU tߋUUN4Mt{M9MV,UMM9M܋PU؋UM)L$MUTT$$lBn4F<M܉ $&U؉$&T,~D$ 0D$D$u$Y~D$ 0D$D$v$/~D$ 0D$D$w$US –EM t 9t[]Åt9uM E[]TUSZ OEt 9t1[]ËM tM 9uL$$*U Et9u]1]U Et9u]1]US øEt 9t1[]ËM tM 9uL$$ *US| qD$E$4[]UWVS O D}U uFt  [^_]ÉU1$t~(Ut [^_]ÉUE$?]MUt E [^_] $$US ôD$E$[]US ÇD$E D$E$65 []US` UD$E$|[]UWVS 1 &ExU(E P $D$L|$E$/E p@ E4lE}pM9D$E$_+E}D$E$=+ED$E$+trmEV0MM<NʈUV?UMD$E$*.1 [^_]ÍLD$E$0 [^_]Í D$ 4D$D$s8$}EE}FUu0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃D$ $D$D$8$ D$ $D$D$8$U ˆEt,9u@]1]USg \Et ,9t1[]ËM tM 9uL$$US Et ,9t1 []ËM9H uU tL$M L$@$} []UWVS øu>t=~(u7Ft=D$ T$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MPEtFVT$U$MUs9}D$D$4$ $Pƅ,D$4$FEF~ E 0%:D$ED$F $ ljEt\UF$F 9:" ~D$ D$D$8$腎E$W [^_]诔8"uE$W$7OƅtEE$yW1!1U ²Et l9t1]ËM tM 9u9]UVS} rlt$M $ƃM t$M $ƃM 1[^]US* E xtD$E$#[]ÍUVS u D$L$BtM 4$[^]ÍM UVS Íutl9u4$[^]1[^]Uc TEt l9t1]@]U: +Et l9t1]@]US Et l9t1[]ËM tM 9uL$$fUVS öuFt [^]À~(tD$ D$FD$F$Vu_D$ D$FD$F$.tW D$L$#AM 4$E 0[^]Í D$L$@M ǍD$ D$D$`$)fffffffUWVS æƅtBD$$OEt E$@KDžMu% $T1d$@KDžtED$E<$ED$G$}>EG,w0G4G8G<[^_]US E$o>E $a>[]UVS éPt@9 u6p 9r 3ƉEx,}UD$$`KtQUtBMI0M s!MA,Q0E$O[^_]NjuӉF,V01UWVS áƉ׋P4@09rJF8u:9t(<$ V,F4HN4t 9t%$c$Y [^_]ÉUMGE$4UNjE$3Ut$ M9t;E [^_]D$ D$D$$hA$衸MA8,uA1)UE]UWVS }9GE$;3G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$2UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS ut 9t 1[^_]Í~<$\2v0<$Q2[^_]UWVS Ôut 9t 1[^_]Í~<$ 2v4<$2[^_]UWVSN Cut 9t 1[^_]Í~<$1E 9F0r<$1[^_]ɉUWVS u~<$l1Ɖ<$[1[^_]UWVS Þu~<$/1F8uF8<$1[^_]UWVSj _u~<$0v8փ<$0[^_]UWVS. #ut<9u2~<$0F49E s+F,U 4t"<$0[^_]1[^_]1ލ6D$ dD$D$a$|UWVS Òut 9t 1[^_]Í~<$ 0F8u`F4;E t\9E seE V,tUEE$N,UEF<U$<$/[^_]1UA܍"D$ TD$D$$({5D$ TD$D$$zUWVS Êut 9t 1[^_]Í~<$/U Ɖ<$.[^_]UWVS; 0ut 9t[^_]ÍFE$.~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$.E$[^_]ËE$-%"D$ 0D$D$$zy6D$ 0D$D$$PyUS Et 9t1[]ËM tM 9uL$$FUS ×D$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]US5 *D$E$A[]US  D$E D$E$ []US D$E$[]fffUEU @]US ÃE$;t[]ÍHD$ D$D$p$wUWVS05 *$}`HtыpG$萍`tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$ Ku}DžPtҋ@w4$躌)T$$PtЉ4$~taNjPu냍RD$ D$D$$uVD$ D$D$$uRD$ D$D$$uVD$ D$D$$cu`D$ D$D$$9utыt$PlD$ D$D$$tUEt]1]UWVSDf [$UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]ÍD$ D$D$#$rEEU D$E D$E$]UE]UE@]UVS2 ]C$$;[^]fffffffffffffffUWVSν ƀ8$gD9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$fP /.pl@istX@XXXXf@ X $;ƃtb|$D$4$(9v84$q$Ӫ1v8[^_]v?1[^_]PƄ$fى4$g^$lj$ׁ|$4$+D$$ v84${UWVSB /uM ^t^F9tX^ [^_]ÉMD$$E5…FFM빍sD$ D$D$9$nD$ D$D$:$n,D$ D$D$;$n1<&M䍙D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$Vuύ T$ T$D$#$jt][^_]UVS ]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍 T$ dT$D$D$iE >][^]UWVS ]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]Í T$ DT$D$c$dhD$/$9E >][^_]UWVS ͳ ¹UyEx i} _$(ƅI$(+FFF E Ft.ED$4$ׄuG$014$0 [^_]Í< t~D$4$uD$ 4$tFu.D$4$tD$ 4$wpD$4$_DŽ^OD$D$4$G)D$ 4$Ex 4$/1 UWVS . #ED$E$;t>Ɖ$ \E lU4$/lU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVST IutFwyM MJ]ZMJ [^]$9&t|] X]XMH ]X뼍D$ D$D$AP$d|D$ D$D$BP$d1fUWVSY NUu }t`t`tAtA}tA uutA} $-[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍D$ D$D$ZP$cUWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ Ɖ) ‰L$D$$_ f1 [^_]ÉM4$aM랹čD$ D$D$>$U@넍EUWVS Eh"l}ptDžxAEEEEEE|(D$ut$$ D]E$D$t$$CDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$XD$4$ |$4$%D$04$c<9D$hD$t$ D$_D$0$U,c4$,4C8D$t$0$tD$(D$$^BD$$D$$@BD$|$$4[^_]D$_$X[^_]Dž4cB,Dž4GD$(D$$AyD$(D$$}AD$$D$$_AUWVS@軇 Ơt$(D$T$L$,D$,t "|$GD$8UT$$\$(.uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$($D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(?"D$8D$D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(wD$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(H;"D$8D${ 3ljD$D$8HL$L@L$8t$@|$D<*tXD$=E$/EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $)u֋U$U9t5EuEEEuU܅/EEUUыr/Eԅ0t3.t*E8:t"UED$ED$$轹MA70E<-<+<::[B9FB 9F  E;u~#9E'xt3.0tE8:tD$Wl$7WE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$Ett p1pu-x/ŀED$ t$D$`<$E|ED$ t$D$<$*t3.t$E8:tED$ED$$7?D$ D$D$a$4Eԅd}؉:t0Ex pq yMMMyM؋E'xEEEЉpE $MЋtp+t)kExut3.8tE8:tt$$u70t3.E8:ED$$7qx:#EE9E:E MM؉:ŨE uЋE؉t3.t+E8:t#MED$,$谵EЋMq17EЉE<-WKŀED$ T$UD$`<$EUuD$ T$D$a<$t$ |t$D$<$D$ T$D$a<$ 'xt3.E8:t$l$袴A D$ t$D$a<$*|[u x;UWVSe k} u*P uǃP |E ;M!8-pxP -'D$-E$ǃP --|$E$tAx:ǃP >u|[^_]ÍrP :u>u|t2E8:t*|$ D$D$@:.$?[^_]ÀxF|'_|>uTx:tL|9M'E8:t=|$ D$HT1P '|[^_]ÍD$ D$D$R$uՀD$ D$D$S$E 4l:bUVSBc 7iutD$ D$4$H;[^]ÍD$ D$D$/p$UVSb hutD$4$%e[^]ÍD$ D$D$/$fffffUSsb hhE$ 1[]UWVSLb AhEtVu;U E} Uz BD$E@t$9s0E@ 1҃[^_]ËE@D$Mxe);u EE UD$9sNj]C 넋E EuGE@D$Ex gE UybE E%D$ D$D$$g D$ D$D$$=TUWVS` üfUB Eu1ƃu}9}EE}B269r|])9ErGË}u sJu(u J J ZR9r [^_]ÉfftEË}u rucuk띉UGD$4$Oƅt[UB)ǍD|$D$$U0MJB E2Xf넃@UWVSw_ leu} D$$$|…0x@@ D$D$D$ 6D$D$$UDžt1D$$[^_]R1[^_];8U$6$,818US \^ QdE D$ED$@:.X$C []US%^ dED$ E D$ED$@:.X$C[]UWVS] cu} t(ED$ 1D$|$4$Q[^_]Í1D$ D$D$4$UVSt] icut'D$ D$D$4$yQ[^]Í1D$ D$D$A$=UWVS] bu} t)D$ 1D$|$4$Q[^_]Í1D$ D$D$6$UVS\ Ébut>D$D$ D$D$4$Kt [^]1[^]ÍD$ D$D$0$$FUS\ bED$ D$ E D$E$ 9[]UWVS[ auttE D$4$~7F0u D$4$[^_]tF0uҿF0뻍1D$ D$D$/H$R]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVS~Z s`E0x$tu[^_]1[^_]UWVSAZ 6`u tLEt>?t+fx f@UPp$MH,UP(UPDUP [^_]ÿUuy1UWVS Y ô_}u$‹EE Bzr EBtntpE tZE EU>UtnMfH f@PM H$x,p(@DP [^_]ÍE뭋M tE E딉UU$1UWVSX ù^UE trB0~4r,txM q J$tE D$ E 0xt$|$$[^_]ÉU)D$ D$D$<h$4 UY1D$ D$D$;h$ U US W ü]ED$E D$E$辶 []USW Ë]ED$ ED$E D$E$&[]UVS]W R]uf~ D$4$F0tN@9t $F0F0ǀǀ FFF t1FD$4$e1[^]ËFߍ1D$ D$D$<$ I2 UWVSuV j\EU tgP0~4p,tu ~r H$t} Lj $[M׉‹M y!1[^_]ÉE)T$ T$D$9$ Ed1T$ T$D$8$ E+UWVSU v[utFD$4$nx$P8D$4$[^_]É4$ڍ1D$ D$D$7$+ US T ZED$E D$E$iH []UST úZED$ ED$E D$E$F[]UWVS,T ÀZEt8uj}ԉ ;M$JFFF )t$|$$踲,[^_]ÉEԉ$E؍EEu}w5끋uUS µYEx9M]Ë]Í5]fUWVSTS vYUE }} 9}7uցE0 tS9utOD$2@D$u4$4$PEt8UED$t$E$Uu-p4$PEuȋ}E+TЃT[^_]Ét$ D$D$2u4$׺4$yP볅U@E 7t"ED$G$3ut$ 닺R}U\D$ D$D$8$UET$ T$D$8$uE7M,E\T$ T$D$8$E~fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSNP CVut;F)F3E uF F[^]1[^]ÍD$ 4D$D$Y$UWVSO Uu} Uts~F<FF DWPWPW P F F 1[^_]Í؃D$ D$D$v$CU`UdD$ D$D$w$ U+UVSN ýTut~u@~w:E [^]Í؃D$ D$D$$뺸UVSaN VTut~uAF u9<.w5[^]Í؃D$ D$D$$6빸UWVSM S}u t5u%G u<.w~9|D7[^_]1[^_]Í؃D$ D$D$$UWVSyM nSu} t*~uPF uH<.wDx>9؃[^_]Í؃D$ D$D$$<몸UEu E D]1]UWVSL R}utQEu@D69E r4E D$D$<$6GfGG[^_]1[^_]ÍD$ D$D$.$UWVSIL >Ru} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M$뙸UWVS4K QƉEԋE} 9uЋU1҅x%PލT$D$<$]wGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍT$ T$D$h$E܅ E܋]ԍT$ T$D$i$Em]wUVS?J 4Put~uEFu=:Fr6[^]ÍD$ xD$D$$뵸UWVSI Ou} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ dD$D$$fffffffUWVSAI 6OƉׅtat1>t F9rF9s1[^_]ú䍃D$ pD$D$$뾍D$ pD$D$$pUWVSH ÊNt4ljփt3Rw0FGT$D$<$8[^_][^_]ÉUD$ D$D$$>UUSH ME x[]ÉE%T$ T$D$T$E[]UWVSG ÝMu} Et,tYPσF)F 71[^_]ÍT$ T$D$b$fEuE9T$ T$D$c$2ErUWVSF LEu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃GD$ D$D$$MÍ؃D$ D$D$$M}]썃0D$ D$D$$L {P7f/UWVSD JEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍ؃D$ D$D$$ME]荓0T$ T$D$$EjUWVSC vIu} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃؃D$ |D$D$$LUD$ |D$D$$VUWVSiB ^HU} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]Í؃D$ \D$D$W$UUUD$ \D$D$X$aUUUE ttuB]ø]UWVS$@ FEEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]UMi1ɉM]썃TD$ HD$D$$MXMUEE썘|\$ H\$D$$MUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUS< ÂBD$D$ED$ ED$E D$E$[]fUWVSP>< 3BƉЉ 9U1҅[ƅD$D$D$D$ T$D$4$Ct1U+<P[^_]Í1ɉ D rFDžDžD$ T$D$<$EuutjƅD$D$D$D$ t$GD$G$Cut$$tu<$Vt$CtcT$ T$D$q$jgUWVSTk: `@Ɖ 9E1 ƃ Q ƅD$D$D$D$  Q D$|$4$AD$D$D$D$ L$|$4$A;DžDžDžDžDžVDžDžDžT$ D$D$$stjƅD$D$D$D$ t$GD$G$@ut$$thuGtLD$ D$D$$?$q1U+uXT[^_]Ë묋$qʍcD$ D$D$q$8GeUWVS7 =ϋEE uE 9E1,VD$D$ D$D$<$&B4D$ D$D$$7t6D$ D$D$$zw $ɗD$$D$${$聗D$I$cG$M$?̅~f$N$ t$D$D$$荣U+Ą[^_]Í @$0/>D$ $HuD$<$2rD$/$T3Pt:D$D$$_#xD$D$D$D$D$ D$T$$D$pD$($C$@D$pD$$$X$pD$$$ D$ pD$D$yq$D$ pD$D$zq$D$ pD$D${q$bƄD$ pD$D$|q$*{D$D$D$D$ D$T$$Q@$8u _D$/$0D$t$ "T$D$$D$D$D$D$D$ |$pD$҄$U*VpD$$эpD$$^pD$$z$UWVS^1 S7EhU 9E1pl 1} } uqƅptBxB |BEBEE qD$D$E $_Džy@E+Ĝ[^_]</ƅptBtfDžrlD$<$$xSrfh뎉l4D$ <D$D$ q$<ll<$l']U D$E D$E$O]UVS/ â5utD$D$4$[^]Í4D$ PD$D$q$~UWVSD/ 95ljEE Et 9|E1Eh]DžDžDžDžxD$D$$脍_DžDžDž@:.D$FD$$ǃD$D$<$蘎FD$FD$<$Žh<$ҎN80t&<‹F:=4$袱Dž'8#QO$#vD$xD$$|E+Ĝ[^_]ÃNZƅD$D$D$D$ |$FD$F$j4|$\$EvƅD$D$D$D$ |$FD$F$4u4|$xD$$%$GzD$[D$<$uD$[D$<$Y.0$蜰D$ @D$ED$@:.$蕘8tD$FD$$DžD$$D$ D$D$4$4$D$t$<$fƋ$9fDžfDžD$D$$^D$L$$;Ƌ$ t0<<4$D$t$<$]4$D$t$<$<4$nD$t$<$D$D$<$AD$xD$$-D$D$D$D$ D$D$ $0u(4$v=4$g=,$wD$'D$<$3DžCD$ hD$D$q$T9D$ hD$D$q$D$ hD$D$q$D$ hD$D$q$ƄD$ hD$D$q$t$*$><$6!D$t$$豅 tD$t$<$ԆtƋtt$ɇ뉍$$談hD$|8$j뛍$t$;rSUWVSl$& ,uEEEEEEEE 9E1MGUqEE fD$ D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$4_=EPt%D$T$,U $UUEML$ML$M $MƋE$c^E+l[^_]ÍD$ \D$D$q$MD$ \D$D$q$UD$ \D$D$q$dEeƄD$ \D$D$q$/6$Q]D$D$r$WrQUD$ED$ED$ED$ ED$E D$E$f]UWVSl# {)uEEEEEEEE 9E1xMUEE fD$ D$D$ UЉ$UWEEEEEEM MEEML$ D$UT$$\E@t"D$D$,V $U<U3D$$tM 9HtCED$ED$E$MEƋE$[E+9l[^_]Í#v$bD$ ED$ED$E$ME 멍D$ xD$D$iq$M^D$ xD$D$jq$U4D$ xD$D$kq$kE ƄD$ xD$D$lq$6$XZD$D$r$^oNUD$ED$ED$ED$ ED$E D$E$ ]UWVS &}lE \EXE` 9@E1D$pH$FXp`DžLDžPpB.dB.DlD$ D$D$<$mD$ <$`bdh< Q< t< L .&< t< t t ~ u9P>uXp<+%<-q<@nL'PHD$ D$PD$r$Oy؉DžL<+<-w҉ht$`$jhyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$2xDžL<+F<@[hU\l K4$  u9F<@t$`$qU\l<+<-t$`$>qU\؉<+N<- t$`$A_Z<+<-DžLDžP.hHD$ `D$D$4$vhQ7F<@uhHD$ `D$D$4$u؋h]PFF'<@hHD$ `D$D$4$kuhU\1PU\PF]<@UHD$ `D$D$4$t)F<@ DžLDžP1DžD$ D$D$q$ D$ D$D$q$XD$ D$D$q$aFUWVSd YM(E<} 98ƋE1f<!ǃP U@D$D$ D$DD$<$v@D$@ D$4$aD$D$4$'"M4'0@@ $@@P T$$w@@$ D$4$ͅ,t$D$4$p?,|%=P $ӟ4$u0$8E+[^_]þ뿍 D$Յ$…tE|[^_]1䍃D$ D$D$N׆$ /UWVSt ÙEUU 9M1ɅtBE}<$EhM L$ED$<$hED$<$RU+u:t[^_]ÉEL$ L$D$h׆ $<EK/US E D$E$[]US E D$E$[]UVS ßD$ D$W 4$ED$ t$ED$$薍[^]UEȅyt ]%]]ffffffffffffffffffffffffUWVS0 E؋}u 9EԉËE1|$}܉<$]&1<&.&.&.&.& F TFuF(}ԋE+uW0[^_]$)]}uƅgы]؍ΆD$ PD$D$F$ +],-UWVSEE u} 9U1ҍ$iD$@$_E E19xu}_D$D$$'_D$D$$L)׉ 9|KD$D$$^D$ D$$19 })׉ q0$d_0D$$%U+[^_]É裸0$_莸0t1D$ t$|$$՗b$^1농D$$tыptEU**UD$D$D$D$ E D$E$H]UWVSx"EUU 9M1ɅtBE}<$M L$ED$<$.ED$<$U+u:x[^_]ÉEL$ 0L$D$ $躱E)fffffUWVSjc8]du 9<ËE1dENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ ]]Ћ~$|}ԋ^(x]؋~,t}܋^0p]^4H]~8D}v<@u식d3`s\s{ l{LȉEl1؋\!1؋`LyZ؋u\ɉT1`!1l yZTىˋ`MʉX1!1ыXP:yZω}ω}E1ȉ!ߋE1NjE0yZEȉ1!׉M1ωEMyZω9EEȉ1щ!1߉EMyZNjMu}ω}1ϋu!1׋MyZ߉Mɋ}u1!Nju1hyZ׉}ωM1!ߋM1ωuu1yZ]|ɉ1!1lj|]yZωxωxU1ډ!U1׋xyZljutʉ1!ω1߉t]yZ߉pʉU}1!NjU1׋Up2yZ׉4:u‹Hω1Љ!1ωuu0yZE]Dω1ߋ]!1׉EyZωE@ω}]1!]1߉EyZlj}X1u1u1Ƌ}1!ϋ]1߉u]yZ߉MT}1|1u1lj1!ljT1׉uUyZ׉ :X}1׋x1u1lj}1!ߋu1UT2yZUu1֋t1֋U1։‰1މX!1ƉUM yZΉTXMu1΋p1΋M1Ή11MnTƉXEh1NjE1NjM1ω׋X1ϋT1ωEn߉TE}1NjE1NjM1ωXT11En׉h|1NjE1NjM1ωT11߉MXnljh}x1ϋM1ϋM1lj11׉MTnω|t1׋U1׋U1ljh11lj|2n>Xxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVSeJ]} 9EEGWEU?@)ƒw)ƒT$D$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼnUE]UU ft1]ÁE ]fffL$$Yai qyD$A(tQS[Rjj [1Ít&.&T$D$ Zbj rz $z(t RPS[ØjRj [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj [1Í&T$D$ Zbj rz $RPS[þjRj [Xt@US 蠿ÕED$E D$E$ []USodD$ D$ED$$'[]US4)D$ E D$ED$$-[]USD$ E D$ED$$[]ffffffUWVS,豾æuEEED$D$}|$ t$D$EE$@EE ED$D$|$ D$D$E$L@EEED$D$|$ D$D$E$?6EEED$D$|$ T$UD$E$?UEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$?؃,[^_]bw8 u>ƆUND$ D$D$<P$qfffUWVS^S} 9E1}D$D$HtHE$Vt=ED$D$<$Ą;Es1U+[^_]ø"㍅D$E$kNtt@D$E$1Nu[ED$cD$<$T;EsED$|$ H%D$`d$T$UuID$ D$D$B$BpQUWVS D$W \$E$qƉ؅u [^_]Éku01UWVSp赺êU[ ut$$[ @B1NjEEE1UЋUME1EHt$$xx[ @B1Ƌ}E1NjExME1EH D$E$~u([ ]ٸ@B1E1؃p[^_]øp[^_]$'[ 8D$ D$D$Hn$nfffffffffffffffUWVS1&D$zrD$E$谄uE04.".&.&.