'V?"iNR0qQNetBSD/earmv6hf ramdisk 08RNi<  RNi/XYt tRNi@@<@T 08RNi<  RNi/XYt tRNi@@<@TU RNit`ARNiRNiRNi$h RNiRNiRNiARNiRNiRNinA.RNiRNiRNiPX`ARNiRNiRNioARNiRNiRNigARNiRNiRNioARNiRNiRNiARNiRNiRNiARNiRNiRNimD!RNiRNiRNi (08@HPX`hpx$TRNiRNiRNi (08@HPX`hN$ RNiRNiRNipxK$/RNiRNiRNiM$,RNiRNiRNi (08@HFARNiRNiRNiCRNiRNiRNiARNiRNiRNiARNiRNiRNi!RNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNiaRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi!RNiRNiRNi4!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi B!RNiRNiRNi B!RNiRNiRNi!RNiRNiRNi"!RNiRNiRNi"!RNiRNiRNi"aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNiaRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi!RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi?\!RNiRNiRNi>\!RNiRNiRNi=\!RNiRNiRNi<\!RNiRNiRNi;\!RNiRNiRNi:\!RNiRNiRNi9\!RNiRNiRNi8\!RNiRNiRNi?\!RNiRNiRNi>\!RNiRNiRNi=\!RNiRNiRNi<\!RNiRNiRNi;\!RNiRNiRNi:\!RNiRNiRNi9\!RNiRNiRNi8\!RNiRNiRNi:\!RNiRNiRNi7\!RNiRNiRNi6\!RNiRNiRNi5\!RNiRNiRNi4\!RNiRNiRNi3\!RNiRNiRNi2\!RNiRNiRNi1\!RNiRNiRNi0\!RNiRNiRNi7\!RNiRNiRNi6\!RNiRNiRNi5\!RNiRNiRNi4\!RNiRNiRNi3\!RNiRNiRNi2\!RNiRNiRNi1\!RNiRNiRNi0\!RNiRNiRNi2\!RNiRNiRNi/\!RNiRNiRNi.\!RNiRNiRNi-\!RNiRNiRNi,\!RNiRNiRNi+\!RNiRNiRNi*\!RNiRNiRNi)\!RNiRNiRNi(\!RNiRNiRNi/\!RNiRNiRNi.\!RNiRNiRNi-\!RNiRNiRNi,\!RNiRNiRNi+\!RNiRNiRNi*\!RNiRNiRNi)\!RNiRNiRNi(\!RNiRNiRNi*\!RNiRNiRNi'\!RNiRNiRNi&\!RNiRNiRNi%\!RNiRNiRNi$\!RNiRNiRNi#\!RNiRNiRNi"\!RNiRNiRNi!\!RNiRNiRNi \!RNiRNiRNi'\!RNiRNiRNi&\!RNiRNiRNi%\!RNiRNiRNi$\!RNiRNiRNi#\!RNiRNiRNi"\!RNiRNiRNi!\!RNiRNiRNi \!RNiRNiRNi"\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi \!RNiRNiRNi\!RNiRNiRNi \!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi\!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi!RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi$!RNiRNiRNi4!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi !RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNiaRNiRNiRNiaRNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNiaRNiRNiRNi aRNiRNiRNiaRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi?\aRNiRNiRNi>\aRNiRNiRNi=\aRNiRNiRNi<\aRNiRNiRNi;\aRNiRNiRNi:\aRNiRNiRNi9\aRNiRNiRNi8\aRNiRNiRNi?\aRNiRNiRNi>\aRNiRNiRNi=\aRNiRNiRNi<\aRNiRNiRNi;\aRNiRNiRNi:\aRNiRNiRNi9\aRNiRNiRNi8\aRNiRNiRNi:\aRNiRNiRNi7\aRNiRNiRNi6\aRNiRNiRNi5\aRNiRNiRNi4\aRNiRNiRNi3\aRNiRNiRNi2\aRNiRNiRNi1\aRNiRNiRNi0\aRNiRNiRNi7\aRNiRNiRNi6\aRNiRNiRNi5\aRNiRNiRNi4\aRNiRNiRNi3\aRNiRNiRNi2\aRNiRNiRNi1\aRNiRNiRNi0\aRNiRNiRNi2\aRNiRNiRNi/\aRNiRNiRNi.\aRNiRNiRNi-\aRNiRNiRNi,\aRNiRNiRNi+\aRNiRNiRNi*\aRNiRNiRNi)\aRNiRNiRNi(\aRNiRNiRNi/\aRNiRNiRNi.\aRNiRNiRNi-\aRNiRNiRNi,\aRNiRNiRNi+\aRNiRNiRNi*\aRNiRNiRNi)\aRNiRNiRNi(\aRNiRNiRNi*\aRNiRNiRNi'\aRNiRNiRNi&\aRNiRNiRNi%\aRNiRNiRNi$\aRNiRNiRNi#\aRNiRNiRNi"\aRNiRNiRNi!\aRNiRNiRNi \aRNiRNiRNi'\aRNiRNiRNi&\aRNiRNiRNi%\aRNiRNiRNi$\aRNiRNiRNi#\aRNiRNiRNi"\aRNiRNiRNi!\aRNiRNiRNi \aRNiRNiRNi"\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi \aRNiRNiRNi\aRNiRNiRNi \aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\aRNiRNiRNi\ !RNiRNiRNii!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNi aRNiRNiRNiaRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi!RNiRNiRNi!RNiRNiRNiaRNiRNiRNiaRNiRNiRNi!RNiRNiRNi!RNiRNiRNi!RNiRNiRNi B!RNiRNiRNi B!RNiRNiRNi!RNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNiaRNiRNiRNi!RNiRNiRNi!RNiRNiRNiaRNiRNiRNi aRNiRNiRNiaRNiRNiRNi aRNiRNiRNiaRNiRNiRNiaRNiRNiRNiRNiRNiRNibpf!RNiRNiRNi $RNiRNiRNih$RNiRNiRNiN$>RNiRNiRNik$RNiRNiRNip$sRNiRNiRNir$RNiRNiRNixARNiRNiRNizm RNiRNiRNiw$RNiRNiRNi{ $RNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNiARNiRNiRNig4Z8f.D*,:]7m{N%e36M2!*_#H~ h)xm/vGZHLYMwaa.ܠ(+;Nv?C1 b!})␡>|74'{- b/rd|jT7nI64M]O9k$`h;ok/OlmE~X>}OU3DhRh:+P/>mײfUrokpUT6&L#QPG2 s %p%kWIm'IL:7rR$jC$J)B=@@X Gu-(Bu B }*?qwBX"9j7#+Vw2@;^8l; )M.\&crac&Nɢc}KbjrzQ,fi2i)?E/[TB%J ZR\,fb?/t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!4 (!!!@%@%,x& LL!@%@%NetBSDKwGPaX NetBSDearmv6hf4p@-D0D 0@`Qp(@P`F`F&a03/T@pP^$?$A-`0`` 0PpU(pGpG@Pq`P03/T@0US ]$X@-lPQMK \!\1 P`0 0R0819  0S  /S 0S10S8 0p ZpG2 pG0@3'q1*03/T@Y p0pWH2H0@3(1*03/T@ 卖d 0 P0 0|]$`P>$D=$ %@-l llPd@P L匮}_`POU $傮P @.>9>@ &P P@-@EO-`00R@,2tMt@0pWo  `P@tt@( R 3@P p@0: S 9塭`0SЍ@P0`0x; 0xS0S  yP0S S0p WmP s 0S;00 0 pP -0s s0T TDP   PpW&4&`Hl??H&FH0`  BR` pRp RX Xp/&&@-d0 9?@ & 000/d&pC-؀-`P p0M@ 3{ A (- A{{z`P$0  ЍpY@d&a%B@ &@-@ M00@  P  ЍBA-` l1V0zP 0 @P@TV PC  W@@7xd0S@ u@0;0kP W 0XptdV ppkd0-S XdUHsp 4@0SV  W a%BBx&CO-5MpY x7p %`P` Ѝ  p` 0`$5XP0S 5%0 0 5X0S40S* D$尠DN00CS0 W@ Pp  @YT `0 @00CS0X?0 X0 p00p yp@300 80: Sx h+ap@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `hIp2  pQ 0Z 1(#00 H  0P \\iqP 4 `+X"J 0R 0p0ZZ3r0S iP ?Y' p00 R0S ``*0S  0 >(d P <`V k`0 ?oR20S 0  0 0R0"P `P hh`0S H,` P0Rt00!P &a%Hh&p&t&l&&@ &C& &d&|&C%&&&0@-MM@P  bp  ;0U$C dP TTۍЍ08 }P ,(0P XECa%RC]C|&Q@-@ TP DD,nP $ 0P@a%RCiC|&Q@-@ XnP HHc0"P $ 0P@a%RCtC|&@-;b0 n~C@ &0$/h&'0$/%'@-0D@-+D@-&1D@-!GD`]@-1   0 0 Ѝ\D`&'@-1   0 0 ЍlD%'@-1   0 0 ЍxDh&'@-1   0 0 ЍD&'@-0   0 0 ЍD&'@-0   0}00 Ѝ?j%'h&'<00/@-0   0g0 Ѝ%'D%'<00/@-0   0S0 Ѝ%'Dh&' 0@- 00 C$0P@JЍDe%,0A-`M!A!qX0 p! R0B=0B  P壩0H 8 R8B 4!010,!0Ѝ>PP O=JQ0P   0S  0 pP0P      0 3/R ! 7000<040LD0%'h&'%'#=_EyEDh&'DEE /EE0p@-|@PtP00 R 0p800 p0  B0Sqs &'h&'%'0 0 0 /h&'%'@-  H@-@-  H@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp`0S 00Hm8@@-@DPЍ@ PЍp@-(`Vp80@  03/PPw8003/(PpE@-@P`P 80 (0(3/@p` P j`PЍp%'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AF 000+ xpt| D  ЍO0 P % pHp 81/qp4  ?P p 4 _0S4 tp0 0 0 0 "CD0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0Χ004 8pX  FЍ%'-E%' FH2FVFR/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  P0 0  0 * $0 !(0Ÿ}?LB?@PN3c` D0S%H0}??@3c`_`RP0!!!! d 4 !`P?4X4 " BXX P!d4,4X4 }" B   !d44X4 j# B  d44X4 W/0SX8p<@0! "C` d @44oX4 :Ѝ`&'Mb&'FTG)GZ8 4w@Ђ`Ɵx@ &Qy(L''K6L0 p@-0 ?0LPKP@@S0P  00S/S`@o8P0p)p@ \P(D8<p|('('טML_LSL''P''lLLHLp@-@(P P8P Yh 0TT Pup`U(` 8-8` 0"p''%@ &L@-8@P(P 8P 8080'' @-<<vyP $000<0 P+'&''@@-<pPG0`F [stlV0001PXW44 0,B00C0Cf 00CS010:uPU 0P1` 00CS00 P U Rt0V00P\W  00C0S"10 T00CS000 U0P 0@ 4W |m V 0 00 0 @00S 0S YI+'t(')'x@ &Qy('('LO-$RM` 0000100010S u@0Աq`0#0P 00)<0J?oT20ST SRP  }0S  RZ  @T  Z     0010S@@  0 1P000CS000 Ѝ S 0P  BR l  @0S Z0 0$t('('('+'(')'@ &M(''MA-0P!S`^P@fV 0LpP0!S mP JV 0HHHA<00S ,v$0@Ļ%@ &9MPM\+'hM('A-P@dp`T0S PV$ R ̞+'x@ &mMO-`@ ؀P0S p0 T T R R u0p[P Ѝ PP P   P Pp@+'('('t('A-p0`!SPP@UL 0Y @ PP0!S P U- 0HHH<00S ,UpGP]%@ &MM\+'hMO-@P b 00CS0p0@g hU  0`001 pTpP@0 pW2tQtTP0PP00;P=U8 v, 00CS010 5 t0P0CS000x0 S0 0 @ X 000 0 T0 `0U0$0T p 0 &+' *'M@ &M)')'xQy('('|+'O-PpP0 SPEUP ЍE P 0C0 X2 Ub000NPTQ _ 00C0S 20  0 0CS0L200 S Z0 P CPE P 000S S ) `V% V000P nTx tp 00C00 0CS0@100 0SSX 0PFGP0 0Z CPF V'P尀VP0PP00彽P -Tt pfl 00C0m0 P0CS0<00jl00`6)'t(')'x@ &Qy(' *'LG-P@`p P`T  0PSzP 0@^S00\P0S @\Z \CP X0 @P*0P00Me%M&M@-T @000 <P 0S( 0C00S 0C0 Ѝ('ht@e%L0 R QQP0R/@- 2 ('A G-P`P@ X 0S@ @0S @T@@DT rpP 0S 0 0 PЍ('MG-@P tp0SL`IPUP 0 @,P @PA ('X0000@-@ 40aA R    0/L&M('40000 01h@- L&('MG-dRdr@`0 0S0 "3( 80?Y+Y# Y{00 R  % R 1@sR0"Ss @`` IQV ^Y0^Y-Yj @ 0@^Y-Y00@R(R0 0帹1@s@R0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 00;Y0 00 V@ T0S('L&v )'NA 0@-@00 00UP0 000 ,R;R 0S  S   0;SPp(' p@-P@0QS@@R0p`V P0C('p@-P.@P R奾, (K$ p 00x@ &QyQ 0Q\S@-A /`@-0S*  0@000S! PvCpP KPP @P Q0 S</R/     0  (']N( Q 0@30/@-('00@- R 0C30S('A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  bT0100CS00 2pP('&G-AP pRpGWR0`0`052` 001S 0100CS0H89  P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  %`p('G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P`('G-A 0`0P0] P 00CS0-0 p& 0FSdp a1S  0PEP0Cp00100CS0('O-HB`0pS74P UB!0SR0XPPP00她PE 0Q0CS00LN!1  PP\00`F`0uP0   P*  0!0CS0P(P*VP; 0堑0 S- S   _POb p00CS00  0堑0CS00  N0PzP('x@ &QyA-ApaV&ʐ0l00PPO -00CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p('x@ &Qy0G-D0!10]PpЍ0S0  $SPPPPẸP*O彻X TcP00CS00 # b0Q0CS00! P1ȃԓ 0 S)"Rʠc0U```00}P 0b0CS00 M 1Q !@o!S/ %S !`V U 00 0NP 0帡0CS000!000\Q00`PR# !RU``0``00Pd 0a0CS00km0` 1 1S 0S21a0S S`l   P7 0a0CS00>@10`! S:`Fp00  1S pGa0S `10 BRpE` S`l   岷P 0a0CS00   ('Nx@ &QyL7NP*'( Q 0@30/@-K('`01S @-0@!S @IP /=P /('۽N7@-A0 R!RUUʐ0\00ZP@M] |xk00CS00+ 0 @ R,W R P Ѝ00!S KP b0 Sڰ 0R0CS0000 0 Q  vP   ('L&x@ &QyKN\N?A-O 0 P0,p W !GpY\ϟYP PP0  nQ pQ lQ 0 S , PP1S P PPP0 nR pR lR 00 S1S P P0PP_PP0 nR pR lR 00 S1S jP!S00P0PP1S 2S 0Sڜ 000@ `PP 0 nR* pR# lR$ 00 S5Pn PPPೃ0S!S , s70S 1Sm cP0PPPeI 010,0,0]0S000@ PQ 0!SP@ =P00 nR pR lR 00 S-0S  /7 a3PP1S PP%G@o%G`GooPbVWP 101?PP00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  HP0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PP"PP0 nR pR lR 00 S{1SkP pP0PP PP` 0 nR pR lR 00 SX_aP0PP PV0nQ pQ lQ 00 S 9PPD B 0  P6p PP10S `Vp0VmVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  l P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S$602P0 PP R l Br R0" 0 S1S 2SqW P0000@ 0S0 0`PP 0 nR- pR& lR' 00 Sc1SS1S0!S ]50S1S d  PXX 0S0T 1RP0PPP` gRF  R 0 B RdJ `<x@p>ZJ0"S:b-pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 /P00PP2P02 aP P v0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& HPP0 nR' pR lR! 00 S1S" P20 2 2020P0PPP pPPP0SR `V0V pʈ0 nR pR lR 00 S]1SMcP0PP RPӰ nQ pQ lQ 0 S?:P0 PPL&(' nNNN7Ne%e%NN+'x@ &A NN-L Oh+'P*']>$O)'Ne%6OQP000P0P@v ^`P 00 00 P 0 nR+ pR$ lR% 00 S1S0!S 30S1S{ aWW  EP0S0P0PP1S 2SqXP R# l Br R0"0 S0?PP0010CSH Pb@p H0"S0mPP00 nR pR lR 00 S~x2 00S <PPPP0  nQ pQ lQ 0 S`0S iPP0S5PP]0 nR pR lR 00 SAP ]92SFP0PP P5 "-@- 00g ЍЍ/'+'-0^S0]S0]S S]S[S .0Ls0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0吱P,H哴( $9 00CS010 [S \S @@P`0 S @ "0(a0CS,0p00,a F L0 0@S G 0&)'+')'x@ &Qy('9O('p@-!0 P= P@01SE0p0 SS t`P@0P 00S' P0P00 IP0 h0T 弾00Q㊯P0mG0 ,()'L+'Ot+'x+''x@ &QyO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00声P? 0A0CS0l10G 0P \QH 0 SP 010S uP/ 000S S)00 S [ U 000dP Ff t00CS0L00 0`00Pp8 P)',' O)'('*' *'&x@ &Qy0A-P0 0p@ W 0 `@P 0 R00R00 1BQF@ @P圭@p~F0"S,"@gR000)','NO-@SMpcȳ00 0GS TcsT`0``00ܯPLF߲` \X00C0+0&SK BR D R: Y J@p R尯PF岲 X00C0S @Ѝh20  R  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p WP EXD @<f00C0 AQ 0 T0 Tpppp  %Pu p BR   @W0 `0CS0(00oq 0 b,')'('x@ &QyO-M 0@P0P0s 840S 0 0 000 (0pP ߍ0P0`#2C 00 S pSN(0Y01 Y  $ 帮P$'E庱P L`H  B R+030 # ^  BR 200S 0 0k C 0 0(PP.00Y0 Y H $ jP$  BR 200S 0 5 C P0 (0 P'0 p1pG Y;ttZ 0P<1D1, ($?00C0SuX   R    P> 00CS000^`W 004 00S xxL00S 0  ]C8 0 X  (',')'x@ &Qy('OO-pᬡA0M0CQ` 01 00C S00`NlЍ0  0P5 P!` 00000`P00CS000  M[  0S00CS0x00` P  P('(')'('M,'('O-RB0M00bsp 0siЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S Z0p0000000CS0C01;  \" \   " L\ B  @      0C LN ('e%('O,')'$*'*'('A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT ᆭ@ 0,'('e%('G-@p0 PR` 0 P (S%0  d }P 0 ,)(P,'x@ &Qy@-B0 O@ &O-eGM0PS@pM$Q403/P 嬨0: SB00W +~- P8:B?0P0: S 0SP0: S 0S 0S 0/S&~P70p0o=P- 喊iP 0#v PvO+/-0P ]D#P{]FP 8/3>P/->P d=0P+I [(H Z% U8.0. 0PT9.0. 0P @DP ^ PT1RP o R00S$ 0SS 0: SOOPN 6  0@G=00 04K @G=00J0SP. Tqo3XG DX00CS0 p Pp  pYW gX0 X p00CS00 0S qP0SGݍЍ0c ?o2500s0 8,'HPPP&P@ &Q&Q\\<0\\<X X0p@-@P@@DDT ` U H H0Rp@\\<ppX 0Xp@-@P@@DDT ` U HH Qp@\\n<ppX X0p@-0P0@44T ` U 8 80Rp@\\T<ppX 0Xp@-0P0@44T ` U 88 Qp@\\9<ppX X0p@-PPP@TTT ` U X X0Rp@\\<ppX 0Xp@-PPP@TTT ` U XX Qp@\\<ppX0X @-ppt t0\@ ^0@\\;X 0X@-pptt \@ ^ @\\;5S %R R S R SSh -^L^S R 0/0/0000-'O-QMTg @ `u @ 0 @0L0@@@ @@D@H@,@0@<@@@4@8@5 SS$\ x0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?9$pTp9,0S d4 @?C000@$0D0p0H0D0;p90$p3p9$0S00<00@0#0p#p9,0S 3 @?CZ㸰张 0x#p p9 0\#pp90 \ 0C0CQ0B003/040 0S ,YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " &p P 4 04080080 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$9[( 9 0R  P 4P0g@80S00P00P00[PP-\0.S0S 0!{Z0P$0 0P(0 $塩 (圩 R P0哩~P000Ѝ-'ſVUUUC1`G-@a!80S "PP %spW G#<0SB|$@P >@#>@>0S5!0CS0 \$ Z  00L0S \0.S0S G%@0S40S t3g%$<0Y?o20S X (040-'T@ Aſ%Q&QG-`>2P0DL0 P0S$00D0H0P0pP〔0t$ApZh4T H0 `F0P 0 H/P Z$4X0 s0X00 00dt |  P PRPS WG( ?R004(0'R S S S3 L0St3 T0Sh3 0S\3PT#QP30V < 00Ѝ10@GS  0$ 00H00P0L0 0T0X0s0X0 00P0L0T0H00 00P0L0T0H00X0v0P00L00T00P0L0 0fb0d0_PP\0<0Y080 PT0 D0h l0N0D0h0000000Bp=0p$0,p80$00,03000@0-0 0*0p0'0t0$0D00h00x00|000000000D0@P L= 00D`0S0\0S00S S S0 30`0St0\0Sh0h0S-'ht@e% hQP& 0-'Ьİ e%+Q@ &h<Ԗ,80p@-@PT @@\px-'80p@-@PT @@\px-'-L0MSM\0 (+ p<剩0 .ލЍ 00 >04@pjl0l 0 0  L00S   THQ@ &Qp-'t-'L-'$0\ 0S B?x-'H0L0S/0 0 0/@-00 SM 4 $;lpp~hЍ\0\@ X0R@P0 B ?  0Ѝ@-'-',-'SQQ4-'QQ0-'P `00CS`0p S00 P0S X0X /X&: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !X@P10S D10S- 010'p  @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?i5 0nT00S -'Q-',-'SQop-'t-'l-'|-'4-'Q0-'L-'s@- P@@P `QU00S @HT DЍp0t  Q \0 \@.U )P@%UQ-'-'p@-P@Tp0 0C0  $B @C-@4Mn$3 30S`sV4Ѝ0 0C0{ 0XPS !$0S 20Sm  4 "; $px/p %0( TH20S 04 $ 20S   0 : SK0( r" 08"$410S10S61!0 0H 10S|10S : S0: S v`x81萟 01R(1 B?V4 0 ['Q p| , lGL\,>00S -'H-'-'-'Q,-'SQoQ`-'R(-'Ag Rh-'d-'p-'t-'l-'|-'4-'Q0-'L-'1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ 0P 0 I`0Sp4QPPU% Ѝ  B 10`    0S[  L0  $R,   V -'-',-'l-'|-'e%f%-'410G-S$0@010S 10S,0000 0 0PB0`VGapP儠UG o0 0C0 W fp0S$,  `YpP V`-'-',-'l-'|-'e%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG /0 0C0 W ,&p0 00 S p0S$,  Hp` -'-',-'l-'e%@- M @ ip ЍT P 0@  QQ  00l)T ФP S  &0p@-0PS``2@P 3P P%AR@P4 *Pᖣpt-'[ARHC-CM@2 `7 7PȐ`T *F 0pPPCߍw ? P@7w0S ?@ᱣP?oP@ &@-8 &R@ & 000/-'@-80 LR@ &-$MX0P!00Q00! 00O 埞ֽ p啞$Ѝ "$ .0P 00t0 p0|, t p\   HH妀"$  ,0埀-'RR>RHRRRRRO--Le@PQM <Pn ^80Sr  Gp߼P 0S ؼP 7 t00CS01p0pЍ0S ḼP P P᯼pPX  ) ,4 Rl ?p0! J0 X 00CS0Lp YX 0 P 0S  puPP X0: S 3P4Pۼ P ƼX0: SmPX gpP᭝ub0S 㜛  OP< PZ [ (兝ቼP ~0 ˯S ,!0 0  A! A ({{ z0 |pX 00@0 QP @Fp lNP O70S 9X0;X0XBP .=P 870-S  !PX pPt0S  H嫿Sp Y@-'dSC@ &&SSû,SHP4RO@Sf%SSSSG-A~M (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx0MSP 0p`E 0E}ʻP6d! 0`~܍Ѝ~,;P 6 !0 0E~婻P6 ~,#`Pʁ6 ~,P0pE 0E~勻PYp  TQ \p/0 00EvPW6>$ /f%m TS4T^TTT00CS0 0 /G-\D`HMp 0008T8$8t0000 00 $0S0 V"4`0p Q 30Sa3PZ#PZ60#f/庹000 0K|#圹P50`#R/V 00D30p Q   #P0 050"3/V0020"hP50"/2000HЍp(0: S P. S+@ ⺺P00S`0:0 03V-V)V q 1X  ?/ 3 0~\P F ;0L S0 00 02+qpi50S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U . XPV P 0f%-'0'Tj% f%'-'9UTf%TU%f%KUm8@pY'lY'4f%}D00S/@-4@~M0S~, 圸P~܍-'f%0@-p@$0l00S Ѝ00 0*0Q 4, A.APf%-'|UL0@- R8-P 0 0 --'U'pY'UA-pP@` OP@DTP`VA-pP@` P@DTP`Vp@-P@T0` Q$@P 0 Q @;;S p@P00T@ m4(0( -( q-f%-'pY' V-Vs@-R@T` V0a@$00 ?00S 0CS3P3A40 S9I-00@ЍpPڀ;;S" 00 0)0Q P?P00@00" 40S @@40ES TT 0$040S40S 30S 30S $0STڄ00Q Q`,T( H,3(00 ;-$f%-'NVxV<'V-VVW`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     ⷸP000S, @ 00pT0pS 0LD)Qo 0,p T09)Q/-'f%Tj%8WmgWWG-P`0 P ,p@P"ڰAQ")Q 0P P 0)Q>3@ ,ЍP Pf%-'W@-|A`MPh1P0S2 S VPLD%,00ЍV0App0 (0Q3 f, P0S(0S 0(Q#2 ) Pڐ0V 0?b, l0 ` 0P2 0< 2,00f%-'W*XWX|XpY'TmXO-rM,M R(`RX0E@FP0 0S 0 |00 SJ'0S X  H"D2p00 ,0$"ᴺ0"⮺Tm! ?⻻܍,ЍT ؑ0S =! !喺!0`␺, 0Sx1pp1 00+ 00!w0T렐p0  P#0S@$<lp@D0~40 B@FD'c d'd''dA-M`P@pͨP5(10S Ѝ 0RP  0RP 0: SP P#0 ጨPW tP # P W0 @,'8d-Vdgd0@-:(4@: SM=0P - \ 00[ P0 _p 0: S ,^Ѝ000  td:P/  0 fA-`QFZDT@P,#0@!81P @$<sP10SP+(0 0 0 =  "4S `٦P"`0 Y\0p 40Ѝ(tS|(tHP 00 0b''hj%dj%d'O-Z#Q30` @ (tJM Mp4#0CS0 t3tP d30S ⱧP0: S X P "Z Z30S 0 "q"'pS"0 "X 2P @$<P RPn (4`S42TP Pu`PaX" 0"0 + u0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 Cᇦz @+Jލ Ѝ  r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00 'p'''dd''hj%YHedj%d"e/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 !@0 X2@ @?PQ*!@0 0嘠P P` hЍXX ႉ 6  ` `@~e`e'|'pe''Rs@-Ѝp@ 0@`P QE!08  廤P7!0 e'~e0@-@MPP00800S =J"Ѝ0'G-`QM MJP㠔@ Y #p ⤤P 0p 0PP=! SR J(ݍ ЍPJ 8 C= $HL0Q\ J(L0 00QJ 8 PTe9UeeA-QP 000p@T+`00CS0pT0 0S0T@ 0S@ 0 dP 0S@ @T@ S P 'i%& '0 0 S00@-@R00000S0@000S `oP L^p 40P'''' e'p@-PP 0S|@p `F@P` @P0/S000000f PR @@@p,fGf'h0 RX R  H R/< R/ $R/Q/ '$' '4'`0@-0S L0@0T R S$ 0@''nfx@ &G--b@ 0(MS 0SzB((Ѝ0 0p5"0C S60 |20S 0X0 00!P 0 ! " PPp  0!$$! 0!㓭 X w(4 : S=  S7  S$  S03 0`! 4  0J 4!+ 010P7 S  S/  S04=! 0400S -ЁЂ ;Ѓ"040+04 ĢP%0h 00  0 0 Y ' 'ffff 'Ygp@-8M@  hD 0`P`U`$ $ @ 0⮐P8Ѝpg)gA-t1hM0@S ThЍAu`Z(‰="(<p@1WpP0 0000p084 40CSH$0r"60"$0( 4 CR+x ݧ7hЍB>'PԧS+<  Ig'xS5gGg YgRgŻ@-@XM="p:(a0 SXЍag7@-@PppfP Q Ѝ0 0 D Ѝ0@D0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq*-0C\^* 0 \ 00W0!00N0 00N ^*N^*/ P@-*0S@L0 ? SR@C:@  ^:R \000Cs R00 S00 Cr@ T \A Cr@T2  0a0Cs R"  -0C\0S* ^ 02W"!0C0 0C S*CS*80P @-  t//'jgA-@((PQ U?-QQpW  :WP`0 n?`S AJA0:S@0 R  0 `-'P&g@ &g/0s@- ` 0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&!PP@P0PA- 0S`Pp 㾄0P  T @R p00T0p0S ,p @P0=0j PPg'ghs@-@`P0l C300PЍp@00S S@@{PP 0 @D \00'@-  Bg@ &)h0 Rr @-/Tj%@-00qB$(nB kB hBL@ &h]i4j.kG-p pz0@d \P(p`0, wZ/00 `kO-lM/_Po^@P$ `P0`p/刏0/ P0@  p?p/@p`?\?A0sQ S  R8?8/00 CRJ?zP< N>P ,c>@>0 -R.Q0 00 0|> t>t. l>h>d> >0SPp2 <>  = 0S > 0.0 .0-0==P====-000X=00j=@ T لPPlV| -1 ! ` S=<-<@0=,=<PE < -<-<,<,<,<,x<,<{T< d<{P䈟 aP rPPPuZ Po{PZh\P 0S  v(P 4 P  @`707C0C0'  7p B;K&06 70 0i W0d0?oT0cQD00CS0R gEH7zRB00 㘃@D@86P (- 6@  |6@ 5@ 5  6 @ 5%  5@@  t6@  5L p5LpT5ş0xC0d RK aR eBq P Q ,% %00%000 00K_4ZPJX l5J S \5I N 4I IHG< 00 50L0m4PH8  /?#7L#3$?3#| 3G ꔃ4 T ,tNG  d4F <3T< P00F t4Pc2~P^E 3E  2D _3 42Cx2PBC\2P;B 2B  L2A  @3A  03` p2`21 11"1+S0020" R002XR0 B+S002 C4 琡0 0S1P" @*SS@p0Zm P000Sa00ZeJ 1pP0000 S D0 D'p''t'lP&Tj%@ &'& -lY'l8f%-''-'(l,''dj%.l''hj%$''0''g''oj%j%j%j%~j%tj%'\j%4'i%mnn! 8'('! `j%m' '&m-meY'Hm_m'mmm.''' G 0.i%'n'0P  /'d0P/X00@- HP808P:  ʠF'<'Nn'p}n@ &A-`  @?\, \PA *\.  Q R( [\SPQU !\@@]^.!Lo \0QS8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U 4'p@-@@0/SN00N P`pPQP`Q*C0CT3A"0L0AS*pSpp@-1MPMeP/P 0P0SۍЍp.S@T|`l @ @'!pTppp ۽p ppq'qO-cM M 33 "@p_3]PW1`0 00S  g  0 ΛPa` 0+QRV~ @  +  T* R`DV;  ccݍ Ѝ&R* \R%1@\ 0@R R P BR00CR 0 0@&P\P   (  BP+T- R* ` V$p0!#MS@ 0 8TS =8TS p  0i 0 x,@T *0S0T00  R S 0 }' Rqq@ &qlqC-`PMM RP  \SP R P0S ۍЍ}@P p lP ;ߌ0 D  0S+\S R PPNP gS PS" SS GS  0 x0pS sS0S080 R @@@qqqr@r'A-PP 0SpF`pK}@PL P40  R p`@@ @erzr'L0@-@0T  S  G0@'rx@ &T1 RP p@-ZDT 4\p \Q Q 0T*  F04⨻P  0S/  00p0S/  0`0q @0/S000 0D0 R /'$'4'rr0A-j40@TPp 00S0o`0 00/S @Tt0T0oP0 SD jp04'$'8'2A-0@SP' 0`.S0.S0S/S XWP 0 Q CR S.R  S.R0S/S E 10S510S ;P:4 CSR ! Q0S 0/S0S.00 `  00C00S080 `V">_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@L& " A-Q@pW :{'// Qp@-(0PS$ l` @P|t 0000X0~ `9V0  o@pp{p'{{O-P`p Ѝ# :0J84YqW V#/00p0K0CSp3g P|0<00D38 r  d ( |!qp  }? $004000JH1P t@0 B(1<<P l<0 㓍 H K06S0S 3 CRT  gSy K CRZ0 40r;;000(4 9 xS!04(4:(404(49(408400C /Q000R($4S::  $ R(4D @>0&"*4*0p000 02S($0 *4($040)($84  R KS 0 0 40r;;00 04KS<  4i, $ |''" |8|p'{||O-j4@SM- S 0cS:l& SR0d0C0 PR/R0R  E?o2R0S%  0CS@ ; 00$0$0<0 0 0ݍЍp$-"  p'p@-@ PP hp@@x}@-0P-S0S' 埐@P#Gs 0N0p S0 `CP`P40T Ѝ@p!Ļ}}&-@-0@P   幥Ѝ@Ѝ/'p@-@ATp@0 R P-OP ` `P`p'-P@- 00|0 x0x 0 0 h@0S XO00L0L < ,y$ O Ѝ@ Ѝ/''''@ &'pp@-xd@Pl忾hPP X帾P p宿e000S  p}]'Ļ0'} -P7@- 000@ 0 0 0 P0S xCO00l0l h彏 X"T sD 8屏0 -O Ѝ0@Ѝ/''''&'p@ &ǀ@-? 囏s}@ &0@-MM@P@Mߍ00/SHPtHP 8p T3p  0RP 0RP ꨀ}s- 000/'@- X0}@ &A-q`@ MT ppIhAPD00CS0>N@ Pp< @Y@DOoB0S@ Ѝ0P: S rP 0S p X M 0 R@@p 0App T0 @00CS040 '#~@ &1~Sh~&O-PQAM'A-ppP`000u4@40 0{4000@0CS000SA''p@-P`@T PV 0@p@@-PG-a;0PU:"0S 2TP0@ T =PP0 T"TU00CS00 S 0 00{Pp'Pl%#Tl%C-3cPr 0 2@0 @@000 DA @2 2 00pD3P 0@ Ѝ/RR R@ &@Ÿ B&Q @0=S0  "?R9R:B!P |R( ~RT ^R d!000P; 00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 L&') '8't'}H" o" 0@- p'0s@-0P`0oW0`0@S P 0R@P@   P@0S00S 0ST P000 R  Ѝpp''Dk%) @-|AL ^ XP sr^( \EA1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !u" O-p`p됰P0@%Ss0V0&S T6g! c0 00 @ P@P@p',@-0@!4Mp JT` 0 P@4Ѝ0@P S7WP@V P @0 FAP@$ P@F IUp'p@-@P0)Spp'O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  ! ,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H ܈ T! z! 0  @@P! 0  @PVb'T@@`@P, @ ⨈  p'c:HO-p`M8P젟찟n!@ j0 X@ 0DS'00S^^* PU @ 0 e 0DS00SY Ѝ` pUU p'" C-锐p`  0BS0p0@SP ! 0 00P@@@P@ Ѝp'G-`dP0@S! p0 00PP@p'@-@MP91`PL0P  IR NRpp PpEp@@0PS@ $F1Ѝp'uPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0@P 0,zP@}1S8k%@k%''?@P/- 0/SSS00'0@-@PMMMߍ00/S \Cp >p  0RP 0RP-p@-`\<0@P +0D0p@h0g00"SP Vpkz'p@-T` RpH0@Q 8 PP 0pp@'j%G-pWR 0S)P TiB000000000CS020S @T  |R pR\Ts/:i424b0000@/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 h00/ lR `R00CS0<10S 00CS00W00 pR0S/S0@D00r0@P  R*0000t/S0S |P 0/0CS0 pG0S 00CS000F0@C0@@0@'''8k%'@k%۽-A-`p0@00婂P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0N''Dk%'xG-2My6r0@T@S@P 0.S00.S000/SS?X20PpTePZ( ,`V d@PP ]` Z.` E0EhKeh@0-S0Sp1@T@dRP.vPw x0S t#~.pP  `P i 0: S W  f.pPXyP pW C0S ?I.pPЍDk%ր'ـ% '@-$0Q @ PQ @'1p@-L@50P000S LTPP 0Ses@@iM 101M00CS00 oM 0 QM0pmi<='\'pTl%G-@P@\R` V101 <P (P  `I\TQp @p0T \0DsQjSh0 @0 p0BP!0 BS@p@00CS00  M 0@0 @T0S 00CS00 L 0 0SZ00CS00 L 0 L 1 0h1@ @ @ @ @ @pp\@@Tl%0" A-@ ` PR 0R 0S SLp0S0 R  M0S  MU  LTLh xL Td@00CS00 pL 0 AQL0S @T H1 WB@MG8KG1F0S  1$ Iߍ0A 0 000 0z@P00CS0 0@ 0 00x0 =00CS0 0S GlGD0FX00S i@00S c'Dk%'Pl%'H''''0 @-`o$M 0 00^0SP4P @W'000p\ pl%P 00S )y=9y0 p000CS0(00S  ['$ЍDk%''C-@?mM000@H0?_00?0,@0P@ '@P0o0`p00dp@Td0hP@0po 0lP@T 00/P0l $00`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0B7S 'x0R8 P>0S900SD 4.000\0,0(00 0p(0&p  =&0S(7S%00S 0 0S= 8  x=, yp@ P 0 t= xK8 `= <=, R , [,( $P000==0S @U0 0P%@I.P  @J$ 0 $ R 0T@ =l.)ğ00P:3 0 0S '|0R0#C,#0 0 3 ChI00S0p(N0"0C0000OH8 2  2  2 \ 2 (Ÿ00 0t2 T0ST"00CS0 (2 R   02D0S#mߍ910S {0D!SS}1 08 L0H@Hs10@0@0S h1 @0S1 L1$ @0S  01@0s`1 R#0SH1   B  @0S @0S7S@< 0 00S *9p@,0S0  <,0Sh@ 0DS'ſA- 1@PM`Rk0 1000  ;p !XZU p@@ Q X@T@Q@@ 08AS 00CS00 )@ 0* 00CS00 @ 0 ЍQ g@@U P000$K 00CS0T00S DM@K@80# ' 8AHTl%J''TZ^p@-P@@Pp 0S%SpsP @D/ p@-P8@Pp 0RbPp@. - @0@ R0S P P\ 0j%'G-`P@唀0吐00|Up00CS0h00SGD0S0 S 0S00`YPPp''j%'A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @#P`0W:SP0R@''j%}A-`P倀000|Vp00CS0T00SA0Sp00'KX@T`'''0A-pPS R+d`a@T"W p000]0 @0 0 X00CS0H00S `vP `@'''p@-P$@Pp0P0@. @-L@000@00 X00CS000S@a'''O-PM/`@ 0P @@@k (sP00š0 0S 0S 000V#   P@ 0P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @v 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp "P pP t"P\ R X R T(HrP0 * R; R 60@@DK P R  TP@0000S R    BR 9D R5 Q3 P'|j%'Pl%%'}@k%'O-`Pp$M `x%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQ>=01 =@$Ѝb@DT@ P  p R   U 01W VYXU' [1 00al 0aS v00@0S v P S>W 00SY0 0 S0 P 0< S0 XꟄ# ''# Tl%'j%# p@-`P0000S S@H000 00 00000CS0p00Spp@j''0@-x@M0 0000\0P>00qH 00CS0$00S Ѝ0@IЍ0'Dk%'@-yP 0SHO-`pP@Md$P0cS @@ <GpP vPP VP@ : R8cS" .U<rP3VpPA U=< P4 <@<T 00S pB00CS00 "< 0 0@ T  Ѝ 0RPU D_<\<@X pP`1000p  `F`l1VD0 /=PX81 0 000SZU0W?<oPU3<U~*W)<UU Ut Ud;}'SՄ1p& [ixTl%Fy'# )]΅O- M$B$RpJ0@0`V% VV:V  V /V   BR <` F R  Y Ѝx! R  \a[  0000S(@@Pn,LP@ @5T ~p [ /R0/S0KW 0 BR r R  BR    BR   { @k%|'# 'Dk%+ A-(A0S 0PS0 0aqP0S00 P000T00CS00S P 0SRh`hp0P RP000T000CS00S [|''''s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `Q@0S00S=STL00 <0 R0AD1U0 S 0S4k%''A-dp`0PS@  R R00PH @|'O-s@0MR02$` 00 042嘀0C v40`SX00 @ 000CS0E0S00CS0 20S HmP*0X00*PmP S P 10S10 DC}0@0CS0d10S |Ѝ60SHH Z- Z`* V + 0S9@0  NP B?`F@ 0S 0 0 0CS0s0 S00C0~0000C0 0`F0CS0V0S@@|''@k%'''+ 1O-0Sp0 Ѝ@1匱 100 Z :[X0S @ PxqQ@P P `X% V800V `@`@% T* R" RPP rP mP@PeP P` DoPQ` @P@|'''l%|A-XPX@X`P0p00R0p0CS00S |'''p@-PS@RN0@ p|'@-QpP0` 0S*00E@P`LPP `R@ Ѝ `0P@@0`SP0S0O-0R0@ 0[1 GR00#S00 B00S0p0 G0 B0yT,Ѝp U   p  R00SPhTs) '|'@k%Dk%ޅ'' $ + /$ '4O-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  P AA  `3A P W 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   x ( R 0BQRQ B  W `   BR  vR v 0ASq Q AQ~@P /  Q @S&~  ;@@ Y  7@P  #  ~R =Q0S 00    @'l%|'@k%''4$ G-Pp`d1dAf0`S 0X00P0H1 0081 (pppV0 S000`0`0CS0!0 p0开@p   0    0  R 000p 0p Dk%|'@k%'8k%'' @-0n@l@k%O-TAT`0$M`FA8q00CS0@0 PP 0@I0O P0 0C0S0AP 20P0 R"Y 0CN0PEPE0000C0$Ѝ0000|'@k%''O-R`p@P[ 0 0000PPX P X  3 0 E0CP00S H D/1(04  @D,0,0D '|''@k%Xl%x% V_O-Pr0BS,`@( ؂  R [ 0 0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y0@FT: 0iPD BU# 2Q0 TQPR D2@Y@FT: IP7 DU0#0 2S 0TS0Q00R D2@ 0PY 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C00000000|''@k%C-PpM@`᠐B 0嘀00000p000CS00 p0@ @XЍ00p|'@k%'8k%A-Pp@.A00CS00 5. 0 ` V.00CS00 . 0 ` V:`e.00CS00 . 0`Tl%&@-y@-y00S/ Rj%T0QH0 0Scq o/P0//'j%0    B /'A-P夀0@000p `R$ #0 `0T @ `  0 0C  S000SAS'j%''0A-P` @0p0W0 P 0X S S0 000 00 0h0 $P   00T LG00CS0 00SAj%'(l%''A-bB0 pWcr 0S 4-2-0S@0PP0/T`P2b000r0S\00CS00  0S 0X0#S >` P  6`Pg- 0 0p0P0 R R A   BR 0E0CS0000`0\00S =-H0,`8 Qj%'00V00CS000S 0S @pWZ00萠~@ 0 Z@Ꙃ! P00 R @'''Dk%A-`!@S1p@!P JO%Tp1@WV2 `1N0SN U 0S0Pm[PZV 1S?p>B O#L#060S$ E#B#?#VB%?%U 0S iPPY\YP LLrWT 0 V''|''Dk%j%҆08 N R S  0S  P 3Dk%O-`R0pMxB0 pP P Ѝ0S0S "0@0000 0#P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 嚲"S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S \  @Vz   B/oZ"  "0''''Dk%Pl%' G-pPK@P EP1N0St `L>@@ZT @pA t`㜠@0S0S 0S0S/`@Y 0 X 000 9Dk%j%j'A-@s PPT0P 0S jlP@ pP@ ZP@jt06 R0S@@PX` p9 0 P m1'HDk%Tl%O-`s$M. PPY30oV &P *P xnU pUV \`H3 R ZP$Ѝ3P\ ZpP&0?oQ20S P VP  Q6ZP@@=Y pW  pP 02 QY QvVP  K(160SI\  \@ /o"/ S [ &(\@ Q 0p0_#Pv@T R *  W R #0PS  R 0 S0C 0 [ 0 R00YXcX `Z^ R[00V'R'Vl5'Dk%p@-PW@\a000 R 0S 81<p @!0S 0 00E1  S j00P0  Dt@ RQ Dt@@@Q00R00S '0S~00CS0000S p'j%'5rO'<1p@-Q00@S($P`0SP00CS00 # 0 $0<p ?.g!#PlP000V0@0CS0800S )p'HTl%j%Z''@-m @ 00S'@-@ b @Sp@-`@0 0 p 0Qp\ PU#00p'xO- 0HRHr@@@0T$ T 0"  @D@ Ѝ0CS0 )0!@T0 R 0S\S 0S`0S S S=S8 " CK 'SI 0 ` D V@!  `0`F V`0#`V "0! V 0  }00 S$0!"0^ 0  :0 1 }S`V0 0 \0$0< "04  '>$ Wj%A-@`s嬃MTL 0SIPU0  xS0S d#"?= 0 BRS8@$#":P(&@`@P@PUV0S 0S pPdTЍP@8P 0S P wPlPxcPT tid`0DPU@ B0 =0 SPF Cy P9 P6 P3 P0 P- P*{xv'G$ F`ʉωԉl׉Wۉ(#߉02Ӝ n ĉljNp@-@PTpU0;U 0S 1@p@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 p'Dk%A-0P@`Tp R@ 0N@T P 0S@@TW\0HU 000000V0@ 'Dk%j%A-P`psp P@ 0 Ap=0 G-PP- 0M00S _ou1q R100 0000 S @PЍ~0SE  0 Q S/R iCU P" Q 000S*  RA ``0S:SV@!00S!@: @00CS00 ~ 0 ( p0SP0 @00'H' '\'% '.8k%'<Pl%@k%C-@M$Tpp``P A0S 60SP 0}P# 0^0v P1U00S^0SP60S .0S } P P PЍP ^Y8 0 P0C?o20'Dk%Pl%Xl%(l%K'0S/p@-P000S@PU00CS000S TpP@T` `@V0`0T0@0v0S V00T00p@''Dk%p@-l@0P00RP 00CS0 Sp@00S ]'҆'p@-P@IPUY$p@-7Pi듊@-8Pb듊p@-P@p9pA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S 8k%''P @-(2R 00C00/᠊8k%00  0 00   /8k%'p@-@tPt`0000S0 000D0 00CS0p,00Spp@008'8k%''@-D@ 00040 00CS000S@'''G-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SGh E  P0)` 0`00''8k%'T 000@0A00CS0/00S/9'8k%'p@-$@P0 0C0C0p8k%'p@-(P(`@0@D00C0p8k%'( A00C 00 0C0/8k%'-A-@P(MHp@`DpPVP u hT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@80 P =p꫊ O-D4o@@k1000S P 10 A0 SFp!倁V@0  0 0C08000,0 000CS010S)0@0 0 0 0 02 P B1 0R }z0u`@0PEPUZJߍ2 00CS0`eR _{00(l%'@k%'j%'8k%'0O-ԏԯM0ϟ  Q"/_@/0 0202280 `00t/20S@0S5@@" 2 pW `R00S  .00CS0.0R00S 0@0C0D0000Pm210SxPTP"PF 2P%p}<k8.U0@#S00 p6 p00@ S0p@ A0@S7p@a0@SaWp@ [\ P0000P-'P 0@Y^00@S Uyp[U'P8Nppp= 0 0CS00C0~000p@A00@S0p@7wp W00C0t00j/`0@?o? @2;R0Sp |\P!\Ppp ?PpYW6;G S4 5:0 Sc@0 W0C *0?0'3?pp00s0 S0 0C0~00@00C0p%W!*00'60'3?00q Q~  B  ?pAp00s0 S0@0C0~0@0•3W5*00'90'6?00q Q~  B  A0'3?00q Q~A• ?p Bp 00s0 S0@0C0~0@000C0w300'<0'9?00q Q~  B  A0'6?00q Q~A•  B 0'3?00 r R~   B  W?p00'?0'0!Qp R00C0@R 1 00C0v001`@G0"0 !0`0C0w001 0`0C0v0(PA(P0@0C0y00 0"!0C"  0 0H$2  `!!J00pS 21 냐`00C0@50y0C0  00S 00C002  B )Pp' "1@0Cs0S10`0C0x0000C0p0 f00S210"QQ 21Sy0pW 0 l0 n00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP3>P0 |P!000P$@D 0Ѝ@PF0 ,  w0P, 0&P00 0<P_ >P &P 00p0pv0((0 @ -P 0(0  p 00@ 0F(l%j%, @k%'8k%* >% ''\% 7NfŐx't'L&) '& @k%- + 0{P B@ 80 } pL0 {Y0D 00 B #PD}P@ 0 0005 }P' @ 0 y BR '  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q y BR K[ 0 @ Rp 0 B p74Pr ᆬPp@< [ B + R:p%pp02!R1S 0GS2@0 Ww 00W2 ` !k !z@Ryr@pYp K/o}Y" R 0#p0CS0p pT@'P023Qw0  00"0 `!2$0  0G-`Ȁ0@T@@0PU @ 0S 0 0  B/o"Y`0p 0S 0 x 0 0 0(l%, @-.P0@-2aM0$ 0 10< 010@0吺1|0000_OPI@1| 1Q @@00:} dt 0S $Q. 4QG Q ,4  8000<  ,000 0 0 d0 0 0 S00aߍ0  p0 `0 KH0 D0 H00SOS,0㑿 0'Dk%'(l%, @k%'Sѐ G-Up0 00 P0    x5P $00pO@*%rP 0 R 03`      0@0S 0 00< P0, RP 000@ 00 00 R, RP3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 ^00^`0 Sl岵P X0 R   L000`0S0 R Ӻ0/0P 0 R000< 0  P 0@S P 000z F`@`!0P00`e P0.    00PU# T 0S #0@P0@00S0P0S0S 000@Ѝ$00pp(l%% m,l%Dk%A-Q@`pQ` @ 0p P0 0W@ 0q R$@@`FR ( X% R"p0 `4 P /呩`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0(l%j% A-P@0 P. 000 `P tpn@`i`@@P 0`0 U000 VPPe``0SU QP(l%Dk%0p@-@|PP 0 @gP P 000 00Sp }pp(l%C !P/0S/80 P/0S Q/0'A-@Pp`00p` P@-` r=PF0@ pT@ʼn PP " < Ѝ E@P}<TQNK H  =뙃4l% 0P/'RQA-pP`% =VU``P``V@ K<`0 R@=P P% 06<0 4l%1A-`P@xpT@Q00C0U U "@P0 P <'p@-X@X`0P0000"00CS0p00Spp@y'''p@-`H0@TpV@PU P;P'|0p@- PR QP@ ;0 bP `;$ dp4l%Mp@-@pP0 S00C T  D;P 0S;,03O@dA T @0@p@4l%gfff'p@-`P0 Sڜ S  x;@P t0 R@U w;p躷0S 0 S `;@ꬷ0S 'x'4l%p@-P @0Pp @  0p'@0@-@ P  R !@B;0' 0 P/ R/'C-(P0 U0M0000p#0C@S0 ` ;@P @2@Y#  幻V : :2 R@Ud2T /o"Rm :h`0"0:@P2V0S' `:p@! 7<pP:P 1 ܻ 0: S:00``!l`P!` `V'oPP # 0N V U0S00! 0 "1P @Զg# 0:00CS000S Ѝ@rT  0PE# 8X'& '}4l%Dk%  f'Rp@-@`PP Vp # x5:pPV ~*:pV t# 0P0 pȒpG-` PppW@p  P0̐P0S TX  >G:  |40@ l.V  T(T 0S @V@ PTl%S& $p@-P  @9p R  9p d0 Rp  9p 9p 9pT'4l% p@-@PpD0 0RPPp03/9Pp'O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P )" >9PsPP jT 890SX gPS!9P0000 Sj\1 0R  9pPW0C S P!  N 8PP A0S( 8PP0 RPU 80 300CS0p00S bT0 00`Y0S'x'll%Tl%Pl%t'\'_4l%'O-P0@ph#hcMdP P00L#'p-0U40@D[T$Sg 0Tq00 0`V_ '@`00S0SီP0SU0SRp0sS vS #UP0+S -S P ` \ 8Q (` R:  幯P     vPT 0 @0SA0MЍUF ` p0      "TR Z00W  常r   %5S 7pA  07p0X0 N J 0D -P&-at'x'5f& Tl%ݓA-PQT 00CSPDq10SK R@ 0r`0CS00 `01L00<S R 0qL0S 0CS>S RSxh R 00CS0N0 - & ڽp@-@Ჳ0TP R R R& 1S# 0 坳PpR!Q QT " "D0600S0T0S 00S0'''Dk%@-@P @@PHP&@-@P 3IP0  ; 'SQp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `HA-@|P|p0`00 T 0000CS0H00SAM0S 00S l@'''L P0  /Q Q0 S//'@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: ዲp3 0S$ UEo,p' W`RUoH0@D>T000 0 00  6TPx0N R T  DR 60SЍQ Q2 1 @$ ''Dk%'$PO-@`PzP ptP oP0@DpSppTPA TbP@DP:P5@<XP, (4  J@P@sSa0S 000{T $00CS030S C@@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 @`1 R T` F00CS0400S eISTl%`'''Xbm2 Pl%vxG-PPE o@0p` TUG0S 00S 0@0@000CS0 00S %@''''p@-H@P02`S@20CSp_V02p'40T0P?o20S 0S//'C-p@`1010r!Q0@S10C1 ЍqXPU X2P·P 0S ''?0!!R/P/'p@-8P\2Sp@\Bp'0-MM01`"R !R X"R   1 1d"1!d2S ,CPl1, ,CP L!0,00C@P$1, h@T0dP5`0P, U @T 0S PF00CS0 ! G4ᚯ00 0$0(00D>S 00 353"!031'''' 0@-`"dy'p@-L@.'PὟ0PPp0C/U00p' p@-T@TP0 0P0 )0 0000CS0p00Spp@'?FGVU\]dks&95{zAH1 =-4=@-? "sB@ &@-,0, Q 0 0 "c'jŸ۟@ &s@-@`A000 #S@P60S  0L00S 0 LЍpHI0S/#Sp@-@,P$p0P 00p'j5@-PRP@ p`p 0R" Ѝ0"S0SO 00SS  00@OL&@-TqPL0 p@Ϙ0"SKЍ蛠'@-TVPL0 sp@0"SKЍʠ'ڠp@-d@P0S 0S 0SS 88U40  S $Pp'Gp@-Px@Q deKᦓP L0   P    pp@ @7 '0@-@PPM 0SLyD00Ѝ000 0?P0 0 .'FO-Pp`PPM 0S<T;$ , P 0S ߍP/0 S 0S 5@s?0P P@ P@0ST WpU: 0S  H 09/PV/` 0 'U\r@-ٗ0S S S8 4 ЍS$ ЍpH֡0/7@-lP$ R\J;@ Hi$0S p (J J Ѝ0'ߢ'0p@-@P 0Sp@0PS 0P0֫00Spd@-YP<@< <`0S00  : gn@ &C-P`PM 0S{00(p/p0 BP" /Q0`@ p0@2P T0p (PH$0@@ 00Ѝ .''|A-@0P LX  @R<2<1H#4O ( ,K , G 0 C 8 ? 4 ; #4R! 2 !4S + !4S |$ !4S ` !4S D h!P0S l( L!T0S T  pHP8W ~ЍAW0S. a`v` 0 0 0US !S|  !3 \0US83  0U#,   0tpPꙣ&7 :ģˣң٣S BB&.6E((G-Qt ,@Q`P0QH 4QP4zPQ t80S,00 80<0S#<0P:cPP:\P1 QB"7R`8X0apSwp R lB <0RT;P)0< S42P0S9`(7Q %(0Q @P0S0 BS `a 0p h0S  0 S* 0Q*da 8ZO^o'5ݥƤm4O-;$M p*qbP 0$S  ߍS P@0T[D@lP 00뉔 40ਛR YS< "$0f0Qjf/ y,2S,!R !PP0,21S 1P P, @oP  0 ppsdT1P8 P, @P0 0008?s0 R* 0S 0pT P 0S 0 pF1Sv   @1S  f/ 01P P%D ''ZVEW}}QWEVS=l'&A-P@`+Pp %R 0R000005S P vL $0f0Q ,G(| '']'p@-0@sP  P$p@`H0@-0S ,'@-P & 'O-@:PMzM 00@ lP5 ` P0P0 ʨ0SP :TP`( @00峨0S``(`儏P+V0` "(`嬩 Y 9 0 ,07P,0S d ],02P P HHἂ$SP,1 MPFV 0SZ 0 0,0P2 2@r`(l(P,00 xP ,00,0`V 0S,00b8P,00  @8, 1\ , TP0 ,0S  S;ǑB0;\V0`(P (/P (tl׎ P0(`0,0P,0S ++RP0 0 *廎 P 0(`0,0|P,0T0 媎 P 0(`0,0kP,0`0 噎 P 0(`0,0ZP,0X0 D刎 P 0(`0,0IP,0\0 wP rP 0 (`0,02P,0d0 `P  (`850,0 P,07 lN P (`40,0P,07 {,= P (`40,0P,07| j, P (`l40,0P,07k Y P 0(`0,0P,0x0Z Hl  P 0(`0,0P,0|0I 7 `aFy0S0S  [0Y: Y0  0J 0L뼃(0bSTB  C(`H 2[9 0S(I # \3  0 R M 0( 03000"0,0 0 0 ,0rP L@, 2![{0ȰÕN 0 0, 0  (0 bS P  (0,S Dp@pݍЍ R $0  QP$0 nP$00!CK "{Ȱ׋ 0R ( [ K{0S|1[ 0b0 R  (0 bS Px  (0,S 哌 (0Sg b'dFXAH: <Чڧ'['I'+?M^n|Ψ ': L&*Y.6 s@-`0PU V  P77@P hЍp`PD!