&@t&tD$E$u܉[^_]D$D$E$6t 1[^_]ËEpD$D$4$E@<-u?EPB.DPtEPD$ ED$$U9MU9p9g^My+th)ƍF߃1BD$+D$4$XE@t<+ !M?!fffffUk\E?w04.t u]Ë u@u1]U0EP>w 04.]1]UWVS(u}܉|$D$4$upxINE uG>wl9EظE! EED$|$4$(p([^_]Ã>w29EظE EppUWVS,!uYoD$ to-D$D$[ <$My)[ C.t@[ [^_]ÍU T$ t$)‰T$$뵍|8D$D$[ <$fffUWVSqfƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUT$ T$D$t$^iEF!FUWVS u] "<-EEEE}|$EԉD$$$~$E~D$|$$TElD$D$Ẻ$lMẺE0EUB.DPщMEE1E$KTU$U~9E~T$$lƋUfffffffffUWVST͞ƤEu}]E E bEEE;E܅~ 0MU tEEGz;EGEEUEUEUEUEEEE EE؋E$]G 8MЍD9E  0^EUM]L$\$ $T$]9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]D$E D$E$9} T[^_]Í.EEEE2EE'E7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]Mȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;E'EbEdEE Eg]U]EdEEUM]$CUЍD9E ỦUM܍_׉F u ,[^_]Ë]Uv]uNՃmu$]a,[^_]ÉUE$]UtÅT$D$ $M]LMD$ XD$D$$`Hn]FD$ XD$D$$+H*uf~*u1f~*LD9Pf?D$pD$G$lhdTFD$ lD$D$/$>_lTODlmT*lJjD$ xD$D$$>hTzD$ xD$D$$A>XPTD$ xD$D$$>p TFD$ xD$D$$=13=qdTCh/p@ @t`<$PG$`$Tk)؋`$TU)lT8UWVS܍`hl΋}p} M\ 9dE1h!lKp{pfXlp1 9sYfPftf/u܅t0t&.&.&.&f@/f/u%9rdU+İ[^_]flpP`FD$ D$D$o$;jD$ D$D$l$s;l`zD$ D$D$m$5;p`D$ D$D$n$:PXllftp‹hG t\SJKt*lfx/t|%=@=t`G\h;FX\D$|$ pD$L$$lh 1h1h C ukG @tKpD$$W([|%=@E9ll/(pD$$`D뫃=u`TD$ D$D$S$X39T$ T$D$pX$ 9``i>1҉l/UWVSD覃ǓÉ 9E1vHf~uQ@ ~ύff/P9uݸx0f"f*ffʃft>f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 dT$ D$)L$pP$gf[!~ʉW-0$P…ZJD$D$ D$D$$T@7pf@!fH9"|$ t$D$ $2|$ D$D$ $2FT$ D$D$ $i2T$ D$D$ $92FT$ t$D$ $ 2|$ D$D$ $1rͩUWVS4||qgU9U‹)߃r)ڍHPftDΉ1ff}tYFftf[tWf{uFfuM E14[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1Gf,f[uSf]efً99S{f{vf}uͅt8Ĥf}Xׅu9f1TffuM M1B:qQf]tىC)ȉD΃tft FT$ |$D$4$^.ɋtFUT$ |$D$4$.FT$ |$D$4$-^눋yuI󥉽SًfvfUWVSx~ƅtyB tA xy f>{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃D$ D$D$$,MUQMU썃FD$ D$D$$M,MU1NUWVS(v|u} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍D$ D$D$$*U} UhUWVS^uS{EtXEPtF@t3z}E |u 9tE1|t E} ƅsM\L$$r{EEEEEEEEEEEEƅrt<$_D$|$F$ ||EEdDžhƅxE`ElM EEAdD$D$`$tT-<rsED$D$<$\|u1tE+,Ĭ[^_]ËEEċEEȋEE̋EEЋEEԋEE؋EE܋EEEEEEEEe0fEEĉD$D$$b\ƅrfD$lD$$xEUJv9UJv9mUJv9TUJ9<UJ9$UJ9 UJv9UJv9kUJv9UJ9[UJ9OUJ9UJ9UJ9JUJ9AUJv 9(h;MtExhEtEEt3ЍLXB. DQtB.XЈUEt3ЍLXB. DQtB.XЈUxtOE@u,E tCB.DBsD$D$D$F$Eƅx|sTDžhy)E$ua)0hE=)|U%EehQx]9&-r8sD$1ɉL$ $<$~ED$@k$ EEEƅsu$DžmERD$ D$D$_T$"N|ƅxDžh'E\D$D$$WEl'lxEu6sw'E$ug'0ND$D$F$]s$뫋h$%'E`DžhVE6D$D$F$EEEE1ƅsuƅx9GUcqEL$X<$…EhxhXM~ 1l"hHNhωxD$xD$F$sދhEDžhE%Yr9ƅx1҉hhƅxrbhuEEhE`D$T$F$EHDžhDžhDžhwisd;ƅx1hLƅx1h8Eƅx1hEUD$D$D$ ED$E D$E$B]UVSiuoc tu=@=~Ӊƍ'=[== (?tD$$ɱu@D$$螱=@sD$$s'@@HD$$H(?@UWVS8bãh 9U1ǃLh Lh DŽPh r捃Ld r lh D$ D$D$$Khh T$$D$\|$4$NA8t߉Lh 8#mD$\|$4$bNt8t㉃Ph D$\|$4$?Nt8t㉃Th D$\|$4$N8t߉Xh ǃ`h ǃdh D$\|$4$Mt>8t$`h D$\|$4$Mt8t$dh D$Xh D$4$)gD$\D$$AMƅ8tщ4$j uċܳtܳ >t|$$0 uቻ\h ?x{U+8[^_]ÍD$\|$4$LK8t߉Lh 8#wD$\|$4$lLt8t㉃Ph D$\|$4$IL%8t߉\h 8xuxxu xXh 8sxwxLTh D$\|$4$KtQ8t$`h D$\|$4$Kt&8t$dh \h ~hh D$D$I$Yx{ElǃLh 1871PǃXh ǃ\h 芋HT$$9 hUVS^dlh tJtKLh [^]ǃhh D$4$~lh ut$s$01UWVS]Ýcuǃhh lh t3$t$Lh $h tIu1[^_]Í D$<$lh uˉ|$s$0Lh [^_]ÍD$ D$D$a$ FUWVS\buǃhh lh t7$@t$Ph $tMt&u1[^_]Í D$<$lh ulj|$s$>/Lh [^_]ÍD$ D$D$a$,BUVS[aǃhh lh t$o[^]Í D$4$Ulh u҉t$s$.1US[valh t$zǃlh []fffffffffffffUWVSP9[&a}ƉUԉMEԅ}@EB.EEEÃ]}ԃEȍFE]|ЍL]DStEB.Eԉh EȉD$qD$Ẻ$sEԉi EȉD$PD$Ẻ$RsEԉi fEpxEfEbxEfEfxEfEoxEfEtxEE`a i E؉EEEčEEE4$0T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)v,j 9u(Ƅ,j [^_]Éր>/tJ),j ǃs$utǤƄ,j [^_]ftt鍳#fffffffUWVS1:&@E$!}LtB.DBt;B.0fkfbfgfE@ E1ɉMQD$ ED$E$|Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZENE0US8>D$ E$胙[]ffffffUWVS8Ö>}?t<$D9uzf.&9ti8/t9t`sc~/t9u)=v,n ׃rtftƄ,n Ѓ[^_]ø)€8/t Ƹ봸#US<7=EEEEEEEED$ẺD$$tEMt<[]ø<[]ffffffUWVS Q7F=t4ƅu"t$Ut,E t: [^_]$^ [^_]Í#$1E uD$D$`$ ǃtD$$D$<$D$<$h<$褗[USr6g<Et=tU T$؉$͖[]UVS'6<utE D$D$4$D[^]ÍD$ D$D$1$붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[t:4 [Ḯ̀rS[T:4 [ḭ̀rS[4:4 [̀ffff̀ffff/̀ffff^̀rS[94 [̀rS[94 [Ḥ̀rS[ä94 [<̀rS[Ä94 [̀rS[d94 [ḇ̀rS[D94 [̀rS[$94 [ḓ̀rS[94 [̀rS[84 [`̀rS[84 [R̀rS[ä84 [2̀rS[Ä84 [ḩ̀rS[d84 [P̀rS[D84 [ḷ̀rS[$84 [Ḷ̀rS[84 [ḉ̀rS[74 [̀rS[74 [Ḛ̀rS[ä74 [̀rS[Ä74 [Ḩ̀rS[d74 [1̀rS[D74 [Ḍ̀rS[$74 [òrS[74 [ìrS[64 [l̀rS[64 [t̀rS[ä64 [s̀rS[Ä64 [r̀rS[d64 [p̀rS[D64 [j̀rS[$64 [m̀rS[64 [̀rS[54 [Z̀rS[54 [ ̀rS[ä54 [!̀rS[Ä54 [S[n54 [f.&*̀r׋L$Q1fffffỲrJ!QS[54 [UWVS/5,r 0r D$$)0r 8r +4r \}IED$ED$4$ NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$UE UπUE댉E䍋/L$ M܍T$UD$DE؉$REFEFd9¶]D$4$舛E,[^_]ËF$艇\}Ef~ FFCFFD$4$.E,[^_]ÃUML$ T$D$E؉$荾EFHUE$~E UtRπM1D$ D$D$?D$5ZE(E9Ut'$/~E UtπUEEUVSÞuD$4$V(4$F u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$蚙D$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$Q[D$D$D$4$$UVSw uD$4$ӘV(4$ЎF D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$uEUw0E[^]ËVPNTUMutt+FEU<TD$4$D$4$UWVSPE }?ew t>Et[^_]Ft$諃V tQFtB1ɉωMT:0$臃V T:($xV D: $iMV ;Nr$SF,t$DF4t -$0F8t$!4$[^_]ÍRD$ D$D$Mh$d?e[^_]ÍED$ D$D$Kh$&UVS 4$kr D$E$y4$k[^]UVSÝ 4$^kr $x4$Hk[^]UWVSi^ <$kr D$$}Ɖ<$k[^_]UWVS uED$@$fED$E $g…t?t$U$ӯUt'zu Ńtt$$謯uUEHutU$蚋EUЃ[^_]ÍD$ D$D$<$p7UVS7,  4$ir D$E$e4$i[^]UVS 4$ir $ f4$i[^]UWVSè <$iir D$$.fƉ<$Ji[^_]fffUWVS0aVUB.E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍkD$ D$D$F$˵ULuԍE9s11UWVS yn詹D$-D$@:.<$mE tED$E D$<$D$$ >RE$_US虺UT$ U T$D$E$mffffffffffffUWVS æuEEt.\u* [^_]M % t. [^_]E } t=Q tME  [^_]ÍkD$ D$D$v$ GD$ D$D$v$ٳE TB. } } U B.DPwM QɨE E n,E 0<rMЈE} #EEE} ;c‹}Ǎ EEJEu}&dW09uu E} ?U  ЋM ME U B.DPE PEE ЋM}ljE_ EE TB.DE 0M EEu } \Et } %Et } &Et } =2ME E 0<cMЈdE TB.0+E P} ;U B.DPtOEE DЍPE} -} ^u!B.M DHE 0ME\ErEEEE E E pE _E NE =E,}MEu}9tedtH9tud1ɀcFdE P ZE PMuU{B.W0EEB.W E UWVS(E܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]讲([^_]ÉxÍ6D$ D$D$v$U U ]܍6D$ D$D$v$責U ]j  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]ÐUWVSu,s n/>3)Ѝ)Ѝ:~ 9w$4s ugP U$Ѓ4s DU4$Ѕt9w$D$ D$w4$[^_]É4$Duljw$t$ BYD$D$ w4$:^E t1붋4s t9U$(kNjU4$DY[^_]ËPǃ4s 뭋U tuGEǃ4s Ds hD$$=wn,s `ǃs 11UWVSu(s o))Љ):~ 9w$0s ug` U$Ѓ0s TU4$Ѕt9w$D$ D$w4$[^_]É4$Tuljw$t$ BYD$D$ w4$T\E t1붋0s t9U$(iNjU4$TY[^_]Ë`ǃ0s 뭋U tuGEǃ0s Ts hD$$l(s _ǃs 11UWVSu4$Dž$s ED1.t&.&P9u/>3)Ѝ)E:WɉM~4T$U4$nUuMG$U 1[^_]Ë4s u$PU$Ѓ4s UD$ t$$Ǻ4$H@G$됋4s u$PU$Ѓ4s UU$(fNjUthP뀃4s ts u/D$$=jE$s ǃs ǃ4s 4$HtՋ@UWVS u4$Dž s EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$}UuMG$U 1[^_]Ë0s u$`U$Ѓ0s UD$ t$$ָ4$X@G$됋0s u$`U$Ѓ0s UU$(eNjUthP뀃0s ts u/D$$hE s ǃs ǃ0s 4$XtՋ@UWVS#UELtЋ,s t'Ǎt$l9uǃ,s ǃs $s t'Ǎt$Jl9uǃ$s ǃs ǃ4s EPE LEHED1[^_]øUWVS8-UE\tЋ(s t'Ǎt$k9uǃ(s ǃs s t'Ǎt$_k9uǃ s ǃs ǃ0s E`E \EXET1[^_]øffffffffffffffUWVS*#pUE  DžXEK/tBD$E $p-E $Ŗuv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $p:!%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pJDž`D$`p脔D=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p_?t9E DtX$p5g1Ĩ[^_]tN~uPf/tpڢ?pĢx貢zUWVS}E ttrD$<$(xX[^_]Et$<$} bDžMtAt$$h(ymt *8"tƉ<$%e1[^_]1fffffffffffffffUWVS1&}<$Ls $R\Hs ǃDs 7tyB.E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]ËHs t$cǃHs ǃLs ΍yU͠ UWVSu} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]ÍD$ `D$D$$o[D$ `D$D$$@UUd]UWVSu} to.&.&8u$ u|:9s :t|tu[^_]ÍD$ 8D$D$$dbD$ 8D$D$$3-1UWVSpƉE 9E1=m}! Mu0Hs t |$$U$|X UD$ D$D$E$|DžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$I\ lj99D$D$E$A^Ѐ txE<#=D$ $,#dDž3D$=D$$yS<:uA)ljED$L$E$:=w!C:SDžD%D$ |$D$$HD$D$ D$D$@$kD$D$@$?qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$k6L$t$<$U6 $[OދDžމ:DžD))))T$<$Wo<ljljÉtE$>)ȍP9rH8E+p[^_]ÉEDžD$$V됋Ls $Q!Hs D$<$*|70dƋYq0$iY\0DžƋ|$/YDž>D$ LD$D$$ZD$ LD$D$ $cD$ LD$D$ $ޏ.D$ LD$D$$譏tp@a$WDžmE$C;;E$-;n땉Ƌ$W>$ŃD$ \$|$4$V Pu Dž$@H $sNDž L$T$$14$V18Dž4$VDž鋝D$ DD$D$$藍0<$V0$UtE$<9貒 M4$V薒 1ϋ$}Uu%$QU됋E$8UVSxEM ut.t^UD$t$$F[^]ÍT$ TT$D$$?M EuM ET$ TT$D$$M ElM ET$ TT$D$$NjM E1US~@s t$^ǃ@s ǃ8s ǃDs ǃ}<:tkOML<^uF<:mu‹M])ىύAdD$$]mJljEEd<:u]WF<:XЀvP2MҋM0 FE1]MVD9ut 0v]M :]U})rtT$<$]IEEM$[^_]Ë]뽸 y]䍃D$ D$D$$ÍD$ D$D$$调]䍃D$ D$D$${z1*E$]K<$]K]諈 UWVSEu} uE0D$=|$4$Dž$d]Bƅ<:d <:tCZtsu)Cd]D$4$]GUn‰ƹd<:uЉƍX)Ӎst4\$$U]lGU@Љ)ӍsűE[^_]Ë]썃D$ D$D$#$́E]썃D$ D$D$$$蔁ÍD$ D$D$"$cZ]썃+D$ D$D$`$1)D$4$]PFt-M14$]tI։4$]]I]K UWVSÈ}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/ DžDž)S$K9>:hf  81Ƀ4uA )čD$_pxr󥋵t$D$$'D$LD$$%|$t$$x%D$UD$$Z%D$ D$D$E, ${udurP)1)rBvBDžqfzU <9D$E D$E$]UWVSt}U 9E1EtqMyu )čD$UPtMP}y:u}<9T$D$<$%U+ue[^_]ø"fUSD$f$Jpw D$ $Ilw []UWVSHv}}ԋE E؋uu 9EЉƋE,5D$l$-.pw }M؉MufuUT$U܉T$ D$ UT$$Luu vU܋9El} u lw tUԉ%9pw t1MЋE+H[^_]Á} u lw uD$D$ $4XƅtEĉ4$"]AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UAnDžuED$UȃT$Ẻ$蟋;Es4$O[f % ЉD$|D$ T6D$ED$Ẻ$*x ;Es1"B9EBf9EzJ Uȍ~|$D$ $MnKNMMčD19C9}rỦ׉΃s$tft1V4$rZDUuuB r EfUSD$ls \$ ED$EU $T$u؃[]1[]UVS_-t$LFL$\=$|$(4t$4D$h$ 2D$9L$\$D$LD$,1|$(D$$D$ |$\L$8t$d-t1+t,D$hD$L$0$qXL$0"D$\D$LD$\xOFF2D$49;|$\yȃ9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -UWVS<1}D$<$2ED$ ED$E D$<$D$<$2[^_]UWVSܠѦ}D$<$-2ED$ E D$A.D$<$D$<$$2[^_]ffffUWVS qfU J}7D$$U 1U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$ U  0Muωƃ}EEu2J0B0upH MHBD$$0E [^_]ÉU U fb ߋrEt9spE9-JUT$ U T$UT$V$Љƅu E[^]S0E[^]Í D$ D$D$8 !$M@U 讘A.D$E D$E$2]UVS耘uE$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]R0E[^]Í4!D$ D$D$p !$M@$U՗ΝA.D$ ED$E D$E$$]UVS蠗ÕE$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Íl!D$ D$D$y !$2L@(UA.D$ ED$E D$E$$]UVSõE$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í!D$ D$D$ !$RK@4UA.D$ ED$E D$E$$]UWVS(ߕԛuEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}O0E([^_]Ë$ 1ҍ}uU썃0"D$ dD$D$ !$I@HU]EU썋"L$ L$D$J ! $IEIUT$ T$D$}!$LIEXD$ D$D$[!$IUUړәA.D$ED$ED$ ED$E D$E$]UVS藓ÌE$ tKtE@8t>UT$ U T$UT$V$Љƅu E[^]M0E[^]Íl"D$ LD$D$ !$0H@8U A.D$E D$E$2]UWVSĒùKD$-D$@:.<$Et8ED$ED$<$w|$ D$D$$5E $eD$zxD$$pE$USD$ ED$E D$E$[]fffffffUWVS0ёƗ}u t$E$6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw",Nwq\E@VB.PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$dtU@}ظ^DE@uS4$euV tQFvIE %Fv7 ,-}ԉ}؉xE7B.DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$ rF<gE\}؉xE^E?$R.E냸UWVSyƅ9N rd~PRuF$D$ D$L$M<$[VMf.&2Z^uC[^_]ÉUy(M$3ED$|$F$UM3ҋMUu~ VЃ[^_]ÉMUD$ D$D$>$7-MU MZD$ D$D$>$,M9N r~y(M\2ED$|$F$荂U82Mu~ 1UWVSpwe}ƉυF(JJrPfJtt$ $ uL蕞t4F%=@=(=Ĕ[^_]ɝttk18t$tB$#t5z |1tft Ĕ[^_]fxt~B8z<~ ^z0Z4FB@zT.BpDpf@PDP01H41 u䋕t3P8H<1 uҋpx9t<|1tftF 0 rĔ[^_]ÉtD$ D$D$>$A*tzUtBT%=./8t, f({f'{UWVStÃzE։ʅE@(u+U$UxTLYHP#BXU$U@PxTZrtftP,}WP@ @J@ @@[^_]ÉM썃D$ D$D$>$(U!1UWVSszyljօxlxD$$tE3G0U3W4 ux3G8|3W< -xGЁČ[^_]D$@ $$>!} }fGH]&G @E}G(UċrDuG$]EЅEċ@hUZG(UċZDuu떅uEċ@뽅?~t&UWVS$kq} EdD$,$8ƅEF$~(EEt=}1҉Eu׉ $9sǃuEuw1ɍ'E‰EM@DEwE1}EBUE$UUQ…U@DEBBTBN(U?fUufBHEuBMEPUEo}}Ut E1ɋUt9xf@H F(EuNE$A}# $uE$F$4$1$[^_]Ã}uω$9sǃuu0UU~8#릋}|\1ɋUYxf@H F(hD$D$@)$qFN(D$ D$D$>$D$ D$D$>$1ɋU@f@H F(ZE4UWVStgim}tH@JHDy$VDxpup$VDy4$wtv$uGt$G$G(t&<$1[^_]Ë@$$dG$ ƃtCG$뻍D$ D$D$ >$Ev EG$k<$Eb UUUWVSfl}57KW(?FLfFL;NHtlfv$\NDFLf;7tȍgD$ D$D$>$Affu@F83G N<3O FJ"Gt uƉv$uuGfFHPp$~DWF(VD{G(G$O(1[^_]ËGt+tEW(uƉv$.uuGGIG)t룃8N?wGGENQ(BI|/u‹E/N,QT$VTT$$7[^_]ÃD$ D$D$U>$1ɉfFHG(uG$F,F(NTD$ML$G$wD$/M $at;9EP$U) @MD$UT$E$+MN,GFFF8V$멍D$ D$D$>$UvUWVS`fu E t1[^_]Ë>}F)uGHf fű~t$Xu} EHDu@8/tF(tF[^_]ÉUD$D$@)$莿ǃUttF<$b<$ugFF)E@[^_]ÁN(fD$ D$D$1>$F߿UWVS^àdutp7u4E4$u(4$E$臿[^_]ËF$$뿋F$$F$$F$$뵍zD$ D$D$B"$+aUS ]cA.D$ D$D$E D$E$l$]]US ]ácED$ D$D$E D$E$l$]]UWVS8l]acƉ׉t,MO=U= =DT$E؉D$E܉D$ L$|$4$=ƒ,u܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1"ك,8[^_]1U>\7bA.U E]UMU E]fffff̀rS[a4 [̀rS[a4 [ ̀rS[ôa4 [UWVS[Öau} u !t9u[^_]1[^_]ÍD$ XD$D$*#$kUWVS4[)au} ttB|$4$[^_]ÍD$ `D$D$B4#$ uD$ `D$D$C4#$UWVSZÙ`u} ttB|$4$[^_]ÍD$ `D$D$B4#$yuD$ `D$D$C4#$KUWVS@!Z`t$(D$T$L$,D$,t "|$GD$8UT$$\$(9uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(芫D$$T$ D$0T$4D$T$ $D$1D$L$8D$9\$(["D$8D$E܍ 0MU‰T$UE$]U})ljEuUD$ D$D$E $]MAQt$|$E $@t~")Ɓwf]O 8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$]p…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]dD$ D$D$E $m$뫉EX@$]MA }E@@eBE $]RD$@E$_E |EMH ] ωu]z,D$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]uDG uNjUtG~uU܉$]}닋]썃+D$ D$D$x#$.