ᡐ 000@ݦV: 6$00S @-鄑00l%p@-@5S4 0PSP p@-Pp0S 5S 1S FD|Pp5S T \Pp< HPp^(( Pp-D''HedArdAЩ7@-1AP(000(;_5 S* 5S( P0S 0S005S | Plh0hPL5S Ѝ0< <mP0WEV'fdmdl%W'gd@-@P f/@' 0 Ll%'md0S/!  -3@-PT P 0S S@@ ᢌP@Ѝ0@ Ѝ/&@-0@QF/@`+ ( @l%z@-t@t0MQh  `P0cS CS SS 4ɥsS00ۍ0(y0@-MM@` PP 00YSP ,姥ۍЍ0oPٰ 0 ;l'&@-@M0 wP @ۍ @-@ 0@ l'&l'@-YMM@p p\ YލЍ<0< S <fEP10YS<0<0rdA6b@-*0gj zgzz'z'&z'z{zgzzz { Ѝ5y7@-P0@ 0$S0S/ |0S' TQBQC0AQ Q4G00S 8@0 D 000! S0 c0As Rx:t8 Ѝ0zg{{' Q { zg{{{ { { @(< @-X@X0MQL  DP 0nS00 yS ۍ(QP `00CS`0p S00 P0S X0X /X!&C-` 0pP04@P :BpGT@ U @ 0@Y}HSPFɉp 0l QU V ЈPU PP pXz Ѝ&QTZ&G-PMM`pJ$0@S0#!)p- P P P%0 x p P  `D(8p P  OP  FXdP08`D( p P  NP $0(0`D, tp P  @NP D0,0`D0 (p P  NP 000`D8 p P  NP 080`D4 p P  DNP @040`D< @qpu P  xNP 0<0`D$\p` P  cNP 04`D$GpK P  HNNP t04@`D$T1p5 P  8NP ${04`DP p P  #NP f0P0`DT P  PNP S0T0ۍЍ!l'&< 3DoYܲ9^}dz*Jj˴ &O-M@ Mp PS `V90S0`S+,P`P8aEX```0E8ġ0 0St 00A"S0#1` Xp P& A<⊈P,s"   oP0S  3/ PAP+ ࠰Rx%4.A dp P" 4S@4`S=+4`P82a0C" 20< S :A"[Ax5|%.A 0p^ P0 x5< A B0qpAtA 0Q<0PA@xZ0x5< 0RA| iP 0 000S P0`㬀(V R s S 0 0p)0`PX%ލ ЍDWl%< b< yHWl'&(o - BR0 R 7p@-P@ R1! 00 割X0 僲X0 l}X0 Xw ( D|, 8x0 ,t8 p4 l< h$d$`$\$XP TT PA0p 2Q0S*X`?\PQ |>Vl-p@}ꮷ= ˷ط߷ 2HWjsĸeO-pᔀ 2MSR R@`aJ 8QG ,[D 00   Y0@d"  8 ,  ߆ D`@0 "   0 !R11`  0S 0Cs R`!S]0   1 0 0208QK  ` <0P+8嘆Q* 8 0A0 @2<0P+8~Q *ЍOt0 0 020 020to hj< X ЍOЍ= %= S*{=NasA-@Pp(DH<9`8SA| 0`ꎹ0/p/p@-0  R( R((,,004488<<DDPPT@TXPl XRl@PUl @ 0T0p  Q CQCQ}C'@-@t40Pt08f/aWEV0H @-P \PY Q@pWEV'80@-0@S K08f/9d' 0\ P0//@-D0 <]44N0@ R. 0Pع@ &m( p@-@PM`P @p  ( ՇV V dPЍp (sH( %p ,; 0(}d(@%~d(0@-PM @ sP 8;4P 0 p0 ;Ѝ0ͻ({dЀſA-`0@Pp!倁(M00l!p0SP@LAH p  ,;eP qP p` $0Q 00S**@P ;QVW V 0v R|0|0  0S(Ѝ00* *D  `@-P&(|d ?,rFSYj@-P$M 4@P p p p>;0P  80P 0P0P  p@p@ 0x7%@d1p@ U@@Pptcidyararbmngnts ?H0D S/ 3C5C$1 4! 8<0/(0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@( 213/P/(A-PT0p(,`D@@,0T@@DA?@?@@(?0@-0@0 (20,20x~0P!P30(> 0R//G-`0(,Bp  P[~ E@PP[ W ,20CS(20CS GL 0(!p@-@`42SM%^ ;  E 82<"@4  0(2,"- Ѝp@( & <"82E@d `ԙ,"(20@ X"\4Ѝp@ ( n%%.W~!5s@-P`l  0SЍp00S@[0"S1Ds@-$M.@}00  0 0 X S@ &A-`P 0p @Tʬ7 /, s0d  ? yqp  RЍAL`0S`@D@, Ѝ n%Xn(A-0ppP@`ph!14P S H d" R S R 0 mU(p@-4@P0S9( Ⴢ0B1p(O-PTM0$ (00#,0x0@00030匠s4<000S8 (2,3`lH(0,8 0}80$08 ?}$0 0}$0  00 }$4 ܂d"P ]6$040 " 店 ` RL` $R0 S l200#1-R0" 0L]L`P@,r00P00S :sP  4sP  .sP$ 偗0L00 S> |0g2< p nE%KUL1G?C$\"00|P@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h` " @$PTЍ P @( n%(&idL&|7:>\-7@-@n< 00CS0 ;P Pp pp50 P00CS08;0 Y@o Ѝ0@Ѝ/&iO-a0 pb5Pp/B$@0eO 0/xqp Ѝ  R ЍOt`0S 0 xqp `BPE,K 0S  n%(p@-|@P2S 0h`n/(23!1!1U &"U 80U p@@PC @ր@Tp( ((G-b@p,'PP 4 P UvW剔LI J$ g,઀U0U 1U01 ;I0s@s \ X"pG' '"q!'|"",q!#34#sO8#@<#$(,0#$1!#(#0)S UZ0)S N0#R00S  C00 0 ]0X 6  0SE1!P|0(MH> AVSe n%*@,(0PUrA-l4RUP@P@mЍp(0PPPB1P@$a$aTS  ЍA 11 0p 11!1<0  11 ?01!1<0d  1P 1@?0ЍA(DS2BQbvO--t@P'G >((n%A-Pp`]@:7000 0@@@A-@pT` rrPPq0@ @@UC-MM T4 P@T@D sP$@ sP4 00(03P (T(0 ,0 @` PF 0#0LP4S@@(4@p4T@0Fp0lt`P5PP0 l!41P30 < 00S#  U8 p@8 PA , R ,< 00\S< 0 0@܍Ѝ0GSʇpP0S -S@`a=)hP00@@4P$, R ,A0 ~JP Js8800  0 R00S% 6<10\A400C0L!L*C_*w0S0Sw0S0S C 0S C CC $SP4#pj h PSe a P >(S50JM]c,n%Rſ0/?(0/?(0/?(-@-  = P@ &G-P`pw@0S   0S X| /U TY0S 0S@w@ s?(pǀ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  D@-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPlN$PPPU rGPP$0@P?( $?(0JhH@-40P  0 00$Ѝ  $C(0@-4S 3/ ?(@-v0 @(  0$vv@ F ?(@-v@V v vuv@@-p PL`@@0 7/P0 S Ѝ V00C(O- MM0p6@  @  @ 0p$000 (0#P;  c@ ܍Ѝ 03/0P0.   P @$0PS (0S W0SU S U hhK000,0;p` $0 p o40@0Y0C @4 `V*6` 0  0 0!0`4  ` `  Y!  00 0 ,0pP,0 0S `pP½# pW `Vxp@P ZD Wp` Y0坽0S5 #z @ 0 %00Q00R00S  000 x 0 S   Z0% 000 0@@0 00R0C0q V B G SE SB `V` 0S 0S^"@U 000  |1P 4<qP PPPPPPL0Is0PP@1>@<heP0PU+ `|1VS HP@ |a``L0Is``@ !RP P/PP0 1A@`PPTG K/\hPP05P 9 5P0h00h04U U0@IP0U* 0RPd01S\0!8P %4QP0%8%\0 P0PEd0U03:\8s0P P|!d1 [b" :0 0|12P0P0(00`P.P$18 ,80PI!2S0P0 S0 ( U$00 `$0W00$000 ,@ D00S< 0,40^<04 QP80,R$0 PI C( ]F D(HeZ-7۽}d9G- p@r W pP\aPP Pp3 $ P(&K/ngD08QP0Q:" 0PS00  Q pxPh`P 80"8 R 00 05 !$uC(SwpCp@-@5%SQ%5 %SPQ %UUQQp  0 0Q0 Q 0C(A-lP`5p@ @ 0% Ņ~@ŕ\C(O-POMpP) b5S5@ ET# |T 5d 50 ! S!$5"R$%P0S88 $cP @TEOߍdP  RR @`0d B2" 0] JQP d gd0P Eh0K/0h0 uf0 @!,q(r0d  01f  j _f  [f,10,1#40L0sK?000/1001001#40>000310 00 000L0 CE](%,5QP Hd d0PtC(I(~@-@ P 0 5C(0/I(0/I(0/I(-@-   ]@ &G-P`p>g@0S  0S X| U TY0S c0Sf@ 'I(pǀ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rdp@P=0D@rOP0: S0RP00 0I PP P81: S P% S  R  rZ PPlPPPU rPP$0@PI( I(0JhH@-$0P  0 00$Ѝ  M(0@-4S 3/ qI(@-Ef0 @( 0$e9f@oF I(@-3f@Fee)f@O-`M$MpP`!P"NX1 b: S/b0P  rR f00pPP nW UP 0C P"VYR V  VaPN P P W\1` 0`PIX1: S<V2"5rPpUPV9 qPW002`` 0!$ $KPPt P5e0SS3]`P S R S0pP`-(pP ``!\1 S R U7Pk`x%|!0#PaY $7 Pp{pU`( FuPP XND% ܍$ЍJF F F@0/p/p@-P@!F $( $(0XRX0X00\00`0ddhhllppttpp@-@ P EEEDDE@@EHHELLPPTTXX\~`\`0p Qp` cP0@ S p@-0@"!Rc0p@-@PEEEEpA-0@PJ04S->C{E->C?XjE9>:>CeE?n:>CF`E 0? AC>WE}C>GREmFNEEnFJEE~GFEX J.X V  $$((,S>,&E}S>G!EmFEHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqxD1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,MI2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 PP ,00S 60 0ppXP( 00S/LCdN(00S/p/dN(O-M 봰 (2 2@0p00 2P0  ` `X00#03W0SH100 0 0 0CW<:0SX%|10SI p10SET@Z000@S0@0   b@ ``0@S.T0  0'W (,0P000R0S 00SЍT /T 00C0CV@Td00S X00S0S@ FP$0  CXP(dN(N(0P(N(DP(M(|2O-0@4p 0 X0PQ8"R000U00S.  @`P'0SP Ѝ5 p $X001P``` 0 00,000(00S/(0, ( ,R00Z P000 `0` R0( ,0 04Q  0R000V00S  P0P`(0`F0S, (00/PS0P, Xb5 P PpX00 0M(0P(DlN(G-@PDZ@ppT@@@@   0@S(t@p  lx` X i5pD FT 0 0 0$ 0p XP(\P(dN(A-P` p@H5p0S B50S !SRp75p0S 150S!SRP@P@A-P`p@ `$P`P00@AO-HMQ M %80< @0|2 0B_ `P?Y VP( ,P8r 04P`P (0, 0S/(0, ۍ Ѝ10S%  qV 03?00?s0S0?0P 0 0" R?"R0`00m88Q"  P`k E0 00@?003/*  0 0 00 ?0k00@ 0E 0|` *Eh050S G&0 0"X0P(M(8P(XP(dN(\P(8N(`N(@-P@p`AMM(h% 0 P@ W4U0:t0 R0*d F%@f1P F40  P,, 4%AލЍYHN(qt77@-0 Ѝ0@-\M`Pp~X @ 0^0H0T0 `'!D0DP RpRLtP \Ѝ TP(O-P"M0 M:x6 PP#P3XP3X0P#Up` "ݍ ЍA(@X ]0p06,08"9<Q08u@5ppL0p 0SXsL ]0 0S z] r000 Sr:0 02P0 @S$00; ` 9: \08%@5  L0 0S^ \DP#H20SN <s0 0 0 0(@00$? 'n60 P 0 xBU 01S0 A 00(!( (h h(| S  C 0 }/P000 R0T 1A| PyvPs8 1 t0 1( @( d Pah;@9hN(TP(0P(M(8n%zM(lN(O-M`@ ) P0G: 0 0@40P$? 0 52ܒ2Q{ p q Br -s)Q0< ,42匢# 0JR hLpQ 04  0R  @PЍ( 0C1 r0 4 Y: |10S<000D0`1 `0 0B1 010S 10S 0H` `$1100}10S pt1pp1000 ppQM(dN(8n%0P(XP(hn%TP(O-P`FM M X ~[@j: 0 \5 RXXTa"0pSg 450S00  000S Fލ Ѝq00 1000D0w븤 H0T00X0404QpQ\t`  3H"0S* L0 00 0 HP! #0000S q0  0 0.P 3 (.P0!0K 0 . @pp  0 0S b  P0 !-P Рᰒ L000X0 H w p 0`0X0x2  0Gt0  m000Bf00S$ 2jp0 0G 0Gh [ Y0# 00C 4 S 0040_pPY!px1p 0p @ 0@0  k.000C0 0 S P/<# P 1R 0 0/."<0 P 0>`0 C c00P0S   0 -0xP 0= T0  0=400,00S ЍN(M(M(TP(TP(O-0#M PQ P* HPX 0k:0 `\5 00  =@/<#| @2R 0 0/."<0p @x 0=`0 C c00d0@Lr CC cA30B$ 0Q,040(0PßP0 8+10S 1 PBU809 ̱P XEʼ0 83,80<01t!0<S0<0<0Ѝ U: p P\E9EE9`f9U  9 R T` R< ܰ(/? 0XTFV p P Q RF 0Y:P`0 FR QM(M(THP(@P(TP(DP(N(\P(G-1P 0p` <   00@ 0S 0 0 80PS `P` 8UH0ZP000PS R`4SQ$,$ (,`(PlP8M(M(TP(@-@8P 080M(G-Pܡ0S1p00 B?Q PAP` 0@`8:@Pp1 ?t<X10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ&dy0SAP 1@0  XPP00Ϡ^P0d000 ATP(M(|P(P(xP(tP(P(BP0p@- P?@<800P 0 !SRp|P(P(ap@-X`0SpL0LP0@1CA0S000pP(tP(P( 00 /P(O-H0MSP` M 003/ ލ Ѝ40 pPࣟ00 ]+0H00@0 t0 ¿ S 0V  0;0X0t3!0S$ d30S0S l0 +"0  1!8!Z0 02* 2R20t0S=W=000 Qo ! ZP"$0$3+P,"0 " Rz{! {  0! t R1*01 Q5 1000S1H  B/oQ" RK d!B0\  ]+BHS@(P:!P R, P k 10S0Q 10S 03/     0P  0p`V X M(P R. Pt!P!0  S D  oP   . 80< 0 @80< `P0P 0 #0 S00@ ` R Q\Q\L@Q(\M(v4P(,N(ON(lN(M(00S/p/dN(00S/0/dN( 00S/.dN(O-M,M@("[:[$0: S`@[ ` pp)P" \)P 0 00 0؍,Ѝ0 ()P  X)P h0S !  JP \0S, WL : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S :0S6  0 19* 0S R P0@4`PƟ Z9U)Q900w0 B?R1pQP @90S  0@ w!8 0 0P080S, KM[  Z8Ppx U0 00(p UtxPP0X Z~P h(0000pP㾴P7@Pq"$0 S7Q770S3  V0;R0.*h0S+ 7('d0 ( #0 =P |870S !`` g @ (8260S 0h0!60(%R/V+:<V3#\Q RqP   kPpQ^q U  #p# PE"`:U Pp[h RXPp%Q_'qP tPE! p 10S0A` 0  Z? 0S 1000S X50S 0S 0:  pwt ?hE$ 0S 1000S 40S 0S  Y 10S0ꊡ  0000 04 $0 S0 0  00 0!jp$000$0 #600S40S 04 PP @ p td3 0R00 0pRLtRPXd00H00XSS/ 0S D30S= \P !2P p2 @0 \00&&`2 0@S0:000S08P40d/<0Q5#fP8`

hd=\ `P 0H0Z0`0AEPp`1PU 0\I85 @5D0LT 0 b32 RPlhTP(O(xO(O(P($N(O(lN(@Q(M(M(M(dN(jN(\P(HP(dP($N(qK(N(,P(PP(N(*]O-@5pş|M,0S%40A7`HDLT T0AX  I5 $00Pxd p 0@, R< T5@|Ѝ0/1b&\% R  P  0`P_Q0`  0oS /  !.0`?00 1> (@ P00~4ğ %1#\ Q  0  D ?0 H#3 0R< S< `3ē0S0x0@S 1d0, tD 0 ll`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  H0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0< ᔱ0P0  )H000Y 0;* 0 0VT0Q@`@ T ^@@`R0@3T5P`1:@P`$ 0@0坳 00  P ~00VT 1PS 売P   0R`* A GP(M(T4P(HaN(N(h!hz D10 S& P[#R0 š!ȡ0S  0R ؀P 1 000p0P``0P00C0ZCP<f TP(\P(N(XP(-lN(۽dN(Tb-s:M(apF -M(M(O-WM M'0ASz0 t pKP `7 0oL H>P 07 00@  6)P 60S 60vV6 N3X C0`06`00夦1࠶00V0:6 R0S2@`aVnPVt=Wލ Ѝ4 P P   eC 0S 7 @ F  L 0 00@(0S Sxp%??DH(P* 4 2  B. !  ]Y5( 0S W 00]/E 0S Y(0A?0HS(G 4(^Y,p=Cp$h4 R@ )xX( I1H 0,  R1 #( Q! R000000X!"!"'Xdx"hp40]/ , R1 #(Q R {{ x@ 0D00Y *( R ,B2"X(,` Q@D aV!X"XdxhQ@D a`V { {@0 (0S $ Q P00r|0SU! $`|\ ld10![00C0DP0 200000C0!" p"0S@0 0 0C0 00@zF ":lN(T89XP(tP(P(y\z(P(M(8P(k@ &0P(M(mTP(dN(M(۽00S/0/dN(O-̢̒0`1CMa@Tߍ0S Pdp@FDAG@D0 ddpv00@00C0 00 R2PU 20S 200S0R0S P0:000RP p 1Q R>P@h1 R 00"P <1q00C$ P X PA0P00 0`0L00 pRpfRTtaX`[`00!Pa l0 0N 0000tP(P((P(1@ &M(M(M(,P(M(SFTP(zxGO-쳟p3张P M`@?< \P  ? 儣 ? A0 nA\#\3 0RT ST D0 S 3 S (@ 00000CSFTYr P 80R000303L32   ?;` a2! Q,S Q0lB*'\2<20S P  P 1 PЍS   dPh?00 1>!  R1Z 10SI0T!  0 S<1`0 ? _;00 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 PpAM(P(TP(@P(dN(U 8N(`N(4P(M(N(00S/0/dN(O-plMX 3@x2xx00,0SlЍ0S @d0,P<0 $$P000P㸀@1 0 0D RpT04:I`1 ARpR\tR`Xd00X0\0@SH0 `V r%P $10S  0@P5P 00S  0 0S  Q\ {{00] }0R  000 T  L 0<4묐M((P(@ &pN(TP(F M((N(?KSO-MԏM@PI0!n0 r?0t0?0SX0S $5St0SVhPWX0S $Yk S Y R,d$?pW\ 0P%T਀X僀 H\=?00!` 1B`01$dQd0ڠP0C00h01`l0R!B1d0d.0CW P0=SLq QT00H ($0S 0 |$5> *&d>X>0S  0 0ꬭS0 $5B111`R B- 100 S L $~0S% , 0帐- 00$%BR0ө`S<B11@%L0 }PP  F PP 0S  <PԌ *堐%<<0S =0 02d0pA?P0;3A?`0 =<0T0.L0s> ;0WHQ RX0>F@ @0]>8 84<ϠQ bh{ S X(,0 Sa?^ @PC l;0S @ A>+@B@  C P;"  @0尠 \ 0 000 :J*-%::0S 20 0؍ߍ0<00

 T9R0堈z Sz <90S 0(S 3S 0S S0 0D80S 8 0S8`0`t800D0Y d88/˃2#\%R  `  0 ?d h pB2 `b7"<6+?H "D H D 08T<\TR\\0D7T `V=S(  H"T VpB$r,00C S=S|mq~S  e +1#\Q  0h ?200S 60S tnP%5k0Lfh $d60S 0&\Q\u0D05P5D 0SP555/˃2#\%R  `  0 ?d h pB2 `b7"<6:@8p !>! "$5S88(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0<0 $ST0< T<$2!S\0P z<V=SL5s35 `!~ ?X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0 3!΍0h0H0DlE ,#0AS0 000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX ুX姁0 8PPK,2!~00<0S. d70! ST0T00! !0P SX00ԀYdD8p@80 0 :87000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S00\04 bM(P(N(M(wTP(N(U q\P(4P((P(&@ &T@P(NN(N(DP(P(nP(8 PP(F M(8N(M(`N(dN(`P(8lN(M(P(Pp$5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0P3 L!T0 R H  2 00000 D0FP1  "q1*"110S 0 020S QL xP 0< ST0T STTjP hFLPt2 L !0< ST0T STT!c0" 020S}0 S\0P S\<P BFP 0P S\0 S\0!T;0`# 02 ppS $S00S0`" S\0?0 0 S 0\00001D0p` 0Rp/d0W S`0?00 S`0?0001D0pR8 0 S 0\000S8D0;!H H Xp㵟Y8 0 S0\000S8D0 ;!H H XG-P`@T(,p W @A-A0 5 P0#R%(r`! 10" q0SR 10a0  a* t1h10S z0 00SP03Q0S4 CP@ 5*< 5 000S U0 0{@xTPUAt0Up Pd0 0S L P<0 0S M(M(n%.8N(`N(dN(FlN(d0/\Q(0/\Q(0/\Q(-@-  F Y@ &G-P`p:@0S  0S X|  8U TY0S 0SI:@ |\Q(pǀ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  M@-@M Mq` @#PxPݍ Ѝ\!r⹽p@P=0D@rO P0: S0RP00 0PP P81: S P% S  R  rPPlWPPPU rPPP$0@P\Q( lQ(0JhH@-0P  0 00$Ѝ  lU(0@-4S 3/ ƾ\Q(@-90 @( 0$#99@F \Q(@-9@99~9@0/P/00@-0@S @ M(p1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT8 |N(dN(8P(S>h p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//TP(O-t4MP U `D``t``@qvH:4D40ŏ 0 P\dp LЍ ?B10 P~ P\IP0S 30S|30S ph3h#0S` \#ST P H0S <80bS s*X0S @"\5S 2 2\5" 0C?o"20Rh [ŚT24 ᕁ(Ud $2 ?0:010S?, A!(Ÿ0#\ P  0B ? 0Sg0S 0Qh 0S |!\5St1\5P l10S(` XA( L!0 0@! 0 * 0S _0 0 00 Q+L0Ph PE @X* 0R A\N(G hP(8N(HP(@P(M(N(|N( dN(UM(8 PP(TTP(lP(P(M(`N(N(N(LP(6 O-8MM 0|*08Pp啻P6, 80S 0:P6 h0: S PLcPލЍ08H0(hSO 0)00S 00 7 7 8   d` _8 Y8 S[V``Z`P`H7V@ U1P 6Q ƹP  όL8P0 0噾86 R>0 0p 0<&0&0P\7p0p 60pw>0 P0p$2S# *1P *0P *.nVXZ hY 4[ 0SW?관X V. 04  E0 <0\:P$ V( Q3C ?/xPPe 2S|3%8 S20#"20$#20PA 2S@4$040404`02P$V20A\2@02 /2C`{0 `Fb/ 0| .H  ?`0PTT#0`P\`Q=S/0P 5` ( 2RV0 S4S c 5*< 53 30S d0 0`20S 0uP3 0 S` V 10S0d"S`` 0Hz2= C ,0"00 00t 2oAp'06# @r00S10S10S0=S0S pCq000? ` 0L%000P%X30,:3a *Q& l10S W0 0LP(tN( xN( zN(hQ(3 C 0N(M(P(\ ҆U dP(hP(     1 X  T ?  ]  z ,   T  M(  C >  _  $ E   N(M(&OxN(`P(  i  6 S XP(\P(TP(N(8N(`N(dN('P(M(L@P( N(4P(pN(P(N(|P(tP(xP(P(P(lN(HP(DP(=S$0S)  0`<<00P%X30*0 00S O0 00S5 0 >0S sP@a 5*N> 0:#: 5d1o p10S &0 000S$OP0a0*{1O 10S 0 00<cQ/dxP 0Tb<0*[d2/ p20S `0 0r0S0L%r0L%r0H00q" P 000cH00STDPc*),3830S .0T# 0 00L40q"  400cL00SPc*330S 0# 0 0t4 R.0E q\ `PVR d0SPl4d*440S Y0$ 0 0$d0Q,%R0%45 S R! p0040SPHu*X5rd50S )0% 0 00u(0S xQ$ W0S< x 0(%0Sv4Pu*q 6E60S v04& 0 08%<5HSR$ ) H00850<SN^Pv*C660S H0& 0 0v@%D5LSR$  L00@50DS%/Ppw*770S 0' 0 0 7 70Sx(w0S0Sp0L5sl0Sd `d(000 80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*880S G0) 0 0d PWt P1RQڨ0QUڜ l 0 0S Pi*9]90S 0) 0 00S0 3 F0S0QQ'` :0 0S| rPdj*Wt:+:0S \0* 0 0 F0S F0S  F0S-(Q\KQK H R0P;0T  E~0 ppV aF!` . R  ` F0S72 zF0Sb]<Q| rF0S lF0S fF0SH  8%L < @%DL<0,5S0SO p t,l000h<0,5<0(5H000/85L0<%0/@5D%4*<<0S L0, 0 0=0S (=0S(4M*D=wP=0S .0dmh ,= P: P5= 0S= @ờPL Z p Q/@TW.  @?00@1>0A@O@@ᙝP.P\7  //,@᧙|>P* ^ P;0.00 0 S 1 >5> > 写>`候VP?``X ? 00@DT@8 H4L0d Lc B b"30x@`P Y( 0S  i8 H4L0d @ B b"30760S  Nt6p00_`\PP6@ 46P( O0& 500060S 1S *P 5 5 @Q U @ 0}pP @@  04 8 +\5P @50S D@@P 0 0  pp*0  0 0 4 8 P  &0S_aP`0 4?s0 S x0ScpPPd0 4?s0S 4D0Sf?Pg 04?s0W:PP/PQ ȓ0Sd$Pe000 4000 Py ds|0ScT Pd0 0 0iD^D0S 00 0 0 00  ID0S 0 0 000  05D0S 0  0 000 w0  0@D0S ppw0p#40  a0  0pqD0S 0@00N0  0 \1 T1Q1Q,+ 0S x)pA 5<00.X!00P!0L!0#00#p RV !0Bs00P P0Sᩗ0@ᣗPT0 `SV0dN(M(tlN(P(M(xN( N(hP(P(HP(LBAL%M(Dy] M(0P(-nP(pP(N(lP(Nz00S q: S *C   S D00S @-4孶 * R  S//dN(M(x1p@-0`S d`4)@ OT D10S810S(儶 1p10ST00S sp@mz00CS0'pP U 00CS0 PPYU NU YU0 P0  0 0 SM(N(DP(M(N(&&&p@-PD0@0`S  09Pp㫳M(O-01 (1$100 ᝚P 1 叚P 0P  PP/Ppp(| @ yPT`00 XT ᾗV ẗp WP @@ 00pP(P(M(P(P(Q(O-@1$M`Hp /2#$`D  P 0 <w  +(奵P U ] 0 PP$Ѝ? 00  ?  彔 P 0 0 0?QR0 0#Ϡ?d&0  8f0P ^hP(dP(IO-M0P8 0`ĐpP/2#V u[ 0 Ѝ 0|x7@[ ЍO ?  ZP _ ? 0@phP(0N(WC-P`U@ (1H U P0 PP0 0T2`p܀*0 L@D0T@S   8 H4Lđ0Ϭd @ B t b"31 ~0S   0P00`0@T ЍhP(S8N(M(dN(DP( 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍM(W(DP(HP(@-0P@T@TNd pL `l0p `̠V W @ 0 0 0P0@0@00 ЍQ(M(p@-`P@XMX  }* `P @+XЍp 0@-Q0 H0@S $\00S P@008M0P00@G M(Hp@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍTM(E@P(dN(0 \P/Q/ 0   Lq,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S U0P 0T`dSTSCPs=PUU00Q A P 0S ??@<#P`"hR0"00S8 lr003Pb0S* xG0S* 0R0E>0*X4c 2p610S g0 00S>\P10S > 1TQ `1*6X1` H10S :0 0H10S <> (1P 0*0`00S 0t 000S d0P` 0奱L 0ϬG̬\P(lN(DP(HP(8N(LP(N(M(M(hP(TP(`N(dN(P(P(Q(P(P(LN(PP(N(M(W((O-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\ 2 \P 0 `2 0T ? w0 ',",2 0Ri Si r0S 3S /0w? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*!0`00S `$ ` `Ѝ 0_S  $  B$ $ R$  B  M( N(4P(TP(P(@P(dN(U N(8N(`N(A-Pph0``ATR @P<U0S @ &1p0AlP(H<0 0 1S01/ 0S00/lP(`0 5 /H0P 3S P 3S P///M(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 N(W(pP(Q/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐpG I I 0` R P/! 0p P  C1p  1p @-DG TG d0` xR o/ 10#/C!000P/@-HG `G d0` |R  /  /C! C!/! !/@-LG pG d0` |R  /  /C! C!/! !/@-gPG }G dG-@$Q uql#`h RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr iPP d P`T `}cP P9  ,.p &0S  ߍ<0H(00,0 00004008004004 04$0D0(0P -W[  pU lp* `\}` 8 $ 8c ,c  c c c 0,0c0 c `i$ ᦪp 0`?`a8SڜPb 0  0**0P0 c 0* d@edAzd@kA-@Mp`;@@ Gp@ݍ P@00@T 0 2 "0 O-`M$MpP`OP"NX1 b: S/.!0P  rR 9%00pPP W #UP 0C P"VKR V  VB PN  P P W\1` 0`PIX1: S<V2"rPpUPV9 ៨PW002`` 0!$ $yPPt P5$0Sၨ3]`P S R S^pP`-VpP ``!