$]>‹EE1]vUWVSMôS}G $Uwt6$BuG[^_]UWVSwMlSu} t"tL D$ $N[^_]ÍD$ D$D$:#$BuD$ D$D$;#$UVS8LRut&== =ED$E܉D$E؉D$ T$E D$E$]=t3w Ef>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[ÔQ4 [ffffffffUE]UWVS$hK]QE։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]Í=D$ D$D$r#$EPD$ D$D$s#$!UWVSXVJOPEu Ud E' } E EE̋EƉE$]OEȅ E? Ef UȍBEԋEЉE؃)֋]ދuމuED$E$M!EȍDU؉UT$}}|$}<$U1Ʌ9uWuuEȉEMEEĉ}NjE4u܋E9MuЉEËE9s#ED$;D$$UU9tΉMuЃ\97]ˉ}}܉+uED$|$4$UM9t#+EU‹ErUENjE9r}܉ً}}M܋E9ED$u܉t$)$UbE‹E+EuEuE9EԋM9KEEEUčB}9EU}؉EC‹u)}U92؋u)uEԋ}9}EЉEM]}9}ED$}|$]$U}]UEE܅U؉!ED$|$$UU9~S}E9rՉ߉ËE9M̅fU؋E.& 9r}G9T)E؍LEDEEUv9uM؉E}9}M]U9UU̅U؋E}f.&029r}Gu9!F)u؍DE؋EԉEUEE9'EUċ} :9t?Eȋ}ĉ}ȉEED$E$ME>Eԋu؉0EȉEċEEȋE9E^Eĉ$]01X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$];}~]D$ D$D$y#$ ÍD$ D$D$x#$k]D$ D$D$&#$]D$ D$D$'#$wh]U$?EUT$D$ ED$E D$E$]fffffffffffUWVS >DEuVtG~^ЉUv.&.&tP1H1 uN9H u [^_]ËUU$]豳t"N^HXNH UF [^_]ÃUWVS->"Du7uu[^_]*F$$Ȥ4$NjF$$賤[^_]UWVS=C}E wu v.t&6tk9uFVO9N uO1MO1 MtGD$ D$T$$|GWG1D$<$KtG9F [^_]ÍzT$ T$D$i#$3E GffUWVS<Bu8F}9FiF FD$ D$D$$FVFD$F D$$FtotfxWFvthV uAzN)91F Ju M ]z u F MЃ[^_]1}81F u1UWVS;A}7t2G$$蒢D$<$ƋG$$u[^_]D$<$Ɖ[^_]UWVS w;lAE70E@$$D$E$,ƅ@ ‹} 6@E@$$蝡ptiEM 1D$E$ƅt[P } uWuYu}8닋E@$$t= [^_]äDf9ft8}8E1E xIE xfff̀rS[t?4 [ḃ̀rS[T?4 [UWVS$A96?utqEEE E8D$D$ED$ t$D$E$,ƃt 1$[^_]u8 uk81ፃD$ D$D$<$$`ffffffffffUWVS0m8f>E̋]} 9E1u9 &t8u)؋U+0[^_]ÍM1D rE̍ .&TЃutS؉].t&.&.&t\="t]W$]nI1B]dfffffffffffffUWVS17&=}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU 6D$ (D$D$=($$U 끍6D$ (D$D$<($$U KfffUWVSQ6F<M} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$Ɖ[^_]ÉUM6D$ 4D$D$Ad$$UMP6D$ 4D$D$@d$$UMUSE5:;Ey (9~)ML$„B.D$E $1[]ÉD$ D$ED$E $1[]UVS4:Ey (;}.D$@„B.D$w 4$U[^]ÉD$ D$D$@w 4$K[^]UWVSP4E:u} taEtHB.EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍD$ @D$D$?$$uD$ @D$D$@$$FfffffffK̀rS[T94 [UVSE3:9ulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS2ú8]l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp4819u[^_]Ë]싃tpu޸UVS1à7L4$aulU4$D[^]ËE4$-[^]UWVS N1C7} lE[LE$lttp)ЉȉB}H}wQǃǃǃGlhEG1E$qE [^_]1뜍Gƃ}?v8}}E?EG EElE艃hE=p)ЋM@G@EE띍D$ \D$D$Y$$vE$fEEE3UWVS ^/S5lEEẺEыE)ȉE䍃LE$ٕlUp)ȉA|hEplt)̋Ep1thE$>E [^_]1끍D$ PD$D$$$bUWVS(.4L<$ޔƉ<$ϔ[^_]US -3ED$E D$E$t []US-ó3E$[]ffffUWVS-Æ3}tHD$<$ƅt&tt$<$[^_]1[^_]ÍD$ D$D$A%$9UWVS-2uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]*"썃D$ D$D$V%$kNfffUE U9r 9]ø]UU E9r 9]ø]UWVS+1w w uw <9E1ɍt-ωD$4$>t w PEu׉MD$D$4$ MtMljMuD$|$E$ w 8Ftt$E$ 4$賨uMEw 9t$$蕨ǃw ǃw [^_]Éw TD$D$$苳[^_]UWVS*É0u} t%5D$4$tt=t1[^_]À=t[^_]UWVS:*/0ut4t$<$ƅtD$<$ 4$諧[^_]ÍΑD$ D$D$<%$UWVS)ô/}G$ƅtx @D$$~[^_]UVSr)g/ut/t$$tU 9P [^]1[^]ÍΑD$ D$D$<%$3UWVS (.U<9E8s7i1}ƉUE D$ED$<$u E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVSA6#ƍU9*ET]UWVSh 9E1D$<$}AEtFyL$$L$T9~L$ T$D$<$U+u h[^_]>f+̀ffffj̀rS[$4 [ÒrS[4 [UWVS}u t$<$u 1[^_]D$FD$<$ tۍFD$<$YtȍF D$<$FtD$D$D$ FD$t$<${zD$ D$D$G%$:6D$ D$D$H%$ffffffUWVSö]}E 0|$E$Ctp?9}raeto1Ɖ\$E$U]9suM9u+EE $]E E E8t 1[^_]ÅuUuCtD$$]DƋE 0i]D$"$랃t.t&:똸vLE8qw .UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVS)u 9E1V F\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …x^D$dD$ TD$XL$E$6 …x'hD$t$E$‹\f8tVE+oЁĸ[^_].֍F\DžTDžX\IP\p9{\hD$t$E$x\NP\6DžhhD$pt$E$Fx'q\D$ hD$D$4$d\D$`D$ TD$XD$E$ \88Jffh̀rS[d4 [UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS u}F9r+)F|$E D$F $a~  [^_]1 [^_]UWVS Ýu}F9r+)F|$F D$E $a~  [^_]1 [^_]USc LEU ]t,HPP UP[]ÍlfUWVS }u tgt$<$kt6tu*t$<$L[^_]ÍFD$<$诬u 1[^_]Ãt$<$蒬[^_]Í4D$ D$D$%$菽jD$ D$D$%$`7UWVS&}u tnt>t$<$脲u[^_]D$ FD$t$<$腴[^_]ÍD$ @D$D$X%$Ѽ떍D$ @D$D$W%$襼cUWVSk` }u t$<$u 1[^_]ÍF D$<$褱tF t6u$FD$<$tăt$<$뵸[^_]ËFE }F[^_]D$ D$D$w%$ͻOD$ D$D$x%$蛻 UWVSaV u} t tJD$|$4$葱[^_]ÍD$ 0D$D$g%$.u?D$ 0D$D$h%$UWVSþ }u tet$<$蝩u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$U뵍D$ D$D$%$QqLD$ D$D$%$BUWVS }u FFt 1[^_]Ét$<$藨tFD$<$ tӍFD$<$qtF D$<$^tt$<$K랍D$ D$D$%$NV؃D$ D$D$%$'UWVS }u -t8GunG toFF[^_]ÍYL$ M썃D$D$%%$U艸GUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ L$D$$E GFG F[^_]ÍكD$ D$D$$%$螷G EL$ L$D$ $uE   FFfffìrS[4 [v̀rS[4 [VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS!uM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1эD$ TD$D$:%$pM E9M gD$ TD$D$;%$5M fffUWVS(ƉЉ 9U1҅OD$ |$D$$ċ<$脩@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ D$D$ $)g4t9um΃tft%D012 (T$ T$D$%$]v2T$ T$D$%$"-D$ D$D$ $fuoN }L$$ te$>ff^N mF.t&*UWVSþƉE 9E1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$Ї4$营9E{ED$t$$+1F5EDž*FfEMfD$ D$D$<$6c<$ؤ9EED$|$$sF<<p EED$D$D$D$ T$D$$v~0wDžFȉсI<<9fE<<|$ L$D$$U8<$]9Er8ED$|$$$mj$m~3LED$E$NDF <Džytt Eut2ED$ D$D$$st1ED$E$1C%UWVS<uU EEMEE܋EE؋E E 9E8}1w~wFl}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ D$L$M܋E$^M܅x9lEE܅t E؅aFfVT$D$ 0D$L$M܋E$^DžMn9fFfF fV ffuu҉T$D$ D$ȉM)D$4$-^Mx 9EtEc҉Uԋ}^UT1'E܍E؍xE̋E܉M܉u ET8ẺT$D$ E؉D$t$ $M]9M)ƃ9}u1hȃiviD$t$E$製1?FD$ EEEDEԋ}1'E܍E؍xEЋE܉M܉u E8EЉT$D$ E؉D$t$ $M\M9)ƃu1yMFD$ D$D$}<$D\<$M9L$|$E܉$腼MFUU܉D$ uD$ȉM)D$$[M9\D$T$ 0D$L$M܋E$[M UWVS@7,lj΋E 9EG uY$fto|$$gt9wuҋtD$G $謞u1ffh$}@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$t$ |$D$$gu8u Dž11fBUVS ut$F $eE $MUYF t [^]ÉE4$cE [^]ø̀rS[d4 [UWVSQF}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$>qn8[^_]1[^_]UWVSÛut7D$4$FftID$4$[^_]Í1D$ D$D$@&$_띿ffffffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUSuPtSt /[]PtfHuX uHuxuπt[]Pt#u[]@ tOEYD$ ED$4$05uEt8u x[^]ø[^]ÍD$ D$D$8&$eqUWVS(3 tƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJ f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.<<븍3UWVS Ɖׅt5tet&u 1[^_]É $GuMT$ T$D$8&$םMuMT$ T$D$8&$裝MkMT$ T$D$8&$kM6UWVST+ ։ 9E1|DžDž\&F F`FD$$D$ D$D$D$F D$FD$ D$D$<$lu G @u}D$D$ L$D$<$_O @,1ƒ $VD$D$ D$L$<$~QG KD$D$D$D$D$ T$L$<$負E+ȁT[^_]ËQu7Iffft#fFPЃ6tRrD$ tD$D$ 8&${Uߟ+t't܃t&u貟襟蘟UWVS(ƉЉ} 9U1҅t\D$t$ ˒D$D$4$L=1U+([^_]É4$PPwstP|.ut$T$ D$D$4$eL댉T$ T$D$ 8&$fOUWVS4Ǟ}ĉÉ 9EЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ]OUWVSƉ׉MEOD$A M$[…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftugdD$ D$D$8&$=0D$ D$D$8&$f mUWVS&â@DϋE$E, 9ƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} u-2(Dpf@fPff[PD 8Hx LD$ |$ T$L$$蚖…P @@ u+!<$菖f$R莏t,$ډL<$軌 LwdmPu .8tX<9 u拽4t t҉tH9Y PP1 UWVSpùƉ 9NjE1>$H$H`11D r틅FFtGGFUCF薍胍1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$蟌8=.t&脌G au$1ҋybK;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$x$tTLt&.&9uiJTƅyx$1ɋtH`phG <t`V9&ut뎋x$+-Ls8vDž:@D$ 6`ptu t Džx$y,vGt$5<$5ux$%,Dž|.Ix҉$+Dž>$48JD$ D$D$u8&$=l>x$z+Džx$]+DžX`A{$0"DžDžt?G t,Gt&H?wB11  ?uNj<$7D$ D$D$c8&$kG H닋Dž(D$J3Dž{vGt$3<$3u DžDžvXx.fǃ 4$1ɋt.GtuŋG@fuXHS$*D$D$D$ L$D$ $6ȉQH9rs$P) xrHH9s $1GDžPtp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$Xx$1ɋD$D$ $y|$L$$ ~D$|$$FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $7ctpD D$ D$t$<$~')ʍ0&J9uB<$J.Xt;1AtF0 $.Ft4$-X@FXVDž|1dH1׉D$ D$D$$蔢T$D$Ii $IwjNxa 7 $-x$#5x$#DžFB0$,t2Buቅ߉UWVSpĮMEׅ M11D rEMEr EED$ E$]-HMt$E$]OoX@t\}}< < ߉ډt$$]t!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍ0D$ D$D$h 8&$a]D$ D$D$i 8&$taUWVSp:/uE$x>FEu11D rE@tmEEEE<$UML$ML$D$ |$JD$E$ttwEЅUp[^_]øp[^_]É<$|UMML$UUT$D$ |$=D$E$ t2E$(RUEetFE$(gMEԋAE܋A EAEAEAEAEEUԋEtEЉƋ@u{Ve!UWVS\ 蛪Ð 9NjE1ar D$ D$ D$ $3ƅ?8#D$4$D$4$x1҉< tv< tr׉ʋD$$ƅtbHT$$NGFt < t< uσxzT$$uЋAAA AAAADžD$ D$D$4$fU׉&.&t틍tڋ$ D$$}k1ҋE+Ё\ [^_]ËډD$ \D$D$ 8&$\D$ \D$D$ 8&$S\\UWVS4 EȋE8Hu11D rM̋]ȍ D$$nEЉuЋM̉t(Ct&.&Ë@uM̉u؋EЅt $].EUt 4[^_]ø4[^_]UVSA6uD$F $rtP PH p[^]UWVSDljE 9EG ut$gt$$ctӋD$$lQtD$F $KQue$1O@=wI$ O‰@=wЋЉ=@1U+D[^_]Ë~D$<$Ptu狵1DžЍtftȍtftD$D$ GD$D$@$+9qt89FD$D$A$z<FL19\9PB 9=0t9$9uۉD$D$ $wuD$ D$D$$I(u9u Xu3fvfvB[UWVS }utHt$F $=E $UF t[^_]ÉE4$E[^_]ÍD$ D$D$'$VfffffUVSÉ13v.&.&.&.&.&.&   lLLLL9r[^]UWVSTNjEGEGEG EM],t&.&.&.&.&.&Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVS$ut0FF#EgFFܺF vT2[^]Í5D$ D$D$($NUWVS譙âEBU oP?ωMM1ÉPHUʉP@)|89]riڋu uwuoxEE);UEމ}E} ]7E@9r})uu Eu sItft[^_]äftX] E]DEv5T$ T$D$($WMEU ET$ T$D$($ME\f7u S,f$UWVS$莗ÃEE} 9E1WEEG?78)‰T$ D$<$cD$ED$<$LEyX1tftE+$[^_]úx)rBD$ D$D$($K5D$ D$D$($qKWZfPdUWVS$ }ЋME E 9EƋE1B.ljEDGtXEE؉ƀ0xC1E 1҉uËutFt9}t`}׍Ty1ME+$[^_]Ã}u1ft* ta) 봻A8w믋u܀.u{E9twVË}DGt03Y؃PuuE @4E [^_]Ã댉U }OD$G$)DžUtEuUE@ u*x(9P,ӃDtftEp(ff} GуcF9TNO F|?L)09"A)‰UtEPE PM1EE/E P FD ]t)É]x9EEPB9uҋEPU@E]BED$UT$E܉$ΒMyBuTUEPE Pa@ ]PBD$D$ E${)B]B0E$E@$E@@@0$E@0@($E@(@,A01$[^_]ÉT$<$]YDžqEx(UP,ӃuCu*E $[^_]ËEP fZUVSodu F tcu.tR4$tEED$4$tE[^]èu?V$ED$ ED$T$F$q t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$a[^]fUWVSp蝅EċUOD$D$}Љ|$ D$D$]čt4$EЉ$rD$D$|$ D$ED$4$QU1}9U1EEމU]̀{u9S4u'ft"Uf9rŰR UMщM9rƋUE]؃{UEU$]EUuUE0U]Ӊ]t$D$Ɖ$] űUfEU{u4C<<u$Eftf9CC %E9rU$]bu̍F}9FE81p[^_]ËUBtnr uv ]ȍUȋU]TUMщM9bCu=fE9T1MщM9*vC fEȍM114D rCEEMύEtfEt}DE}}E<vtft}d}Ds!E󥍀EEEEE9MEE$]\E$]C]̃ ]1ɉE]txà uыE]E1ɉEfuuà tu؃ыűEFEFFCFC E1ɋ}ƉtRƃ uE1ɋEt\Etwupű}~utftEEEu u}̍G E9Yt#tfE뽸ű}~ utftűN yu }̋uwEEű}~utftEEuȋEuMщM9Eƃ E̋up1MrEtfEt}}EXÍ@D$ D$D$]X($:4]EErEu<u"M%$]s&fmHMUVS~{ut4$[^]Í1D$ dD$D$/X($g34$[^]fUS#~ED$E $[]UWVS,}}} 'v?NBCDt}81,[^_]ÁB u$<ƋEEFOM؉NGE܉F G EF$G$xF(F,}EE=V-~U V O(N1utE)NE܃UȉF99U9} 9U܅TEE = =w=wUUE=?B 11 +EUEUEUD$T$ $ED$F4OF:ON;J64$0}vPEF(V,}{EF-~E F O(NEEE뮋EAE܃= =w=wU܉UE=? @11 +EUE܉UEUD$T$ $E܉D$tF0F8GF9UF0F81F4F:1tx11 +EUE܉UEUD$T$ $E܉D$F0dx11 +EUEUEUD$T$ $ED$F4[F81F:1UWVSyöD$E$ƍxD$4$ }и9ED$D$t$D$ D$|$$t4$IttKD${D$ E D$|$$ƅt/Ĝ[^_]É4$z31Ĝ[^_]É|$t$Ÿ뽉4$1UE@ ]UWVSx~EEU ;P snH,X<3t;t-?39r09Pr+HE)E1[^_]?SӋ?̋]2Ӌ]2UWVS$w}uF$ED$ F(D$ED$E $X}f4N:^;)ЉMMЉ]MF$)lj}]f4)MMF$)É]Ef4E)MMF$U)‰UF-NσthtT?<߉f0ED$ ED$)N8N9^ )߉|$4$D$[^_]Yf.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴1EE<2w]EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVSUmJsljE 9E`M!t8\$AD$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,hhDžD$ D$D$$]j uit_atP%xrt& r; ut$D$$u f})\D$|$D$ D$D$$ g:t$$%t$$ H%88%$D$tD$$t$vE+Č[^_]}v.& p;8u}vhl.t& P;8udt$T$ D$D$$U$8<$\=!\$&uD$ D$D$V$|$D$ D$D$ $uz|$D$ D$D$ 4$Iz|$D$ D$D$  $z|$D$ D$D$ <$y) D$D$ D$D$4$y}艽EЉT$UT$ D$(D$$0B.9D$۔D$$\)U frffXftD$D$$1ՔD7D$D$$9|҉ƋD$ D$D$>$1D8 DAu.L$$*9|ȋD$ D$D$$aD$$ 5 D$ D$D$Ĕ $0fuAD$ D$D$͔$lD$ D$D$ $1ՔD7D$D$$9|҉ƋD$ D$D$>$91B.D8DBu.L$$<9|$D$D$$UWVSdôjEĉED$ED$E $a>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,1`ẺEEfEEEfEEEfEEEfEEE`t3 u'^"lUoUt& x;uED$|$ `;.D$(D$E$?E`t eED$$;E`AED$ D$D$!$~D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^;D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,7^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,g]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\aD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,/\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[=E`ek‹wt& puED$ t$JD$E$:k‹w p8uED$ t$St$E$jWc& PJ8uED$ T$t$E$jWuf Wz?uED$ T$t$E$aE`t tED$$ ED$$1ɋuEzED$$ E]ED$$@E@ED$$E#Ef Ef Ef EĈ[^_]Í T$D$ D$D$<$=n D$D$ D$D$$UnU D$D$ D$D$4$m D$D$ D$D$$UmUP D$D$ D$D$4$]m<$`D$ D$E$nĈ[^_]ËED$ D$D$F$ED$ D$D$B$ED$ D$D$>$uED$ D$D$:$^ED$ D$D$6$4QED$ D$D$2$ ED$ D$D$.$-ED$ D$D$*$ED$$ jIUWVS$Zà`uE } 9U1D$L$ t$U‰T$$}xVD$t# $U+u#$[^_]$.19UED$ D$E D$E$]UWVSYõ_}ED$|$ ED$ED$E $x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$uMt Ev[^_]Í|$D$ D$D$4$hEtËE[^_]UVSV\u chlt& Bt ;2u[^]Ét$D$ D$D$ $gv \[^]Ét$D$ D$D$ 4$Ng[^]UWVS6V+\U} tfUBb~U f ~t;u[^_]Í T$D$ D$D$<$f[^_]ÍlUVSUá[ua&.& Bt ;2u[^]Ét$D$ D$D$ $?fv d[^]Ét$D$ D$D$ 4$e[^]UWVSTZ}auwX w t& d @Bw- wi ueȕ@w, u85\u(Lu<uؕ,1|$D$ D$(D$4$d[^_]Íҕ捳ލ֍΍|ƍm뾍붍뮍ݕ릍랍떍뎍UVS*SYuE_D$(YD$4$_x#_Y[^]_t$ T$D$(Y$UWVSRëX}^v.& rt;:u[^_]Í |$D$ D$D$4$Lc[^_]UWVSL3R(X 9E1E <tmD$D$ D$.D$M‰ $MbMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$M~UWVS4hQ]WEEEE$GE܍U}}؉HEU;EEU t 14[^_]ÃuuU<-1E<+u JMBB.DK+r1&.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF RGEuuESt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVSQM>SEU UHMHMHMXˁHɁ@ ='-E썇'E)ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)MEC$yEE-$yEE$yEÅU܋MXE^}d\$DD$@ED$<]\$8T$4]\$0]\$,]ĉ\$(t$$L$ ut$ut$uԉt$uЉt$ủt$ uȉt$(D$u4${%E$Et $Et $}EČ[^_]ú)‰U썇iEESEW- uVE; er@ror:@ unk@ nown@ LOC@ RR @vers@ionEČ[^_]ÍsEs}\$DD$@sD$*t<.tȅx%[^_]Åt<.1[^_]ÉM T$ T$D$<)$E[^_]UWVS0HNTE荰EEEE$WPlPHH8|$ x|$x|$@ D$L$T$ "D$D$4$觰~ Eƀ0[^_]UWVS)HNu Gt-D$4$u?E tE [^_]Ë?D$gD$4$aukVB.DPtM@D$ ED$4$讍ҋMyE8m1Ɂ]1VUWVS9G.Mulh Gt-D$4$ u?E tE [^_]Ë?D$ƜD$4$qukVB.DPtMPD$ ED$4$辌)ҋMyE8m1Ɂ]1VUWVSIF>Lu D$4$FFy ;F|/} t)P}D$4$[^_]Ét$E$sUSEKEM QQy ;Q|< tZ[]ÉL$$%[]UWVSEuKEu E$jEEEEED$4$F0u ǀED$4$D$4$[^_]UWVSDJPPƠ9uV@ttuF*V@uuOFuuFuFf~@t8D$4$Tlj4$kP[^_]ÉFu뺋F몉4$QfF@UVS7D,JƠ9Fu t$@:.XD$ D$ED$4$'[^]UVSCIƠ9Fu tE D$ D$ED$4$[^]UVSCÊIƠ9Fu ztED$ E D$ED$4$[^]UVS,HC=IƠ9Fu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$D,[^]ÉED$4${EUVSBîHƠ9Fu t2ED$ED$ED$ E D$ED$4$37[^]ÉED$4$EUGB@H9U]U)B"H9U]US BHED$9$?[]UVSAGƠ9Fu t$ED$ED$ E D$ED$4$[^]USAG9$mO[]UVScAXGƠ9Fu Ht2ED$ED$ED$ E D$ED$4$=[^]ÉED$4$EUVS @FƠ9Fu t9ED$ED$ED$ED$ E D$ED$4$9 [^]ÉED$4$8EUSw@lFED$ED$ E D$ED$9$D[]UVS4@)FƠ9Fu t4$lM[^]D$$US?ED$ , D$ED$9$9[]fffffffffffffffffffffffUWVS q?fEE8tj׉ƅt|$4$Ot@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS>D}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$E|T$ D$D$X*$ <.EE룤u9sftuu_SfӋ]KUWVS0=CE׉΋UU܋U؋U$EM9L9MyE荃EEuuE9D$E$t4$ME*t4$MuuE$EtE؉Eu܉00[^_]ËuE$Etu)y9uΉE*T$ @%T$D$X*$E0[^_]1UWVS$><3B]Uϋu M MUL$T$ L$U‰T$$"EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂|D$ D$D$X*$ <.Eډ)؋ux$[^_]ÿ뛉댋]썃D$ 8%D$D$X*$뷋]/EE}8UWVS(e:Z@]}u ӍR9M)ÃM <.E썁|EЉU u2D$ED$ D$D$EX*$EJBs1([^_]É4$Et+([^_]ËUU]UE([^_]UWVS+I9>?E}E(M,u M0p 9tU1҉u$t|$$I:ƀ?YE4$kDžU4T$|$E$-Eƅ9s9D$|D$ D$D$X*$ <.7)U4E$NjE$|$D$4D$ D$dD$$HNj $‹>|$ $}wyEt}wvML!򋽤(t#t<.z<7|0.}u$U$'D$T$t$D$ D$dD$4$nG‹$i9ՔxB.|f @)~ DžƋD$D$<$9u׋)lj4$}O<$xJ|$4$1ɺ0f; @|01x DNu.9uՋʋ)‹4$9gƋp)p9D$ H%D$D$EX*$J}+R"}$4$VD$t$ D$dD$<$D‹$$D$t$ D$dD$$nD‹ $eGD$t$ D$dD$4$D‹$9zA9[D$|$ D$dD$$C$utE+-Ĥ+[^_]ÍE4$)5tD$$1ɺ~l>8E4$3+D$D$$U &Ƌp)9D$ H%D$D$%X*$I}$ 4$VD$D$ D$dD$4$A‹<$4|$D$ $Dž- Ɖ$H}u ;}$$|u$),D$t$ D$dD$$@‹ $ GGD$t$ D$dD$$R@‹ $IG$D$t$ D$dD$4$?‹$_wGo"AD$|$ D$dD$$? $9u}3$;xl% nG GGDž====Dž$`lj9w\&79&&Gt1Gta$D$D$ D$dD$$~=‹ $uuO}$<$fOwG$$T$t$L$D$[D$ D$dD$$<‹ $$9 E$p}$4$V~NL$T$D$?D$ D$dD$4$;‹$TD$ *@D$E$pt$<$C-Dž##?#1>)0~0 $a09"$,‹ $#u|$D$ $U R<$0|$T$ $ 9$sƉ9$)u}$@<}$D$t$ D$dD$$9‹ $GGD$t$ D$dD$$K9‹ $BGD$t$ D$dD$4$8‹$bGG<o"q"}4|$ t$D$$軳4$9s?D$|D$ D$D$X*$ <.։)׉}49)= $sS@u$D$oD$ D$dD$<$y7‹$t6c'92@Dž@DžDDžHDžL@)‰t19rE4D$ |$L$$賱<${9s3D$|D$ D$D$X*$ <.)U494$Pt$|$,ED$JD$ D$dD$4$5‹$@t$$4$A븃}$u$f}$v}4|$ t$D$$.4$9s?D$|D$ D$D$X*$ <.։)׉}4FD$2D$ D$dD$<$n4‹$iF9|Dž1op9ƀu2$BDž |$D$ D$dD$$3‹ $|OP9w|$D$ $U v<$T|$T$$U Y%<$)‰Ѓƍ@t$D$E$$+4$)D$D$$U r)j1K:f.&.&.&.&.&.&.&9t؉4$QD$D$ D$dD$$$1‹ $u}$4$F$$D$t$|$(D$ D$2D$@4$x0}$<$.G$ D$t$+D$ D$2D$@4$ 0‹$q4$Mlj4$$zlj$H$0lj<$]|$D$$U ^8%<$cG$UOWT$D$t$iD$ D$(D$4$8.‹$3E$p VUUU)ȃ= $s[Ht$|$$U C4$z4$2~$bD$D$ D$dD$$ -‹ $o<$~$D$T$ D$dD$$,‹ $<$IfF $7 4$)D$|$D$(D$ D$dD$4$,t$|$$U a4$CF$~t 4$o4$dD$D$4$4$j9E4s3D$|D$ D$D$X*$ <.>D$D$$U v9pF9Gt1Gta$bD$D$ D$dD$$5*‹ $,uOE$ VUUU)ȃ=F$s>+}$e}4|$ t$D$$裤4$k9s?D$|D$ D$D$X*$ <.$}~F$B= g$s}$+4$%VD$D$ D$dD$4$(‹<$}$ )ƍG GGG GG GGƅ=t9yG GGG Gƅ=fDž==fDž==Dž====W GGW GW GGW G$g<|$D$ D$dD$<$$‹$eDA9D$|$ D$dD$$w$ $kuD$ @D$t$$Dž  1F)0~0 $K09 <$譼‹$uD$ @D$E$D$$ 1F)0~0 $09Y <$‹$uJ}$4$lj$}|$BYD$ D$dD$<$5"Nj$‹*T$ $1ɺyk$ C4$Nj$u4t$D$<$9Dž9s3D$|D$ D$D$X*$ <.)u4t$$1ɺm_4$ =$Nj 4$u4t$D$<$3Dž9s3D$|D$ D$D$X*$ <.)u4t$$1ɺgY4$7$Nj4$u4t$D$<$-Dž9s3D$|D$ D$D$X*$ <.)u4t$$1ɺaS4$ /$|4$u4t$|$$+9s3D$|D$ D$D$X*$ <.lj)Ɖu44$Mt$$1ɺ7)4$ }4|$ t$D$$$iH)$qT$ @t$L$$X…$ЉPzD$D$$U 9ȋ$r s}$ f<tu$˜>!<$r $D$|$ D$dD$$x‹ $o4$-r$WD$|$ D$dD$<$‹$ t4$D$D$ D$dD$<$‹4$t$D$$U )D$ *@T$t$$ 1F)0~0 $D09<$覲‹$u $>xY}4|$ t$D$$Z4$"9s?D$|D$ D$D$X*$ <.։)׉}4<$>~($eD$LD$ D$dD$4$$ w$>O;|79})$>v$>CD$ @D$L$$ƅ[o1>)0~0 $097$~‹ $uu$)5<u덍D$D$$U R$'1$>|UWVS8@- E  U8u)E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$P8[^_]U M8E#ʬʰ]UWVSmb u}'|EtG9E r'Gf|t+E D$<$պy躽([^_]9} r+Ey;}uET$ %T$D$l*$E뵋E9E r1UWVSEE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]~(UWVSEu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]07F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,bxM]`]P(UWVS Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cAN])](ffffffffUWVS MFE}]} 1E䍘%;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃0u F*${zMUWVS9.}u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉE^T$ 0&T$D$g*$EE L UWVuL o^_]ø1 fffUWVS\æϋMM 9uM1t$D$FD$ D$2D$M $MaƃM9r,ML$$A7M)11}U+u\[^_]ø\ UWVS EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: E E+Ju}: w) ]u$M EÉ$SrKE}~=Ut3}ƐB.njB.w\DAtu܋E Ƌ})x [^_]9u]䍃mD$ P&D$D$e +$ [^_]ÍM U$WEM E$DtiEEM E$HEbt?EM EÉ$MM7tEMffUWVSöu4$豚H9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} q(yUWVSãE 9E1D$|$E$tGD$T$${tT$<$4NU+u [^_]MfffffffUVSEuUMx#L$ T$t$$Vx9s[^]ÉL$T$$[^]fffffffUWVS vutcEt\E $)ljD$4$*u?|$4$Q&u%džt$|$E$# [^_]É4$%f謨UWVS utcEt\E $(ljD$4$)*u?|$4$%u%džt$|$E$" [^_]É4$O%UWVS _Tu t\E$'ljD$4$)u?|$4$6%u%džt$|$E$! [^_]É4$$蓧UVS uD$4$o!tD$E D$4$5 [^]D$E D$4$ [^]UWVSodu} tAv-u3D$4$'tD$4$3(F1[^_]軦USEU tttu P1[]vUWVSî}u t' td@t/tZv{Nw u6(D$<$&tD$<$R'71[^_]D$<$&tD$<$"'΅uʍ&UWVSu} tPD$4$a&t͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈\$8؉ȃD$xtD$xj݄$D$|L'tru|$T݄$L$PtT$0D$4)‹D$|`(Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|;ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|TH$$Lt$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـ8\$8ـRD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|`(S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|SMD$`U|$p|$$N1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$|$'D$4$.$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|9LD$`Z|$p|$$rM$%|$x==p$$\$|DD$h$DD$p$DD$H$DD$`$D$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaUA.U E]XUMU E]Fffff̀ffff̀rS[44 [̀rS[4 [̀rS[4 [̀rS[4 [UWVSöu Et"4$tEExu4EE[^_]ËED$t$<$utGt8Eu׍GEE[^_]ffffUWVS1&u} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]Í0+D$ 'D$D$eT+$}|+D$ 'D$D$fT+$}UWVSbWu} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í+D$ (D$D$CT+$|+D$ (D$D$DT+$|+D$ (D$D$ET+$|1sUS&E/T$ D$PT$$>[]USE$uE []1[]UWVS$ÛEpEEEEEE1ҹEEuxw88 w38t'E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`USaVEU} ~\wEBu - t wJt Bx1[]ùr u-JuB-袀萀 UU1Ʉtt'4$nD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USK@Ut/9E t*D$ $(D$D$p,$dxE []USM E%t.9t*D$ $(D$D$p,$x[]UEtt]1} ]ËE ]USQFE ~>uTEtKD$ $(D$D$p,$`w~Ewǀ[]ËEǀ[]USýEU tt 1[]D}UWVS|$ 7Etc@@|D$D$4$&|u E[^_]|84$?|81EUWVSuthF~O9tHNM 1[^_]ÉU^|ED$|$E$U7|u=FUF맍D$ @(D$D$Z4,$~vi|UWVS:/}t;t-M tWt1$>;wr$><$>[^_]UWVS}tJWt7E1U9}t#E4E D$4$lu߉[^_]1[^_]ÍD$ 4(D$D$4,$uUWVSK@E@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(2D$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 D$D$4$Hff D$4$>[^]Í1D$ (D$D$6,$bUS̬ED$ E D$D$E$$>[]ffffffffffffffffUWSrgDžt)tYBfBfB B [_]ÉU6D$ <)D$D$M-$7aUuU6D$ <)D$D$N-$aUrUWVSƫûlj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]ÍD$ P)D$D$`-$-`UD$ P)D$D$a-$_E+UD$ P)D$D$b-$_UWVS\葪~ÉEEE 9E1fjDž9E]qA D$.$(zB.8tGt3\_u<.uuy.u}fD$:$(tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $3R@)9x‰ ȉ@ ME4$'QL$D$t$LD$ɞD$ D$LD$$蕏A,Dž9E0aD$ d)D$D$B-$~[D$ D$D$$DTIf ugx.fcD$:$u$?fnUWVSlQFZ‹BcB $(1DžmDžDž r D$$DžtUpЉD$D$$<+Gt< tu򋽜$H@)49O)9y )ЉA V1ҍ;tftH<@ lj)9t?9rr ΃rj놉D004$L@9U$a @ E]Džl[^_]à f.&< t< t򉍼D$4$j P8 t$$ N19<)׃ D$$T848#Iu‹tft‰)‰DžNtftR :)9&44$J@9‹f&B0tP< t[< tW< <9s>z2D$4$ tpu׋)ʉ׃ (D$ $8f cFt$$]K'9Dž1Ct$$Kz90C0D$ (D$D$^-$SwP$&f0x0k$Gtxf\>0N7L1UWVS`PEE‰Eu 9E1FE@ D$ .u‰t$L$E$')}EE4$FML$ML$D$ t$ED$@ $d‹Et]$:E@ U+`[^_]ÉM@ $譀M<ʍמE`MUƋE$u눍D$ (D$D$-$Q$UWVS(֛ˡuE>FE苳@ }tgJUE<$EML$ML$D$ |$UT$4$,‹Et)$E@ ([^_]Í=뗋MUƋE$t([^_]Í@ $Rt:@ ED$ (D$D$ -$OqUWVSh觚Ü։} }}U 9E1} o-2$(c 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$<))9yrtft1'$1U+ h[^_]3z 7t$$l*D$t$ D$D$$BK@ 9N04$==3׉T9E>f t$$c9P }u,04$=tp9J90Љtftפ9P'$1;NjE$$;$[<|$t$D$ D$&D$$%6<$;=9D$ )D$D$-$F.D$ )D$D$-$qFD$D$ D$D$$&Hg@ 399x04$:=1Ɖ$}:P)9| At$ D$)D$$%r<$ :p)9L$L$<$X8f&($ЅwDž$ I1Ht$ D$D$ D$D$$EDž8@ ?9$8x9D$D$4$W>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $Ulj$ FfDž 1DžD$D$4$T0։9^f 19s<04$CJ})σ (D$ $zljUWVS$u}6EGBEB $E+EDžD$ED$ED$ D$ED$<$R…F D$FD$FD$ D$|$E$MElEE$<$lEEt $[^_]ËF t:$[^_]øEE$h<$E$[^_]ÍD$ )D$D$-$>E$F 뮸xUWVS@E>Mu 9‹E1kFB FBPƋ }ۉ\$D$ D$)D$<$~HNj9s4$h@ D$ (D$D$-$:`4$$@@ -$@@ t҃$S@2fJz UWVS评ä?ƋEtvF u>ED$ ED$ED$E $Elj4$?[^_]ËED$ ED$ED$E $EDžt뼍D$ |)D$D$-$9[E1UWVSۃȉ>t@ËED$ ED$ED$E$ًU EƉ$>[^_]ËE1[^_]UWVS0_TE}u  t=/10[^_]Ã} uyMMUUUUu|$M L$D$LD$D$ D$ D$E$skuE0[^_]Ã} t==a8t{bPWPtD@ 7 E #dT$ ,)T$D$-$97Ex{UWVSX܇}E EЋEEEE 9E‹E1$(1r E؍EEȉMԉ}܉<$%D$D$ D$D$E܉$qDž E؉D$<$XƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$zPu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$)@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$(@9Er7‹}ԃrsSt}MԉM܋E$\E܉$QD9E1uU+X[^_]ÃỦϋU)׃E (D$$t 8E܋UEȉD$|$$79P@ EĉỦ $R9ŰEMEЋPEEE$gE܉$\Eaf{E̋EM8Mԉ $EE7ufiK1E܉EUS|ùS7D$D$@, D$, D$ ED$E D$E$[]USn|c6D$D$ @, D$, D$E${[]UWVS,|6'7tDÉt$ D$@, D$, $ًU EDƉ$07[^_]1[^_]UVS{Þ tpǃ, ǃ0 ǃ4 ǃ8 ǃ< 5D$D$ @, D$, D$ $?Ɖ[^]Í $ t5ΐUWVS0zƅAqB.8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]NȃE@ fu+-dtr ufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$E@0E@}Gfg D$<$1İ[^_]Q}Wf9xD$$3‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09FYu}U >E E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$lE 1[^_]ÃuEt$EE ԅtEuT$U$EM U_ԟD$ *D$D$`-$MD$ *D$D$^-$U ȟD$ *D$D$_-$*D$"$$UWVSQÇW}u t'tQD$ t$t$<$ [^_]ÍD$ *D$D$-$XukD$ *D$D$-$*UWVSPV}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃D$ *D$D$-$XUpU썃D$ *D$D$-$#UE1U썃D$ *D$D$-$UU썃D$ *D$D$-$UUWVSvOkUuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$E 1[^_]Åt<$E냉<$hE ωЃttkE녍ȟD$ *D$D$-$D$ *D$D$-$dUD$$rNjE 8Ut Eo*D$"$ UWVSMSu} t tJD$(#|$4$4[^_]ÍD$ *D$D$?-$uȟD$ *D$D$@-$UWVSHM=Su} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í D$ *D$D$X-$BD$ *D$D$W-$k UWVS1L&Ru} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í D$ *D$D$|-$BD$ *D$D${-$T UWVSKQu} tt@} u[^_]D$ *D$D$-$u D$ *D$D$-$UWVSJÁPu} tt@} u[^_]'D$ p*D$D$-$cu D$ p*D$D$-$5UWVSIOu} tt@} u[^_]D$ `*D$D$-$u D$ `*D$D$-$UWVSpIeOu} tt@} u[^_] D$ L*D$D$-$Gu D$ L*D$D$-$ffffffffUVSHNuED$t$ ED$E D$E$E~>.t[^][^]USHtNED$ED$ ED$E D$E$[]UWVS>H3N}E D$E$St u)x[^_]9u.D$ +D$D$<.$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]USEKE D$E$[]USEKE D$E$[]USEÕKE$r[]US}ErKE$@[]]EVK9ULE=KE M7]UEf]UE]UEfU f]UEȋU ]UWVS$DJEE EEE0PE }썿,}Uuu9E }9sux.tb@tx U9sS@}AnVUBc} 980]($[^_]uuG뒍V>[U|$M $jU:M)ȍ<FtOD$ $=t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\] ( [^_]ø!!"UWVS(6:/@EEEE܋E9ErME 9EsEEH0}}]EEƒ@dt(]n(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]"D$ +D$D$`.$=EKuV]ڋ]9 }9;] }|>}uE~΃s/uuUD$ +D$D$`.$MUWVS$_2D8E 9E1D$D$|$ ED$E D$E$t>ED$D$<$tE+uЁ$[^_]ú^UWVS$1Ɠ7E MU 9E1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]É@^US]E M9r 9s9su[][]UWVS06EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS05uE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉT[^_]É=()[^_]UWVSx/q5EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]s[^_]Ë]X(1[^_]UWVS .Æ4u}E9E |2&6D$D$$umtF;Gt1 [^_]ø [^_]UWVS..4U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]ÉO(;,?UWVS-l3EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]É(F[^_]øUS,2E D$E$( []UVS,ÿ2uD$D$$NtD$T$ tV[^]øffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS(,2}EU܉΅lt F"}uFEUT$$]@uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVS"(}D$<$#|$ ED$E D$E$ND$<$[^_]USt"i(D$d $*[]UVSC"8(7uT [^]ÍD$L$d $訋ƅu$5ƅtD$d $\FFF US !Þ'@U T$UT$$ []UWVSr!g'D$-D$@:.