\1 S R UPk`x%|!0#PaY $ePp婩pU`( F⣩PP XND% ܍$Ѝ1JF F F@00S/p/dN(00S/0/dN(G-pP1P0@0ʟ 0  X 3#15`05 à121 R0` Ppp0a0!R00S w9% 0%# 0! RXh000R T00!ǁ8P,0M(nP(X(^M( lP(tlN( 00S/dN(O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S v?F00 0 P0 T0SpP8P&pM(^FM(R/G-P `$ 0pN@V` 0G@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1!  `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 ЍI J ?0A-1àQ`P x0x xx0Sp@@ P$` pFQL @ @PQ0࠱@J } ?p@-@P40S:a80Sd0d dd0C800S   0!00PP80Sp0 ]!J , ?s2 ,0S/`0@-0@  L3,0,0080S 0  X0@ X(s5J ?,0@-S ,0, ,,F@TP ݈@ڈHJ  ?O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00PЦ U0#03?Z[[UVR@D `0P$005Q (崦O0$0 ᏈD 0XR @P"!L0<p(08p$0 0H(0 0 `,0`4  0 4$HP $0 xPH40  (00 0@Ps,05S00SUSP3S` 4$`UQ 0 00`F<0408p@004`<`3 00HpL`<0@ RS80 0 ,H0PpT`f@P ,Pd3Qk 0Q 0CQ @0O@ $@$\Ѝp0,03(0?D00T P %HpL`VW 2`0, S24040S@p( D0 0 P  X Z ,2,",Z (H [`j400 0Q 80080p0?(00T` 0RZ@p (0 0 P 80S010!00C800S   0{` 0SP THpPL`P@ lT@Pn P0T`@V !ZP` T@!00P0V0$0D X(LBAWZJ ?"`kJ NBAWt~J ]J  G-0,0S0 P@Ԅ`40S*Ѝ00qW!  0W@P   k@PpJ F ?A-`0@c,0Sh0h hUPpnQ H0< D 0P@DT@J ?a C-`0(Pc,0S0 *p@BQ |0l x@PEU  0P !  0 P P ЍJ q ?s X0sC-Ђ0@ P@` 0 00 0᭤P 0OЍp X(DP(X0sC-Ђ0@ P@` 0 00 0ᒤP 0Ѝp X(HP(p@-0PQ @`0P Rp   T0`! o@P 8|4P/N(X(> X(s@-,@P,0S ?00X(@-,P ,\  E ЍX(p@-P@h0h 0 SX0d0R 3?p@006.4 Q#3SRppTP(dN(M(27@-0S S+,Ô2 R0 ELh `Q tp^PC㇡aQ* Q( H<QP 4 ,B 5*< 50d30a3-210S Ḷ20 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S ჶ0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*|0p00S V0 0@S Ѝ04M( X(M(8N(`N(dN(X(4L @- #olZ O-0p M"##0@` 0$0L4@ 0S $前pP t0S@P8# 00" qp$4$BtUhUaU bU P5#i0E S0 0,p$C @* P80 ( 0 @0S ,00(# `!B P P0V yЍVp FpqP` he pbP `P0V:P0V$ SP XpE0[0b$$0 !/ P  @P 0 S 0 00$ 0S Z(0,  $ 8}p C @0 S 0 00$ 0S Z(0,  $ 8Yps  @0   p 0 Pc 0 ! P4lZ eP&J J rAG-p@P` 0P V  00 000G 00`000O-0 mM$0P@@`004080 0bW, AW- LW% 8ƃ4ăcW iW0p X$+ppH40S ,mߍ8 40H4: S@ @0(008`,0000400P  P 0 0! ATp 'p 0Q= 0! $∡匱@P 0V$0 0/S ỿ<<Y`J`0"<.P0<0$`P qP< ly |w <)V@Hѝp n/B  n?< n/ F0Pp < !$$0 @#0P!S! 0`pSpV|p 0S `0S  R  R 0S( m0$H 8HP`pF0$pM 0$ pF dp>  T 0S ,( PQ S RPQK P&zd@6z)bO-P-@p`,M$P "p($0S0$020S'$p P V 00 0P0Ne 0 fP AP PP `JpP$_p,Ѝ`P 0`P ,z ?o  00 00 ` p 0P"qp p Up` $P&*@K UUgG-@pPT!\p`:D10S:  p o09 6X $$ fp+ P%W00S $$ Vp YPPU `fV rV GTP$$  :p$VP&(K  @- uolZ A-@P`pP 4\ XGT  @@A 0妵U  A6 A_p@ &Y@- R0Ѝp`P@ ^P0 0S 0SS0S $$1# BS0S iP - (P/00#s01"$#@K O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PG-(`$p@$~PP 0㘤I$0 0 Q P gPЍ 哙PC-p$4P 啓R%p@ 0` Q P Ѝ XP404-@-0  Ѝ Ѝ/-@-00@R 0 Ѝ@ Ѝ/-@-P 4(7 c Ѝ Ѝ/pO-MP`@PЍ Pp P 4S  0HT0Pp$Q$VP 0S 4S $X 4P S $ SpH0!!`000 0 0  @ 0P 000 00 0 0 P p1 T`喘&P$(0,p 0p$S4pS 0 Q p" | L0 `0p"SPb 00P0S*6Z~"&HO-$M@pPTPP ? 2R 4S  0-$Ѝ0 mQ Q0   RSRQ"  "S 0000 00 P 0P~4S 0S(  00 000 P0 0P0 <00SS P   0 0`S4S 0$R V P0 RS 0  000P` H0H 0000 0   H>pJ*U  9 C U G-P`8MpB}@Py@@ C>dtC$$0840; ȷp+!p I~pp H4$t: S! W B.L p< $4S0 (d,T0.B. ؘp (d,T0"W|(d,T04$t0dT 0"  (d,T  00$0  P0p 044S   0  06p 0P Pp|  0Ppu P P 0" RpP5:Ѝ Y0p["  ! d@  d@   !;!W!@-@P 4B BRP Ap 8Z4  dЍ@ϖЍd@!!@-@Pp P P.4PS 4 !"D"A- @P0TP p` X`p0 p^"t"$$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /G-`P@Pp 0kP<  P㬐`0`00 00嶛PU:Ѝ 1 00X0L@0`奛P1 00, 圛PU"S"@ &"agC$$0A@- P@- x`R@dxЍpP P 4k R 0 -"""O-Pp_o!R0`@tMR(0S00S "R0 U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 40[ P#  7/p ' 7/p 40 P m0 $8  P P  P "A-@pP`P 5/p 4 5/p 4  #C-(00pS4P Ѝ$d@ 0    0d` 0 0  0 `WP #+#d#O- 0 0pP*|@ᄐT  ` P Z @Z` 0  |@-@O #p@-P@`0 坙@Tp@O #O-Pp؀ $M`@0吰     Q  t0 p ` X0 T p` 04S0 { w$Ѝ@O S߲#O-PQ@04p 00` ЍP P0S* E `P0       04 p p#p p04pp  ###$0s@-SX`@ P)W0 ?o2R0S  Ѝp-"@- iR sR aR p` V~3$p@-P@P (`Pp _p-\$p@-@T 40`PPWpp-w$iR@-- 0 aR bR LR( CsR% tR@P 0P0S`-00p`(j0 $-$p@-@ M\P`ᦫP0 0͵0,Q0S K ЍpS$ǀG-Q@PM Q  ЍA~␀ p$x`P phB~0 00 ` 0PP y$m$ $O-$M@`HP 0`$ЍPP 0 0 0 $0Y!<#P0* Q P0 0?Y S0SXP pY0 P pE04 PU 0pop $ XxP 000 00 ppP {y4   \ $  0V,S( 0 `$4 80+p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0PL 4$$   $ 0$$? p6 %A%\%z%%%%00S 0@-@C^M E$E$$0  0# P#Ѝ0 @tq !"`#XT 80 @P8P&O ' ''.'C'Z'x''''0$ 8O-`DMPp4  1币<0!p 0S& ! R"! DЍLRR a0BSS0 H10S  4F P $j@P  I wux@ vP䰟 8gx T 0 外0@ % T @0  @P@p'O 'P&a-`Ļ6O &w$'A-p`(P@vP0 p!`P @00 0$0@-@P$0S x@xO-20SK@0SD00m@ DP 0SD0SA \^<40$ 400#?qpp, 804<0P$ 0I,0   P bU@UqU PH04 89pPTЍ0$$ `Vh0Y`0X0 0000 WX0 0 0S " [ P$0 0(000qpp 0 QP Р 0Zup , op p  $ sz.P&lZ #$W ...O-C~LM` G@$P0 0H%yp<50S ,sLЍqP sP @0p0$  0mqp PP`0$0G$$_pP0P 00 0XpY0P$0  0 ($0 040IP BP 4 0 ( $ "5 1 $00PR00( ,VU 0Sd% 0哒#80 08 Y :0 U P  0 <0P<0 0(, P00 0 W P (0( S,0,0U000U,  ( 00W  00SWX0W 4ST 4SQ 0S 4 X4 `4\ P 4 "$`0 0S 004 _) $ 0$ R40H LFp 401SD<0S0`01pw0'x4 $r/040s?pp^' 0S/U0P` 0"p  U  0  (Ph 4$$  2/P&8W 6/M//!////lZ ,0Y000u00C-P0 @p`$M!!t Ph!|xp*0S00' P 0SF0SC \^> 0T 00S!Q` $NP$ a@ P P TpT  T  0/$ЍP`LW 0P&XW %p@-P M(@,`6#"X0P0 0͵0,對0S ⪍ fЍpS?1ǀ@-WM M`p@T 09Wލ Ѝ0S@ P劍 0$$ 0$$0 x50 0xP x xg 0t_m0 $8XWTU#D ^H1`1w1'HA}123K31@-1MP@a qPg0 Ѝ@.0 *(` 000 010 0!p|pЍl 80XTP0 0 4P 0  @TR- Q $m0 8 00  ppՌ1S1SxЍ@Ȍ2\Q\ TЍ@轌lW 11<1111112112P12SP `00CS`0p S00 P0S X0X /X΍&A-PMM`" 剌" 兌@2r@pTݍЍ  s o `Vk De   `0"0"BBP F0S91!BB;B86 $ !P0#vP%$ !0#T sm0 $80,#  bs@B 0B   H0S 0CS 080T X aaa11b?p'2 -2F2?2M2HAS2X(~222S$2*31kA-0p @P`M!L @@" vp420SPf+ lP`P a@ P uP xP pЍ@@ p@@@0S00} P 0S0S \^ 0 Q  X TY0p`pV E A Q p8   `4(uW X3P&b3W p'2 -2F2?23mp@-HM@P`4 > 01 0S 1D0!Uup T  P 00S  0 <iR TR LR a0BST 3plRs0BLbHЍpT plZ 33P&<W %0 Q /0@-$M` 0 0@P!!0 0=00<00;0 0:00(0壉pp0 0,0P,0 0H '# :p DЍpW0`VpW O4C-`PPA B@T$YPP8 aP* @P& i%0$0CS0 VP P4 ?P o_P0Sa VpP x=Pa`a Ht>P  4n>P  h>P  b>P  \>P  V>P  P>P  J>P  D>P  >>P  8>P  l2>P Y_P  DP ZPY r?P @] j?P phV P >PU 6a"80x9x >P P R2".=P  pV_Pk ?VP  p $ 02#W: ,.?P +VPP ` [1! | =P 0!xlx ^>P !0xpx S>P "x'>P "d!>P #P>P m0$ 80S `P p +>P@$0T lh00Ѝ`-7P&Z 7Z 78]6Z 048ے 88%8X48=8H8U8c8r88<8888Z 8888Z pY&O--@`pZM* qp t:0S dЍO0FS iS@:PC>`C$P X 5ЍPP X00 9PW0P 0 VP0$$JPh `X UPP HUP (0JP$`0 ;P $0 S Q4 O=P 4PP0P 4 P h 0`P00V0000\0S 00 0(0UP 8U0P,0 s^PP `pP `$fPP04 =P 4`P `P @ L;Pv H F;Pp @0 SD00H0 RL0( 0Lsp 0qp(  R$4 "#qp 0p` ᣀ$4P p$$嘀$4PpW *UpP( x&UP$ Xh&XUP ]0P$0 $d`pP$d`$&? p 0qps p :Pt :p o  :P   :P  :P  t :P   :P  @ :P q( :P   :P q/  :P r :P 01S [r/s?`&(Ѳ Ѱ  :P s/t :P{$$$4P,^]P _pP  _$$p0 "qpS/ p0 l< ;Pl <pP < ,s< ;P\ <P `:PQ  Z:PK < T:PE (< ;P $ <8 :P5 8 Z* 0>l$ Bp $ P$4 "p#qph$ mY$ 00"\R8008(0 000(0 40P0 `$,p 0$00 P00 T0Xp0$$~qp|$$1$4P0H00`L0p$4&pk#`qpm$$$4Pp `9P&Z -9P-95988V988x989889XlZ pY99::<8U1:04ے 88%848=8H8U8c8r88n:J::::0@-@M P  P 0 0SLp< <# 4Lp$0Ѝ0Z :'i;@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍi@;i!;!i-;@-@   0Ѝ10S/p@-!MPM@P% PA. (01P A!Ax@P 0`0?oS c` 06P ``(+0 0A. 00P0P A ^Av 0 0A. 00Pl0P AX X?A\0P 000ⳝ4ލЍp'Y(h^(S9;B;I;V;d;;s@-6PP 7P 0 '`@TRЍp]P  00SUV  l@Z ;>J0 R !O-M@ Pxp!p"`P"    RP- U RP:RpP {UpxQP tU \s7P 0"h 0R00  p!  Z7Pr 0SohQl @ ~pal EU! R R RZ  0PW l Z XX (s<vW 0j0S, @ h~P@ `~pd HQ L 40R !sm01Sp0S 3/p\ U 8 Xx~p \ [ 5@ `k~p ЍZ :;k0;;ɘ;H<;;<A-pP@P@QPPP\`P xRnQ P QP[[@\T @- 8P Ѝ}A-MP p17@P00p`ЍpP  0 ~p !0  p8;i@-@p @A-P`PpP00QTP@?0TT  FqA-P`PpP003TP@:?06T  FS@-( 6P00 Ѝ䖯p@-8M@ Ps6P 1 ! KPP T0 Q0s0S00SPP  P@ZDp ^  |S< PP`ZV8Ѝp#<d[ ,<m<i@-@BMM  6p 0S 7  /  0(L(@0S700$0/ 0d (>(@0S BލЍ<吀@ 刀@iw<<<0@-MP P@P tSP Vl0l lvS 0 0S ,p循Ѝ0m<<[ ,<i<@-@M  x pЍi@-M @5PC0 xx p  1Q0r R0s04 1p`Ѝ#=d\ *=iis@-`Pp@ @@j5P0 BC@Ph[R P@ LR@OP 4 aЍpn=d \ *=x==;=7@- P@:pT T2L[O P@00 <<0400O@ Ѝ0\ ;==*=;07@- P@p\ \ 0H@.O P40 00O@ Ѝ0)\ ;;;=*=p@-M`OP0P0ЍpxRP@Ux_@Pdԩ0 D(p<é8 P@ PP :aE===i>@-$MpNP00$ЍCR`^@Pp 0 XpL哩P@ P`@ p$㍩a\C">7>iP>@-B ЍSF]>@-000 0  P{p `^@P^| ` @{pl P0 R00bS ~`o|U ~~Pxi i>>>Hs@-@`-PP  0p (o0J|>p@-` MP@ENP Q Ѝp P%    CQ  PN@GXDrBvi 0@-,M@ P3P0  p,Ѝ0 0R0s0S 0 $0 QPP  (NN@XD>d8\ f*=rBp@-P,p@`@@MPH0H HHJQQ P 在`pk=B\ *=x=@-T @3P00Ѝ  p  |[>L\ H@- >@-M T@l3PD0D DDD08 0{ p$[[Ѝ% dZ\ *=i?@-M T@K3PD0D DD#08 0Z p$:[Ѝ df\ *=i%?0-M $00D P  #Ѝi>@-@0GM P$0$ $$M@==o\ *=;00@ P/a CRWC/A CR=C/@- 00@- M@ 0( 0 p ЍiP>@-PM `@@⻐h{G 8 8 d}Ѝ$$= ?SF0?P4 0@pPo%@-p0X( 0`P/ R/Po%0 O-4M@@!2T0(  Dxpď P(0$`!pSp D@T PoS@ڐAP`@ ptpP`[T000 [  y R  P Q R. 0S $P\(P  1/P Vw@0S  xp "SR(0 SL兦\ 2/P W0X(Aɚ;6e>JAO-MMPp  U p`%b  IpP$ 0Y00$0 ⴖ-{ c qxp@Y Vp dxp Q T{ @{ K p$(Q {$_X@T .X00@0 08xP{K @0I 0 ,0@4@!xp 0[0Pd0o 0P 40,@xp<e 44|{Y](H0S !P31m{H0S;I0S8Z`@T 0 3/@: " M0S:00!  l"M0S T>{b@86{Z@03/@t J⥑I0J/wpNI0!S{a`"%J` 1 0 d1 T|p 1 d\!1 Hz`@#%Jo!1 @ t1 x!|1  zP@Th 03/@ 03/ݍЍ\ :AA:BiGB~icBkBXBPo%iCi2CLCdCX(\ rCyBCBi HA CC߲CCCCO-@PpP  p T dI@bIPT!ܤI `P \٤PPU D1O0S (zTT wW P.Z  P' w1P! K0S 0 L0S 0M0S 0 N0SO0`S PPV y >\ C>JX(}&@-,MP@rpP IP`( 6 pv0S h` H/P00< <T0 $F,Ѝ;Fl^(8i(Fe GG@-P@0 P20GG-@^IPP0  `@ Y㔀LpLӗPP  5pp H H@@@[@HG9 f 2RGl^(.s@-@{#I@P00ЍpLPLៗ@P <` 5PX[u Gl^(6s@-@QH@P|0| |iLP[Lv@P T` P/[u( iЍpH9 f RGl^(6A-@"HPP0 v`@8L*LEPPp p< >FJN@豅9 $f RGl^(G@-@ \k.PP0P PPCL 0 S@@00 >00ЍGd-f RGl^(@ &G0@-M@nHPiHP dHPp_HP d0P P P P 4P=p Ѝ0豅HGHGl^(7iG7@-@嬋dx ҋP HxDP P! (x Ѝ0x@HHHA-M`@PK \ppP"ۢ(     tp% (( pl"x <@T h8PWx`2PPPx RU TЍ0 P7X@P㙢 $@tp (xu 0R xl)w w` TpxhQp R%PPx wmIP;ЍAYQ\ 0Q    1 0PwP0 RSŠww$ w0` R P U 0pD` P;g :8i(iH,HX5T (T( R R["00 XP 000 ݭPs0"CQn BQj Qf?5^ XppUPPZ Ჰ  }$P vHpWWH 0  FpA 0STt 1PPX0!F8!100#R0S M0o8^@  0YPpG@T 0CS0 0r xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@Dt@S 0q@0@Dt@ T030Z3H@hWTh l nEP/OU8 @ 0 0 0`0ꖯHh H==A-X Pp@`P00G30P 0 p 0 `P0O-P`$M@ HpcX) P W0  |Pp` 0p0  0p- 9pDP08pN/?Snp `|0 4h AP,00P0:P,00U0,`(0DN/r%ݍЍh^(KiNI @-p IiIp@-d`dP0S s@ Ppm np@@pP@@u%^(O-(pPW` 00S`1 000xSP p<14! @T Z  P 1! P `IR  BY`W    1P Y:WWP P0@DBt@UWAq0@D@W@Dt@@t@@H&L&IIJQp@-@P&00S#0 000xSq`Vppq`   ,?QQ0S p@$$q 00H&k*JxL&p@-P M@ U U( 0P0 Ѝp 0TPTT@ !!0P!!`QPP  @ 0A-p`Pp@ @P(қ  Am:;p@-@P`M   `ЍpG-SMMPPx!x㭛pX!\ `FQpp@El-ClHp@-P M@` QP0 aPp@@I ЍpiM@-< @m!P$0$ $ ЍMdj VK@-< @W!P$0$ $ ЍZMdj VK0@-MP "Mh@PۍЍ0@I P P+3gP@IۍЍ0@Eg0S0S1iSMN@-T @^!P@0@ @@BI xp ZЍMdj AVK N@-T @@!PM<0< <$  Zp<Ѝ dk VKPX4'S$0P0@ 0 0 @PE( 0RtP~ 0S0'U 08 0808 08P080808k(@!!0 P se0 /C BRY      -Bd8$ B2"!0``F ^w E0($800IcCP S@BA`p7 0P0a ;k!0儷@"0(0(0SF j0$ P0B'S$0؍Ѝ 0 00'S   BS>C'0C'S Q:Ɵ"!! CR   ##9C0C<"!% &S&2"!2.B&>C2"" h&2"!/B Q 0*Sy S D&S   2S% Sq 0S R )SI&0C'Sg00 0S 0 t7 t0j0( 0 B( @ R `%Spj||pW>dj `R0 0Lj`D0S4 j0S `p0 j4H3਀XP0  @vjp` pj0S Z40$S.L`j0S pZj{`Uj`pLX#v0,01ap`J zX4!,003c1s0Sq5jZ&0So  j ,J, #j3Hp#P# P# ß P# `jXH<#S0S Lj0S?  0i:Si0S2 is刢 `0V V"    0iV/ i0S Di4i` p X1p 0J,0Y820, `&#Sqv ,, i1H!P! P! P! pihI  ]S !Sxtplhd`\XTPLH <iO`OeO7OiON`LO̴^(nO Y( $8j @j OO^NWNH:Kn SOOOOOOOPOOOfNNPO^PkNxNPKP P&Pk N4PcPNO ONNNNNNNNNNNNNNO0@-M TPp@@mFЍ01 ]+@ihP|P 0 /x%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0.-@-  LL ЍЍ/@-@LYeQ 0S/@-^(-@-  LL ЍЍ/-@-  LL ЍЍ/@-\00S 0  0000 0 KpЍ^(Q@-@cHccp0 e6{po 8QJQp@-pMPP2 P0S 0@P 0 0 00 0XKp DlP@@ ((@,P0P4P8PQR@Rx%RoRR-7@-P0@00 0 S Ѝ0@Ѝ/0C>S00!031 0@-Mt 0J@P \ؑ FLPP @ (@@ 0JP 020Ѝ0x%_(-@-@ ((h    hd`S@ &SRTP@-d0 !X|!T@0 6p0\ (0000//o Do Yo Ph0h@-` |!TD0 6p0\ ,00 00//o Do Yo P-4s00#q^0<\ 0000//o Do Yo P 4qs00#\,s0Q00/00/o Do Yo P-H 0:# ^4 0Q$0000//o Do Yo P-H 09# ^4 0Q$0000//o Do Yo P 4 <# \,4Q00/00/o Do Yo P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00/o Do ^UrUYo @- 0 00dP Ѝ  x%A-Pp`@WЍ P 3MP@ p7@-P@U0  (O}G Ѝ0|UA-0@nS0oSp@ p|P`\RHPG0nS0oS.IPP)IPP'@-.0 f`cU@ &O-M M2Zds 7@-@P @0Lo SϜ 0 G Ѝ0Z@-@"90P@j@-@:0P@茏@-@ W@0S 00S0?  ЍZp@-@P9P (0/SpD!p@@!ZZZ@- Qb)_Z@ &O-p0000@P`ᜐ (,唰00 Kp0@DTq oP0 PuP<֋u9 O4P&--7s Z@-M@A>0 0D@00 l0"]p0S SH OE 00,00 嗋^W[0[F[u[p@-@PᱠP (卋0/Sp p@ ZZZ@-m a^Z@ &O-p0000@P`ᜐ (,唰00 SKp0@DTq oP0 PguP<NXu9 O4P&--78u Z@-M@A>0 0D@00 l0\p;0S SH 4D 00,00 =^[0[F[u[p@-@P)P (0/Sp4 p@0 ZZZ@-  7^@ &[G-`0@P $p堐0 Jp00@DT oP0 dtPPϊt  ]A+G-7P&w Z@-MM0An H 0P0 $@\p 壊]>[p@-@PṟP (啊0/Spp@ZZZ@-u `][@ &O-P@M P0:`TrP"ZJp)@20 R. +x   &  x `!p0 *00)0 &0_ L\pM =uPfPMP- 9P GP p1g@P UP|0 0|00|0|00|00|00pt`x0 tPtPZ,0p0Y00t0V 0;;0x0U<%Z$00|00|000Ѝ-8\P&0 (x 8x Z-MMJNP0 @PG00 |0+[p0 `帉0 0N/0 4 z000 0@(?_\>2Zxy J\7@-@P =0Lo SϜ 0 傉 Ѝ0Z@-@]60P@j@-@70P@茏@-@ =0S 00S0?  VЍZp@-@PtP (P0/Spp@{ZZZ@-8\@-+40 0,0,0(0(0$00 0~_V\\]\ ]@ &W]\7@-P @I=P00S\ 0   Ѝ0]p@-@ PX0 0(p|PP(P\p@m@_(YO-@H p0H ($$e %Hp50pGWQ. 42@FP 40S  4 40S 4 0<007a08:l$0000000Dv0@90;glP04P 0Ic0(80@008 0rPPv0       +  @   ' B 0# R #  # R" , @ ( "  )            q20  |q0$000 Xq0 000 4q0$800 q0<:00 q08:00 q0@900 q0,000 q000000q0909R41r0$000 0 0t0,0w0 0x00007000+ Ⴟ4  Ѝx%x%-]P&y $a(a((a(pz Z a(]]]]]]]x%C-RMMIN@XPpD`p`00EL Hㄑp$xL0Xpx0KS 04  R< pL04I0 Sp? 04n/`  0wHP ,PEP.0D eP! D4\ 4$04 0404040 40$4 0(40,4`044<$@\RݍЍ$F8Za(2Z}  ^<^,^p@-@P!P (0/Sp,p@(ZZZ R R @-/&_0@-@MP`p 0W000 XPPЍ0P0 0 0X0 W0P zs@-`/P0@00 ZWP0 KЍp0/s@-`P@00!  P0d RPPP @@ 0\0Ѝpx`(} C_(002P0/@-@BMP' 41010 0000000 0P X?< 8[QH00BߍBߍ@o꠆} ſG-0@`p8Pp3 pϿ| D0Dv4<40 8p0m,j<0(000pE040p<0< Dp PH00ЍpPPL PG [x`((KHL} c_O-$M@0 8`Pp0 @T .V0<00$Ѝ 03/ Z0p 8P P @0 ` y0P":@ 0 `  p00P LH0@3/pP8 0P 0T@Pp 0 0  [꠆} s_0/A-PMM`p/6- P@1L# 4NuD0@@ 0@00 0@p`ߍPڀ@T ߍA8Hꥆ|`(C-P[ 4M@@0P` :!0P`PQT  00T 0 <P  4<0( 0``00S0 V0S`0000 pp  jPP0QqqD0D00V 0 000OPP4Ѝ 000<0`(__|`(--0M 00H0 @P (妄~ zg /Ѝ__@- ZW`@ &O-P@M$  0O0p 0@"b0"@0@ "eDpx20a0CSy `2g@P 0p00@0p N! 0 ZnPAKn jP 0S Q #  hKz h!! <HP 0S Q   -z ' ⯆p x+лUp x 0[4S08pS @p @Ѝ?B--P&ia} o` ~ Z`````aOava0@-M MC^P80@0 0DP&(00 0Up 嫃 0 AY >Y ;Y(-20P( l4Y,00P , T-Y0L*Yލ Ѝ04#Y(Y?aaaaaaaaa7@-@P 70Lo SϜ 0 ] Ѝ0Z@-@800P@j@-@10P@茏@-@ m70S 00S0?  1ЍZp@-@POP (+0/SpZp@VZZZ0/p/p@-P@ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P ˰ȰŰDD῰@@ṰHHᳰLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@Pၰ~{xpA-0@PJ04S->Ci->C?XX9>:>CS?n:>CFN 0? AC>E}C>G@mF<EnF8E~G4X J.X V  $$((,S>,}S>GmF HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqxᔯ1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,;2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ 0Px 0㡯`0 C cà00d0 PS CQ c ( e( 80pW:,0 0  0 }M4a(He(@e(xe(e(P@P`P @4& P@  4p=L 3Ep@ d3T@  J4SP@ * ?4P (d0S0,5 Sx0<0(5002 0,%S0022Q04OW 0QOOxrx" 0 04 0A XvOA 040A 8mO8 0 4QdO/ 00 Q*[O& 00Q(RO 004 QIO1 @00T(0D%\3SB1\CppWXp\1X0SH*O X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001N @4p0 0R`0 a 2!$ e(e(y%y%mmTe(`e(mnInwnnnXe(8e(o oxe(oTohe(oe(y%aoTde( y%Pe(\e(pe( Q S,QdS18$Q<4R:xN  @0\5?>C0P4p3x00084%$0<0D0t@׊0|00匐XL5P5G   ?ဿ8`F  ?y  ?⸊ pl pG8#PE0 0" 0 p p4%p8$``05<4Rp`YN$11 84<00x 0 08PSPK @R`@0 ? @`0PP* ?#@P`(6#R0:3`@0$- 00[00 1p&"0 ?001>0[`0 c2# S,Z Q Z3?001> !00   BBpQ0㮩Pp0/2#$ 0  ?ᛩWp1Wp#T0p10G 0ⴾE  ?ாPPB@TP` 0P{됈  00B1  B[1 ` U"B !!0 R0CQE0E ?P僾0 pV됈 0 1 B[0`0US  B 110S oM:e @P`x1u G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 0000\60S|0p ?HL404P@0 @6hp9'(IS@00 Qcw(7\5?>C0P奁%4tx0eL70(1#T a2!, A3 31 0  ޽@`0 04 p  0H$4  E$ ( B, @%LV.  R*h (r < ( X ( \ $( ?.@Xt@+@B@A.@B,-8 Hu p\ @40K pވ0 ,p B8d A YZQ !Ĉ0 XZ R ų{A/  <pW $?.t{ 4Ąß Rï80\@$D04 0H4( 0Āp@2 R 5#< 5$23dr0S+z됺 z'z'xz {' 000d0 CSQ c6Rc(+S`P-L @ z犸 z'(Ȋ0 (08[+S,hL 00 SP0\h!P !0@ 1@Ip0 Q0& 0Sb@ RK QP0 뀠@t9 j0JF 00jK0`0S>te(^Fo7pqpxe(pL e(&ht@&pe(qpC1T8e(U ST=qٽ@e(4a(Fqe(y%^q S< 0,0c0P0hA 0,0S7W p开8嘥ȿ+" < Q \%`R 0  ᐡ! #0@(0 0 @DU@4A]420 @R40 `0```0T0(lb 0 5p2 I `0 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R`# R0C00h0$l`0 R#00B1d0 R*%눃U` p 0 0 0 (0 0C 0(0(0 S 3`R` G $%R0 l ! `(4 p  R2dᢼ 4RT T  4P%QXԐ R0 d0 0   0 w  8 @ h`Q 㑆+H0(H (|P+Hv 偆H00S , 0 B2\,^   00/d A! a,3 1 T&0I$01=S,00CU oh010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0 80 C  0C1448000C ST00C@ pd`h48 QT* B!44 T: $5Sl0 @0h pp^:S $%S0! !H`$p$p(0W,x0S ,4 k d,04  0,4 $寿 00`  Vj0S   0帀0 X#` x04y 0X\%Ϡ H R     dp 0G g!<Y 9\%R i0SP Q``ƌ` $$T :`R`  $%R0l ! ` p   R2d :RT T  :P%QXԐ R( d0 0啻 咻  (   8 @  l;R` /  `@$  $ ppS $S00S0@Ral倐HG[P00@߄8p`0x1孺4pYU0IX!@@Al00@0T: @5A$\Q 0@08(0 儺 (0d0O@ 0NN nC 01tp0S<=0S0 000S.H08CpM = R0/5,\%R    0 d0/ @ `.3,00 $ (H0000P0S 0,00C0S0 P>0S dH0S G|>0S 0> G00@P|:x*,EZP>0S`EN C>`>0S303040404 0#pCVW*<2rV.JPToV.GV0S  |?0 PS?\5=S,??^ E?ᨸ0 0S 04  dLĒH 0@ `Ì014 ,$0S0S 04 h d ,04 0C 04C)ݍЍSmfG-`RM@Xr !rPP dqP`T `5P P9  ,Cp Ǿ0S  $ߍ<0H(00,0 00004008004004 04$0D0(0P W[  CpU lCp* `q\` 8 E 8x ,     0,00  `! ^Cp 0`?