<$脎E t8ED$E D$<$|$ D$D$$E$D$zxD$$[^_]ffffUS ø&E D$E$[]US Ê&E D$E$z[]UWVSe Z&E։ϋUt%T$ML$$Xx[^_]ÉD$4$yƅtU1UWVS%u} GD$F$uD$$~[^_]UWVSã% l$^xD$4$mFE9l p ELh$ D$4$݌ 9d Džt`t\Os1Wp΋ t $vpP9uዽp$XGt$Ctt ; r`t4$ǃ ǃ | t\1tt:$ݛFt)NtF D$F$ыF9pt$g; rtt$荛ǃ ǃ| Kd$˥ uAEUl p h$*l$LĤ[^_]ËWjT$ D$ D$ $UWVS,8-# 9U1DžDžDžDžDž$Jt3D$D$ XD$D$<$=~h$ | | FD$TT$Xt$\L7k9)B)Ӊ))ʉ)щL$T\$Xȉ"D$TT$XL$\_u)Љ))щL$LD$H,/D$ i)\i(\ËD$T)\QD$dFEUED$ ED$ED$<$ƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F.1'Xe]؉ E܋؉ }<$}؍4 1ƅ F(EUjUWVS|$8ljD$T$\L$XE \$\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}Q)à u\$hT$P.׋T$h(.&.&.&)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 qL$@t$<;t$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9\$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 D$pT$t9#D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`6D$D$eЉ t$x|$|KD$pT$tD$xT$|D$pT$t D$pT$tD$pT$tD$xT$|É։D$hT$lD$xT$|D$pT$t9؉D$xT$|D$T$D$xT$|D$D$ ED$D$HD$D$X$D$\ЅtE D$xT$|e[^_]Ë\$8`TD$<=9Ћ|$$)D$xT$|$$$D$ ED$$D$D$X$D$\Ѕ$;$D$$9$;$$D$pt$0)$t$h|$() ‹$|$@D$`) $Ƌ|$4) 5T$<;$$$$t$x|$|$t$h$|$p$$|$@$$$$$$$D$$$$$w\$hL$piF\$p9hFdN-00dFD$xT$|L$hdF)ډ$$D$PD$ ED$D$@D$<$D$\ЅtcD$,;$uV$T$0)Ћ$L$() ‹$L$`) Ћ$L$4) uD$<;$u \$p9$t\$hL$p$$UWVSD\$ljT$( 9D$Ë$@1΃ ~G \$1D$D$D$?D$$D$E$T$(Bщ€|$?t>T$4L$8\$\$T$4L$8\$$@+nЉʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$[1ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0x$@L$ @D$ D$4L:f.&.&.&.&.&.&.&9t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Oщ€|$? D$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G 9t$ tG -t$\$49t$ \$|T\$a\$UWVSHǏ|$`ƉT$lL$4 9D$PNj$D1fB:/ t1P.tt!P.u.ux/ >|$p|$X40>D$HD$h$t$|$tȃ|$dw|$T8.&.&.&.&.&.&.&%1 ڃ9t$tuމ|$Ty\$pC\$hsK\$l\\$T\$l\\$L9D$Tt$hL$h\$lDT\$d߃D$pD$p\$t9D$Ht$D$l>71D$t":tD$l0>D$t9yD$@9|͸!9tx/aN?|$P$D+ e[^_]ËD$`PD$84$\$`G,뷋볉D$0AL$<L$@lD$,/ \$X))D$8t$8D$ t$|$$\$`9|$t |$ DD$40|$8%|$x |$8G|Ft>8t$|$lG$D$\t$lD$dk XPD$T1$D$L\$hD$X$(D$TT$dT$t ;H Pl$ty1pYD$tT$pFP~L\$t9\\$p}3=H\$t\\$p\\$L ;N>VD$\9W\$hD$lP~7|$ldF$ _tft|$lGD$l@11D$h ؃ux\$T9؉ӋL$LT\$p|$lw|$ldFT$|$@u)D$lJD$ht$t|$hwT$xmD$`tD$lD$XGtt$TDD$Pt$p@dPdPltftߤ1ۅqD@|$p`Pp@D$LD$pf@D$`<EPHЅut&.&>u)׉|$HT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$tVtftt$l0e[^_]r1D$LD$`*t -~0 wNjT$`)׉|$HL$Hy|$8u|$X|9|$@ ,;T$|;D$d7$|$$8,$|$ g8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d,/D$Dt$<uVQ9L$X\$\{9L$TT$PL$XD$\tD$XT$\v9D$Tt$PI=D$XT$\_1ɋt$pD$dGt9D$TD$P11D$L4D$x-D$|D$pD$TD$PD$px|$dt$xt$Tƍ>>>!.&.&9iFuD$pD؉D$X1T$p>4iF>kFuL$T\$X)ىL\u dFىL$X|$d9uD$T؋t$pdFdžhFD$|؉lFD$lpFƆqFfdžrFFD$pt$@p dN\$lډNjt$ttft|$l 8D8\$HډNjt$`sFtftt$H0|$xT$|p,g;^1fc뛨{2Oi)\= ףt$D4)L$X\$\9L$Tt$P|$t$CD$<D$DșD$XT$\D$D$0T$4T$4T$ D$pT$0TT$ Tp-\$T$T9Ӌ\$PT$ |9t$dt$<0>FD$<șt$9Ћt$L}D$(D$Dt$,D$XT$\D$XT$\poD$DD$(9}\L$T$$D$dL$T$ D$,3QL$dlD$,9Pt$pD$dN$]=uҿT[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]M1DžuAM荆dNdNt_9t:*~+uـZ@̓avÅ1t&wUVS@54 /tu[^]1ɉR[^]7USٸ7t̿$^[]øUS諲à}u[]Í̿$%[]UVSxm}u 1[^]Í̿4$4$[^]UWVS4-EuM V~KhFhF1.t&.&.&P9u dN9ut [^_]Ë]rl1[^_]UWVS軱ǨUM Z~>dFdF&.&P9u09ut[^_]Ék[^_]UWVS(;0EEM E3 mEE1u,/ǃ 1}tME!}t/ǃ Gp7>袼u U1)Љ3 ([^_]Í3E؍3 E܉΋E؉$YNjE"D$<$EE3 ~|$E܉$[tm}tM썳̿4$4$MN([^_]ËWr觻y}D$/D$<$HOG3ѵƍFD$$4$4 1ҋEҶt  P([^]UVSկu FD$$E$4 Ezt t/P([^]Í UWVS{pu  ǍFD$$:<$4 E t t/P([^_]Í UVS 7̿$ƅD$D$ D$$mtQ$Eщ…t Љʍe[^]ÉT$L$̿$T$L$Љʍe[^]ÍFD$$/$4 E>щ돾Bb0vUVSMu tE[^]FD$$E4 [^]UVS艧~Mu tF tE[^]jFD$$(E4 [^]2UEt@ E]UWVSu} tF FD$$}4 [^_]UVS4蛦ÐuD$FD$ FD$F D$FD$FD$F$D$,D$ D$(FD$$&D$$4 4L$ xLL$L$ NL$NL$N L$NL$NL$ NL$$NL$(N L$,N$L$0N(4[^]UWVS]u } IXP& ;r B}y[^_]ÍIlP)׉[^_]UWVS^S7̿$  3 D$tQ|$RXPL$u} &&.&.& ;p H}!yL$u} t1EU [^_]ËL$u} R|$lP)EU uύ̿$ 1L$D$D$ D$$ L$(3 t7D$oD$^L$PUWVSET$RuXP$M ]*&.&.& ;H p|yE U $\$,.&.&.& ;A yyƉ;u ]9u ] $\$,.&.&.& ;A qyƉ9u ]|M 1]1 ȃ[^_]ÉƉ;u ]}# $\$ ;A y}&yϋM 1]1 )ȃ[^_]Í [ulPƉ)똍 [ulPƉ)L [ulPƉ)RUlPE UvUWVS 7̿D$$} ƅ3 t<t`UM T$L$$Ɖ׋D$$9 [^_]D$D$ D$$&uu} 벾[0ffffUMU t"1&.&9t<u‰]ffffffUWVS}u tSB..&.&t(TSNLKf9t)ȃ[^_]1[^_]ÍD$ /D$D$B.$U끍D$ /D$D$A.$WUNUSt u#$p tЋE$>YUWVS؟ͥe=t:F$V FtD$$]4$;uƃ[^_]UWVSqf}ƃt $tCƉxtD$<$\E FEF e1[^_]ÃUWVSuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍD$ /D$D$H,/$rS멍WD$ /D$D$F,/$FS3D$ /D$D$H,/$ScD$ /L$MD$G,/$ERUҋEMT$ L$D$H$RffffUWVSqfƉUM <$EtC$pupMH  <$1[^_]Í̇ 1#.&.&#txu8u돍D$ /D$D$P/$Q7<$TuUVSshEU Mt [^]MUE􍳌t$ /t$D$P/4$IQMUE[^]UWVS E$  1̇ E0E}M D { uZMUCЋMU 9u` tgߋt}Ct9K ttFߋteC9K ut2 MUCS$ЋUM 9tV uE9rRE9sKu}샮 E$ ut?$gu[^_]ËE]1 tߋtCU11ҋE]ffffffUWVS^SUE0}E, 9E1M zhEED$E$D$h8$PhǀPǀTǀX71DžD8H@L,D$ |$0D$8$"8U+d[^_]ÅE ((hEED$E$D$h8$ShǀPǀTǀXE (D$ 0D$D$Qt/$MW(D$ 0D$D$Pt/$nM((D$ 0D$D$Qt/$3M(RT'UؗѝUT$UT$ A.D$E D$E$>]U蚗UT$UT$ A.D$E D$E$]UED$ED$ ED$E D$E$]UWVS,!D$@:.FX$w(F`F`y ;Fp|4} t.FXPVX}D$FX$f([^_]ÍFXD$E$HUS觖ÜE@:.Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US ODE D$ED$@:.X${ []US ED$ E D$ED$@:.X${[]UWVSؕ͛M} }E EEEeD$E$&E@ E@U~5M19E}EtfEtME)‰UE$UE@몋U tE eMOTEfH @1[^_]ËUulj7wWU<$\UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $%E[^_]ÍD$ 0D$D$Q/$(Il1D$ 0D$D$=/$HE)1u E MOuo U/D$ 0D$D$/$pHE@UUD$E$$EU)1u .fBefm7MyHMUS 赒êED$E D$E$w []US脒yED$ ED$E D$E$x[]UWVSJ?EED$E $ƅwDžt}D$ED$E$9xY=?fGfw  G$ G,r G(Y G Eu/[^_]É$CLfG 1[^_]D$ D$D$<$)[^_]ÍD$ $0D$D$>/$\FUWVS"}t6D$<$o"G ƃD$<$|"[^_]Í1D$ ,0D$D$;/$EUS 觐ÜE9ErD$E D$E$ []蠽ffffUWVSaVu F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9u<0D$ 40D$D$W0$D+V9Vs4$u^4$qg1D$ 40D$D$<0$ODI fffffffffffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS 7,UM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$ F0`UWVSLljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw L0t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$8011ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$2L$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$!L$D$$9$L$D$$9$L$D$$9$L$D$$9$xUUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$HL$D$$98$+L$D$$9$L$D$$9$L$D$$9$L$D$$9$L$D$$9$eUWVSHv|$M$} |$8}|$<]\$@ 9D$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$D$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$ 2⋼$<$$ "SG f A$fx/D$<M$$DŽ$DŽ$D$$$$SD$$8$$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$3 󥋔$\$l{$ [L$8L$ D$T$$4$$FD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$@$4$$RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pdM$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$Q1$$|$D$$4$$H2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$x$$D$l@$3$"$T$p$$$ÉD$d4T$p$$D򍶌3 t$8t$$DD$ $D$$D$$<t$d$$h$$$ $$$4$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$(4/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$ $5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$ $4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$x$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$(4DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$3 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$APvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $D$ 4D$D$d0$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$蟡$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVSû}ED$E D$EE$$©P4E܋ܾ\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$ܠD$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$$B@Ɖe[^_]ËED$E D$$@Ɖe[^_]ËED$E D$$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS,}m|$D$%U <$Y!d4m܋ܾ|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$$d=Ɖe[^_]ËED$E$D$$2=Ɖe[^_]ËED$E$D$$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$X¿x4፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$4$U:ue[^_]ø랸뗸1fffffUWVSp9==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$PأD܋܃݃T$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$``(\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$``(D$D$PD$ D$`|$Nj} t$@ ;؋L\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$$6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0كڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$``(D$X `(.&t u)D$@L$$~YD$`D$؋T$HL$H؃H\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVSu} G9F}uuFV|9s]B9EE)ׄtdD$D$$UhREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVS$}<$FD$t$rD$dDŽ$ݜ$DŽ$E$E}É$-wʋ$,6牜$}D$p0E@D$0D$h/$D$xDŽ$15$DPЉ$K$C‰ǃ/ ˃9?~ыL$xDPЉD$xU tE u0e[^_]ÃL$t8et ED$PD$TL$hA$Et$LD$t1|$F$ߍN L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$TD$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$`(1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$*=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈T$@$L݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـD$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈ D$@ؠTD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$بT\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$xD$$4$$$D$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$`(݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$`(݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`6D$h$$$ $$D$x$$G)‹$`(݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$ (fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(-&E܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<-&E 9Ex0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVSuEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS0ޔ}u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSٓEM]E TsCD9sf9r)؃L9s&)D$D$ $]][^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVSR0)ˉf.&.&.&, u썊a)ˉ.&.&, u썊A)ˉ.&.&, u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVSՐUBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS qf7} w.L U4tfMt@ @.$0E $^ƅEFEFuFF [^_]øMEP$UуL ‰)U= w$| @.$It @.$0xUWVSSHut"F w"7u&L 4[^_]É4$[^_] @.$UN?L 4tU$[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8 } EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $MnMUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVS7,u ,  @.Eut?t|$E$EE$`EtsEu7Eu?|$<$r‰EtUE$7Uu @.$u먋E[^_]D$H7D$E$ E1[^_]7EuO$rDžt@q@, E @.$} @.$g, u딋En @.$=1Xǃ, Eu1>UWVS$D9u EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVS{ñutD$E $zDžD$D$4$(ptt ʃ9t*xD$4$ t|E%=`t`fx ttpu ffx fp@ P$ P,r P(Y P Ĕ[^_]K51Ĕ[^_]ÍD$ 8D$D$E1$/514O1US=z2E UD$T$ D$E$[]UWVSzutFD$4$O nx$P8D$4$X [^_]É4$Tڍ1D$ 8D$D$=1$.UVSvykut&nxP[^]É4$[^]Í1D$ 8D$D$I1$@.ffffUWVSy~u1$'- ffffffUWVSw}uf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $F0F0$F0ǀǀD$4$FFF [^_]ÿF yF$i4$Lǐ81D$ 8D$D$82$+81 fffff̀rS[d|4 [UVSRvG|ut8F0u ǀ4$uAnP[^]Í1D$ 8D$D$;82$ +뜸fffffUVSu÷{ut#1V ҃ t[^]É4$[^]Í1D$ 8D$D$;X2$*UWVSXuM{u!7FF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $QF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$ e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$QW8t6D$D$ V\$D$4$ ?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$AuwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS fl[rEU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVSkqƋ4D$D$4$-EtE$8Gu͋$tMtf~ 18t$9⋎t $?4$uu&E[^_]%U9%8}%]EUWVSjǽp]tCƉ$Q[^_]þUWVSj}pljUD$@$:ƋUu 1[^_]ËOD$M$x…1]~˃Mt|tatOt=t+tt9EGX<^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ $ ;F@tNO$跺4$2%81[^_]ËX@.NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$p5X|Plx ,H XPp[^_]Ë8f8F8FF F FFFF4X@. ~D1 󫍾$F~ 818t181D$4${dž0M8?8UWVS$V}\uF(x~(V0!UN9F9MUD$N $~MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$EEtlE܋UT$ML$E$袭ME)UЉL$D$$AM $EUVU(_US]ED$U $ #C,9C(}#C0[]fUVS TZEpFtD$D$$F u  [^]IUWVST~ZEPwhHtwSuNP L~8xpXpTPtYtQ1[^_]1DžLDžPXDzDžTHDD$$$ƅtǀHXdž$$ljFHDt dž w4Gc^G G -G pLGBG3GE UtAtCf\ Ft$Ot$賳4$4 XxD$ ED$E D$E$XE EUuM, Pdždž QXTtt!ЋTDTT9QX1XA1L=f+fdžXD$ L$D$$T PD$D$$fxuu fxD$D$$E t @E@t E DžLxpX]DzpTPO AfXmxD$$s XD$`D$$` =b1уX`abcddefghhijkllmnoppqrsttuvw `b1d}h=f]t_LX Љ lp&D$$ 88D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$O,t$ I1T$/T$$X +XFTT$ 8T$D$*2${TfUWVS$.L#REpFtD$D$$FUED$E D$4$kDžEtuD$D$ED$D$ D$|$4$踜‹!@u FЃ$[^_]ÉUD$D$$LUЃ$[^_]D$D$$'Ѓ$[^_]fffffffffffffffUWVSJPuE U VfFFVVfFFVV f F F V V fFFfFFfFF=6F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\Nt&.&"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]Í+D$ 8D$D$b2$F lUWVSHÝNuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\Nf.&ɉHɉH@tH ɉH H ɉH "B9uȋF m+D$ 8D$D$b2$F ƒl'UWVS(fF[LEpFtD$D$$%FE  D$D$$kEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$f$u ([^_]1([^_]UWVS7E,K}wFtD$D$$FD$<$tr$tcFt$~t$lt$ZE4$I<$AE$譥[^_]øUS mDbJE9ErD$E D$E$* []fqUEtu]11ɍT9r]1]fffUVSDIUE X91rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS4!CIEE@Et } 9x 1}EEEEE*EP}GA у@3=0fuftpfuE@E܃!‹EH}<}0}}Gu kUzu@G GGBPWxG8GBW}O ME9kOft DAfEtD$D$ E܉D$L$4$蔨V1ۉ]E@Ex#} EHU ꋀEEƒUƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$ѹE0E@ D$$谹MAt MM} y AUtiUJAUQ}Q D$ML$D$ M L$D$<$耣E4[^_]Ë}GMWW:D$UT$D$ M L$D$E$!E ]}؉0fuft tpfuu^/Ex }OE@AD$ 09D$D$2$D$щT$ |$D$E$lE@E܉dU܍AD$ (9D$D$2$U/B $fUSEP M TH}[]UWVS>CuE9G Ut OuhM Gt"V T$D$$vG$4GB<$"9}thG tkMtOtD$L$ D$GD$4$wn"?9}tG tUE?9}u1[^_]1G!,USUE @@ @HKYXBP[]fffUWVS <ÆB}ED$E @D$E$諜t7ƅt|$$t [^_]84$V8UWVSD< BuE 9‹E1k*lt$D$ ND$D$<$ =5DžDžDžDžD$D$$|<$*ƃtI<$)D$D$4$tntD$4$tSD$D$$E+uqD[^_]Íӆ$ L8D$D$$諙4$裛8?gUWVS,T:I@]ƉUM܋ED$T$4$YNjE  &ЉUUD$L$$]̷EGfEf}UBM (9tD$T$$]肷UBD$D$$]cXMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉ME+\$ d9\$D$b2$E؋M7UE:98uDE܉ufp뛋PUD$D$$];UuT,[^_]ÉUD$D$$] UE܉ufp5UE:98to!D$T$$ZtfGUE]+L$ d9L$D$b2 $UED$T$$]bsUWVS 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MU+D$ p9D$D$b2$ZMU.fEEfF fE~EUč+D$ p9D$D$b2$U'UM+D$ p9D$D$b2$UMSfffffffffffffffUWVS8M&F,EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋+L$ |9L$D$b2 $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸+|92E܉U|$ L$D$bE܉$]UE@(EuU]䍻+|$ |9L$MD$b2E܉$rE9EM؋UB=VVU]䍻+|$ |9L$D$b2$UUfEED$E D$E$rUEH(EH(]䍻+|$ |9L$D$b2$U;U1҉T$t$E$]8UUWVS :/%}u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0À$ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃+D$ |9D$D$b2$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃+D$ |9D$D$b2$UMUWVS@Ã!}EpFtD$D$$JF Tt:t@[^_]F(tڨ1EE+E؍|9EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b2 $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃+D$ |9D$D$b2$7MTD$|$$ו럍+D$ |9D$D$b2$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfE+}Ѝ|9}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$b2$MMԋU<+D$ |9D$D$b2$D$ED$$D$T$$術D$FD$$Dž]2FM䍓+T$ |9T$D$b2$tVMM+D$ |9D$D$b2$>BHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍+D$ |9D$D$b2$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[T4 [UVSB7ut5D$D$ D$ED$4$Ot6E[^]ÍD$ 9D$D$53$럸fffffffUWVSãUE pu 9lE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdr9d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?hD$ 9D$D$X83$hMX\pD$E  D$\$n8 X9hƋ`9d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS, Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS r gl4$(sD$$D$F $3 [^]UWVS . #}$ L$K#1$KD$$D$<$h3t$<$2 [^_]US ìl$mr[]US, ÆEEVEEED$D$ED$ ED$D$E$xt}u E,[]ø,[]US l$q[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9t9t,EȋU+u0<[^_]D$$D$$.#ԃ $Zb(UWVS`zoEE 9E1} w6}̉M UERE9t~9ue $aXM̉MG} EME9tX9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $Ia'UWVSDj_ 9EE1uUč}̉qMȉM}ǹU7UȋE9r}9t"9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $`U&UWVS8â 9>}}̉11҉EE9t9t)E+u18[^_]D$$D$$ ׃ $ `fx&UWVS<* U 9E1E x;Uȍ}̉/M UȉEFE9tK9t[E+ua<[^_]ÉUȍD$ T:D$D$<|3$̭UD$$D$$ 륃 $E_%ffUWVSiV }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]PMUBfFF F D$t$$]u1[^_]ÃQʋ]C ^)fFfF] H@ L$J UL$ $]lOUBeD$B D$$]rtH D$D$$t&KUWVS$ }E΋x!fzfz:EF~ =(M9AfZfZۍ E@ EE@utN=$1EAfBB B D$T$E$]s$[^_]É=ft1MM\A4f9rM됉=w+f81&\F<f9rZUM]+D$ :D$D$b2$蚪MU룉UE]+L$ :L$D$b2 $_UZEUEME+\$ :\$D$b2$UEMUM]+D$ :D$D$b2$שMUU]D$ :D$D$3$蜩UUWVSLoT u܉E։MM  fMEE=EffEFEfE=f}EfE111EEf}u։ʋME@ EǃtVE}TG:z Z]f;u]9fEA)fAfDY|$T$UȉM؉$]MKUԋM؃f}Ef;ErE EȃEȃ]f9]f9u}EE\E9E]9f9u9tMԉU؋]܍D$ ;D$D$3$MԋU6E}TG:,E}TG:EE]TCE}}uL1ȋMfAE@(t 9Hf;UE f)8EEf;}ǍFEfEu}l&gEHEA ÃW)fW]fT_D$L$$]IIfEEf;uf;uu fEfEE@ EhEHEo}uLMU]܍D$ ;D$D$3$蚥UMMIUѻEHE E4w(ufFMf9MuufFEL[^_]Ë]܍D$ ;D$D$3$fEf;}'1뗉@f;ErfAf9stEMA]܍D$ ;D$D$|3$菤9]܍+D$ :D$D$b2$]8M ]K)fCa118a\t&Sv.&CUWVS ƉUMED$4$!YǍED$4$YÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS( ƉUMED$4$UXEljEfGE}fyUzyAB A u.E B=f9mEU܋ED$$fEUMEABAfAEfAB A BtHUD$D$$hUU}HD$D$$jUED$E D$E$MU܉RE䋆U܉׋usOuCu1u9ut2U܋E$5jEU܉E]E([^_]äu9uuΉUftt֋E$iEE([^_]ËuBfF] fu]EvUM썃+D$ :D$D$b2$UM%f] z>1D$ED$$`iFUWVSpaZ EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN y EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]Ѝ+L$ :L$D$b2 $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]Ѝ+D$ :D$D$b2$ϗM"M]Ѝ+D$ :D$D$b2$藗MTME̋]Ѝ+T$ :T$D$b2$\MEMUEEЍ+\$ :\$D$b2$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]Ѝ+D$ :D$D$b2$nEMċU6MU]Ѝ+D$ :D$D$b2$'MUrM]Ѝ+D$ :D$D$b2$MUԋ]ЍD$ ;D$D$q3$贕UűEԉE}EEqqqUWVS4LA }G,EЉ+E؍;ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$b2$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oM+D$ ;D$D$b2$M:  GEu\uBMEt H(x)Z]fmfm sMM Z]IUWVS* E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀvc |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVSZO } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVSî } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVS MDžDž<<>z DM E5?x  D$D$D$D$ D$t$b$(uVD$D$D$ 0D$T$4$7At0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$l@L0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$$'3DžDžEDžDžDDžDžCDžDžBDžDž>Д DžDž DžD$D$D$ 0D$D$$>t0Д DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$u$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$$$2D$D$D$D$ D$t$$#4D$D$D$D$ D$t$Ӣ$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$$"3oiD$D$D$D$ D$t$.$!D$D$D$D$ D$t$$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$r8RPLDžDžDž D$D$D$ 0D$D$$8D$D$ 04$T$ 1t&=S,vD$c$ `DžDžyD$D$D$D$ D$t$?$D$D$D$D$ D$t$O$7SfffffffffffffUSVK \ []UWVSP:/ EEEE}|$EԉD$$Ẻ$1u} }Ƌ u%1 uBfEʍ M MM9MMfJM^MHHu u p Puup0@1Ẻ$D$|$$P[^_]j D$D$D$D$ D$D$$ ‰ f@ fN9fE@EU tdM HUPMH Uup 녋uMHx0<@\ uM M  M310t ED$D$EЉD$ D$D$x@$2u}u tE E E~ vMiM DUWVS ?4 <$t V6u.j$Et+-t V6u<$E [^_]-t V6uD$<$<E [^_]US$蕯Ê t$[]EEED$D$ED$ D$D$E$w1t uD$ @D$D$A3$$d mfffffffffUWVSѮƴ E }0@DFƅtGFU M U9BFD$F D$ $GEUtRFE VJE}9OT$T T$$EFMAE1[^_]ËM!@]GF MtFuV]SF }WT$|$ MQT$D$E$ u>E]놋ED$ED$ GD$F D$E$LE!@F aD$ $'t̋EUBL$$w't}VWVUVS uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS xq E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$]%Et͋]E0U=UWVS(耪u E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVS^S }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[Ô 4 [̀rS[t 4 [US cX EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[ 4 [f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVS  tMƋuA~8t:F4@9s3`V8F4@9r$z$F8[^_]ÉUWVS訦 E}}u 9ENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]{F86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$]'NjUN8#UV4V0]RD$ D$`T$ $F4~81.& @rPu B8~8BX;F4rE,yF8$]"F8UȉȍB=]I_8 4U]0_UF8$("_UF8$]F8tgD$`||$t|$ D$xD$E$b&DžuUN8]^N]^{]UWVS@̣ EE M 9NjE1lI%;E" = ,9#ƅDƅdHD$$"8BƅC8 D$BD$d<$Ylv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $jt[U+ @[^_]Á},d`@ Džh1Dždd ׉<$D$`D$D$ t$D$$"f 9?RD$ D$`|$4$`d9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$[Ju"dhD$T$<$gFPp @?.T$Ge``697nV4P4~0x0~8x8NFwPRTP׉) tGPǰ9 fG`9u Yt&D$dD$ $gctIt70tfttG1VD$D$$&p8tD$D$ $Zbt"T7d$TCt18S4$D$BD$d<$bFttD$D$ $bat ,S"A!D$DD$ $ at$-B놋rD$D$ $`S$`) Nj@8@P1q`D$AHDž$`Af$ AjtStD$D$ $_zn4$@\tNj$@D$BD$d<$`tUWVSB7 <$E D$ ED$ED$E$MU E(Ɖ<$[^_]US ڛ EU BJ  D$T$$ []UVS 葕Æ utxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E E3D$ @D$D$l 4$>D$ @D$D$m 4$>UZS UT$ fD$ ED$E D$E$9]ffffffUVS  EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS(Ʀ ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$]ӋE111 ufEUD$ T$ED$FD$$]&;u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVS贇¥ Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$Åt@C؃[^_]ÉډSu1V룋KT UWVS׌ u xD$4$HE%=D$($Džtz@@&@9uE ED$D$ EЋUԉ$T$EČ[^_]@1Č[^_]UEU U U$]UVS΋ ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D @:.D$ D$%D$04$U D$E D$E$]UWVS E HMPpt)rP@t6B E$`1[^_]ËxMt P@uʋMAUWVS4zo }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$%U11MM1 MMEԋU؉D$ T$E܉D$AMD$$9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVS ut PtH J H $nu4$`1[^]UWVS见ǔ uu2&.&[tCtډu[^_]Ë$[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS 袀Ƈ U EtUM"t&.&.&.&t.ZYutD$D$ $ E [^]UWVS  } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS(-& E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]/E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍ1D$ @D$D$GX4$.u ]܍D$ @D$D$HX4$.bf%BBff+E XffE]F3G]33 4UWVSxxm~ utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]1D$ @D$D$Z|4$,[UWVSwí} utWD$4$ F u#f~t(1D$4$ [^_]É4$2 5.4$$Flj4$[^_]ffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVS!v| u7tfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉FUZ1맋V0 t~@9t $V0F FV덍1D$ @D$D$<4$T*=fffffffUWVStz u}E FftRxT$$<xF0PV09t'Pt($ [^_]ÃT1݉UUPV0ǂT1UVSnt u7u[^]ËF0$F0Tt$[^]ǀP8$F0Unt MU 7u]É]sUVS`nUt u7u[^]ËF0$F0U t XtTt/$[^]D$\$F0ǀP8$F0UVS8mõs 9EEȉD$E$>U+u 8[^]f̀rS[ds 4 [UVSRmGs u tt$D$t,@E$[^]Í#D$ AD$D$94$$"UWVS4lr D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"'D$ 'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]9&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍D$ AD$D$KH$ L$(=D$ AD$D$MH$E"UWVSjǎp EU uM] $\$M] ǀA.}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSio u} 9vtGFfuUT$|$$xFP^T[^_]ff [^_]ÍD$ AD$D$C5$s덍ǣD$ AD$D$A5$G9vV֣D$ AD$D$B5$'UWVShn u} 9vF t5Fft\D$ D$D$$!Ѓt<F fF FfuUT$|$$[^_]ø"8F 뱍D$ AD$D$V5$%DǣD$ AD$D$T5$9v ֣D$ AD$D$U5$?UVSgum u9vufFftEȋED$ E UD$T$ $QF !ӃtNPVTfF ȃ[^]ù뷀fF ȃ[^]Í֣D$ AD$D$j5$kǣD$ AD$D$i5$7UVSfÎl utO9vuFfu$[^]Í֣D$ AD$D$|5$f붍ǣD$ AD$D${5$:f6̀rS[k 4 [USek ED$E UD$T$ D$E$[]UWVS@eƓk t$(D$T$L$,D$,t "|$GD$8UT$$\$( uL$8ǀ-[+nD$,L$8D$0T$4D$T$ $D$\$(ɻD$D$0T$4D$T$ $D$\D$ T$L$8D$$11҉D$8T$<0D$,9tmD$ \$$9D$8|$e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(OD$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 }1th|$ D$t$E D$L$T$ 7D$D$4$D$t$$ҩ'ljUED$ D$E D$E$4UWVS8JýP Eu} 9E1X>'T$ t$D$E D$D$|$ 7D$D$$Xu(u~E+8[^_]:|$D$ ED$D$4$ND$t$$uXtJH󥋅D$ |8D$D$$BX:'ǃX$…X1A<+wKuىDX9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVS<HN uE EEEEEEN>wN# t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USFL ;UT$$L[]FL -f̀ffff7̀rS[ÄL 4 [>̀rS[dL 4 [USSFHL D$04 D$ ED$E D$E$[]USFL ED$ ED$E D$E$[]ff&.&$D$4̀D$̀fffffffT̀rS[ÄK 4 [PS[mK [USUEJK 7u 9[]&[]f̀rS[K 4 [USEJ $1[]UVSDJ t [^]É4$buF1f1ø11DJ \1øUWVSƅUu't<uF=f t/tv=uF ދF ӋF ȋ t@ 9s0.&8u +P 9rt Iƃ Uȍ8D$ |LD$D$7$FU.ūD$ |LD$D$7$<=ƋUfffffffffffffUWVSGB@H D$0}|$hu }]\$8 9D$Ë$1M}D$hD$DD$,D$0\8\$ ND$<%t,P D$,t$h\$D9s FD$h<%uԍWGD$CD$XD$<D$\HZwt$0LT$(D$$ D$l1D$X|$lD$Pt$P\$<9}L$,L$\  \$P\$HT$Ht6\$DT$h.&.&9s  sT$hD$\|$(1ۍHЍABHЃ v\$< T$(D$$D$\0|$8GT$`D$d|$8\$Xd$\t$`|$d D$X\$\\$4|$CD$HD$P$3D$Pt$P\$<9}L$,L$4t$hL$D9sL$Ct$h|$4L$X\$DL$h9s0sL$hr\$`T$d\$d|$Xxd$\D$C- t$`|$d9$D$4\$`t$d)щ1҉ىD$PT$T)iiƸ1҉D$HT$LD$HD$P0T$`D$dL$`\$dc19dÍxD$`0CD$4)D$HD$Pt$X9}t$Pt$H)t$XD$XPF\$\\$4|$C@D$\hD$Pt$P\$<9}L$,t$4L$D9L$hAt$hN0\$D9 L$$N^\$h|$4L$<\$P)ٍYt$DL$ht&9s0sL$h\$tD$$D$ D$D$D$ED$ED$ D$D$<$x ƅ u G$@ED$D$ t$L$<$jƅ,Gƒ @1u`$yED$D$ D$t$<$ƋG~U=2D$D$D$D$D$ T$t$<$ƅGD$<$E+NH[^_]ÅD$<$|ȋPu@fffuGtwp fHfHff$衵t$ɉL$ T$D$8$qPtIthtRD$<$$+x$xD$<$yD$<$gD$<$U4UWVS, }U ME 9E1GED$ED$ L$T$ 9$pL$T$ ˒D$D$$Co=E D$D$ED$ ED$T$<$qU+,[^_]Åx$腰=wttH|.uT$L$ D$D$$nUѭD$T$ 9$oqD$<$9$3UWVS( E E 9‹EE@ pc׭$M T$$s-EB.D$ D$D$4$KS ,t&.