`a8STcPb 0  0**0P0^  0* d@edAzd@kA-@Mp`;@@ ap@ݍ P@00@AT 0 2 "0 p@-@PP (p0/Sp"p@ZZZR/G-P `$ 0pB@V` 0;@`` V`@&!D( `G-@P 4`S| Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@O-4MX0p0\00``PA0 0,H, 0S P 0 pmS2aSMS ASB0C0`b0CX S0 SSU0@0 0DT dS$ 09R "P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p Po0S00 0 004 00P4Ѝ b*b` Mbnbb@-颼( $EBvq@ & R`$<m g2 WSQ( 0t0C@0庴ප= 0(b S 03S0! ,0婴pᐩ ॴ U0B 40P40  0AS (00 0勴  ,凴pF0L-000 6 0 6p< 0g,(2200U( ,0 00 (p|Pc`$H% $0$d0@d0<`LP>s> 0T0<0<X5S!<0Sc X <PU GPW  a0L VR0400& \p#  @ \ 110B0͝f0F 0&aPeeC0CP!Pp\p : r!P0 `  0Z0C `$00SE 0j 00S0 :#*&(:C14:0 0L:Ѐ70A* 0 (X "*A 6 !0H 0 0 :PpD ZH&ȷ0S\9 R0H0kL  X&' d  yP &X p \ ,p0&s0&$0#0  0vSsw0Cp0 0 V0( " Br  0& 0 `v] BRH(0 x0Sv 0Su00t8t@ pp=PPXP 0R SHq So-P@p0S $h7L R d0 P# 0`Dd&oobe+Eu&0#oH6 C 0 ᓔ)6 60 <묖 6g0CT 00C0CS : B07! S9}0S0  C02#&0P@yP0 0Y 0:YG:xe3006\  0(01 0島 0 J୶T2  060 5&坶ĥ(6YB:(0TSL0S d0 TP U740S pW,@61 210!!!0 SD$ ᓢ"" $0d0$&S: 060& 00.?xG 0W4#0004 @pX0SMVPEPUI 30SA @W ?3PUCL0S \08`0 '| PP1 P# jT36z<6l0H0p0t0x0<08630IPp`$?!j{P |?ph j26M<H0p0t0x0;f&! 02/!"6 QP*dT"< P 0 l0念PPP"w 0v`P!m  P  6!d!PU:< &U":0U:  C!0 :!0 h℀+L0S]_U(!% %F*p0SK:Wc: 0 6Pi(i( si(5si(`sssst~%p~%ti(Zti(x~%QSNt`j(i(tpj(ti(tuqpi(Lu &ht@&cuC1S=qٽAvFquuv@vvv vw|~%A% 8w%Dp(i(i(d  0P0  Wp %p%* 吣  p001p1Pn 0 !IP `U&`06!0U/0 h hL0S `0  `1#'$/%l16=;|pH0lp0t0x0:080&2l0 P 峴C 1`p2& 0hD0Df?o2U+Puܴ&0#ִ6` c2Hf H0 HD:CߍWEG-`RM@Xr hPP dhP`T `P P9  ,:p 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  :pU l:p* `Vh\ ` 8  8J ,|  x t p 0,0j0 f ` 0:p 0`?`a8S&ZPb 0  0**0P0hU  0* d@edAzd@kA-@Mp`;@@ Xp@ݍ P@00@8T 0 2 "0 @-`p۴  @PӴ00S0?0\ 0S 0 gS\F\GL0 \ gL|0 SDKT ЍE%KUJ%FZO%A_0 _w jw@-uH D=<<P4@0 ,P=U@:w@ &w wA-p`P@vP V0 Pg_wG-`RM@Xr gPP d?gP`T `P P9  ,b9p C0S  -ߍ<0H(00,0 00004008004004 04$0D0(0P aW[  89pU l29p* `g\) ` 8  8 ,&  "   0,00  `❲ 8p 0`?`a8SXPb 0  0**0P0T ◞ 0* d@edAzd@kA-@Mp`;@@ {Wp@ݍ P@00@N7T 0 2 "0 0-<\   RS  0 SD& 0 /Dp)Q@-$ Q:z!zO--@MMh VZ0d00h00X00|00p000 0\0$0l0(0t02000040<080H030<00404p 040F00G00H0040P0050<00S00|0000000S00?00H R00S 0t0S ᷬPth%|0p 0l0- SHd0h 04?i/06pD @|0@ Sp00⧨ D_6P o 0D@器/a9]@P#m6pD 7P |Sl0S 1 : S  R 5 @ 8ʭPPP0j VPrPE_oRb p嶭PU p  ậP ᵭP@D 3m`Tbd0h 0 0D0&7d0h QP  < h0@ F0S@040x0 0P0T0@0`0,000$0 T0R0 T0R@00@00S@0S100t S0P00RS00 R0 R0S0P0y /0P00Q,QP `R  V 000PV 0`S`SU [ T @0S T0S2|0p 0/>0 D0p{ 耝p`ST(+qpv @@0S ?W01?0#*@0cph T0S*Zp_ T`[ 0DZK Y  Y* >05ZR[:\0Sd P!0SV@ 匡PXP UU \0 0P U PDIp绬P0 @$  0  , ` $ ( @ , T 0 P < x @ D04 0`aD6pT g 2"_[[P0T`?p[sp0_[|0[Pp0 አPUPQPU\FY" Y Y < Y0S *0S 0S0 000pD0(0 L!0S <0S ( T*,0 Y00S,00,0<0S$ < 0C<0S* v<0#Sp<卫 $0R0$00S S d^H0S H 0CDH000 ,0R0,00 0S0`0 0R0 0R400 40R000X0S /㗠X0PL0& 8 yW0PL0 LF4pL]50P!* R0b4R  00V 0S(dR0L|800S0Y00Q$`80V`5Z0A00R`(,0ES<tZ  X,0S800PP eZ  ?٪P Uu40S|58 R 0 S%X0L000080 Y $0S8Py80$04 8 R Q R8P 40P0S4U(8040 4 R Q R  R U R PPP$0S F ㅪP3P0!01 $0,0AyZ-Y  pP)1 0$008s8`A0Z Y Y0c X00 Y0 2" Y" [ * Y 0S:$0U  Y ,0S<,0ꊠ $00` 0S !0 3 [45x:0)qb&   K0  !͓ YQ YQRU10A0  0S0 0@c&0 0 0   0!୓ p@K 0W1!XHE Y0 !Y10Qj*H Z00R 0H  Y0 Y00 N0zgzzzzx zeHzezL&?x<{{{M{{{{b{{|A|e||||}5}>}?/d}|}}}} ~0~g~~SF~.6>GOenR;$0@ &Dp)gfff{$ URRaArrAaQ!A0Q R0 I7`0SP0S00`0 Yx00x0P0 0S !3# Y Y00 X00 0 00 0d"700 0$0|7,0S 7[ 7` 7 0S 7P0T @7X 6 0Sx 66a4RQ66Q6 6l0S ݍЍ0/^ &>l021`[PP -al%3&>Cj1 0 S0|0| 0$02#l0廭 Y0000 0l 0H0 20R08 0R000\0\0S0 Y0@0$0pQ p#   t  003Q0tp0H0( S 30S d(0HH0 0(0"70#0X0S% Y 0( R030"S 0R<00&ᑣ+80< S a1p! P < L6(0<0 l(0S Y0( R00S~ $4 0$0 Y000 @0,0 0#40+40`00 0 1@01T01P00 0$00(0x0,040303)00000 0$2?@1c4 04v 08#$0 #(#< 0 0& 5 =Q p0QX0S000t0o0 00 R  PT p:&?  D0pk P^ ( 64 R ( 4R  R 0( S6071011l0( $R030#R03S 0$ |C4Q`000S  0! YQ0R0( lR00S \U(0 00 25 010 0P B24 01(00(0S    k B*{@- S-c A 8 / eA@00@- 44@4P\P 0B"" Hp)-@=B'p|)0/p/@-e 52@ &G-`@ P p,!>0$P U0 0  P@ G.0P\0# 0L8_ R 01_ U   Hp)-̀s@-pP@ 0  H1X 0TTX4LЍp wP `810 G4Hp)HXp)@-03S   4 ЍG@-@p$M0 0S ` P:1 00P 0! 0r4))l41 hg40Xb40H]4Q@UVPE:$ЍQ45P\nXH0@-4M@ 0P0S 4Q 0   R 0  9   0 "0!4Ѝ0@4R  )   0 "0!R 0S 0S 0  ( 4Ѝ0@34Ѝ0Hp)ú @-.p?^pq)݁H@- 0 R* 0s# p@0h|)P `00CS`0p S00 P0S X0X /X4&p@-`@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h噜d嗜`0Pp <10C <1$0 810S81Hp)%&@ &q)0@--@4MT b3A`^3d[3hQ V3`"R d2RKN3 3d2SA |= hk0:{PPS['ΞkHk>[E{781 < = * + (+S  PPP!3 0 @@@ zj{ k{[+S[34Ѝ00B:k{{'*k{d+S2?@@-C6?Y@q)Hp)-CT%r)r)‚wp@-j0d2S_0Hp)@0@-0S0@d2S̩`2"R2谄%Hp)@-@ 081  0/t1 t t*   <(8(gK*@0C d.K+ C x e0#-S88<8xS`S?S DSf .< Y0 ( 0BK+ 00CS00.K)a0CS00  ⮟  PK 0@P: 0@0 x9 t90Sh9 00K )K ) ∟ ( PK 0  PK. / K ; k  ԠPK P 0K. 80  Q ` ⺠@Puvp @80S 7  9  ⢠P]7'<07807407007,07(07$07 0707070707 07070707.   r`P-K PP 70Sd'0 0C!0R3 D70S0S K  @PPOh `ܞpٞt0@Pp } pϞt@@hP0X#T0 0T\  xpW phS  0QSL0Q㕟0P@i0X\0D`X0D S@0S3 @DU1 PP  PPK 0P@0 K. .K>l%l 0 ,@ट8@}pP @ XHl m0S$0 0C!0R3 0S0S 0`0徟P `0ḟP c=0,C0 0 S;.0l0 -+ 0  d0d0@  4凒IS p 1 01 Q 1 \R \A?p@1cG0D H`R(p3 R  ~-  Z   tdY   \0T0S 0D00D0. L0 SH00H0H P0S  ⼝  %P0S* | 6 ⪝ d PcݍЍ ❝8  ◝  PPA0S, P  ⃝  P v  ߞP j | ӞPP@d0S\X000+ ss.@P.8**|*f||*@ &l Ҕuf x|*Ԅ%Dɯ;oL|*#5In/_œۑ2|*`|*gfff#&Q^6-۽O4kkqx6F&ot@-<00iS03S !65PY)P|**@-l@h 0\ 0 L  @4  0   *#+4*@-`0@Px0 B0PU1 S2P T0p0S 0@ S<<0 0,$p6, ЍЄ%|*`|*=&BC-PD1`0B8! Y!R!tM@p  10S , tЍ000iS00S 00S d `P *W @ 0 b P םP000 p 0p, W@000Є%|*L|*L&P|*`|*Ԅ%a`0@-@X0 B0@T1 S2@ 0P   0S  Є%|*G-lQ0S `` @P 0S 484a4qP0 0@0C!R! 1S1 "R TP`pȀА U0(@P 0E!0R30S n | Xi+0S+ @TP`00 @$ `|*&g|*|*|*L|**O-0B$p 0Q0US`PP PP" @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@Ya P`P30S  *x#0ES0 000D30S ЍY8 0 X@00020S >P0 *qX0000  000S 0@@* 0 0@0010S P0 YQ: 00 0X@H0000S X0000000S~ @0 0 n RT 0@s0S @ 0 @$ 0 k@WH00S 0 T,} D( *4|*L|*& ޕ@ &#@*b|`1A-0S PP@`DqD T0 :41,a PU @T)$PPP@`0S 0D !0R3 P U 0S 0S  |)&P0S0S \0S < )l@`|*&|*L|**|*Ԗ0A-0S |P `p @T V @TL$@ 0S$p$00>`@`|*& *+O-!1 RR0夑S S@P|q| 0P0: ЍS DP>`P 0 &< 7)000a PP@:SR  0")o Q Vr`P0p\0 p000a000P|*`|*|*&D*|*g|@ &ėڗ2O-0S 0b0 8Y 1P!pġP@0pP00Y: P0 *@@ 2 W0: R0':&0 R S U :SR00W 030"S P{ 0000 S 0 SPhd z\ Xu(000P@ Ѝ`|*&*|*|*@ &C-MM@P Q0S C@p T0:ۍЍ0S 30 ;B000@T`PP@p0 % ` Y   000PU `|*&|* 0A-0S P`tp U0(h@TP` 0Q0F00S 4@`|*&%|*>A-p`P@P 'p>pDorP 0L0 0C?oR20S  P T@ &np@-/0@PĂ 0Pp SRp4*@-8JY0S$0$ 0 0'e$뗘8|*ޘ@ &A-`0p0O0000 SPڤ/0>+b P0 P<>P@O 0 0O0?4*,*ބ%0@-@0 0ؓ0@0Ѝs@-@P`P @TZ TT?'?0 00?ὓ+"+R  + !Ѝp,@ &$0L<S/ @-P,*ވ%@-<~!p @,P!0@0ބ% O-1@`pVCMv Pap@0DWCߍ貀TX B/i0S x VV@0PS 0 ?2/ 00S 0S 0S0000崐(h X:0000Y&*Đ0S 0 0S 0 000R*Q l\&0S D`W0S  `D|**`|*&Pd~*O-X3p0]MS DDg@c@C 800#0T%00RS #0I%lp"& URPP "Pb&W 0"-%00RS[ 0""%xlph"lLTPP"L  PpfDDB@@r0PSY : SVH `P؀/0 '10L<aS$ {@ 8( D <`  8P  H\  T  X  `Ђ{᷌P ,D %8!88hR/0>+b  P<埌P P ]0?0H @P UPPD y  %L P pUPBP|]ߍ`|*&|*8|*P|*řބ%ҙ],*%ވ%3 *H4*h CP##ܗ*@ &ތ%@-$@0 00: Sꠀ*G-@ q `0S+ P 00S WP0 S00P R HRڄ00S tL%  Y`0P 0 Y00:$00S $3%|*L|*@ &КG-AM`P@spP00 040AލG/0 008/P1 00C 0  R+h X $0 * 0 D p^,*-۽@ &>gA-MMp00 0/R @`㜀GEPP 0S P@ۍЍ D @`D @P 0S `P`,*p@-0@ @P SP @p@-@@O-3tM0 S llLh00RSX3 L3L#0H5#DC4#S8-44tЍO3( R$ PL   1$+-$p0@`00 ԢԲL<` #L\0@ WI< h`VV#W2@Pp L<0@'ph0PxSiSbP 0'0@$ 000 S#L<0@ \\PxL StЍ0 0C0X10S 0`S$0` S\{X{h0SS   S.8P.0dS X00%U0P!rd0 8#R`|*&P|*|*8|*%ވ%ބ%@ &Ļ,*T|*X|**K]nx|*؜A-MpM`@PP 0pp;d!d@P TTH#L墋< 0?#ۍЍ aD D< pPU U`k p0P #ؙk x#0S Jp T0TP 8 "뿙R8 [Ep@ &,*T|**Bl@-:P@-L@4#S 0 W 0#S 0 N@ބ%0A-@P` 0 P0: 0lhp ?}0@$a@00S$`V SR|*L*L|*f 0S 0 0/ R  /0Su0 `0p@- P0@P*D` ?}0Pp UTp$/p|**0p@-P@ 0 P0: 0|Jx` ?w}01S 0p@D: $ P\@P@ p$0|**@-MPM@T 0``p/VVP   P @T@ۍЍVP @p@-/PÔ@P@p00/00@P 0S ͝A-P/p\0@oC 0T@@D~ZU pDP@D*G-pPL`04PSp@P`0PP0C0 T`4 $D@*h|*G-頡FPTp A`Pt&0@(0C0V$Q@$0( 6 00v`PPEPP j @$@@(`/ܑ 0`0 @ `P`D0P p0@0 P $4 *h|* B[v@-@᱑00$D *0@-S@ 0S 0S v 0S p0 Pgd T` R 8dD0&F$ ЀP 0S00ꇞӞ*p@-@`PP|50S ? 0P0 @/ቓPDo幒0P 0 00pO-2p0SlM ||宽x20SGh PP qP L D0`000@(Q /*` R 0?*@a0Sf@01 $10 %1 08`008,P: %+ v909909 Ѝ0 B+"+R ! R  xEUY0+5p`PlP d<X (`e 20S O Pp 00 ?'qp V00S |剶0S 906;#;S T%kE+Xv*@|*%L|*&ަ@ & *7d|* `|*Ngu|**0O-t'BM @R MT'T7PP jP P Bލ Ѝ$W0S70S  600UP 60Sf KHE B ?<960h]php0(04%48"8<<HHLLppp xx||p9^EpEp:^EpE@%0A(US0 (12222( , 0 4 8 @ D P T | Z40(01@ 0D0(02,020028 0T0Pp00|`P$ 0PD \4$ R> P<(4 R $ R w3  {x u upro`lP i +ɍ0/ဳ䀣 0/00#00 20 0 0/0?,00#H0?\0?d0 0,0刓吃(pX``P20R000%60"`20=S" " \" R0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h0 aRS! |#3 h\ PJ!0!! 0AQ  嬴9-0CS  % R0 R R 0N\ \0\|0=0- 9!sD|*lT*`|*& kL|*ۧ% @ & 4MdyC-2BMMP0000 00 Qa0S q=܁0=P  RP!0AS[0 =0p㄁0W\1hqPP  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڐ0=ۍЍx0 l0P0d0`0S L0Dڳ3*|*T* *|* C}*H@ &|*ը/O-MEMM 0$P0@B@@<hSD 4 4R 4S{ #404P |DQyD$` B D 吃夠PEN␓{D0S[h 04;`#4 "SQ A 0P3/04$!0P+s00@ @"͡3( 0A E6/0@0 GR00 G0Q0'G2P004SQ 0P3/04@EP0 C 6/0@0 4S; 4$`0?0;DC0 4P%x P~ ׍EލЍ `4SQ 0P3/G+p0 G#͡0 0A6/04G+p0+ G4 $  BRPEN0SP @0S1P@0S( 0$00S  B0SP D$R00S5 00S \0l 9P tlx3  PPmP0SY|*T*C}*%l*L|*& 0 ꠀ* C@-@0SS|*0O-gM< 00 0 80 4 @؂  P  0 @0 0H0@0LP0DbpPP:P S  S  S;  S 0 ``kp SK  S"  S<60S  ,,[(60S  6f0S -P  050S  :Ѝ50S P 0 L50S  << 0, 000%`,,;0S40S  40S  P 0 0 8 Z0 0 0`40S 0 H30S  30S30S r ?Ps 0> ttZ 0 0 8PMP30S` P [L 0  0#`0 0 020S  u20S620S " P& 0 ''Z 0 0 820S 0 $m "`f0 0 0=10S 403/  !PDZ00 0X10S00S 0 0 800S 0 m4\  03/Z 4   00ꠀ*@ &`|*L&\|*T|**Ԅ%2HCDDE]*X|*s CêԪH|**DFG@-1M( 0  S != 1 1R 4S5 !4pq04l@0TaP/ P0S  R+* SR-P- !0 010000 QP 0PT 0$M P ЍPB0P;C0P|80S050 000 @ 0@0 0|**T*|*Ll1@-|cM0S llhChS0S YWPىl0#0,, R0n  2r 0500K Pr5"0C590C990C9000|Ph|n xѯ0S \2d"`2Q090 9  8  4  0 00P1P2P3P4P5P垁0hP1 20345PfP# TЍ0@ j@P=P(<P$; :9876 4 1jS$  $ PP  Q Q  !  (  x]TЍ0ȷ* pӲٲ S ŋ  '`$1>LQY*mP$ 1ƍ :O-@`pRL]RS7k,*ĥFܺ@-,*0@-6S 7X*@-0|||x|m/l`@P" XT`;  <4v, @إ+ *e,*@-| D3@ &0@-h@  0@ 0\Q0CS @CL&p@-@Pp00Sp8PU``p840#U :P;X0Pp4P8P P 2XPp`P -7@- 0@P0 0P0S0! B Ѝ0@Ѝ/G-P`M`P Y{@䠟 T0D 0 S ޑ`Ѝp | J ]  ^p!0 l 0`# $C0  .0`  W0BⲑP {L&@-@`Pp@"!0# U 0 x⅑ph h8/ \{P@TP, #P  Ѝ譽 &S-,M| 808"40!00!,0 (0 $0$X0޽#,6@@ &-7@-{`P @XT@D R 0@=  000 Ѝ0@Ѝ/Ȏ%p*ap@-PP@ {0S 0CS 23 0 0p{mp@ TT 0 0 {a, ,Up0Sp**j%A- `(p 0pЍ P .@P  PP 0pЍAp01Sd0 \ 0T2Pp 0` 0S ` F(P `ꏾ*Ȏ%S߲C-q@1MS0`o1SP1SeV1 묁XV ЍCVS 1S  D1ЍCPkV0p0S) S S  3zX t@ V(ЍC   zX    z X t` TT ЍCBVЍ*Ȏ%&pQR;C14 0Q 000/ *Ȏ%ʾG-AJM1MSp=j`0 Pxy c4F0 0 Fepp 0 S JލЍ;X P0YyA7J.H0 0G1$HL  $`000P Pvpz Lr0S8k1!0 *3%A-XQp1`S1S@1SFV1 1SV AV1S A 0QjVS D@d0S VA0  p1S XQ 1S< A`V*Ȏ%&pQxLA-a0 MSP@Ѝp R   *|P10 01SL0 D1S*HP R! *Ȏ%6O-DMhYp2 0S 0 000 (_P (P(0U%`(` P@PDЍ`(P$PPv (  PP$0 pDЍO0(` 0v ( 0C$ S  )v%Pp㠱吡v00Y0S Y 0I00h!,,p1!0< 0(  (`(Pv ( Eu (V((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! *> %OpFC-M⬀p`` (?uW0P0 0000 _PPQ ЍP>@P2 PP  PP 0p$ЍCz 0R  (0W400(00 P( 0SQP x0 Pp0!00(pP0Slp1SX^`D0S U 0S $OP> *O%p߲0@-P@0,M08PP0 p,Ѝ0 R  (0 0 1SL zZ{e[jKZfke[KK{K+S  *pO-lrMM 00`S@ kTPL 8P"P(J@ t @Y:0@@  0E3p,oTٍЍ?u  p Y d(/u"QPX !4%*1 210T 1S1!T0 0*T 1!0 0*Pn0 D Y @n 0 D rH* HO-锋JM M`P@p~n03<0xn0`400c?c8000S0P0S@TK&1X0+;4 0@X䚟4S ̪U08 *0<: 00U0*:4 0@p:@#TRT 1S d   GRT:T1L W00  , @$ 03p0 ,_,^੟ , ^, ^방倀  , ^, ^뀩  ,l ^,l\ ^P  ,< ^,@, ^   , ^,^  ,^,^  ,^,^됨  ,|^,l^`  ,L^,d<^0 ,^,8 ^X 0 (, w^,s^ 'XHQ S(P W\7$R [? 0WS; XQ;X PD0fr4EH0 1HL00 1`00D0 pML0X 10@sX&4 0#Q0X00Cs 1SLh X0@sĈWG4 0BWPE X.- TSz/D44pS ,],갠Z 0 R(0 R YP ?r 0 0 0P3A8/%00D0 Jލ ЍW@ 섟 RH 1 H0p&H0S# 0 0 @3SH  #Z8p$W"RY 0 00@0P0@3A4/4pGWpp 0 0 @3SL1R 0) 403001P  0p 0040 [*!Y r0 S P40Sr0 00   $ $  0`p`08哫*0S P   B ( P R0X0,( 0P$0 ,( iq$0H0 Gp0@  !H0 7p0/;㨀H0 H0'pp8r0 Sp HKpP  H0p6W 0 0H0pH0pp Hp0pH @P0P ?p ppH0p 0H z*%D S-%*p N*'19CGQQ ӡXis|  * Ȏ%O-`qM俟=P`a@P U#*0T?SD00]P.0p0/809p R  `1`SPP`  Ip00 14PBp 0,@Py-  +0S qߍU !/q 880U  0Sq0Sp\AlPYPD7lP,U ,0lP +lP040 #lP040 lP lP040 lPy   l PU  p 8 ቷ804U T 0Sp0S ,k P"U  p 8 ὸ80pU  k0Sp0S!1R00:q{kP"UZ 0| 80 Rn aBQ @IKKLGJ 5p  -MKIpap 8 i8 W   ROp R0!P  : <0<00140KS0J  X01S 4PU 0H?oU20S0H?oU20S0H?oU20X0S  p 8 8 W  Rp R0S*  %00140KS% 0400qi4PU4KU* io 8 8 W  Ro R `0 01 40KS0 }DS01wXu40S x  Kv 0H0l7X' aXg zXpp0Z0P.' @900D@8A@QpkP 8BMZ08 4@V80 R@00Y@0-1 `0400<0,0@Jp\o  @c40$0 6@ @Y6p8 80 @W1!0 \6\1"04 @1@S4 pco0 mdDp@6pH xYpHP*0 SX Zm-0E1 nd! `0 D000``pn P1!0`1p00CS%$%1" = ^@P qߍOtor4S 044 (04c0(00p`000 4, Yp:X~,s RT=0`0D Di@P0=S x#8 R`  iP 0=Se @#8 R @a  iP 0=S #8 R  qߍOn( T W0@400, 0@WD@00S a1S, rY, pP PU-  > 0 0(0 0,003A05/00P9T"Yg(p@,PW\`0,S(P T'&n XJqpF n0"S n 0 SX0T R 00S* S S+ F$0Cs" d0P T0Lp0 pT0pUXN0 &p000&00' T00.T0hp0* sȎ% ď l 6IXMGszjo  <Ώ 7:VXvo N%C *L *u%c*m0SN@@T T TF0P 00T 0@L l8@' 0@0& 000.000h 00qPC \07p XW qߍOAm0S \0TP0 0 0t000( 0, 0Nz@-l@ X |T xlP l\L `LH T<D H,@ << 0 8@ & ,:Ytt0p@-@PT`h P  p@0p@l [*m@-M @ A P   PۍHp@-IMM @`) PIލЍp P0 弴0 l嶴hP 0S 0S0 0S  PHA*@-M @ PDXۍ00 R   PH*H- p3MM@nPPYW^`8mgP $hgP P! 04WgP00 S 6P ЮP00 S * ƮP2  t 弮`P` \2P T/gP ,[PP0 0U,00P` 0STX J1!P J P J1!@ Pp10S d 0f 0pfPPPUX$ PkU 0 $9V, )PnP`ZZE_oR 0PPokU  4S J OP |夳p- 0dTPf^Hi*spe}&  @ &\4O-@MM`;@.p*p P @ dp @0T @0Z:: 0S ލЍ0 0TPL A@P@(0HT*20Sa001!pZ<0V90 ZVP jZ.@+fP0 @Z!V㟹 0Z ;P jlZ.u@ZoP jZ.DZfP jZ. |dedA*n@-0`0 0SPP 0@PL SP Ѝp@(P I Ѝp, O--lM8 4@00PPlЍB0P$0  $pPmU  圲T T T;H0l4lT 0dL6H0P4PT 01H0@4@T 00SZHLm 4TP 000 0S0R0S,0 00 $0@` 00@TF*3#03 0303P0L0@֋P$0@`(@pW6*00S 0dS0ktDᅄ h 0Xpt  ;Ppk P X$km0H02R 0c0BnS01080S 04 S? ?<0?@0,0S+ 竸0相S/H ?Vc L0,Z JH 0Gc?H 0D?c {{'0{D 0@(0 0(0<0P00@0@ Bn} 001 00Pup\ `?4 $;Xep J? !4 ;$`Vp P0 0L0 {{'0{0` XHʟ 0bP 0b  0lUY@-GHHT4=ImI'FQQjtS0SQ0勤d400kS& Lp0p$Pp p$;Xp~ 0@U 04p$;`pq `0X PHɏ 0b p0|b 0@U00`  0pb 000 Tr(0S0gd0kSㅤ8 q 0pPp3 4X`p$;p( 0U 04`$; pp    A A{ {'{P0@0 L0.  A A{ {'0PUHp Ǐ 0{ b 0b 0 bL0 Y@S9@-Oh V@ &A-@p4S`  PHT0DPEE$UX  ucPV00lcP V0-04 P $ 3MDPE@D*e Hp@-P@Q0 Z 0 pAcP@ R 0S L`#Pp 8R00 0, 0p$R#h%@*+L+H+D+@-2400S (0 0 ppc r`*@**G-XM0MS0 DpW,Q`@`$$Q0 ]Y+0Ax<P 0 0 ۍЍ0 000nS ?S aS ppS qS x0  0 d00L0弍0 8*h*@*&|+H&!9A-X`0S L00S 08P8@p0Pp00|+`**h*@-@L0@22@00S\&,0, 0S00T&p*D*d*+*C-RP`tM  4ş4@ !Q RP ğE R`S `0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ Le 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+=Q`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 V00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =L&H&l+}+l+l+@*Pp@-@@P@T -|@| |P|`0Sh `0 pX@ P ,0< 8$0@pp@h%@*׉M+L+A-@P@p0S0P0`x0 R `| R0T @ 0S 4 P@` D+**h%;+P@-, 0 Fꐥ+WP@-, 0 :ꐥ+ P@-, 0 .ꐥ+^P@- , 0 0 ꐥ+@*ܜ+dP@- s, 0 0 sꐥ+@*+P@- a, 0 0 aꐥ+@*$+p@-PAM C0@ 000 0S0! :P7 0S40=PP0 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&@AލpP, L0 P @4  9P++++O-1M MP+ 84 1ݍ ЍP $9P @4@/ (PZ30S cs؃ 4PPQ u/ 3P㜃堓0S0S `V~`30S5 0@P/ T30 083 0% (3($3Q0Q3@OoB0B%Q20S  2` 0gP0002`P0 0R R00 R K@P 42H"000 H 2 2QU2@OoB0% Qy10Su 1@#P0001@h, b 0PA0S0X  ,`V pQ 0S 0S0 0@P+ 0! 0 00 00QQ0@OoB0^%Q|00S  d0@ 0P000<0@`ꐥ+|+4*D*d*+*++*`*+G-JMMPp 70@ 000 0S! z8P+ 0S(0<PP# T0  1 1 R0 0S0QW`5 p1 0Sd1d偉P* H1 @JލЍP @ ! ;8PJ-W#P0ʡ ,c0S @$00 R000S00 'l0P0>4qp P0ST00@h++++@*++ L 0 0 0 0Y긥+Q> 0 0 0 0N긥+Q]G-KMMP* t2 KލЍP\"7P @<2@82000(]P 2 0S@2߈- 4P0 )qaЁ0S 0S 00 2@P y-`1@0S p4PH1 \0PP 818!00,1 0-0S ]P+ 0 0 000 T P _oR H&l0Q00S 0@0aP0 00`0@ \#ꐥ+T|++a+@*4*D*d*+h+++Q]*L`* @-PAMM K) 0 !@bPP0 E` pF L p0 0pppp0+6PAލЍ0S 0 `Tꐥ+Ļ@*d+Q]0P  /IP@-)0$ 00 0ꐥ+@*Pp@-o@P P `hP T~P (pU ( P$0 0 pI@*0@- 0l*+P@-( $0 00S/0嫇ꐥ+*@*0@- 0*+Pp@-0o0@PP  0S 0 假0S P {(0 0pP@`P< P A4P000 0gꬥ+@*IB*X*+!0@- Z 0n*+0@- P 0{*+@-(@(0 E 00S 0 *++0@- 5 0*+P00P0SA- (0 !0ЍPAaq0S000+0S 0S1000PPP00P ,Kc7`0H L0<\04 ꐥ+**@*I*|*0@- 0*+0@- 0*+P00P0Sp@- '0 0pP`P@9P# 40P l30P xl00?o2`SP@8 8 <00S000ꐥ+@*I5**OP00P0@-S `' 0 ЍP   5P 0pPd00}S`00S T0T>0H^P 40 0, 0( 0ꐥ+i*@*z+++0p@-PP0000x8@Ppmp dp@GP p@'1@0@ 0S 000ꐥ+$*@*+P00P0@-S & L0 ЍP 4 4P 0 P 0ꐥ++@- P& @1 ЍpP,! 4P @1@r*P0 P` /@P`*0@0 S0 0S P xP l0 Q0S  L0@ 0nP000$0@ꐥ+T|+4*`*+*@-Pj& 0 ЍP 0S t '4P 0S0TtP0@nP ,0 $ 4Pꐥ+ +C-`@ppPH_oR`%ZP=10S|1| ЍC TPda8& X1 ЍH5U@ 0 00 1"T:pX+(PPQ 0RPwXp-\5|0@0 IT Y0P``TT TU@T 37@P XP $0  ЍC+@*/%+`]bR?\*Oh@-$MP% 2 $ЍPN0S!r3P 0 1CYP 00|S 6P zP 0t|Y@h1d@8) PP @4Q*]O`**p@-PPMM%@p1@ۍЍp(`A@PC@@T( aOPA@/YP+H00S `00CS0 uU0000 A. l0 0 /.