&.&.&DA@tD$4$j.t&DJ@utSFNu tDJ@tEpt$|$<$调7$N$<1U+u ([^_]L1UWVSP u} E 9ËE1fD$4$^1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#^8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$HED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$AFDFD`DžDžD$4$虹,fffffUWVSlö u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$TxƉt$E$踸EEFD$ $蠸U(fBMЉU(E,) X}|$}|$ D$t$E$д,Ɖt$$ 0FD$E$FD$$FD$$ U(fB )Ѕ9ET$ LNT$D$l9$El[^_]ËE$訥EE$ߦML$D$ ED$`;.D$H9$fU(E H E, 9(B B U(D$E$$U(BD$E$U(BD$$ U(BD$E $E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS XM U }E@4E)Ѓ FD$$)FD$E=s$VfFE@ uG1T$$ǵF D$$贵 G fffG )~ [^_]èu2밸9u1 [^_]Í$jU *U $jU븸UWVS>3 M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$GD$u4$说W׋u$ssuXuQ}׉+u9~ED$4$V+E~[^_]äft9}u1[^_]urpU($HiUM 9}t9D$ 8ND$D$=l9$SgMAyEtflffffffffffffUWVS(qf ljUM܋EGkE8u䍃6F$~d ʈdGtD$C$`띍F$蹃~GtD$Y$}`iD$ D$4$tD$ D$4$ܡuEO!F $=~GGD$r$_D$D$4$ytjD$D$4$[uXO@E܉D$ED$9$_O]L$T$9$t_zO TD$D$4$t*D$ D$4$Ǡug OD$ҕD$4$葠u O@D$5D$4$gu OD$D$4$=uZUr D$4$Yƒ?v?T$U؉t$E$tEUƄ4D$D$4$şuZE r D$4$ƒ?v?T$U؉t$E($sEUƄ(D$ D$4$M D$ʮD$4$(u OmD$>*D$4$Kg?UVSTÑ $@it."|xEEE%EEEE\ND$D$D$ D$ED$t$}tT[^]UVS Et4D$E$nEEFEFh!fF [^]Í UWVSxË 9EEtbUD$E$Ef3EfF}<$XD$t$<$}X|$4$ZFUM+ ux[^_]Í IUWVS }x$SLJft/1t$RDŽ9Ӄ[^_]UWVSu u4$`t&tuOxu:<$ndžt$ndžf[^_]É$0R뼋|E9Eut$ RU Et]Í]U­ Et(]ÍѮ]UWVSu] }4$sfdž1҅~!1u.&{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVS uD 9 E1D$4$PF u uD@@$dD4$U4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$hF WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$ٮ$ w`D$D$4$jmƇ_WHwDG` \Dž01< t/t 201Ƀt&9c< [< uuDž( D$p$[8 Dž4DžHT,8D$ D$D$H$8;s<;t<#tH8domaH8searH8name%H8sortH8optigxionsZ< t< GbD+<< ~< uvfxinJ< t< I(  t t Dw`D$D$4$"kƇ_D$4$VtDž0]t DF 4DdLʃ Јd8$D$D$ $Kx8$&s,D$x$x}t<hlp ė ȗ DDx`0DpHH`HD@H@`tg.&<.ǃu~DD$. $hDFHGD$.$hDqPALD@$?t‹DHDH U+h[^_]Áxservfxer< t< 9 < t< tD$4$谰< X1DžX DrDž\DžTD$5D$ D$ D$<$PD$ ,D$|$4$v"MPB=9Dt/RωփtftPBj@D<ЉT$L@$dLt׋$ˆL,D$ $OL <4,LTDD|$@$%d<mFV9xDw@ut;u㈕$<,t$$N<$TDLD 44 K}D$ D$4$!D$.4$2cD$D`$2Dǀtǀx|Dž0Dž(9$4TDxD@Dt D$4$}Mu덃$S< tt< uDž0]L$,D$ $=MLtċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž0)@DDumuT>uvuYLpD$D$1ɉyffL LsUD$E$]UWVSXö }u h3 l3ė t;D$<$t ė Fȗ FX[^_]Ëȗ 9puttl|E9EtztI\ND$D$ED$ D$D$t$kBt ė Fȗ F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]ffffff̀rS[ 4 [UWVSd . D$t$^M@$TDžDžDžDžDžx@ N L$T$ VT$D$$]T$$=F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$=ut G74$͇@9 W ‹Atft‰)@0Dž'Ztftlj)@#tP4$@9r5‹zV$d@ $0Z#Džd[^_]‹)ʋ;Wf)f f{\D$ |ND$D$$:$蝐$tc0P@~~ 9V)ȋ 9cVʉ)ȉA1҉=tftH<@ lj)99h΃r낋$ib@ $WŔ@ 4$@9:ƒ{tft‰)‰DžJtftR<lj)944$@9`‹wShf`f% PD$VuKu2ifM/f릋$_@ XUVSû 8t$J*[^]Í D$t$5E[^]UVSwl 8t$n_[^]UD= Ut]UVS+ ut$)[^]Í D$t$D[^]UVS ut$^[^]UWVSâ u}t5W¸t[^_]ËF [^_]ÍD$ ND$D$|$:$eUWVS.# }uENH NH D$t$Cƅu!yH L$UT$@$mtEG D$GD$ GD$D$4$Su4$]G [^_]É4$][^_]ËG [^_]ÍD$ lND$D$$:$UUWVS  EC98 lC.:)lj}싓 u2E D$ $边  [^_]Í t$E$3t$ $3t{ t1= ;txED$D$E3uًED$*D$ED$ D$:D$$Y [^_]Íl:D$ED$ D$:D$$Y [^_]ÍD$ ND$D$H:$ĈED$;SUWVS xm ''w} )ƉT$U$Mtn  UT$ $dMtG  D 1 [^_]ÿ'y qUWVS(ǘ LJ̗ LJܗ LJؗ z 11ҍTEV 5 )Ћ ԗ ڍAw ND>ЉD>]T>ӉT>VMHL>@CD>ԗ Cؗ dLU։‹ؗ xztؗ =w ; OEtؗ =w ; Oܗ tH~kؗ LJؗ ؗ yU) !ȉؗ UeUTv$̗ ܗ ULJܗ  M싗 1ɍ O]MEUtwM<9ErMtu艷 Ѓ([^_]LJԗ 5 LJԗ D>ED>ЉD>]]Ӊ\>VTU;D> rU=UsD>HL>PD>HL>ԗ H V=Ë ; eQH P H З HLJؗ ܗ Vܗ MULJ D>UMD>ЉD>]T>VT]ف9 OQLJܗ 롋З LJ LJ D>ЉD>]T>VoMUlC.E9E $µUMHD$1ۀ} ËE)؉D$ D$:D$$SUMLJԗ D>ELJԗ D>ELJԗ D>ELJԗ D>EqMUD>@E싟 ]X] É %LJ Q l mUUxzؗ Mt ; r tXQ H P H З H VЋ]!LJؗ [$:fffffffffffffffffffffUWVS0 EЋ( u䋸0 }9El[u؍YWu썰XuԍlZu̍HZEE]]EfLDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$WaDžH V€ʀ UTL@pD$ D$D$T$OM P!ЃLPoo0<$oT$7o01[^_]À Voxo0<$o  PxD$T$ GP^E E DžTED$D$ D$D$$_Džt HƁ Snn0En01  G GBG G !G GD GD$D$L$/PLPP LЃHtfD$PD$L$1H  D$ $PP D$rm8LlPu  P-D$T$6PD ƒ@ u6 h ffffUWVS1& }EpFtD$D$$/F [  D$4$uc  t$un  T$U4$DžU9B(E kb1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$7.[^_]fffUWVS9& EpFtD$D$$-FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$-UЃ[^_]ÉiUWVS$ }9EUEEEE;E MmG$~4u݋M…tEL$D$<$G7UUD$ ED$}|$4$9uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$$E(t㉇UWVS(軭ð uE䋆EMM܉;E E苷EHMU$H3ƃUtY9Euȋ})lj}苊U|$$y'U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$a7u@EE9E 1([^_]D$ ED$ED$$%7l([^_]UWVS$1& M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $Mp6}9} MUu1$[^_]Åt#UD$MD$<$64MU눁 $[^_]ÉT$$%Mt$[^_]UWVS( EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]G5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVS  EU EpLB< D ?ZU )ىL$D$$]f}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]jMU ̉EU ]썋L$ $\L$D$< $]EU QEU ]썋L$ $\L$D$< ${]EU U E]썋+L$ \L$D$b< $=]U EUWVS D$T$$tV@D$T$U4$NjUuD$T$$%[^_]D$T$$o%UWVS rg }EpFtD$D$$.%Ft:ta [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSD警â }wFtD$D$$l$F}  8GuD$4$D$ D$D$$%@ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$G;EtD[^_]ËMN$tD$ D$D$$T?Љ!ƒtL$D$$*u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$‹E؃9tD$<$]D[^_]UWVS>3 u~GtD$D$$!GD$4$C uUEu@t*$+u*4${^tME[^_]Ë$tE͋D$$E EUWVSWL uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $U]C1[^_]Ë]C鍆D$D$ ED$T$4$ul}D$$M UtEdžU|$ $tU#DfffffffffffffUWVS ͡Ƨ EE,E}1EED$ED$$]ƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃+D$ 0\D$D$b<$UU]ZE}E9}twu})D$D$$]9utAFD$FD$$]OtVTP‹}u뙋u]RZ}8 [^_]ËEpE )}fG w [^_]fUWVS$聟f uƉЉfMy} ~ϋX9U)ω\$D$M$]BEffEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]39E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]aD$ \D$D$<$ <Mt !EEfEE:M]`D$ |\D$D$T<$;MdUWVS$pe Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$QEu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$6B…t EME$EPEwD$ |$UDBD$4$A tʋ@f8 $dž ?UWVS,˄ uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$:UU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍D$ \D$D$yx=$7M UaM D$ \D$D$x=$7M VuM DOƃ=Fu u䍳\uDG)fET$UUT$7$%U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$x=$5UED$ E܉D$D$x=$5D$ \D$D$x=$5D$ \D$D$ex=$h5E@ED$ \D$D$kx=$05pD$ \D$D$bx=$4FE!UWVS EE @u E1OftsDPND$ t$D$E$]D<ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃D$ \D$D$x=$(3E@ M]f\Q=맃1fM1UWVS}ò U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$9…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$lUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS|| Eu} 'D$ D$DJD$4$]#9tDPfzuft,ˍ< fED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$U#EZUUT$L$$H#T$ $GE$ ]]fff]D$ D$D$$4$ USnt }xsn]f$ZUPKFAfff]2].t&%].&fffUVShn]t EEEEjuVjZ uǃ d9tj'jj%jVjj'j>'UWVSEE] }3t>u艈j/VlZYtp0&t0MPVZYMu}] EEAe[^_]Vh"hU"h:.#UWVS]u 6_h"VSX tfu7$D.ۋ=p3.)u謈$D.u%h"e?Zt$D.$D.""hjP D. @u5$D.hDŽ"j(hٖ*Xu4'hЄ"j(MUW6ZYMtUBk 3&u6h"j((VKSW3&P)UWVS] 3h#jh#Su@@t h"p3.DP褓DE.ZuDE.$1HE.TE.5&5TE.5&jjPHE. y 5DE. E.臖 E.赕=0-v@E.u h"jE'E.u#E.E."E.5&E.5&hD.HthRPmE. yQE.PhD.HthP5E.ңE. E. y5E.hp$j&D.蠕D.ΔhD.u/D.u8E.H;ã E.ujD.D5`D.8E.91>Ph"h:.jE.E.=E.t t7h"Bt E.t+h",t=E.thG"E.p3.jWE.ZYu hn"|;R=E.u6=E.u-=E.t$=E.jWg[^11ɉ=E.u >=E.t =C.i ȉ=E. uh".XZQURPW x%uSh" ,URPWɅ yShp$j-Phē"jjUWVShu E1E1ۃ}~F8-tEhԔ"T(_th"PZYu 8K.h"*(_th"PZYu h"Xjh"h"Ds!EPMuh"\0考E_t<1ɉMMMMMMBh "d%! 7Mt&t"Qu+ZYth+"jEhQ"WE)PE @}w}c}6t^%}4E뷋Edwy$<&}8tEKv_7Eh'"574EXZnEbEVp3.p3.}uCp3.Eu4>tj@uY[t}u U9sUPUxtă}uEE1ۋtPZ\tS#XzEt'U)RPSpSÃ~t C}u"h'"h(%EEZYu ha"K}uEEuh4K.WuuEpEP-u yj=4K.y h|"}tLjuVjhSPy h"%XjVjh54K.Py h"%Xh'"EjuVjpSPjVjw54K.P,uI1ɉM̉MЉMԉM_1<&H>v   DGu΍EPEPjW =8K.t}t.D1}tEܿjEP4<& Gu褡Ey hkA#j Vh~f54K.Vh~fSUSME-}u j u XZjkUE 0NjRAUVSEU [`J @`.uc1E1ۋ4?&Vh#޺uUyl:.H:.Y^yh:.j XZ:.P:. Cu 4l1e[^]ÍL$qUWVSQpq1t.x.....p...l.DžDžDž1h<"Vg @I&/0$ ?&S'$?&1=---r-cl.jP57ԕ :uy57h"/-p. \....|..14D@&4@@&h"蚸C uD.v.kx.=7j/WsY[ÅtC?t two@tj/S2_ZDžtG;tt6o@tqtj/WZYtA?t(tn@t.t9h"Ot.Ph`.hd.hh.hռ"57qAu7<t h"jC =h.h.Ph.Ph.h"57 A~!7<u..9sh"뉅.=7j/WY[t4PWs_Zu!%=@u7-Y7 }d..6--7.57.-[=~ PPh$"j  p3.)ˋ.=.t . . . x.tJm=p.t t$h\"4t=.t=x.uh"=x.t=-uh"6lKu -n=\.DžtDžxjjVjjtS@t,YtjjVPjS@t=-=\.u4P5-r_Zu%=u \.p. . .1 .t1=.-=\.uRjhh`.PR -y'D8uh`.hҽ">h`.h"--`.-jPR謪- u5-hf#M[^ =\.tRPZY@u5-h"E̋UЉ1ۅuthRP5-h "]M̋]Љȉډ%1 .1g...... .nh.hrdAPn @uX5-h?"fh.hedA5-C@u-5-hQ";^_5-P-[ .1ۉ .ą.=.=Ѕ..ȅ..- .̅.?w=...!ȉډf ...tJthVP轨- @u=5.hp$`5-w- --j-~Skd.Yu Sh`"j.11Rjt y.1m|.ą..R|t.t#h..d..`..DžDžjjVjjSd蕼d.Zu hN"j jjVPjSgy5d.1d.X-j/S:E^_ޅtptj<7=3Cr#(<@/%=u50@/S[@u5,@/h\#@Q50@/[TY@u 5,@/h{#@/tP:TZ@u5@/h#jjRUWVS}u 1ۃ~^;-tp3.114<Dž8h#VWƌ 1҃i!8-t+:t!;B tBu 7BPr5σitot8DuFDž4뉅u 7zSh0$h˜#@ bDž<SuOdx1jSVDqCtjjj ǃuhI&VhiP蠋 @u h#j艭WRY-7tvFtjNt^HuTRItBQ~OZ.0QXɋ0u h#jR돃넃<tP8tV4t;SjPUWVS$u] 3:h#j}r h#SVƊ Btb$&jj57E/E/E/E/E/E/E/sE/dE/UE/E/vBeR0G.f"$,&H $p&a$F/F/(F/G0F/1$F/,F/a,F/1$F/ F/?$F/1,F/10F/"(F/ F/1F/F/1= F/F/F/F/ F/p3.)Ӄ\(F/=F/t*th#0F/ ,F/ $F/tihӢ#jt:Dž|=0F/u Dž|=,F/t=||)Dž|=$F/tDž| Dž|4ɲ4F/j=F/P2Cx<hSh-t=v Sh#h-蕐Y--X/u!-= -vx/uP-@ߣ-1hj$XZ=$F/t Ph- Ph- ZY@u躠8t%E%=@tkxtHZxM=F/P6 Y_@%=@t&/h-h)#jRDžx0Džx=(F/u1=F/x/lt$PHZPvЀ8/uj|Vyt 1pluv6hp$jޠlQh- ^Zh-ċCHfuFs iPshfE#3lDžpltW~Zu)wfush?#2Y[ftf tx)-C,--=~TSh-h\#2 o{DsC(huTxtClj/V&YZlt)xlhC#>PYZlhl>h)8/t z/t/Bс-vPh-h~#1 VPRlζl- -= -vx/uP-@ߋl=$F/xt Ph-i Ph- ^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-h#1CP@% =@B%=@t,M1@ush-hţ#1Jl΁@w `||t {DPS^UZY+= F/(h-sh1"KK sH (F/ F/u&fNush#/Y^jSt蘀fuV58F/V8F/@F/Mh#h&h6kE%=@V踛Bfuk=F/u%8F/H8F/@F/y/hA#h&h?jRXMZY+h,#CPph-BE^XshL#/Y[=(F/t'PRU=(F/tPRTPS6N{8t h#j txp?1x=(F/t,F/ 0F/(P6_#x:DžxxUWVS|]u >j/WYZtxhR&&W衋_Zu^h#VSy @uip3.)Ãu]p0pBZY@u jjMje;LtEPtIFu'|V0h#VSIy w~RTfw$&1pV0pV0V01tV0dV0xV0tV01V0lV0thV0edV0Vp3.4)Ã=lV0t`V0-=|V0t,`V0=1=|V0=tV0uV01ɉ dV0tt%V1ɋmSP|=xV0xt)SWfYZuE%=u }SWXZt Whp$j裙E%=@9tR ÃSZ=cUWVSu 6/'h#j_j踩ЉÁt1hhc%VuGw tVmtDžhptc57M*Xu57hT#jؘhW(tWZ 딡p3.E%=@t x"st/$tSR@^Z@uStSZYy7hp$芮[^DžlOt?t7?ZY@)l;UWVSu] 3$h#j\ h^#SV,u tUit)ft5huT8W0σvuC0W018/tj/WZYtPRd覃Y dv1Whc#'XZDžplt5>WjZD@PRhu1t p p9UWVS@] 3"01:.Su]Sjq0uEUEUSj^_SjL0ZYuEUEUSj¥^_Sj(0ZYuEUEUSj螥_XSj0Y^uEUEUSjzXZh #ΪH1411=81=<1=@141P]1E؍}ȹEĢ uVSjxVSj豑 x"}ujVj蘑 y}tVSj} xjVjj y}tVSjO xjVj< y{}tVSj$ xjVj yP}tEVSj y1jVjߐ yVSj͐ xy y贑h#0j ^=-tUjh%(7-[^y yh5#0jX1 #=-u=x-t 豕@h#Yt8u`"V~ZÅt @|/tCPK,1_uh[#j_X1ZYtlj؍P(1/hHW0Hh) j- t! ttBGuBĞ@豗9=PW0t h#j輑=-u-L֕t X1X1e[^_]UWVS]u 6=h#j-W 1he$VSto tLtPt9p3.th#肧_8/u|h#P7 Y^ukh#S& _ZuZPSY^@tHxPh%_Z@t2|9u;xuM9 u;EtjjY^uj SDh:.\XZ:.@t h"jEj'4UWVS}] 3h#jU 1h#SW5n ft]/WPtwR)dD1벃vtbit6rtxu{$1<1181p1<181Z41K,1<(1-p3.9=<1 zu8Quth#!Xt@1؋Ht ʉA?jd01[<1 81u t1=(1t =$1t@jPWfǃ uh>#C =<1t.u)WkXCHHf $&PDs VPshfE#ja=<1tC ƒ?uts VPshfE#@1k=<1^KPSC#HjSWOpC 1ɉK +{uD{ u>=<1tCHSft\wlfucKPSCus辞Z=<1u&shp$蝣@1Y[Rh2"8X=41usZuKC1tl=<1t8U֊8?GȊ8r4,1  1#1 1s2@X菊8t h#jȋWTh[\xVS4¡(1YYu3t>jTPShfE#@1_uEE%=@u"=D1uShN#@1Y[뱃=<1u=uE%=uS02ډuv=@uS=41u S{ZtX't?=<1uShp$輡gU8G8? 98u=,1S>X5@1>.1e[^_]UVS@jj'^X1EĉEȉEEjEPjN- E9u 軼9EE` 1j j.Y[h 1H h 1j d 1$#jOZYh#V-1ۉ]$h 1 ^Z41tt3Hu:P1." 1 111E 1P141t.U=-v= 1i`M=41tEPX101,1tA:-HyPs,X-H J h- ,X9EHm81 1= 1 1tL_4EPXu u:XZu u8Y[}um=-t,Eh#^E=` 1u PEuE=-u}rEj^=-'7=` 1u7hX#I:[u\&jh#PjÃPT$Y|=V-uL=` 1uCEP$#9Zu EP\X8tEP5 $XE11ۀ=n-t$=1uEPX1n-u'j4&^XC̈́RPC@ZY=n-=14-15P1(h?#f+$-)XUWVSpE 0>h#j.L1ۉ]t3. 1p3.] ;E9hs#W6ZYEW2t_9Euphy#Su6d tZftatDeuI렃gu=j57%*EZYz57hp$j豅^p3.E ]SuE\ZYy h#yEPhBt @utc y h#qX}Whht@uQc y h#NXEPht@u.c y h#+Xt$FvE 8uVEPuWSfSy]^1ɉMME 8URu V#cYZURV[YZuURVd^ZuoE 0B.DPt"VSUPS6VSm6E9jh#Vs uVSD]EZYVh#2nE E}tSju褲 y hB#j}t Whgtua y h#Xj'UWVSu 6h#jI81 xo<111ɉhdtlp11ۉ`jh-hV#VuW`Rtf(LtntMH1һ뮃PthtPdtXfuuDžl뇃vudDžds=7hDžpYMDžt@Džh1p3.M)tIu ulpt$t*tt h_#j8 t)ˍ4D1@1>=<1tzj:WDYZt@0j.W]YZ`t!hD1W_Z@`u Bl>t0<#u0%lD1hD1WZY@u ۉ]l8xPWZY@u Whn#j=<1tED1E@1jSVDZǃ tl`1h#>pu jSWed W_X CHHf wg$&s !JPshfE#oDžl=s IPshfE#EttDžl  DžlD1ht)KPt9Qu@1t;Au A<5@1RslЃ t"`tshp$BY[ds\4Z~8t h#jV#UWVSu f8181 81 ʈ8181b81 ʈ818181%d1f8181h#ʕ[tkh#趕Y&t7GtPSYSxTPZ9ujVjdTH h!A#V*LY_uVhp$XZ81e׋H󫋅LsLDXtP-Džu VF[gh $J&h:.DD:.HD:.ZYyh@:.!FX@:.P@:.0t- t( D:.y h@:.E_@:.P@:.