}Px(t@$tꐥ+[*@*T*S00@-MP 0$ \1 Ѝ0P D!g200CS0(P@.0S0PPP P@V \T0S0 @ʴ@P @PV [U |0|`T0S 0L @yV [ ,0 ',ꐥ+@*d*0p@-p@P0 p@;$\0\`0XPS 0S.0S0p@' $/00p营+++@*'0p@-`@P0 p@$L`LP0S.0Sp@(  00p营++@*=P00P0@-S # 0 ЍP | 1P 0hPL00}SH00S <0<ς00P 0ꐥ+R*@*a+P00P0@-S # 0 ЍP | v1P 0hPL00}SH00S <0<唂00P 0ꐥ+R*@*+@-MMP`+ G@pET \P + FW+ $F@ 0 ۍЍH+@-PV# <0 ЍP $ 1P  ꐥ+S@-P;# <0 ЍP $ 0P  ꐥ+@-P # p0 ЍP 0S L 0P 0S0,*  0Pꐥ+.Pp@-" <0 p00@PP0 Pp ꐥ+* 0@Sp@-" <0 p00@PP0 Ppꐥ+*$.Pp@-" <0 p00@PP0 Ppꐥ+*;@oQP@- " $0 00S@*ꐥ+d*HoQP@- " D0 <@0S ]0S ^됥+d*@-V0@-P000P0S h" L0 ЍP@ 4l@P@$zT Yꐥ+Mp@- M PH" 1 ЍpP! 0P 0"p`1`.0S@1D0 0S 1(xP%P0 0S 0@T 0%`(J@P xT d@ @0@ E0 @ 0@3/H0T 00S00%ꐥ+@*Vk~*d*T+d+0@- 0++0@- 0*+PA-PPPPU㈀ !00P@lph0hP壀00`0 @008ET,0P A.Eꐥ++@*}+l+7@-PA 0P00{00 Ѝ0Pw!0P%0S0P 00J0@0S 0 S  @ J@00+TD0 S +<D 0 /Pꐥ++@*T*D*l+l+P@-0oP 1!0 0@P |P pPX0H P@<00Q  @4,0*+Ii*@*000 0@-S$00 00 **+*000 0@-S$00 00 **/+*p@-@Pp@0@- 0A++0@- 0N++PG-uR@Pp]P\T- ,`PgTP( ,@PP_[$W$U; W P10S- D1D!0 << S4! ,P`KU1`1@W 00S 0 0  S  p $ $l0`h0@P`pP \P LP D Ѝ***@*I**]\d @-r0营+P@-) x0 pDP \00}ST00S H0H@4P 00 0( 0$ 0营+*@*+++P00P0Ss@-  0 Ѝp0` 0S P@P ⹠0Q R   L 0Ѝp@~$Ѝp@ꐥ++@*+ (CPp@- $0 p0@P0Pp营+*sA-P0 "0Ѝr0S2~P70S10S 1~@a0 ` #C0封S Cb"c! !    c#A P0U0C00CS0<\ P?00CS0@8| P7 (!(-PS0np00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 Sꐥ+0*@*x*<+<+<+&P00P00@-SM  0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$U@00ꐥ+@*<P00P00@-SM 0 0Ѝ0P | ,P 0(qp L0@0PB) 0,0S 0000ꐥ+@*EP@- 0 Pꐥ+KP@- (0@P0 @]@*XP00P0A-S쀟 w00ЍP  8,P 0/`P PPP 0RPP@P@@-p A DA A00wuꐥ+bR?P00P0O-SM  . 0 ЍP  +P F @P@ 0R@P`y-|0P 0A0hph`h@Р0000 0<0 8(ꐥ+bR?++*QLPp@- 0 0p`@PyP tP oP@)p0 ` S P@@ @000 (0ꐥ+l @* **A-p`P@Pd0 A\P 00-4 0 RU A@**@- PP   R Ѝ@xP  HR  t@0S00 Ѝ@`pꐥ+ ȏ%@*S0A-p`P0 ARPs@PLp @APP x00 F00营+@*Pp@-2 H0 p@00Sp@000"|0$@$P0@Pp营++@*&*S0@Sp@- `0 pX00Sp@H0H|0<@PP0,Ppꐥ++@*X* @Rp@- h0 p` Rp@P0P{ D@P0P ,Pp ꐥ++@**O-MMPPQ  3 ٍЍPʴ#EE{*P c@3pY 3  PP`@)L0@0p㓄( @0S (30@ @c0S000p`J2l{2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )b?0 N`0S@iR0@S 0 F)b?0N`P1{ d1 0S x10SL1h`10S ,0{00CS0.  E ?0 03/00S 0S 000CS0 S0  )tz?_00000h0 _Y 0pS7 ꐥ+<+0*@*#T+L&X*Vkd**\*l*@-@P 00P ߾00Pپ00 -d0lM DT00S >TD 0d P,00ppp*`*:@**-lM%P00S T@ 0de P(00pp `*T@**A-@P p0 0Cs0S13M `DP@ 0 B RQ@  0 0Cs0S13p@-`@P:CP , 0S!PR x,p@l,*`(P %CP00 0,7S!0Rnwp@-@P %00PU eM hRPp00p@-`Pp@0P<~ 0.v0Sp h0 S Ѝ00S 0C @pP2*P/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  BrL&G-pP(P SR@ (CPP0   CPN0 0010S / BPe )`@BP 0PS $2` P):`BP P)P :BPP000S`UK ⠙0S 00S1 @RđR0 d TBP0 0 U ~){)x) 0 011 ښ0Ѝ @PF) `y= 0S000W) 0S S St0 0S 0`S@E)H0PU <),P*x*t*S - BR0 R  P R $O-@M M pPE$@NBP0DHLP0(,$00D (0p0,0DHL` 0 0S 0S X 0SR@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;N@P `P P޽P @ٽP4& $!000S V PU@ /MV@0S  <P @0U0C?o20S b4pWp 00C00p0Tp pW D'=pPpUP 0S =0P00$ 0R 0000QE+ s<Z0<03 0 048)3 t30S6Zl# d8(@cA0P0 $3@@-(:VA0P@ 0 @!(0`0 @i0 `0PPy P00@tPS (P Y0@ 0'T00STeU 0S} W +X<+X;+X;XP+ ;0!0 4Pp80L YA+ P0;E>00004P1@@DcT@@/@0P  00+P 0; 08 04@ 0R 0S10}Sw0S @0S 0S@0P/LP0Y8<00 @#'/\*|d***+d**a~+ɯ@ &*O-jMMp@lTtQx|Vύ<84PLH0 !0PX0A6M0 0)p7 4A'H8'0SRl0sp0st0sx0s0S|0s |&T>0S0 /KP&&>0S 00SU  0o 0 .=0S |P' Ui=- )0S L)P$.0?0O0 0 (00 EQ /p>0S-@>P R( @,0 R_JP<0X 00|ST p0Sp<0Fd yZN P> = 8 l,D:<`0S00  U ;+ 0S 00S 0Pz 0Sw &pH,`P` 0S :/KPSHX :H0?`PW ᚹ`0SU 0S[ ,0 0 P#P %>P  0h![/0d1`1\10A?W/p h10\1S 0S dAT! 0S 8JP ( Wj0 0J⟕0S 00S P `A%dMPMύW0004!0 8!e4 @!0R PP000sMT9e/01010W`P VN?04 0 ʖP|P|0S4 0mWU`P@Tt  p 0m_0pP8/LP90S jPPhm/f@L(PC9 <?900S m?/90S00?o 2#P P0 P70S P 0S$P 1S$d7dGpVTXIP@3D)@887007P 00@T G LP v00@T G LP g00PR VP`|tFtP<`|<'(P<60S'`@T)6] LI = *!CVh+*@B***@*+*+*P 0, u\0J\uP 010Sur@P "``P pP P000P P P  f"}P80S S WO (80K/CR032 V 0S` !0 0t W5V6ZP Z4 0@"2S"82Q0SM?0<0!p2 SML2 8DᵵᲵ0SF20? {u00P 00Sxy43 r|00 P 00S% 30S003Mq0st3 @ Q P <mD]0S30dtlpxxt4l Rʘ4$Ht4R P N4DPx! 44`t0Əs t0t0@T> U  $PDJ0 0 ϱ 2 @Rx J0"0C?o2? J"0 "0A呰r0 S ;S0 EP 0 R RT 0SB0S(0? &"( ,0 R /$ $ T @/͡"͡pP 0o"@RD á0 #PP#PP0S0S60Sx#@P $2)'X000/R0HL0$/0 pww0TppT0 T`p` dJdP #P U pW70S 70S7wP $;0S @DTP80S \X~0 0S( PZ0S= S E#b8 8`00S0T0SB uPtI  #P $ DP0 Ue g@90Sg89 Q b`) Q0p9 ,W9#'2; 9R.sr w. 0A3/@p:@<  : R0 8:QP:Eh*h0 0 S ,lE*p A)t=(x9'"0S,: 0R.MRxAv0S 坳000S 喳000S 右000S 刳00jލЍ0S 03/0S v00s@- P@8P  8P0P TЍp堋`P  8P 0 FUp;P Ѝp@z 0S S0S  80PP0@-Mh 00GP P10S 0S00 0 Ѝ- qQa @T0 S 00S 0s 0 :k8P 0 S000Bp@ T dCP 0|S ֲ00 0S00 0000,*d* ***`A-` M@p !3000@00PA0P/S:S XA@ᢲP 3 <2p$ (2/@D@P/: DpP =@ဲP | Ѝ@/000p0 @@PW@p00l0@@DcT@@0/0@0CcS1S@+PP00/@-G (0@  000G@p**@-G p0@ `00S T0 0Lpp-<0000S 5G@p*`*@**@-G@u\00S P0 0Hpp 8 10 10S ~G@`*@** d0@- RT00S H0 0@pp00 101000p*`*@**|+ -X0lM@ .d @280 00ss! p*,@**@-0lM@0 0 00 0rS sS l d d1d X1P0 00ss,d $p*|+*+gX@**a@-PP`@ @0@ss00V 0ss0000@? bP UV 0A0T0Ѝp00CS0 Sp0 S 0 /O-TMxp|W00ʿ? p00p 0F0P`0V0W B@0 @040SD H 8PZ0S= S D0 S00 %@P(F0S F0#S {F|0pS `1 R R 0Ha# 8eFtp uTЍ ? 000 $@0 PPHF0S DF0#S@DT|0S ld@"\7$0V 0 `{#N"00 "@B*@*O-PBM M`E`P$P QH?0a>0 PPP0p`5(p5P<$( P@+40S5V $ 0D  |70XD S00H00S+(0 0S 0 S     R  T!$PP$p 0 I7@P$p 0㼳tp8|# apy0pSS 00  } z00Bލ Ѝ@D3@b30S VW@@c3! 72 0Y VW T 20S 5V  R x" R " R W WSl2l <202gW D2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F4*{ | +*8***@*<*4*O*H ++L&*-A-` @T Č 0 ЍAЍ/0p0$ P 3xj!6 h0h ?oa0@S P 5/_4*+*{ *HO-@FMs M` ( @C C  C0$0`30(0$ 0H,@eM0P SBDհ0 ` 3 Fލ Ѝ)M0 @,Q(.2@@Ȳ@aGT  B 2 M 0 PD0P|2d (BP `"`d. L.0S 00S , 0(d 4 PP d۩@0S00?o2 P B0@6L6 D01@p  d峩 01 xD0(66S0d00 0d0A0`PS ċP P 00S t0 |0nP@0H @0S0,`@M0?**++*@*Yk *Ļ8*]4*G[0O-FJMMsn0pܖVXv600S00p  91P.X l6  d60 9P<JލЍ(60 0 0097S 50SZ5Fi5य़0S# Ե0S5 Q U 5R "P 0S 500CSL5li00\=0S P97S( 544(%(0SX0$000(00000 PI 4t0000Z40܀C XSX @4`0(  $   TD CP 3<!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R |3a0 R0S R3(0s0?008'P30SC97S00000 0S   0p-008'PL2 0 00 00I 0 @ p\ 087>P< 97R] Sȁ 0S [Q0sN0010S ;70:70?70>7='<CL0S ,0< t1, ?P!1 R  < 0 !0ZP 0S 0097S|0 0S [[X  S\00000IR**** *m**@**d****+<*x* 1Cy*)I`@-2Bp`WLM LЍ@s pP=  p7 0001G1 0S<0 ?!tq(:(00 Q 00SZ=9Q ='/?@#b!"/op 9A0S 5A0#S PP00+0(60 8pp A0S A0#S  pp 90S0 00 0 0LЍ***Mbp*0A-H`D0 82Vp  R`RBR RB`2b  Q  ,+00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 ;0SV 080< @ `+ RD00S0D H0WP8KN4(41<S$6P $00|S $:P/$7@;0SR ;0 SN $ 卡): 01RS 41S $00-S0S h: dP:$ PD0S $ GߍY0S : <0sX@0sYIP0080SS00SWt9 l9 P9T00$0S|  T$p ѿT/00PT90S ;;0 S$P$1;0 S$9P$80SD8Q0SP|PP=D0S!0S' b+|80S Zl(P  7P($80sSG(8  @Pw00S  5Pl]000SpcP 7 87 R0YJV41SC$45P!t74!(06 6 (0p(0ɿp 0: S 0&0&07 R,7'k8$00|S @$((0S$x(64! 6 680$ ((0S6$|x6R P פ06TFPb460SP 50S h50SH5P50S~ 0CS0D0S 5  (p(0Q$(00%p00(0q(0d5P001!^PL":0 SEt480S 80(3/0(000L0S$4 SDQ  40S 8 4R+ qp `پ%'0$`x0pu3X@$P  0,i ǟP$ D0S s0 0 @ 0(@廏P` T0(0 00㮏PwsZ,pq P @`@#<+0 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ x9400u90 SE1(00@N i9,00(00@T!000t 04p@ TL08a0L0 TUA @(, p%P1 Z0#Ul@L `cTT_< 00S 0A<@ (0S 80(3/0*+J*+L**D**** ~ `*@*+*-+ND+HH++ Ļ&*` B]|6*+}*_t} /0^@*oQP@-X@ L0  P 回@ 0 8*+ @-@~80 ЍQ p@-P,@P@p[P @ȏ%@-P@PDP,] $0R , 8**`Z<*@-P@PDP,A $0R  8* S@*0P @- Pp@T Wp`W VL\ P  R/%G-@p`xMI3T oTP ЍGFT8,,a,1 (!Q@ AQPr ЍG| 8S 0S P pP  0 @DTЍP 0 pX0   " 03/ 0  8*l% 8 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/8*%p@-H0H@8D0 (8080$8P  Up$80T+8*+@-A(8S Y]0 S ](0) P p p $8S 80pP\ UP 0S ,8S0(] (8S 00CS0 0 0` 08! 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝpx8*YHT+&Vkd  P/@-@P$P  ~f@-<@0s}(00pp0Co%@*O--p4p$0 KM00) T W0 P 0 0SZP=9 =:k{ A8`X0 P@ A{ QP@0H03 3#(p  `|#0]{l`XT0,S(#  f$#F`0S f"6`<<0f"(0` U  S  RS0|"1f 0;#;Z0S;#;0d ƒ>#/+"+ 0"%+?;#;0@#5;DE !0@SX `U0TQ1QM!0 P EP A Ak{H{7{ZmP!`dǽXP e0 !忽P<X<z@e 0 ᯽0 @0S  P0S S d 国@ d0 St00pp .A**Х+*SF+Q ++@*KߍP@%U[0DE?@-:5T0@ R0 @00S 40 0,pp%5@*`*@*-$M?0 0 \$Ѝ0-4M 00 0004P4ЍO--pMM$EU߹ " pֹ4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S  0sT0S )P 003(40S` $1ּ`$S 06 { A0( A{{zdWdp00#f฼3` 3R - BP  4. BRڗ\3\s"B P#0 f<#2ᙼ` 0$ß R#3SPS0r 1"000f0`  $P(0 0SZP=9 =:k{@2 AP09 A { Q% 5 P;!%#3[QO  d 0@ f0 !?1`P0Fx1p Rf P 1*!3^4?^0330h!P0\1 000ssk$u0S "%+0!iU; `0Sf `0 0pp9Mߍ Y@.AХ+***+ X+H+Sȥ+QS Z dq@*,*+@~!P P0  A A k{I{7{Z`0Uy@0P  坻p\P<2<`Tg0  剻`  僻@-V3@SR3@p@-Bd00` pd00CS00p ,P P00 @R0S"P7d`Qd00CS0*zp "P \Pd00CS0mp000S8A PA p0 0 `V({p0 c`Pd00CS0Ap 0@S P,P \Pd00CS00p `V0 0 -Pp@+Ė%+A-pp@`ᓞP@ ."PP ቞@P PE "P@OoB@+O- U0mMS pDPd 20S }mߍ0P.0͵1f"4PPd(0P/S SUpE P\4PPP P,$0CS0 p, P P  P0 PsdJm-P P e-P d0ppJP 0? hOzdMzd'p P 0Sd0pp+P0? 0zp P 0S0S di0 P P d00CS08p`2`X P Q82<0 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 p P`, ^0#S^0C0 hyP\\ *Ļ+S<++ J@*{xL&<+<+D*0*@-0 @0S P  -!P  0 00@ x0 lP T0 LP 00 ,P 0 L& +00CS0 Sp0 S0 p/1A-0aS0P0=P3U = P 00.S Pl`1h \H T1P@  D( P00T,!,!,0 $1$ U 0!0@p000 00000P0 0p0S000P0T h0h0 @U t0+P$0`V**s"@*<*@*'DD*U++WH+L++* SITp@-@P c0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p4*d*+++****D*0* H0@- 800S ,0 0$ppp*`*@*,*A-@0Qp0S `0S ppܳ 00`Pҳ帳00000S p`0S pp000080xT  /pd*4**+O-`"AM |2 MR0pB h" R S4 P 04 SP 4SPP004Aލ Ѝ$Rg1+u;004P/S +:+6UP|DpVp們0| 00g000000000S H1o410d 1 R100CcSppW000S 0oe 000000塸?$RV00ew@lwPP9T{ P00|+*`+d***+*D*]*>+<*ĻA-Q0qS0`00@S Q`Ѝ06UVP P w0 R 0000@ Pl00}S0s00T 0S$@, U **+@*8<*L&+O-쁟a0AS04M00qSP Q 1T4ЍPF P0.0lP00XL(P" H@)P$,!0̷20$A$000 0÷@, 8-/(P 0 嵷@ P 0$0qp00P0}S0s00U 0S(@<T I**++@*@i@*qu<*02@- Ph+A-`P`p L@P  8@P $@͙l1Ke@-@P舘+ 0A- 0p0@S0`P0HP㬀" P 0S 0"S x0S R00`P"S0"S0 00ꄔ+**++<*0@-M M P  @(Pۍ Ѝ0Ph唓4/SO' @ (P;0@TP/P-{O-@pP`V1@@P`3:(`E(0P԰0Y/  0'T@1PSZ 0 10S 0S0 R H&0S*00 0;0 Ѝȥ+@*@-6-L0@0 <ppIpP0 0SP0 0$-@Ѝ@*ht@ȥ+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C****@-0 000 0S R 0Sd0000S b0Cs R@ S0 Ѝ L&H& @-(A`0S0 0 0 0!0ᆱp 0S:S50P0S0 0 000 np0S:S5000h `0PWpTo00, 0 Kp(cЍp* * (C-@\ᄐpA`\P ^T1:00"\ \ L|9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!d*`++S++/A-p`P @ksP0  T  `00T  $0@ R   `FVp`00CS0 Xe PpTD000`000 T00ES&eC-pP`$@0尐T!Q ( 00@)ax0@P`0 \L00D P 0 ЍT+?@*|&\*X*O-M M@ P 0<`0  83P`\ (P #\y u30S) P Q PUP ap*0@00002F.(P x"xFP|*F@hhލ Ѝ !pp04\ 0X p \M020(PS @ <(0, 0/(0, pQC*0$S,F␡0I00S 0h$Q000SZ=9Q =*/?@#b!"/E p4*0S *0#S [*0AS  \0 0 PE0 P0Ӯp 0S )0) 0 ៭ps0L\ |P)<00 *QK*Mb)?p@-@Pp@薮mp@-@`00CS0pP0 @ )0S0`00)0#S V )00p0 PA-p@`pP0 @ )0S0`00)0#S V )00p@-@PP`$P 8$Pp0SpYp".@-@yP JR@-nPBy@-@np 8P@-*P+0@-PlMQ@00 00 T  40S P 00 P 0 0o 0 ePrCcpWX 30S "@"@@`  H P Rp`9P@ 0S @P@ " ' # P@z" }'T0S @P@qh" k'0SHLp0 S8 00P 0 0XP0 2 ձ 1 PP 00 @T 9" <' P 0 0@T *" -'P ےlЍ`媱]DP@" 'T1 1@T 0P [0`Vq#PP)000,0 0 0P@T|Q P}P* (*@**1X.&%+"+D*d*<+0*T+X*\*++7@-P5 1 Ѝ0Q0S 1 1/P !0 CRtA R Sd10R L1P 0S0S(1 0`P 0S 10S 0 0@ @0 @0@~0 @x0 @r0 @l 0 00S 0Sꐥ+d*+;@*B*|**ft** L+H+D+++ܜ+؜+$+ +++*00S!@-@0M, & 0+P0S8zoy@0Ѝ0@o*-A- p ?8p` @<QT@D0 @ЍC7s0 ,,@T*Qs00!$%HrG-AMMP`P>xB  d2d `2 T2 P 0 04R| 0 0   0R  0 S!!`TPp@D✡0S1  1 0S00SR&@@T  工T @{7<1<1s0S & P0\!i 1 埥!ӥAލЍpP0 SS  S00<1s0S 勪p 0圠0CZ vZ <:7 0 @\+X+J8+H+++ ++ %+@+0@-EM,P aP@P7Eߍ0 ,PU x v dq H!x0 <  @!♵TP)[ 6Ყ !. %OO-``3MP@ pHHD`!4#(3 $UPE nPb00CS0%p00 R0SdP1s0S6 P#hP2x2l1s0S  귊0 PpP1 Ps0S  P pC PXS,1s0S 7 P 0 S 1s0S <1s0S 坩l1s0S 0x0K`1 ⢤ P1- R @C6; U 11s0S WpG'P`w <1s0S0 Z ЍS R   R VP0 Uq 0QDD8+\+J +H++%\+T++]@++qp@-BM,\@P3L1 D( % $!1 '~PP5`0<1s0S v P00  Bߍp ^@`NUPp0ݤOJ<֨a8+J +H++!%@++\+p@-BM5,h?@P3X1 P宣0!i(1 $彣PPb5`1<1s0S  P0B0 剣 JBߍp @`UP|@spyv<i8+J +H++!%@++\+0@-@hP4MTP 0P,,<<0   4Ѝ0\+I+0@-@DP4M0 0P88 04Ѝ0\+I@-M, ,PF A S 0 001 1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍%8+:KIT+@-(@ $T @M\+{t zt @-@1TIТ@$p@-@PPpwP p0@-AM MPAލ Ѝ0@D▣P0|!'둣PPl1LAd1T@㫢姢㥢0!P0 uτ嗢啢呢+r@劢 ⽲U 0S S 000 DT孄   T lt  10D0 S B/o" R  0C|%S+@ &+@-MP Ppop p)l@PL\܍@, HP i܍,0 < 걶+`+.%0@-MP MgP(@f?o2P0S ۍЍ0@3P55-d dPPTۍЍ0@Ʀ@ 5_ , ۍЍ0豶+%+-FRp@- P dd*@PpPPnPp@4<埦8P L|l1s0Sp0p@y+ĻT%\+p@-P MP+P/o"P R0 ۍp@23Sp`7@P\ۍp@gP l! r R< < 5 ,:ۍp豶+f+mĻT%@-  Cԣ@ &O-P4M$`4~`=@PȔtȴ`0 `4$$p0Z$ dQ Y  Q|x$0l P0\$\40X4L@4 ( 0$噥!PS pP iU Ut @DOo0B#10<13 B0lS010S P  ) RppmC QtS`S FS4 9S/S0Su(#a0CS00 yES2PPS2P9Pu 4PZ x/PP[ W|2 @|P[  dPW @PD D(2!00=2 1 0 060S1/ P* T2%,00!0 0 㐡v0,P 嚰 D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/dPk0SPP54Ѝ蘶+++а+%hP&+|++`+42 ذ+&m %T+@ &1 -_I@-+@-@M h \0P0 0D0@10S  10S0S@ЍïP  h00Sß0@\P 0 00Sˠ0S 00P0P@0 S090: , ) ++`+\+H t A-U`V7P@r @Ptpk 0Ph% /Q4 Zw L:ypP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T , P004@Ѝ0400/S@P w w w 㝡PcHc@ 0SyQt0S Vzp=0#Ozp;#s00S: $w`P`|` R  V \3Q 30S t*: h wPX3c0S 2Q P Wo2: @vP 2 : vP 2l!: vP 2 : vP 2 : vP t2!: vP T2h,!: vP 42L<r> 0@4Ѝ0+%@-`0S@ oP0S 0000q20\ @~+Ks@-0Pl00@0p`h R R  l R  T8E03/@ЍpQ P%<%+HA-$q`AQT 0SP l@P00000P P0 P0 tP  dd审\ 0H@H  "  \ %+mܧ Y@ &Ę%a+,0@-1s0S 0P I_%h+(0@- 忛@0 כH++@+p@-`BM P̛@0 S0`01s0ST01y0 o0Pn00x0 ␛BߍpB/ BR 0⣛00P y0001@+%>h+H+ 0?o2 0/%H-AM Mzw,r,sp00000P0000@0 mPڶ0 đ `P0SS WS BS 0 +PP  Vdq0S 10 S0Y`  1s0S ؠ0S Q     |P Y 0@^S00CS00 S00 P0S8+9 \+++%h+p@-PH@P@ppP P iP @% 0/@-Ro/A-@PP p 00CS0 `V ?PPxݽP0 P00XAK, 0S P0000 !0S0R 00 &4 5A-A`P0E!S qp0!0P0CPSJ0 `00CS`0p S X0 X 0P"SP, ㇠0SP`0P0CS`0p SX0 X ! 5X!l-0 0P0 PJ000P lP0"S0T0A+80 0P0 pl+&< &H BX@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 JA-x@_P0 =`P`PP2 00pPF 0P 1V @P  @0S@0SؼL+00@'PP?P PPP P 0!SPc\l+X%JUp@-@MPP\1  @P`u00u0ۍp0 LP 0@ 0000S T2  P00 f (]P%lĻ+vp@-`@;PP 0 41Up$P`@pJ7@-@P  做 R z v@T| Ѝ0(R( d0P0P O<+P K(&P \+[f@xt yt _p+0@-@M@0(@,0 0 @P Ѝ00,^x0 ⵘWPPPP0S p00@SPG p+%\+@-僝 (,⣨p+@-@ X ,~mP L$~ V0P3P xZtX:h  XC0~ ՙqЍ\+xt yt f@p@-0M`5PPS 1<1s0S |+xAx7 0 9 0} < 4S,Q( ,0F R.  <P 81P` }0(0S r=R 00FS0 xhޜP0Ѝp\XTP DΜ%\+& Xp+D S(7D@-0 嫗@7\+X-@-|7-@-|0 R   ЍЍ/᜸+-@-\0 R   ЍЍ/᜸+A-ARp`P@1T ppP)D`@DO-dM@P{0P 0X{0P0 0 880 0(P400Pp`,@@0,@ T R3 U&T  (0 (d(0Jp ` Z0 000_o 0,@ @,@0RT ZPPU  w 4 JR  (0 R 0S0c} } 0S dЍU 3 ` 0@D(0,@`E00(0 RR 0;0@D(0,@(0 R0@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80!()PP (^* R  8 %Q  R P`(0cplh`8@Ht  D  $P $0`000S(0( 08 40TU (0 Q@D0T,@(0UT(0 Qt0(00@DS,@TcqJ + Y );Mc{ O-lM($z`~zPVPP78@ 00Ÿ   0<0d2d@0`2 @0P 00B@P 8/@P @DpP@0S($,P @ || [lЍH<`@40S( (寕 Px  , Dp, 0P¯4 0<P00<P<  B,$( p( ,0RQ @(S<`@ 0AP%<0%8s00%4s00u0 0'<0'8s00'4s0\ 0w0 $P$@cm % ! 5 D V C-锑p0MS@0P t&`0` 00[qp@  -?sp i@`0 P 009 pppppW0@ @ [@Op`6t0` }> ?@d 00 S @. @ C< √0ЍCЙ0%g     &2 A-MpMP`ЍA{0@: SPPT@:y`P00S 0 00hQTP1 ᩔp P PU0DsLS<(    [-+   O-0]M-SP MPP50S ]ލ ЍOv/c]ލ Ѝ@p •P$ 00S0W0S 0Sl ` xpP  @pt0* R\ D RP 9PP,pu E`᠕P =a0v: S+ pI & 3 P@` P|3z  KP pd ` 0 0LC0 00 0S0S`- P`A`v `0S 0 =ۓP |V ӓP `z{ R 8MRK ᩓpP Z P w!1Z[  0᧓ .ޔYቓp`l: 0S'HQv00 0l! P: b  0S- hpP  W ]ލ ЍOzP-?g 0SbpP P : R S00 R0S 7PPdST}Ꜹ+%-  ̏* V 8  d y     ) &E N 0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@  uP HFP00S D00S  40 -F!bNXD밸++4+%@-HT@-SxPp@-P@yp 000/+p@-@P0-S@@p GP0Tpp0p@-0@S`@MP0@   P@ЍpPU P ^v0P0H%+] @-@P @i*00S@ +p@-@PPp00Spp@@ +A- `pP@P000 PP0 0;S@-@P P0P00S@R +p@-``MPU= 0S: QP1 @@?T.  \  `00@ C @ F00 *S ?0`?1XP10EE>P `Ѝpm dz 0@-08EP40&P00P00FGP00P 84P 40P|4 t ldP00\<P00D< 4P,40$p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@8+t,@-P X00S S 9(,0 @ T 8+p0@-@TI0 qp0@ @}01p8+t,p0@-^ 9 @ 0@&)60 P@ ^@T8+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/8+P0001S0 0/T%7@-P R I0 0#0 Ѝ00R 0@!"0@@qp Ѝ0@J?8+ 0@- 00qp Ѝ80098<@ q|/ 00\ /8+A-p`z PP"@9  @0@  P09   U 09 r`A+8+@@A-p`VY@  @ @ 0 oP0 0y0 T 0 0o0@A 8++0P /8+\ -P0S0@  / P2:1S0BS /C-@,QM@`@|0S1U?:ЍbS7 .S6 00C S 0  ?OP w>cS@U:l>0@0CS000000C/  0?NP @@@D+D+ p@-@P 0S`PpPQ P@dPQVL.>lP0S  p P\%%4A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0STP@u0C?o2D+@-XMpL@DM@M<M8MTr,3,!4!!!8!!g088 0Xl28Q V 0\48 #Df  00 Q XPP@30S |[0S 0S43.P ;P b3Pa0S HP R3PQܢ0S'80S- 08D0SeVYP0SeVi0SM /Sr *S1 S S(P%UJU!$"0ES00 -6;P p0Z 0S :10 i!A07S iS U U[00E.U S``dP eP PP0S`<0S P0 FP xP <P 00`P iV\0iS 0 $( 0SXP0@T_U0 ,0S U U =U Y\ P(+(++t,+++* ̉d++ +Ԯ%P%>P |+0+`+H+ ++خ%`4̸+_l{Sx+++%+\+p+0+++U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,Y~P& 0e`0,0\0@0S 0! [,P 0Sj-P *a0ES000 *P *0 /D: 0*U @U !U<30S 97R0 <430S07S ;07S 00#p#*.10@S0 @007S9  P 0S S30S PP d0S7 40Sb 1#0CSPwd ;P $0FcS00 0 e`!0 S $0!R0)?040S  #/0 S 4%0!R0)?0 c!R00 !ı50S!R0 !R0 0!ıy v 5p 6!R00 !ıd(60S!R0!R0 0!ıR !R0})?0F60S 60S <`@0 S 0-70S y0 S 0  6!(gR00 !00J 0R eSd0C0<0S d 0!0<0<pP0miP0b!`Q 0!(8 S\Pq3IcG\80S0SO=F @ \8 D 8 H 8 qP- ;,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ıp ` `<0P 0P0 0!ıP *P r P !R0p;p; 0>P }0P0 0!ıPs !R0;; 0i0P0 0!ı=`P \ QPXQ=qpT 4< ]P0P0 0!ı=`Pl A0P0 0!ıP 5 3=1<`P3)P #!0`0,`LPM(P 00,00  <=0=0S:P V<H- 1 0 p)PP U U ?Vc!P0> ]PP U U u!@0 MPP U U E!8>0S %L9PP U U.P*!0P.% (P0 0S .00S>0գ?00 ϠR0  B  ? 0 S /00S0?0գ?0/0 H 00 `? p?x?0S080k>00S/D+@-@0 S!0O-S`PpM`^`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0B80  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 r  80 -^P ^ [0J0CD+O-pZX& RP P`P|` P [ ``F 0R@ 0R U *0@S0S  Ppp@-`R P@ 9\0P @@@ 0ppM-@p M@p00PCu RT0Ѝ` `?<P ?0 `P?~<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 4+(++p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#h 0 DPp@{T ^gP 0S0^  PA0dP fP pip4+(++@- @ @t+ @-p@+t+ @-p@r+x+!2G-pWuPP{ P0`upЍ[@P 0pqpF\ uuu?SZ 8\0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*p꼸+|+Fp@-p@`PP;O,;0XV@` ` ;D Op *pt+F 0 t+ 0 t+7@-dP@ PP 0S  P Ѝ0t+Po/@- * ЍHA-`QpP P P@P%U0P 0 P l @^[T @P 6/PM[@-~|0p p0h hhP 0X X@0L L8P0@4 4 %% ( C-P1M0SL @10SH 410SF Pp` Fi0@?oPU20S@ [PWe@UTЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P fPE!U@@4+0+8+G-@`M0PSS00/ @ R S"\R" :R R DZ Pp EP 0H3/0S@00Ѝ P/@-.p P' w)oZЍ00S @  df)\0PT T L' 8Hqp  H+8ZO-@`\P~PPPpᔠ唰0SWpV  S P0Fp@ U0 PPUP@ RpP SpP%%p@-@QP J0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`= PPp@pWp@0 0@-M * srp@  - PP  000Ѝ0++400S/@-$@P P@++@-@P  +P/ @-p@&&0@-M@%rPr00S@(aP DP OP AP dP oPiᆦ|0t00SЍ0 r0LP 00qpr00@E(+0%O-0M0S 0S j0@S T { P 4X ЍR @p Pp 00t pPPP`\P# LP  pPPP 0S P``40SWPTvPQ ((@'#PP3`00P0`0 tP0`0 -P X ' X0 cqP% 20SP `EP   @' YP qY |2 pd T2 KD2p@20WF0b,2P 0S P (rP11P %0S (. 1X P DP Pd1 ,XL10S %X 010 (0 qp 000Sp 0 P0P L% 0 R  [ R 0 0P: l X .++ `+^+H2ظ++++ĸ+++0+خ%+t,̱%P@- 0@+00@-[P &@+`A-P`XpVZPU@JT[jP0t, 0 +@-}P@ @0 + 0 + 0 +p@-P@"@P Pp@5pp@-@`P(PpVU p@ Pp PpA-@Q`Pp _>W:WU|G-@@` PР @PUЍppPW7FP W8p0SkЍG+@-W0@0S @y+0 R/%R %R0 sR0/@- @PP +G-`d4d@p00CS0ᚥPu U   0DIS  VVp@P0 P00@- 0PMA-@0 0pR`@0S00 R0R@@0`P0S U  P@00%%O-MpG`@ P!Q[ Z@P[@P) 00p00 0sЍPP P K PT VPAP !VP00pWp%% @-@LpgPPP Ѝ@{7@4@@\`H0H 0P0sU d@U Ѝ[ĻS& A-PPЍ0S `p @@@TPP D00< 0`rsW nPUn.@-@@ A-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0kU@++C-EMP PEߍ@ 0@qp `,onPڬ嬐P ` P:T0S EP @  f0pS`P  CP@D++A-kT1@0SFn <1RpP> (Fa1P9`6`3``PZ0p000 0`00rTP@pW QpTW Pv0STЍ 4QT@꼸+`%%$;0A-0S@`@P0L Vr@pQ`PT@TT輸+C@-@@@P ,;P 6o` @-M@P Pۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` `P PP <7#@ ЍoP lPP  0 q T P TU @T ` vv`=mP Ẅ@T@P@T 000d0r@P<`)@ᡄ0SST++V`G0A-`V8@P"pP0 PЍA"sPp` @@@@+0 `pqSS@ST ЍAWЍ輸+v-M 'nP  @oЍ0@-@P0MSP @SS nPN @Ѝ0@T@0: S *@rS+%%@-M@nP͡0 00Ѝ0@-M0P@ mPh0 R\P0 R\ tu p0St00Ѝ0+++/S@-@`P P0@/R@-@ (0@0T[#@+@-40 R\00S@,@++h00S /pp@-qp 3#qpP@ QPpp<+@-P#P3#0 R/  +O-q$M0S@P`0S\0SO@sP`@@100CS tDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000` 0 0000000P0 000`0HP$Ѝ+ +p+(++0+O-M<`p@P8@V |30Sp30`So`V L3``F`V`utV-,0S 300CS QP ""]l"QP ""0S6 O`+20"`Px0X 0SJY/Y @ Pb"VD"0 <0 ut (20S2"0 000 [0 0 10S*P10S k*qp@PZ |"Pw"P<1Ap"P  !qp 410S E"P ЍO0G0 0 ЍO"V utS 00St00!20 0Q*)@P7ut`b(+++X+%++++P%+<+++H00S <0P/000S $0@///+++(+'G-(pP@,`oP"V 410S(1`V``ut 10S100T T0 00'*`*00oᨂY Jq)qp00S@P W ЍGo!Vi V %(++++X+O-M`aP P @+P! ЍO!qp@PV00SЍO0Aq!P0 00@WЍw!pP@PT p 0Z qp0 @P<+(+t,A-p` qpP@VЍAu   0@2Ѝp@-@4P0SPpPqp @(+0P  P/ %0P  P/ %@-P@p@-@PptP0S 0 0HS @ 00C0"P Pp@P  B 0+ %+0/+G-`@ qPU  P9H DY* OpOU&8c@e{0 "0XPP00040000 (@0@000S < 0P00EP   0 %+P/P // / /00//000////0/0/p@-@4PPP O4Pp4/O-M cDT {rPX  0  (AP  0'XQXQ> 00  0 'P*Ѝ=ЍO <O-P@4M(0X0 ,0ut@6 P4Ѝ40ST400 ?QE('@PPp,d00 0lp P6s[  ` ܳV0+5 cp` P P@Pᜣv V{" `?V@P,0S0 \3Z0 A'D30pW06 0$~ `P" R $0 S S`" P P  `VʏZ: P `@T_A[ x20S  P0 P (0 S  $PQ20S 0 @ 1 R00 SA@ P Pd p 4ЍO V  P0 0PA R TA0  Pp``@P41`!Z 0 0@P_ V V@P P P P P@Put 0 0@P_}l00S V V0 0 0S m@Pz`0 ++<+t,0+X+p+`+++7@-P@P ,0 R  000 Ѝ00+O-`P P pP@000S  p@`+@-P @,zP00P  B@?(+A-p`Yqp\rQqp@PA4X0 {P0T0A ]xx+0 R R /@-h@M0 M0P`p0@ h P*`0 h000ۍ Ѝ+0k*p@-P@@Ppp@-@P \R ^R3 R   0 tS jSbS4 0CP@S 0 S" 0 Q ŸkC P eS  00C00C\T PQ  p2 p@@p 1@@ @@p@@p@@pQ 0xS QSDSK #1SJ BS0 C^Rp!XThdR C&R  0 !@@ 0000 0000 0LS 0 00 060S@@@p0 000 0000 0 00000 R      R Z+ X%+X% SO-PPAM@MPp㨕ep!PH)(pD)0,p<00?)pQp L5@P8u 0hpP!0 0 0P0  P  P ,00 'PxAލЍ Pg `P\0=Z* !Z' <Z 0J^S0͕ 0͕ 0$ugv>Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000S@  RG = Z* P+R( PE0P-!$,P3% R R R000#=R00S 0=S P,0E0P0 S0PS   Y PdP P P 0Su p0P `%+%`&ĻSAbq$0 RP  /+0 14/+0 Q/P/%@-04 ,    00++++G-P㌐剀7G@3GPT`ppP `HT \H  !  OH MH @`匀+A-8p@0PS` 0P0aP +@-@$ 0 @z+P 0 R   /+p00S/p@-`@mPPPpP 0S8@pPp  ++ \@-8@RP000KPl0 0O  K;D0&<&8&4&0&00d+Qu+++++P/0/+0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00++++++C-餁P0@SpM`"p`xx!0 0 0S[0@ 0 1 @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP+X++(++@%8%$+,0P$0 00S000/X+$++(+p@-H@P0S0000p01S 09&P++Pp@-`0 p@!X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP D++++++O-`CM00dwvP1S0& 1S8  0A# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S k 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[/0 `0S% Uz% 0R 0Q0tP 0C001萄 S vI  0++(++p++<+A-p00PS` HP ` P 80@0@D@ 0@0TЍ++p+p@-P@ 0p@2A-`p@@PGE$1S 0P $@@4+7@-8PPU p Ѝ0@@ @ Ѝ0+0 (! ,!/+0(! ,! /+P 0@-P/+P @-@P$0P/+P @-0000/0@-S@ Q) 0S \Q@AOoB@0Sh Q S Q000S0000P) p@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010vS00# pP0Dv0q# 0dc F$ F# 1R P@#1 PR0(d0 d0 0  0U*P0C0#0RD001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0[P 0S0C 0Q` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh bPd  0 ЍG*_V` P V10S t! RS 0  m_PP P P0 HPPP0  B01S0R4AB @D pP@DT0CR0S*A8A@DvP  0 )0S pA++++++0+++D++%L+RCA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S Y00S$1R0$aʈbPt` F F)00z$<0u0$10P0 0S $+++X+D+4+@-(@0S =\00+G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Պ0 0C0S [10S0 0S N G7 GjY 0 0R  7x00S U d00SX00S D00SX    +p+@+<+++++<-0 R!  ^ !0+04/+0 R 00S P@0~0/0P 0/\!4 0 / B  0/+d+ 0 /+qp/G-p`@PSpP 儐u U 0 6 0W 00V@00CScP %P 0P0@P+t,PG-P0P`gPpЀ@ 0@D P V 000U00C0C0y Tʌ'P 0 BJ 0 Q@ @D 0@DSB+t,G-p`P@0@@0W  S #R0C00C0Ѝ RP   ^A 0 rpGA-0PP@q1`EP q 0P 10+G-1@l`Pp0XXqp00 R00STDP0pT@p+(++p@-@ppPT P0S0Ap LP%@-p 0%80P/ R/0 0S 0 /`+00 0S/$0$ R `+++A-X@ 0S0dS 0p(0,`P` p U` 0`+X0QH0H 0.4 00/ 0 0+`++A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0`+qpO-PP10SPU @PP0⼡p`@` V  RXWA  0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@PPAp ` W0 0K0  0`qp @TP+`+t,P0G-`p|PU0  SXW@ U W0S P)VP @P P`@V0 0 0 0@00qp0SP`,Ph`@W 00 0@00qp0SP`V@`+t,G-`P@Tpတtu00V00S 0SP@`P@tu TUP(+G-@Po0p`Ptt80@ p 00 0`Pqp080]`+t,800S/,00/PP//++00CS0 Sp0 SI^0 p/O-0P-SP   ~ ?p! bgXpXP_X@P0S,5@ 0S 0S%,@T @>WBXW7WX C A  { 0 $ ЍO6`P @@ @^ 0A $ 7\v>[>+& G-@P $`P( mpP_ `w   o@yz  0Z Pp@ ;p Tt p@n P 40 w p]V+C-`Gqp p]qp@@PPU.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   +@+ +.Pp@-9 $P" 'P= P !srp p^P 0 &- &P =06 pPtd0`@P\0 L0Af&P,@md006p++$(+@+G-@p`dP4T#0 5T Ta0'0s000Pp0 a=@6T` P'0+@-o0@-MPh@P  ' srЍ08!P 9=0 00&++@-HP!sr@e 0! 0&+@-\ sr @@@60P&6 =0606Ѝ++G-6@PP`j>T6k.sq 00P6 <06PU p<P0PPЁ  G P ++x+@-P ,0 0R  +#l0@-0`  ^ @^TSa04S '0s05S #++0@- @P0 QA6R 00+G-pP@P P8`Pr<`o<p6W @+00S/A- M`p2[@qpp6W @ Ѝ 0 PUP4P P0 [,+x+`<@-  0mS Ѝ 0 Q0 @@P 0 S# B PPP0`0 S  Q0 R pV`PPp <px00(+17@-PU0P( P@ P\0 Ѝ000S@PP ;P>;A Ѝ0@~H00S< Ѝ0@ 0 0$0 꼸+K+m0% 0 +<07@- R P(0(@?@0 Ѝ0%(+@Bx+@-P M# @0.S 00S Ѝ 0S 00 00S000b @ ` YP0@ 0R 00@0@$%x+  <07@- R P(0(@?@10 Ѝ0%p+@B\+@-P M# @0.S }00S Ѝ 0S 00 00S000 @ ` X3P0@ 0R 00@0@$ꥉ%1 I \+_  { @-@PcP  @ Ѝ @-@PP  @ Ѝ 0Sp@- Sp00S p@t l0p`qP p@+qpP@ 0p@ 꼸+ +x+P07@- S Sl0 Ѝ0XP@T0PP p:c@ Ѝ0@g:0 00g %% P/L0@-0@S 00 $0$ @+++P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P: Ѝ04@P,0  0 10 %%,%+H0/0+P/QP @P/G@-@S|A pl,@0TxSPLHD~@|<z8x@% !!*!S!!!!#"W""@--0@dS!@S1 CR&0C  R  0Q0 . Ѝ@A C#R  k Cr Q 0Ѝ        @^P @. +"9 ""O--PN<M`00P@*0 S  ?  0p00C/  0?pT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ L+H%L%@-PMP M 0@Nݍ Ѝ@` @90Sp=0 6 x@ݍ ЍU XI9* H 6P0S (8H%#L+L%/#H$#P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000%%?#c#@-PM 0  0 x0 u @lGd P 0S>000D ;0Ѝ,0P tO`@+<+m#P @P/f 0 /#и+P/00S4+0/@-@0S=0+0/@-,@0S0 0@00Ѝ(+#0/@-,@0S0 0.00Ѝ$+#0/400S/(00S/@- qp@++P@- 00@ ^S00S00 Ѝ0# %#p@-P0M % @!`P@@0,S  i0S 0 ,R 0p 0Y0SX 0Ѝp40@0000$ U @+ + $$$Z>$0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R  E C R    C R  S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  ] k y +[$v$800S ,00S 0P//t+ ++$0P/0 0 0C/|+(++A-PU  @Ѝ`p@HrP|`V 00S0\V0S 0S`@W bP `@$V00$D+@-0S0*00 0T( Ѝ *  T$+$@-Q00P 0R  Ѝ$$@- 3$+P/0S/P 0  //ỒoP@-/m 0LP/+ 0@-L   Ѝ+$A-`@Pᕼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍeL0 @Pp88 0 R @@-PJ &$PP 0@s093@!+P0P0h0 P @0+S9P 6‼69P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PmY   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0eP.00S +++L%%$ @-@PM @PU`p0@ tRЍU  i  B U Rz  0H"00CS0 U0S U3/U@`x 0 AV00SXS^U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 P W 0  0S00S000ESU U U J 0S0nPS000 00SD000V T{%%% +%%&p@-P`@ᵺ000C S0 ` 0 Br ^ ST00p pS 00 000S/P/++@-XP H0H@ 0S0S  0  03/$@,&+P% 80S/S/ 0CS/$P%O-@pM0Q 0S [; 0S0 0 Ѝ`V$P  <0P  AAQ-P $YQY0 C0@@Oop B0 0S `0 0S Wp0pP%@-'PP0]8%/@-0M @20S4P 2     L2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  L2 P!2 R@ r$10P@ 000 0 R  RL0 @000S T0 0S T \0!PL 1 10S 1㊹0Ss 0#So @++,t,+L+%<+%+@-n+@- . Ѝ@-PI5`c@`@@ሹp0 `P Ѝſ@-@<5P  ,0m8+G- @$pP` 0 )!0 ڬ@@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 KЍMb@B40@-0@@T KP  0 %++@-@0@%0$R/ $峾+p@-<] 0$+@- R0 0S20 P00S@To p@- 4@0P 4嶻P}p@ X00S#żhd0`l`P}빼H0@뭻80@0@S p@ 0 +H++%+p++@-0 0 ЍS87@-@PP Ѝ0@(0 0  ~ Ѝ0%88p@-@P^P $@UP g800S ,0 QTȶp p++@-@1P0pSQ 7޶000@ @U'Qζ0 0 R0 ?o2 `;P J0W Ѝ<HP t;0`70+ ,+8@-@P c*000o/O-|MpP @`< _1 Y0 \0ACX 0s0^YP P0@ 0   W" !Q0S|Ѝ@00S0/0 0 0J P00CQS 0 XH R 1 @^AA0 +/8p p p D00/40@$0@0@+(+800@-00 0^ʎ1C0@ @(++@0@ 0 C\1/0@-ACL\@c0(++0@- @P 0000CQ0@ (++`0 0 P0H0@-0^@P C0/+(+<001P/ R02:/+ 0A(+0Q@-@ q1!0sr T0L1!0sr $0A Q +(+A-pP 0RX@` P.X00yvt 02C!A`Ѝ(++ 0P0PP@/(+0 :Q Q .Q 0?Q  \QQR/ R//A-Hp`0P; R@10C @C" 4.0000 +껒p@-@XPqp00T00S 00CSp@u@qpp(+@- 0 B Ѝ@- ; Ѝp@-0@PS b0Cs0Spt 23p0PjS BS bSp0mS tSpp0000kDx+p@-h岴d0d 0`P;@BS⥴N ⡴,PV❴⚴p +o +%C-U0`S$M@p`d$Ѝ:S/ %S .S 0 pU@0S0S ?S \S0S 00@ 0X 00~xX@KXBX] DX. @4LH,X؀ PP6qp@40S(4 yP40S K30S qpm P j Pc P3 qp P$ |P0/~tG P3"Xq 003BH@6Xg Q0R 0 Yqp 0 O|2MP0t2t"0 \ P B B?U8/qp20 PP01P 1011]1Y1Tf- P \1L0  0R0:P0P P[xy 0RQ u0 ˹ 0R0:|0P 꾹lSA Pb ] PPP$0dP +S+ 0++`++ +(+ȸ+K0%H0@-@@00SOoBټ(0(01x 0 ++ +%+0l% p@-PPp P$R@ @Tp `$@R@p\ @R @T @R \ p @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P ,00@p@-@PT `0S`0 # p`{0@w0000 S`@@0@A-@QP` @$ @4p0W0 S 0 R 0 0 ]PЍ A,P 0`0T X0 @P +0T0 ++`+ ,A-`pV@  ` R P ( ^QPR(;P" ^ U!R ( ^ P0 0 Q P$^U $CP 0S` 0 00`Q!PQP "Q P \U!0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-oP/ ,A-`PM8@0C0ppG4 Ϧ AXЍ H/o0"^ R  ? 0Q 0( XϦ@8,O-pP@$M0P`@0L00SF RC L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 00L0`00 0C=P$Ѝ@ , 0   / ,0A-0@S uPT(`V0(0l00S@`p f(`qp +Z}@00CSr+ ,+(+1O-`wv@ 0 0РS ЍO;00S 6P@Đ00CSL$ ЍOڴVqp O 0ZqpV Q  P,d@ Ѝ@%+8%+(+p@-P@T 40@@@ @p `))@ ,8,p@-PH@U p@^Qp@(0?o2(0 ,8`,p@-P@ݹ p0 0P !U@p`,O-M"X70@40pw@780<047 @%70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00 `$0000x60(0, rs  T0000S (0S0 00000S0S$Ѝ00C000 L0H " 00 000zy+  0Sqpqp0S`100 00S0 @ y40S PIUPe U 0B 3Pm40S 4L HF0x4Pt4U 'VPR \400PL40S 8400S0R0S P4L0SPr`rP L0Hw3PPU7  T  qp R#T0'`L0 `    h  D0RPD0 T 0P@TX\Ph( f( P ` @ PUeP  0 `hPp`PL0 )P  000 0`0 L0$00CS$0P20S t000 0`0 L0u408 CPPI h0S8 Z5 ` p J!` 0C Q00_0p 0S0' 0P a 00o0 0S0YPPYP(1Up1' '0S0$0`P0S 0S < @B X0C  BSp aoZ0Yp0pP0p+(+x+++t,+ + ,++++`,+0++p@-P@ܷ  04P !U0p P$@`,p@-P@ķ  0LP 0 Up PS @P@`,p@-`@V000P0S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp pX+@%8%8,+ ,p@-P`wU 0S0P@T 0P@|0 pP '@x0 00000@pp@&0P00 ,+@-,0PP ,O-P3@أ0 404M`p 0P 0 X0`Sp$$P4Ѝ0  $$X0X8< rq ut00T00S04\0^ut 200@_ut$0  sy00 $0Y0 @$Put00V 0S 0$0(00X0 0$000 P#srG RB R 0A0P 00<PP7 0 Dqp@PK a%ut \0@P100@_V `p000/V0V`p ` p @ P0X08< Z000rq0S Z0 _P 0  0qp`p000 040. ,+0@-MP @tu :0 Ѝ0@- 0( 00S@ ,+h0p@-@xP HP0 pp000S(0Sppܮ% ,+@-$@$0S000{ @ ,$,+O-0 ,M"0Qp 0SGPy pC 00#  \PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(09P2 X`@PEOqp@P[iH@PutTXPJ1\R0 0#Ip HBHb0 0 0(0s0S 0S >20SX` 1``FxZ@P 0 @PX SiX12`[@Put0`V@Ph=Nث 0@ P`p 0RW 0` ?00h 80 ,00SACt,T +p+(++P+G-pl0P` 4 @ ᝴P 0S 0S Sx,A-` pPB@<#0Up0P -#p@-HP@T 80   p 0 ###%x,O-0bAM M }Bp#W 0A 0β EPP r0S0000Aލ Ѝ0!S  PA>004S S S ၩ0PS  0 QP04 n0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 C%Ļx,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c PU Y< 3T S+FP2@DPpp@  @@9 0 pW "x AR@ "T<"0S000P ;04P S@ . Pp 0S 1T DSP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S { P w? U0`00002x,%&t,L&%9 49Ļ0@-@ղPβP |ɲP lIJP \忲P 3;PE;%?9E9L9R9`@-@PAP P@X9e9O-x1M0S" @`0 ЍOkPp000 0 Ppxy@`Ѝ00S 000S  0P @`RW 0 00X0 t! r! 0Sx,t,~9++0@- LLPR^0S @T 0 Bx,%0@- LLPR^0S @T 0L Bx,%0/x,0/x,00S R/x,@-KP U:PP:P}@-0,//@-L@T 2p0 PAS0PЍ,\ QR0* /QS QQ*/0000/@-@P 000000/0S0C 0//0@-  0#A3@0@0@- 0@SPR? P `Q  % ` PЍpA-`pP@T@  G-P`"F$@p(, SQP 0$ GfFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0  PЍp  000@@0 0 0 0 0 0 A-^\^1!0 [h ^Q1!0 [\=[^Z ^\00]QQ$ ]Q0\[Q`.FqQ5 `@p 0]QV 0@Q0 0 @\\@0[T T nT  \TR  @0\00,,999p@-0Pt @R RP D D < @D@ p@踚 @L&,,:C-1`pMQp@P0x `0Y 0 *PH D1@<1`0 $g\Y R T R 0 0P@ 0  [R .0Bs0S83 0  00]RT[T@ 0QT 0QST[@[T0Q[S@(0 R Ѝ,,,3:,00@-M M00P/S $S+ +S00+ 0 0 9S#\S @P0 0 (g0IS@P \00ۍ Ѝ00@00 S00@,,r:I:O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S0QU 0VP0 0 PUP @0@ p0 0fb`P=,P,,,:O-peM?Mo0 P\W ?/0 f00 ϟ0S?/0 |0^0T/L? 0XfS ^@/?0 rf Q 0S 00@00000S 00@0p00pS 0S @P#S ;S 0@0 P00.P Pn 0S @,S|P0S 00@P  0S  00@aW=-0 (Q@pQ< @;Q }Q 0,< 0XP @\P 0h,`< 0CPU P@00,(< 0L5H < <P  <<0 \\^ ^00\ APP00t0I S kP0S 00@TP;0S004+4*6p ne:*0 0S 00@l0S 00@`00P0S 00@|Q0S P @0SP X 1@( u9)0 |RP0U 0 WPx9x)0 P\XX898)0 Z$ M0P8(0 TJ4%]P M0!0 < 8 SR$0 (   8%00H 0$0 PP R00C0 0C S000lX,X< P07'0 8\RH [IQ␸0S <<00S ,l< 7P00A g 080 [%] 0  0S 00@\0gSk a9SX0SvS S 0&6 0[08 9R/RR0C8 &R* P 808z\R \ 00BQs0 S 5%0 T S00( 0  \ R5%0 n ;Sf IS00pS wS, iSY 5%0 R00vY E0"S Y4$0 5K  0S 00@<<0 [  RR < S 4$0  W04 0S $d4p 9  U@P M[ 0S @;S ABe0110P\SS434#0 %MD  P2"0 < @P 0S 00@0@ HzpUch2h"0 0H hp Y (2("0 20S%000 S90S 0Sw @;Se }S 1!0 <v)  9099090H 0خ Ԯp000 XH 0S  p Ub   pYP 9)0     呻!1 ! 00 $(ܮ9 09909 l0,L& ,,,:4 :%;!;:\;r;;;<, H<4<A<I,H<]<{<<,E==<=|===,>t>>> &?0eݍЍG-@`@tp嘀PU@T00S Eh0d0>T0 0S0 0, P,,,P,,,,9?p@-P @ 000P @pT%@-@ 0  @0T%0p@-PPUph8@P 00CS0hp -hp0 $h,ĻA-p`dB R3 RQ R P$0SV0(  R R CV8$0P ,aP0 P0!7PQh$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0g( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0,ĻH,6@@-|@X0  0S 0S00CS0gp X70  ,O-DMX0`SpM00S 0S .a3#X0X0\030 `00d0崓XSXP 00CS0 ~gp XX _#pP0 V0 X PލЍP2 gp0S 301P 01P p4S 240p0p4S \PP fP 00\01Ptp0`0d0S00d0000S 00Sh 2P0  `0 2 01`00S +劘+V P0 `+0|+0Jxb2Jc 0d!5 P*2\PP f46P\c ( p$p~1\0pp!y1 0`PS(0u06PX50[00.p0\`0P l000S SP@  0  l7(00(05,<@&F,,,`@i@H@r@@[A@]Ļ@-@RP #`@P@-@@P `@p@-@PTPp0 `@@-T`@PP z 0O$p0 G$ Ѝ,@-`MQqM0S000@03 0@0S { 0_ 0 0S S ` 0l"6@P *0 w5 Pe 0͜00ڍЍ,,,ſĻ@-@P  Pt_ `p\0 P `P 10P S x u_ Ѝ,@<:G-pA唁!0`PU , R:(,?0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0    0 ,L&A-@P p0R`*W00 ّ 0P P 0O-h/MdO0 0XPЍ08000C S0 0S4 0  P0 R `>0R*SD>0@o+P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S0=0@oP 0-=0C>S00 L0 R: L  0` p``c0Sx<fl<8 00 T\04 08<0S ",H0SP80S4PU 0`  EӜP0800A E4 ې0T P "0 t 004 0p 0 \\ 0@; 40({0 ,;0R$ <0p k0P 0S ~P 0 /P2S 0 @t`0S0`V: $k h00@ X:@壪0S 1 0,]  @0P y0 @0A [0`V: $8 5`0 0C0 4P 0`V:P  `  0m[ Wp  9P 0`V:}`8K8 30 aV :l ` 0 0p30 ST88 00  0#<000p00007< <0 0B15s?0 0@d,0-01S ^00oS^ P0\ S0S Q0S Rr P0S0S0 s00Q qR  8-,0@-  `Ğ\ @ T\    %R    ,8-p@-TA0 5S <0S -00$!<YPa0U&!0! R8  (P  F0  ,P  =0  4PP fp@800\P ЧP @ !00, P$$Sp8-p ,,@ &jp@-@0` \+T  .t/d lP`PT p lP000ST @&@ &cA,xA@-@P PD:@P @0?SP@ (p Ѝ/AP@MP 0S SDg4<0S800#XAAA@-  h.@+A@ &@-0@<TQ T00 T.0001S R0Slp@8TX` T@0$ @H48.T(8  @,/., BB@ &8-B$B-B@BJB@-¤ .*B@ &7@-@Pפ  ᨍ0S 0@T ɤ00 Ѝ0ä0"S sr@-@P  p WЍ@C<0A-@X``# ^p "RG ^<0d#N R 2p% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,㷞0P01p蔇,z,01//00/00/00/00/00/ 0  / l,> 0  / l,00/00/C00/C00/FF00/C00/C@-@Lr,00/@-@t, 0  /L, 0  /L,C 0  /L,C/00/00/00/C00/C00/C00/C00/C00/C00/D00/D00/$D00//D00/.D00/9D00/m00/00/*00/00/00/CDsO/gb@-0  0Ѝ@-@ +@-  ,r0@-%R  +@-  ,k @- 0q,t, @-tx,(0@-% R t,  @-LD @- 0Iu,Lr, M@-Kq, @-  Jt, (0@-% R yLr, < @-  p,,< @-  g)o, < C@-^Lp,< @-  V+m,  @-  M+m,  q@-DT, e@-<z, e@-4z, e@-,z, @-  $,l,  @-  r,  @-  *n, @- 0},z, @-  ,, @-  )o,  C@-Lp, @-  |, 0$S00 @-z, @-@D(P d 0  eS 0@-0 |1忇蔇, p@-P( dP& <PV 400C`F V$P SuP4P 0CP  @@PL$p4P P0S 400C`[zk1SR !0C B/!?1A]!NRAPN P  ^Aжq0r0xP00S11A)zP`PxP@a@1S020-(PJ @$3@P, #0@S00 2P0CP?P <P>P P2P 0PUvP tpP1aCA P yt#y1S'ʰ1 4A P jtyP '00P1 RE40S 3/Pd PP d P,ЍPR0y :[ 0SpW 0m 3/pg P 0`@ P (t ~d `xyd00x00AM%0 b02P 00P000^xYd ,E@ &fEE-L&P -ESH&R^ b  001/,P0 R0//,O-p`*@PP [ ! 0P @ Ѝ0͕00 1\$<0<P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,FP/D0 R/0@-A1 P c@< フ,O-dBp0 W`@4f0p 000# Ѝ0P@P 0S 00@ [& 0 mP @V0S :V000 00 `[0S lP &V000 [0S lP V V0 00U P0IS0SPPl0 00l0S lt0#?C S UPU  4i0Y!0Cs0S( 23PP PEU ,L&VUUU @O-$MH0[S0P 0L`3Dp= G0Y0 0S 0g րeᰏPolpl }l@` 0l@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0 fUlX 2 e 0  B૊,S P0{ P>  PN P P!VUA`E D{{@DP`0ee be_e@`"PD P AP;  KR !   ` D0S{0@0!P`1 V0p00@  \!`Xw`F`FV0p00@  DPE({@DU`E¨` Y @ @T`— R   BT0S 000 0 0$ЍO0Y S  ,FL&@ &A-lP`Pp `k@k@0T `P@ P ^P ,@-P@p 00T0* p@Ѝp0 00㕊 0l` 0@ z|@t 0P e $% ,Fh0p@-P@XP0Ps H` R :NP 0S@@Q@pu$% ,@-@= ,0h ,0i ,-@-@00  Ѝ@ Ѝ/-@-00 } Ѝ Ѝ/-@-  ЍЍ/@-@@H@-@H@-pP@`M,0 0(L 0 00`Ѝ@- ЍSO-M P`@pj@jUiT0 0aP& 0#D0PSX 0SU L00SQD寍PPL00PT]y@DO@W <p σPRWpV`KЦo`0 S`K0 o@PD@0  9PT0 0P00L00$T *=Z  `p `u``Ѝ00D R00S 0S PL0X3#PpuoP 0 0p똰!DCbb <}0 EG-MM+ o{+L ;{+ g{+03{ u?P  i>ۍЍ0@-@M 61@@$#P @  qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$E*cH@P3P/[P+W@P':@P# 0Pz 9z  0S 0_ Z'P @P4o0m%(!*00z,,b --@-@M ⴎ0@@> #P* ?@4  qSP 00*!R00$Q )@P  0S 0` ]'P%|()Ѝz,,O-`M!  0X#*0S ` 0 SS 0Xp0 S00C `@I0 S:ᰊPP@ B pQ %S0S iSc %S, dS 00T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 yL&7@-@ PU ! O fG00 Ѝ0llP X= L 7 N걎D( 0$[*xz,]"2=Vp@-@Q`T8080P00S0S   0p@3xz,$l,ſ7@-@ ~PU  wG00 Ѝ0PP | d00S \L 0H[S0 ,d$l,>bsty,@ &s@-8Q`@7hUx "^yb|]bx ^nb^3b]4xd 0 Ai@Pxx=!3w~P >O>]] exЍp-He@ &O--}Mp@`  0$p 6V 0S  P R: 0S  똵P B눅P =qpPT PfUS L:/QI0B? 0K(P wFPP nF00唈P又P: @  t: :0S :ZP : <;r0#0w 4$"0}ߍ4]&3 340"!03140`040&2Ћы ` 0T40   T(0P400  @>"!!0#  PV  XT 2t 0S h2P tt?Ԍ0S$@0 OU0 <"QS zx1P T~ 1 R0V$2j@T 9 @>0XC0@0S@ @  0R0SQ ᨲ~0S  +P 0 +\vl0  PS $2 |z,%ptbtf@$l,xz,xɯ *n, ؽ,C(/0@-0,MP0 00 0\PPP@P DDJ@0Q ,D(,Ѝ0@)t` %@ &g$l, -O-iMs?!0ZP 00iߍOЍ/Px<`P<1P 0!00%`P z[p P@& [P}pT00Z%DU0P 00GSW 010#S 00Pp+P@ P&Ļ$l, Z-O-p0MT@X   p$p堠 `V  @P'U` [{PP"P@P T>H E0ᔠ PU m0'SP0U*S / ;P0 0tX/0 0P 0@ 0 0H0 zPX1Z Nrp`PUQDQ( =2S022SP0220C2  S |S`` zu$00 00( 0`0EVPMUS.Q _PPYV   0%S @S B* B◉ 0.S 0 0P1ZpW@P^ 0A0 0D $R&4e?Rau00 (k@0 0 (cPaaq0S  ZV0A 0E?oX20S dBZ^$?Z^[a.uV @ x 60S. `@7(Zu00CS0000CP0S \W$0S  `3QdtWU ^Z^X PYtjG0ЍO Ѝ/᰾̾xht@-&0@-CMlO1PP 0S .Qz@P 4tCߍ0 Pt , ,+!,G-p@ 圀PB`AT:00Y W ,/Y 000 yP EQ 0 @L&A-`Pp p@ ᆈ ,pt P{ @*",A-Pk@hopl t0S DQ0Q.SxP @$ $@t Q HVDDS75`ێ,Pz0尪S  W:-8 4e0 w=C$ C/ax H00Xx=0夽pQ>e0 sP400嗂0 P40  U? =Ur0YR? ;/ 0qp @*<: R0 :P'P P 0X60,09Pt<FI0.\̟   0/P `0< B 0 0u`````VP00ۮtl= *D00lq0,ݍ<Ѝ>0a X8s t偃pP  `{P pP;{ 1sS1lS+2 0P%QP ZP;npP`~, s*0x*0woVP\8 0\8WV*0yU l*0z\*0}\8@*0|w(:( R0U:$ R *  Q9ɟP \ɟW弩^ D9   +X9 @H- A|)0p 0HApp p=SrL9)10@@ CP 0H0 H0App  A]YpP( 0W` 7EHMb8"E'Q|%,LP[f$](",(,0HX}P 01/ SC-鿏`@(MPSP3S0 p 0p :00 0p@0p00~/00 P 0P/S/00 0 /S 0/0 P0%R  @ 0  p@ ߍe@-p`CM|@PlP#`0R\PP @ W<0080 `0(*PCߍeS(p,,,  t,@-@ @z,@-0  0Q P @0@ 18 0/P $  Ѝ(,< *n,xy,0@-0@XMPA0  0@) P x x0 t0Ep@1P0/Q   LL 1 0/R@, ,@ Ѝ0, ,L (,z,*n,(,lw,@-M@DVPkP   o o0 D00Sލ\0\ \P L0 (0< C 0, > Lp,(,)o,lw,,l,r,!P,T@-bCMX6S $P \8lP9XT20S H1\6S 81020" (1PPr 010 ZW:4S / OL\@aU 10 A:4!SO *00 0 B6x3||1@P) 0l )\&T#D 0S 4!4,!,0S     <TP\6S U p<uCߍ 0 B, , ],*",j](",{!H<$,>+!,*$,YHx%,8L!@-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%phЍ0L0 3/@P 0 @P  Q 1/P @ @t@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T B| p}P00 0S 0S0S$ЍP P00 S }S, R ,0S R : 8 80R:P3#///A-@M`Mp" *0P p Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTTA-`QM p@ LP PP vPЍ0}PTP0 phP@$U@@\T @ @80 @iP*8G-Pp0@0Mw'PP H`0 R - PЍ 0L03/P 0 2{놁0 ,{D @;$0S P @Al @=l`z,Dp@-P`o0@0S 0p@&ſA-0Mq!P0`L0 3/P< 0t@T 4/@0@P0 z 0z 0 $0S k$0 kT \k kz0S0C, &Ѝz,YڽH0S/p@-P@K 0000p@:O-p@P|M YH0P,0+`x,vP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00pP ,0<<0@Dr@0S @P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 @ @-Z P 0P 0Pp PQ` QTPQH "P <080P/,/(//, ?cp@-8@Q0@P@DPp y0PpH%p@-P@P  k j00pp>@-  p\%@- { ph%G-@PMP N/~ j0 0 s0S1 0S XP a,P ލ0S 0S1S P {P @l0 1h0$1d0(1`0,1>1S nP >(%0`>@SppԐ* `$g c $0HX 4` e0S 3Si Xt 2~ .~0`0?  `p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(Pn 0C QW > 0 0B,0!4!ßp0#0"`p`0P*P 嫾P ,0!4!xŸ~0#`x\2P  @000@A0("p!0N?P0S Jp }KR }0p0K?(0811n$10 100 h<@qx1fP0p( {1S%4` ␠0!c 0A^ 0Y ,0!!0#P c0@  ,0!!P0#O0h `j+:IU}Dt),QNEFXSuXL&'Q`@-PM`p PP 05p _@P  hPP 0(pP 4P 7/PЍ @-0 0P Ѝ @-0 0PЍ䨚 O-aM,MQ0`aݍ,Ѝ@|`Ph "yPP - TypP, U@"8Tf+"h b^+b~h`wP@``VvaV+"nh+bih~,P 0 R@3 PUFh0$P 00S 3/p0$QCbbn`Eo`YG_FPExP 0000!z8PP 00S 3/p003/pNo\RP 00 QUi $P 00S 3/p $QUZ ` p0 `` pxb.;8/ 0 ``px`;".6/0S.   g  h0 x0Uy`PU  b +`P"  <OP+"gb+K "`P 6xP# 1xP ,xP 'xP "xP xP VxT g  g` (yPg ,,H'Gf^00A-p$0p@` P AP0 @ p> C 01/@P00pЍpP@00003/003/$AmO-`UM MM.x0PeA{.={ Qe@,D'g0R@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯Np 54, Q~W <S <7h4F>D0C27\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 p0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @t00, nE "fx5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$#@`hT00,0S E 0S N?,$$L4pW@4 0}10  A :f "5f 1f,1p0!,1 101$14141(8H!L1 1$!0L1H!,/6$1(1\),0q, 1401$141(!>8!@ $$!pR  } C^yWw  ŸHp#0Ÿ$1P00$4;p2P p>ؠCT 2$10>0$108P00: 0 f0G5  5Sp Pj $003/$`uPK `qI!> ,! 5$F0@?S  GPkPC K;AS? $10С>C418!<10S4 @_ 0bVQ!!10b/?y0,1014181>C0(1}1S0}1$1S ` E@z,-&d ZHp%,,Hp,z,S$l,_PP$030/0@o//BO-@P MMAD0*!Rp0)Q`U0 $0 b  P ] Pp ,-*l'0`$0 HL$P7(pP 44\,4 ܍Ѝp 4*h0Spp0 @0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0 S "S S/ Pp  R <pWP00P0)l2YP0 U @' 'pP 0s P&P }d0S !88 ⰎQd0S !8\0 PS !83`0S !8)X0Sl! hSd! 80\ EⅎL0@ DQ\0S ` R  !8g8 p Q jQ{dPu^PoX0 STPecpQWpph  cꔇ,fd$   z,^c|",mz!>3?GSK3WO-eM0M*Q8U"lUY&dd&@'&Xu TQ X &0 40T mQ ލЍ4 )qWd nP7 FP!' P  @oP' @ pH0X h40sP40 Z P U Z@D`@ 4 p PU   S0SC   0S # 0P000P F1aP14s10D#5:d#d \%X%T%0S D%@%< 31iupp80P0 0 ,0ST0 S00 P0p800SS 04  0x;8.:/P>0400ST0LL S>@ S?0 0$ <0sP<0PL!@  PP ,0$  40( P9 S-  S `0${ PL rP00(5S0+4^jb14  z0 S r0 o%Ȱ0ꔇ,]$l,S?Vz, $>WyHX >afnu~N]t?O-@BMTMh Pp ` T@PpT0$(Pppp`PP@BލЍ䓟C3ܣ0@ 3# $04@(8 3P@@00<DT@0\ P `430$3 04 2 $02(408@00S0 lP d댲夒  Wp208@`2@DDAT L2L"LL|t#P 82 4%PI(2  *20)ATp !0 kP&!$0 U@0S   %#P 0Sp C0@ 4 000@0x; 89/P1  6%P !F %@P 0  j @$$0 z@``W@ ?̧  #7ħ m۶K ql,,HSûb0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB),+, $0@-@"!P(@),@-$@2S 02),O- @P@B`P@   PP@ bo@p0Ec#రPU* ЍI QP  QP @BI    R0S pL&@-@00 KP Q P 0cЍ O-p`JMMԢPppp HtP)NU\b`H4Pf}PX` EpGGYK hpP 0 000! 00P T"XT1P T2X"TPZNT"R0 0XpPX 0H,081A 0101P0000PPP lP,Pf0S9 0S)X^JݍЍQUP 0Xp$1Q QP SU T"P 0 003/PT2X"S0 S(0S 0SX$(0S003/PT2X"SP, @ % 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o 0@o/b0 !!//,10/Jop@-@4P0 `^1111p/,O-P@p`ԐԠ԰0/ C !  !0  Pr00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ/,@  0@-P@M/.{r1, 00 0d0@00 0T0@@@@1 0 000@vP,Xߍ0 /,O-Pp@`4M 0SpP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   0Q R  0^0 0P  P  H   4@R,  8pT  TX $ `\ ( ` , d pA- 0R 0  DQHa@1QRpB   !LAPAPs0 \Am0Q     TTAU @@/,AO-PBpXQMU<21PX\1S2 \U \QUЍ0C`1R`1Sj\`l001PS \1 X#X1! 0`1Vle.0X`0 T1`X " sq\DP6 \ ! iq000: S.X1 2 \1`0r0X1`kaP 0 S 0.S _]hp ` XX PY SX1, 2 $ e]/,(%8 t p@-MM`cPoۍЍp)P@P+ ] P*+h\ P*+\ P*P Pp@-&M@(NH`Py4 g<0 0k P (Ox4(O ff\ <@P lލpeabty, O-p@MP! c0  h 0d`嬢Y ip` 0 0P0SoߍP X%]P0lP0 a0CS0S  PQU`08Sڠ0SP` R SY0  0 a00 p 0T1勅00 0s [+,$pY 0 @00t00 00S 0 MP0h!R@O =O0㏐ 0S* ?0!CUa0 , d@edA0,y!/,@- D@01SP@ 0S 0   /, @- @-G- T1  D1D1Y-3M M  BP3ݍ Ѝ00@-M  0X 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,z,T,P,+m,Lp,Z(,)o,lw,@-0  0$ P <08 0440000 0 ЍLp,(,+m,)o,lw,0 0!S//0, 00/ P /0, 0( 0S0 10 1/0,/,11<0@ Q !@-0 " !//,0 10 1//,@-M/.m, 0l0d 060 P000@ 0@, ߍ,% /,0D D /Q/QQ Q//,,%@-@0@ 0 0WPЍ@- @0S&00P,0@-pAM'hPN @yY  >P<04Px9J/}^0Aߍ0/,܈,@-P@ / 0P  ( Ѝxz,-@-   Ѝ Ѝ/-@-\0X0@P D  `'Ѝ@Ѝ/>H-@-\0X0d@P D  A'Ѝ@Ѝ/>7HHh@-,P P @@-@gP@ pJo7@-4@7iP 0 P Lp,)o,tx,@-4@#iP 0 P (,lw,xy,QA-@@1@#PP1P#Ttpt` L^P t u_"<<Q5O54XA1X-ty,7@-@+P @mI 0 Ѝ0@ &0@-EMP@ lX |]P0000U ($$0x:@mEߍ0܈,/,,@-`MXA JX'g81^A P0x ! ,l<# H0`  0000 00``PPpR02_#lUx:` J]X (X(!(Jߍ/,܈,ʻl  (%(@-@P !0`Rxz;hP PP rxZP`h 1 ( T (,01M@0Pڵ@T w4\W Ѝ/,ʻ(%@-@<#0@- 0 Ѝ0@- 0 Ѝ@-0@M00  0jЍp@-P<@0/SpQ gPp@,%@-0P  (p,,,G- M@ p`P2 0 3P(0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ Ѝ?FS l,z,BP,*n,`O--,M`e$ \@pq[KpPd $\P@cdT00S@ ePPEUM T1T!TTi$0P0   @$0VSS00Y00S e P E H $[0 0$0  0 }$ VRR   P # 2R @D j0@QRe `P$ [@,Ѝ H  G-p`@PPU  fPP 7/G11PpO-@ M$[`P Ѝp0P 0`0 VSSTP$`[-@- 00Ѝ Ѝ/I -@- 00Ѝ Ѝ/I A-`@PMMP\' ``eps@ F43T0(3T$$c3T&  0So 0CS+PDS0)  0 0S9 0S r0S 0S QN@.P% 0 `0 P@oH2@P 000C?o270 o0`(D0SލЍ!7SfP1Q! @F?>@FHod!H1P0  0M(Y' j 0S 0S| q0Sx 0Su QN@ P  0/0 @P_F? Q. QFNn$oq3,z,T,W&,(%meeS>r,,l,kZ-MM P  P  ۍЍ-MM P  P  ۍЍ7@-hP% PdP %P0| S0 P @LP J0@TT Ѝ0 -x0|+R/ @-d|+\0XT0PL0HD0@<0840/,,,,6,؈,>,P@-@ A@0@Tty,p@-@PM H(@}h000H ,0@@04P,P4hPp0: S HdP yT uT܍p,Th 8PhQ @P2@Pڤa <)PT8|1|!||Ngx8%<DQi! P1 0880"8PP  Q P00S nz < R t00 00000 00l0 p@ m(Nt(0S!Lp,|(,)o,lw,;, V 'x z,P, ;,d O- 0CMSP0q `@h0!`*10`SPW!000> @ QO@3/@P CߍW! 000_Z 0S<X 0 5@K+T W  00 0 5 0S l00S \  P0W0 ! !  000(,*n,, 4H],/,7@-PQ@0 SS 80 000] Ѝ02S  O- UMP!f4Q 唎 g#ß0/S^P3s0ȃC0`/V`3P QHU@tc A@ `PKQP 84(@1 U ` PP$ 0RP P l^ 0 10S 0S6 0 1S20S QPpG $29BY/>R챟 !0 aB0 0r 0R R` 10 1000p_R `01S RB  0 P a0S  /SPR Uߍ` 1 06UY U@P@T TpZxz,,,%/,.Zv--(,p@-Ph`@TUdpUP`P  p%HG-pMMPp p@ < DT|P P0P   1PڍЍ D9|Px D1|P6P E`P 6PQdPP 0 ,Y0'{` aP 0=Sp  D PW  P P P\pP B PPH3(Q]d20p@-4 P@8e0 Pp@@-G-P@p4 %e0pS R p2"4p0QSP pP`p 0S!40Sp  Ee`/0 R/@-`p0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PdP  p@W@-@ [(Y@VA-P@p`p0S 0pp RFAC05#h00P200#X0S%0Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0EpЍP@`p   p   0`.V勽 t@T  \`PLyP <uP ?@+:IU}DtSN@p@-PMM`;  p  @Up 6eP2ePۍЍpp@-@P c` DP  0QpPyp|d zd@@-PM Mp;P `p  @0PQPUdPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPc00/00/4\80S0 S001/\80S  00@-\\@"SR0(SS QU S!0$0S\  0p 1Sp@- l@$\ 0P"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/, H0, 4 T 8 X p 40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 BRp01 408 00803/P,000403/, H0, 4 T 8 X p 000/O-0@p 4M PPp`204ЍOm$0 L03/P$ Ѐ0 \ p!D@ Z["H* 0*P T P , [p b8``pp 0S0P 004Ѝ0,O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R?!S,0S 0S00 0S p  0!"0 0  SPH P00P00 0 K`03/P L Q Q  Q R S E    8  L O-0c(0M<00PSp@Qp`00 # 80s 3 0s\h0@l0 S@3`7 0D@0 "(0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D00p2 p0 0,\HL0  $\00(, 00 0\P23T 40p0P<0SNP0 K T00SG0Sj00p0q  x0 0 000000  P0 0 00000PX 00808/\0 PpQXQ Q(00,0p 0#_p a X0S h^ 0$0p0 0(00,0  0#0pg>0PB,z,-TB,WSoC-`F`0pSPlM^DP[0S H[0 S@[0S9[0Sk2[0SG+[0SH$[0SI}[0SJv[0SLo[0Sah[0Sa[0S000$ R$000 "0& W40SU4 QQ00Q00Q00S 4 |lЍC( .[0SWA<4W>0 P Q Q  0 \3003 0Z0 lЍ3003 0Z0300 0$h3 0Z0 0LS(0p`@ w0 qSH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S hP`@=0 <" 00 P0 &? R>0 H0L0 H0L0  H0L0 H0L0 H0L0 lH0L0  TH0L0@ <H0L0E $lЍC!SH0000%0PpG0  d 9/ 000(00 PB,  E L Sh px,z,   2 2 h 8 C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/0@-EM0@P 03/P 08 00 @@003/Eߍ0@-`,MHP J@0 0 0PP@~00 RS THP pW ZP00H P00P0,Ѝ @T@0/W  /0 0H}JH P00L&`p@- MP@D0 L ` 0  040PP`2PH0Dd ЍpG-%(M@PU T L@P`4 ,VV !R "2 Vr PpP`"pVp$UpWb$U  0 ]0 00 00 0% 0MppppPP J(Ѝ p   X C-40PS,MJ S S S ,!S SB ;@P? `q``X 0A>; e8000 00 000 0 00 0 0M`P 580S=,Ѝ  < O-P@0p(AMP U   b  p1#`w0 !(0#@ lU`P $P \I00 P P "I00P0Z@! 0 A@BA0  0t!C @0  L!~- P0  $!tD`pWP@!@3@W`0 -P\ @D@0 - U! @ P M.P嬠o 00@p `PD=XAߍ #"0P0RPV Spx,PB,4C,>yeO--P5M0<p@$P cP `P%Q4  0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ Q\42PP00$4 04PA00 00PPPgI0S8@P 0P40 0H03/0S,0P p p0C @P0D P000`ċ@0SOP pv0,01v0(1PP ! B BP2"Q%00C  R B C"[ [ 0 R80pPn 0 R#,500y60004Ѝ<0X ∑0L0 3/ 00X0 ,b0  * 0ȿ P  1@0 B )R RU4PQ0R r Q0CFS0TR000US0a0Ѝ@0  ll74PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V SQ @3P0 /S`Sp`` [XtT00U0,`0@ C,{C,C,ST8 T\D, 8TxG,l,O-0MS@pأЍ`  hW0@ 0 P0S% cS2 %MS) CS, GS R 0PP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-OM M P#0 P0P<0@0@0>0P(0` 0H03/00040 00!6 0R 0  0(3/ 0Ps`` r S08 P&a0D&XU\a`v0$0800s0,00$0&p`0(`HpD0WX0h05R0lp0h o `pV Sh f`U Th ^PUh XVU 00 00PTk0P`000@ S40dP0O>0=C0H0<0000D0 0O$xUT0 R  xPk0 000H0P0 F0PT0S xzQP 0S80Q00`Q0S 0L0 aA3/P 0Ȁ`0` 0&003/`Pdp0E0 7#`@0o?OX` X 0 [0R0 `<0S@00D00S8X& a`v0"$0#$0,0+q0,0$0$$0| D 0gO 0xhv0  0ZO 04i 0QOȐ 0 _x0h00l010h Ht0pw+D[@+ W@L L0` S*pV 0 TjU 00 0`Tj0 8TjP0,,0$ Q00Q03S (0A( 2`L-qp 0 `&E00`P3/0A` ``Q5VP04`Tȿ(ƿOލ Ѝ X 0C[0@ X 09z, px,C1#D @-@! 0$   0 P 0"ġ0S 0$ O-Mp@( P,`|1/0@T0P5PZ0YP0 0}N @p0wN@Tp UYp 0 kN X00 $P $ T<000$08900p@3/ 0pXl0%WQ@Xc'pF0Z0 0唳+Dtp CMpW000 0Cpÿ D08MpWP0W000 000W 000$0>z,C1px, #0@-@M0@L0 3/P" ! !XQ 0 0 SS@Ѝp@-`MMMP;` ;@P R -> rMލЍp{dЀ@-@P DwNP 4rNP $mNo*p@-0@ 8M! 0`P@@ 0 P8ЍpKNPUJ0 00  0 P@oC-T1M MPM C  01/@P  0Q$AHL Q>0 R 0S wP P 0$003/$qꔇ,#0pQ@-s;A #"T R0//s@-(@T@ЍpHŻ0P0 w003/@P/@-tMr`P @P0 p@3@(P  90@Tp@tЍT0 @T|0t dl0l pM `P L @Ļʵ(,g,4@l,M[/@- @///@-0@Q s㙻@!o?0 \ 0P000@-@4M0  NP0PUfJ0 00U00 0  04Ѝ0g,//A-pP@`VT0S0S XJPH0P$1U8J0U00 0X0`p@g,0SR00/p@-@PI<0P4`" 6D0# A@$!ƺpz,px,A-<`P@JPp( 8: Ag,@-&sD@-0@-AM  N0 h0S Yg@L0LP0T 44 0 Aߍ0cCL,1G-1MP`@1P!t1t1t0ppli`PBL@ O堻D0 [ㆺ'ߍ ,@P JcH J@P 0=SH?A@0   @T@  aP 0 l g@P P ^@@ 9:Ļd$l,H1A-1@P$`p1P!P0P0P`P`P0  @3@ 00|g$l,9:7Jbp@-0M02000`00P0@P @T 1X 1TO/11 0PO/11 Ѝpu;R 0@- P D&,@-CM` P@LP 3p0 0`0SO/11 Cߍ5Sx xl lPX \\T0S  <~4/1, 1Lr,Kq,,M;妹Jp@-P@tB1 1  p܈,1p@-P`6@P20 p@,>p@-P@ႹP ?PN/1 1 pJVp@-P@1r1(1 'P1 1 pYV@-W@JC-@aM.pWLTV PS2P@PG aߍP ~P @"{080E0$"rmP ",j2X , G 0, G ȷXN?1L0 0!,JP Px1x10 pAPphaU U UL10$0PU@4!44`A,ppP0S S  @K 0` 0P@JP0@7 Az}7 0 0 0F& 000 p ȵ@,⪲dz,5uk$l, =9:d%g,܈,Kq,Lr,,--Hc Kc A-P$pQ*@P a-@T F @峲P( 0 3P  0J> P G@oЍW\\r P< 0 7]$l,G eh//O-c@T Ѝ@T@T( ^& L U[Z [Сԑ YZ PUPE P P$P@ P$@0"/,O-$6#Sp 0 ?P` ;#S0>p0 d00\ `0h0x00X= P$`P`t0 (04H_000 00 00p;` @-`X0Sg0 C\0@Sh0 `0Si0t d0Sjl0X h0SkT0< pP S 0&é Ѝ H ~";SnO-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q r@ 0 @0R0 0p1/P @,` A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-㪬@P`p1S 3/`V@Td0@@ᕬT0P0S@000S4000S(0000AҮ` ,,` p@-@4`4P0Sp@®10S 3/@,,0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 ̠ 00//00/00/00/10/Q@-@@@ 0A0003/P@  @HC-B`0SPEM;0 i=0pSa=0 St Y=0S R=0S@K=0S(D=0Skݮ==0S00$ R!000uF 00% % d 00q˥p`a@B0,>0;p8` ㈤80|$4@`!0 `40 000 f0,0pLz0$100\$10 `\0@ pd0h;00S< p0 PÁt ,l3 000000 000 0 080pTp` D3d,00ᙥl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0lP2Q jbЍYPR00SZ 3/@@OoBS V@0&0010@!Rx!@!x@|@pPpt@彡t0S|0X*@4P PQ 0!@x 0T:x0S@ Ft@OoB0@|0xT::@ꔇ,+ z,hi, R S08e@ P ,` u. 4 $l,C>O-S[?UM8 ,0044@`D ֤pP ѤP UߍƤ0P00 P P30 40S 0RB 80S8(1SI1<00H ,H!0L\." ? 4,#H@; $6嫦㨦 0@PP"@T "2B 00!P0S 3/Pt20 SU@0%0cD0`t T2Rw1@Y,N nk ,H!!LPH@0#`P`T@WP ` 4@ 4,4,00 0040 @o 4   , d 4, [F440P1:1!8 @0 000000 0000 00㎣p` DnD0S#0 5Q7[T Y 0v ΰ,,Svp no G-/0@JMM`0)PP+P%P& 0S" 0`"`!p/X6P T` H 0@T* /R  PU:@ m+ % P:J:?0 `HIP+0: S pW;:>00ꨠ t!ϽPJ>0@0/S|0@!M+ $ SᢾP`+$ P*P 0/S`0oo`bS 3p30&000 SV+t$ P*+$ P*ᠾP9@᛽9@`ᖽJލЍ-@-*@-M @PЍ(0  a@P V P mkP:00p R G-`)#PPp X`pl(@P Ѝ0S @ p4P0 \ NpLo P Xp0 @ ڣCpeA-tM `PXP HP4+$$S@P@0 ᴭ@ ;1@P+J$J.0㗭+J#xzJ.0L㈭LrP ねPP|<i, xPPs~+J#Z0J.hPPcn+J#J JB`B QPPLW+J#l3pd0\!0J>P 0.4P UT ލ⯽P@[ +J#J⮽PPp0J.@+k# P h lJ>PT )(98l%+8/00/00/00/00/0@-0@4M#|0$P