΃߃NP诪^ JP}=l91u l91 =p91u p91 Ph81贊Y[J8181P(}=81X=81t 81lh,h41h81h:.萎5h1h81h:.Ԓh81jZxd-h!A#v([_uvhp$jLMq1JPhmdP| h#jv^~WwYu Wh#{81eȺ81t jSR9 h81iZIP|WUWVSjj]Sjjh&d<@u hI $juuT/YtjjSPjh&1<@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ ;MQhp$8#U1G맅u) :.yh:.j (XZ:.P:. 1e[^_]UWVS ƅ]-ƅ_1ۉ:1:1:115:1:1:11=:1:1:11h $u uS ycPtJTtgxPl$& p;1뫃 p;1q p;1 e p;1Y p;1M57&Ex;1Ye57>Vj:V7[Zuh $SH:1t)XV3dZYXu C[Ӊ:1=:1t h?"js7tuhd"1Ҁnuxou-h%P^_t#:1v֋=7u p;1i#7:1HO~ph&Ph $h:.m$j^]t;1Up;1t p;1t x;1p3.M Tu)tP1ۉXhU hGT 5x;1P肚XRrRh#RLbZYTLS蓗jjLRPV9X}XTPT0VhPà uj/SDZYuSh"h%hS8VXXu"VXXu9SX^ty2LhVwà LVhp$juh"LRiaZYhZ $LRNaZYSh $jjhVjSlǃu Vh( $jph:1hzd@PN uWXP;1`PhedAWN @uVh9 $WV^H__9~VhW $(_^ZB1UB1j 7%b*C1PhY$ B157h$V^ZYuB1h}$V^ZYuB1j $c^ B1B1jh$SB1B1j 7z;$m\(-Y=v Ph$jmPh$XZ= C1C1+B1 @1D1C1=7C1 C1B1E t== C1t)=C1u p3.U 4)u%zEh$X1E1̃=B1t1@1jjiZYHth jiYX=B1th jhXZh= jh]Y[1ۃ}=B1uP@PEXZ PEX}u6h"$@YXE tKEPjW6y6h2$萃XZ6Eu:@UY9ËM}QZU܉9}u-MXDD1t؍e[^_]ÍL$qUWVSQ`AT1l0*iL΋HƉ1ۉDd 7tPSgZY@tEUX\f1ɉjjSX\ \Xf8sf1҉jpPSX\p 9u ShF$98ulf8$8p3.`9*ЃPu#@p3.TP`9Pp3.T &@HtPSAWZY@u֋Hxu ShF$ShpL1O?h@-h`L1>h-hhL1> h`L1>hhL1>XZUh-$?XUh -hxL1k>hxL1>h hL1n>hL1>UWVS$1t1󫍽p-tT1k8M1u;JDžM1AuRh- _^@uhma$h`-^[@u ha$jchx-^YP-@uha$ޅtsh-_XZL1L1L1}t x-1 -ƅh-u ujAǃ z=`Ntu&At/CG$&Wha$d_MR1LR1wKR1kL1-ZL1NJR1IR16L1*HR1Pjhjjj j57;DR1 6Pjhjjj j57;@R1 57h%oL1D9u:ƀL1z{k Lmm _$H&-L-B-6-*`- -ƅ--=p3.=L1uu =HR1t_;jm<^+=L1=L1=L1uu =HR1tjL;YL1t HR1t t Dž PPtVSE PE)PaZt褴Džuh&h\$PVZ @u ha$_t*HkttWP?*XZuh&ha$GSGHSp,YXuV _Z@u h&hV$Sy*Yuh&hW$j_V:Zuh&ha$jQ_@ uhb$h&h*WSй%1󫍅Ph+b$SAuh_$S舶_Xuzkh %SsZYuhQ&h&hqPƍH_v󤍅PhiS` @uh6b$uYSG-jV@Z thFb$h&hihZ$VVCƹ󥍅Phui S`@uhhb$Ujm8Zt h'j1^h> hPR18hPR1q8 Uh-hdR17hdR17h3 htR17h3 hlR17htR1 8 hlR18XUh`-hR1}7hR17hd= hR17h; hR17hR17 hR17XUh`-hR1)7h-hR17hR1H7hR1>7h,C hR17 h= hR16hC hR17hR1:7hR17hR1A7UVS8my hp$sYh{%=:Zy hp$sXjhEo$q[^]Vu[jjphp$p u=jhwp$pXYp$uwp$jh$hp$Ph"hS%%j 7jSP  @t-Et Php$s^XjhEo$mpZYtj PYhp$rj ?Y -9W jj h+V g{jjjj j jjjhV M{0jjjjhU 8{jjhU *{EEEE jjjjjjjj j j jjjuV8jVjk1EEEEEEjSjXjSjX$j5j.j'EE EjjEPEPjEP!ƒ$BujY8R1 -te[^]UWVS]} DžhDžT1ɉL11PXDžDZ h;r$WSf8 ubfFt/RODžPg7$ '57DZu57hq$Xu78#t57Yu[ j dR@Pu d:uY[WV`\fAhT!Bt*TP\ @u\hr$!kXZ1e[^_]UWVS ]1XPL1 '1Thu$u S1 Aa$ 'S1뾃P뵋7:tX)}띃P딃Tt ht$j$S57誇T=7XbPVS1KP?DžL+p3.)1S1S1tS1HS1E 4Tt-}P6u_XPt*u{\uO?{\u<څ69X68X6hMu$jRLPO9^Lt 0h+u$VBZYuL1C \äS9XuS8XUWh#RTAZYt:h"TRAZYt#hZ $TRAZYt 6hvu$,h+u$RTdAZYTu1uz\usz\tٍw_G TRhPƒ uPhp$jjjTXP6hPà tThu$6Y_Щ$uxjSXZu3 O8Sh( $jAPrjWXZ5hS1hzd@W. W=XS1=S1NjjjjXPډuzÃ&5ƅ ~h#W?ZYt"h"W?ZYthZ $W?Y_uTv葃_ZuF s%Myu>h+u$W[?ZYu%Fx\u vh6u$WhPƒ NFjjLWv XPty j\P)^_1u?hʀ$jNi T\P覂ZYu \F9|1hSW#[j/W蛐tPRTC=Z1uZ1u h$j06tX uuh@Z1h$u.hr%P,&^_@Z1th"Wh'j5@Z1t(Z11RP5Z15Z1Z1Z1Z15Z119|z<@u t#Z11RP؉ Z1Z119| h$t0 Z1Z19sSQWRPhA$j4tOtF Z1 Z1Z1%Z1RP @u5Z15Z1Wh$j4*0PY[@uWh$nKXZ 17Y1ۉd`1h=$W\; [C4$!'|h3̀"j|P57 M |:u 57h-$zf2뉁 |h3z xh3n |h3bp3.pU|P57ިf2XZ|8u r57hO$j0>&PP$hh$j/j|P579L |:uy 57h$릣f2 |h3 |h3|h3t h$@|h37ph3j|h3@u |h3 |h3A xh35j|P57Kà |8uy57h$hݖ$j. |h3 |h3 |h3@j|P57 d |8ud57h$`j|P57J |:u Pv57h$#w. |h3jj8h37v# |h3 jjHh37$@YX|P57pXf2XZ|8u57h $|h3Dž`|h3f2zut>&f2ta=t hb$Of2v?=t h~$1=f2~#=t h$ٽrfr fpf2٭p߽h٭rhlxf2|f2PT߭P=&٭p۝P٭rP f2hl ݝ(uu hɗ$m|h3Щu h$Xf2tf2Уf2\Hu 9p3.t @9}hhg3Xh3#=\h3%Y^=u |h3 |h3 uXh3Hh3f(h3,h3u8$h3`u ~ |h3 1~ |h35 h3=h3Wh3Zu Wh$jL+|h3@ph3B.t DKt@9t)Ѓ ~h:.Y5ph3h0$j*EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPhj$RbƋ h3$h3H19}LDg2@91B|h3uQh$'Y9~ h3Dg2Ph((# CXZj Xt 9} Dg2F%rf2xh3xt&jSjh5lh3 l@u h$@Xxh3t&jSjh5lh3k@u hƘ$@_xh3t&jSjh5hh3k@u h$@^xh3t&jSjh5hh3~k@u hƘ$l@Y|h3 t-ff2f2\h3f2f2f2t'f2ƀf2')ˆf2ƀf2f2( f2(g2)ȣf2f2jSjj5lh3jy hn$qf2f2@dB|h3f@fJwuJB  &ݝH104hLf2jy^_݅0zt -Lf2݅(=Tf2ܭ0ݝHf29f2}{݅H؞vlLf2(f2+`>&s=`-t#|h3t?Lf2(f2vܕHvo݅Hepf2>& f2vݝh4f2Lf2݅hܕHv݅Hr jݝhlh3EfEjhh3j @݅hu h$] >&ٽrfr fp٭p۝h٭rhPjEP ( "8 Rhϔ"EEPURj5h35h35lh3Xy3"8 h$:h:.Y[ hLf2jLwh3D`_Z~9XU8|h3L uePXh$! X`)dDhh@;f2 hfXf2Hff9u `-f2Lf2f2=f2u=f2uf2󥡐f2\@f2|h31PT s)hPU@ EʉU1ɉMiE'%Uthp Uf2ݕPhf2hf2݅P`f2`f2h-ܝPv ݅Ph-݅Ppf2vpf2؉ffh3!@th3\f2Dž@ffh3f2@1҉\9XDpfucTPV@df2PЋX)t6(uRth3u|h3t@th3h$|XDž\7th3 u|h3 t th3h$RXh<$= 뽃@uhhf@fXffX-)Jf~8|h3t1KQ@PRha$|h3t 1ufX-|h3uY\uFDphfXfu1bTPV@dDž\5$h3Fd9{|h3n h3)PDg2PhDP A9~hDg28DuC烽\uODxhf@f\fueaTPW@dhDPDg2P+ h3Sh$v h3;$h3}+u ht$V_hDPh!$?CY^Dž\`<$`"'jdhZh@<$"'h̚$ch$Yh$Oh&$Ehf@fPhC$7hh$h|$h$ h$hǛ$hݛ$h$h$h$h.$hH$PhZ$jdh_h$dh^1ɉPTDž\1ۉ@jdh@Zh@<t%w uh$<uhќ$h${Xh$Ph$f^_hPh $.jdh[FhfPfh@fRPh$ jdhsYh:$jdhMZhR$jdh'_h@t <uh$hk$o^ Ph$aY[dh]jdhZDh@Ph$dh^_jdhy[hߝ$jdhSYh$jdh-Zh$gjdh _h%Djdh^ih $!jdh[Fh"$%3jdhYhPh5$XZ|h3dhDp`<wg<`x^FXsI\s)`hG$EXX)k`D`X) 뺍FX`xFv<9~<Y[1҉``OFX`XO\t h:.Xf2;f2<}h3"UWVS}CÀ8-uCh@#SZYup31uuu'h@#SY[1ۅup3πh$u W t[dw<$"'Eσ=p3t 뾁북뮁(EE돡p3.19tcM E1WtUPZU<RJXEtPVZhʈ%VOED>itjPhp$jq}tVSDh@#j}Džu^%P;_0l$t8=p3tj jh@#WhȞ$=p3t j jh@#Wh՞$j8j jh@#g tVWh$jWh$j h#h!"h $jjh#h!"h $ }u2jjjjxjjojjf jjZjj Qjj@u h $jIjjոZY@u8th$=jzX}u謶jg_j j薸ZY@u8t+h.$*Y2 u hD$^Z W$XVSuhk$* d0jj1ƒ #Bu$SPh%jQUWVSDu]  's3h('SV} v~jm cStITtbLus3뼃dw$#'s3s3s3s3zs3ks3\s3Ms3>p3.)ƍPs3=s3tjjhTh%Ķs3 >Ejjj"(s3jURh@hPMT @u h%;)Y=s3y hI&j;u=s3! . WZ) '    ms / =s3t1ɉڸ`1ɉMhjE؉EhjE܉EhjEȉEhjEĉE hjEEhjljEhjyEMU ʃ} ʃ} у} хuu h8Q#E1҉s38gtj5s3_X1ɉME#E#FEȅCEċS:-%BRU:ZH3U$($'s3"0-s30-s30-s30- os3dYs3Js3;s30(  @uCEċSEP1ɸ uCEċSEP1ɸxuCEċSEP1ɸSuxCEċSEP1uXCEčM̋SEPECEu$CEċSEP1ɸXs3uCEčU؋C[Eusuċs t^ps3hw$$']1Rxs3Fs3:s3 .s3@"s3s3 hs3 @s3 s3 s3t `s3 ds3t1s3jjV詗1s Rs3uM̍EPUEuM̍EPURYuCh %&s^Z=s3uhz$h$h%\ s3DHw*=s3uh$h£$h%* 1ۉs3SEP1ɸY]ċus3Ã]uhޣ$1];au uh$s3s3t]ȉ]th$j uąu}t }ċ]=s3uMEȉE 18E0 1҉p31atctguTEp3Eģp3p30t3@0t3p3s3p3p3`s3@s3p3tyUU9sHxt)Јs3tKU؊B<w r7ED T 9sJU L }؍W9sIH 8q3s3tM}tHpVWh8q3 =s3t =s3t8q36$s3tKMtHxWQMV蔦 =s3t =s3MtC$+s3tKMtHxWQMV@ =s3t =s3MtQ$s3tKMtHxWQMV =s3t =s3Mt_$s3tKMtHxWQMV蘥 =s3t =s3Mtp$/s3 tKMtHxWQMVD =s3t =s3Mt}$p3f5p3=s3t!=s3u=s3tp33=s3Vhp35s3e u(987t/Ph$Y^9~kPhߢ$ٚXZu83u =s3tH8ts3 s3 s3 s3PSV 11ɉډe[^_]We[^_]UWVS }hЪ$PZYƅh"u W t.at"t=Tw37Tw3þ뼡p3.)Džt>upTw3t&h3$SA^_th$S0ZYt2=Tw3u)U @w3vujOuShת$h:.Sh$h:.j蓩=dw3u.dw3h $u W t@A3w$('z=dw3udw3먃=dw3udw3듃=dw3udw3{=dw3udw3c=dw3zdw3 GLw38`w3)\w3`w3 =dw3"dw3@`w3Dw3Hw3Xw357@w3X=dw3dw3=dw3dw3j=Tw37Tw3hs%PY^>Pw3/=dw3Fdw35dw3)p3.EU)tHt:t#u =Xw3=Lw3t =Hw3=Tw3tEt h3$W4YZt&h$W#YZths%W_ZE U @7@tCƀ5\w3jj5Xw35`w35@w3e5\w3jj5Xw35`w35@w3T>5@w3Sj IShp$j@w3}H=Pw3jEPjI @u h $EUuuh:$ֵ[h`RPۃhM$#t S諵YE  1SQ%1RPh]$f1=Pw3tTphs%V_Zt)h$VZYtuSht$莮j Sh$j訤j衤UWVS u] 1h$SV tRtfu2{3ֿϡp3.9td1ۉ`XVSWZYVxPV(kZY%=`h=@uv^u^Ph$][^Dž`ddPhS蕓 FShp$j0hٺuٺÅjhhí$hV蟫l={3u Džp{$lPVX}ZY8t Vhͭ$^X5{3S踤ZY@Shp$`e[^_]UWVSdOh#jtXZE 0l1ɉ ̛354^%54^%1ۉ54$$^u$54G4G4G4G4G4G41ɉ `H4 H4 G431ۉ5454H4H4H4150>4,>41=(>4$>4>4>41>4 >4Л3543h$Xt/hSh33 =vj?y$Sh$9\3h#Z>4u >4`"h$_h$PY^u G4h%S_Zu15G41ۉG4QhL$SZYu G44hs%S^_uG4G4 Sh$Y[h$Pt_ZuG415G4hW$SOY[u G4h$ZG4t8u G4#=G4tG48uh$rX1G4h%M_thN}#P[^1ۅfN:.ftPYdH4H4:.f:.ftPZt!`H4u葡t H4&>4111Bh57h3 =v#j?@$57hfE#j54U Eh $RP HP̃D1$)'541=G4=G4<>4jP57 -t8{57h`$ L3G4Y4>4J1ɉ G4=57D$5>4XZ1G41=G457 54$#PZYH4:.754G41G4j P57 \H4~8z57hu$j554Yj P57| >4~8*57h$뮋57j hV#W 57_h%P;ZYt"8u57h$GujPW @8X| H4m1G457mXDžI1=`H4=H46`H4H457YH3y57h$D37?u:.蠗1Ph$HXZ:.肗b57h$Ph$+jjj5H4/Ep3.)ЉEE E 1T3G4G4H4tq154DžDžh54RjVtt& u0PIt_PVh4$1ɉ 3 3hX#/ ^t8t PZ3uPhXu;PϘXt߃=3uF t8t Py_36lY3=3uy3uh%JZ3ghPh3 =v&j?3$53hR$| 3hhJ$h3 =w=3tj o$ h`$P{ j hu$VK hj$ X޹$ih$ X#$Mh$ X#$1h$ Y#$h$ _#$hv$u XՀ"$ݔh|$Y X$o#h$= X#$襔h$! X#$艔VRj衼XZhj"Y^hj_Xh[jXZh[jY^hj_XEt7U ESRPWà ̛3uSjj詠_Xj XE j:0ö[^t*E 0SYuU ERPIVXZGjh H4v^_uh7jA^_hj 3XZE 8j@WVY[ƅt @hPS- E @1ۉG4t1ɉ <>4 G4EQ@PXZG4=G4u u >4ujVW =G4t 1ۉ >471҉@3Ph$5H4 5 >4Y=G4\뿃jh H4buXZh7jY[hj ^_we[^_]UWVS}u {hm"P4ZYtWhh"S#ZYthg"SZYuU4)~3ltXnuzh/$VW duU4׃Vt1PσwB0-뾃cu3U4U4hl,'hn#h:.迢jNhl,'hn#h:.褢Sh$h:.蔢j#p3.9u#=U4t 1#M1Q;u5U4ڔUWVSu 6~h#j誶1ɉ h4 1h$Vu ua`Gt+It2EtHa<$-' Lh4먁%Lh4뜡7u#h4p4zXh4kTh4573$57P躂h?#W71 Lh47u#h41҉p4jjjh:.'h $/Ph4jjjh:.'h/$]X|PPhP$h:.聠jp3.4 Th4ut U>tt 1j5U4Vh:. t h"j5p4蒒UWVSP}1ɉMM1h@$u W t3gt!utGu.7E7;u7E85p3.9Et3SZt@E%UCMM@uShG$j1}1ɉM}t E~E1}t6h%EPHtYZt"8tu hY$jGCDʋE 46Z@u6hp$jh%Y@ttEPW%_Z@uh$}tu諓Y@u h$jFtuZ@uh&$FtVRPnkvhp$jh#zXuS%%jh$SSHShp$jUWVS] 414H44bs%14h£4a1X/'lt2Ft&V =4uRh4萚Y_ RvP% 44444h%Z1u"h:.h2b%|jGDuG 4hc%Su tsmtW~ԃptXrth:.heb%3j菏ft$Cuh4h4h_b%57_#뚡7rxPhc%DV[_uUu;EE|Chc%nY1t:S%Zt@ <uOtS>Xu 1hjhs>$h$W Džh2tt25L7o5L7`ojjSPc@4uh:.hc%t^5454tY[5@4}Ehݗ谓h}jh}jhӗj 5L72Chh4&UEj@2j@)ǃZRj*FP[1XZt1x|1ExMx|uuSx|1Exڸ%Mutx|ڸc%pMx|ujDXjV`pZY؋pQ lJl9ujjjjjjjjj jVpj[ ƅDž%DžjDž%DžQEp;5p3.t dSlE tEpp3.U)‰} 0Sy jjjS|ǃu#h ;5p3.{u uPjSt%huʅ h8%( $hG% Y;5p3.u;WS@jjp3.} 4Sǃq u uPjS"0t@hZ%訑LHSZhg%茑TPS4  hx%hD@Skst dh  t u @ 俀dh%@1҅~d%1҅uzuvtSZv0Sh!" uT#tT#t#h%PSh%j+0P耈Kh#h#h#h%j+0PYdE9p3.u t1ht0PX h%^@uhL'h%Y[uhL'h%4 jj L0Shjh$M'ĹP$@uhL'h% S-ƍ@Zv8Vhգ%޿Vtt#8t h#`0P] ^-@~ Vh%艿Sz , dh1ۅ Ӄdh1ۅu,u(PPp3.u 4 d%1҅u3u/ Qjp3.u 4ه gPjj譇 @O8thL'h\%躾XZg@uw8Ghm%H8/dh9 Ӄdh%1҅hh%8D[^@u!8th%hL'h% hh%DZY@u!j8th%hL'h%н 0S,^t&uShL'h%SPhŤ%豽h%J1d%@1Yҍ0uF(Pjh0j@u h&k,\(}Shj\3@uhL'h?%XZ@uhL'h%cYkt$u/>JPh %5 hkA#蔼Sh+h/%eh(\,X|Shj\x@hL'h?%&^Xh@S"+[tPhL'h:% ;dh% u =uNd1ۅuLuH%1҅uu p3.u 1QP0P @uhL'hN%dhӃ %u#ӃDž %u Dž#%1҅uu p3.U '%VPh&c0S謼@uhL'h`%p1҉贎h[P'ZY@u hs%谺XSh)jϮ@uhL'h?%聺^Xu/dh@1ۅuu dhVP0P1҅uHhL'h%4P$Y[u64h%[^$P$9x uً4h%‹t x td@Ah uhҥ%Vi0Pxd%1҃ uuh%RYt{ tjjM UXZ[ލV0SfVS:1d%@1҃utSXt"{ t萊Sɻ X[ڋdh@1ۅ1ۅut% t$y tIヽuc11ۅut@1ۅu2u. uh%Rֶ0P 0t,%@1҅ut0PhVj襯W0P8[^ tWhjjhՋd%@1҅uu h %[u u0PA yh/%蟶dhÁ@1Ydh0PhjjЮ@+0Phj Ԫ@P^$ZYy1hL'h0%d[^j1ɉ$ 1Dž$d%1҅ҍ0uuS?~Z@uhL'h@%Y^PSMXZt;t HptqrP P7XRK1ɉ^WS _ZtP萜^S+S腷؂S;@".tPב[hӃ@tRt \tBhQ%h@Yu&j$RPr @uhL'h5%XZ襰El\h:.G$ht(P1hL'h7%&hL'hH%e[^_]ÍL$qUWVSQ,Y1P951󫺬95108@<4hq%S, H0"$j'Z7%Z757f951Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f95F누0f95%1ɉLj LP57!XƉP 8u!78tL8u ;Ph%kj LP577 ~:t L9t Rh%4:5 Z7@s>th%j Z7jh:.1|&.&.&.XZ#7@ Z7j LP57 &.7 :t L9t Rh%ju@=Rh%7< Z7 8LP57D7_X:tL8t Rv)ݝ ݅ t,j;Ph6%>&v RhZ%EٽFfF fD٭D߽ ٭F $5|&.=&.߭ =&٭D۝ ٭F &.xy57h% uhp%]&.^ Z7[&th%j LP57C47 4x8tL:Ph%'0%Z7 Z7 Z7 Z7 75B.tDFu h%4B卅(R$R RRRRR RRRRRRRRPhj$QƃH1Ʌ~ )1Z7h$ywY1X:5@9u919~X:5Ph((#AwGXZj Vv Z7t1DžtDžxDž|Dž:h:7Vj57GtPvFPh%:7pHP:7PL:7PqF Z7@Yj LP57&.7 x:t L9t Rh%=hh,%Z7% - Z7zZ7%Z7% Z7RLP57@95XZL8u 57h $@LP57Q@95^_L8u57hS%p3.,)Ht64Z7j.VHY[Åu VzZ)?wSVPƄ t@B.t B.fA۹1󫍅PpKjKPP=qSVP/qPdP;s$TVh%j誑 Hd`hSVjȖS8XZ7t=&. h%XXt1DžtDžxDž|Dž:h:7RjVCtPZCPhp$j:7HtΉ5D:5pu h%Hl:7p pp{8H:7 y hI&GZ7@t"5L:7hP:7P t hz%@1DžDžDž:PtPj@CtPkBP@h%jxtZ7t h%WWXppj0j)5H:7t h7%Y(BXZ7tVDžjSj'j)5H:7t hP%jSj(j)5H:7]t hm%'PPZ7^_Шu h% u0&.1҃‰:50@s Dž@0 1ɉ :5&.@},Zu h%Rtd @:58:51w 8:5m <:5DždZ7@t8jdPjh5H:7L@9sP:5@Dž@=t:7u(jPj j)5H:7@u h%H:70t/҉jRj*j)P@u7h%YDžjRj+j)P@u h%,Z7%u) t DžDž j Sjj:5H:7)y h%Z7t-DžjSj&j)5H:7t h*%=&.t188tb Vz_u hE%T955951҃8t4P 1 C)C.C,ރ 9s11ۃ<t/8<v8BYu ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%ubusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260208165040Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluCould not find index %dDetails for index %d: StartType: %s (%s) None (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?] %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addresspltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresvvmresered/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: ND options: DHCPv6 options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %snd_dhcp6_unknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completemulticastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s%s%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist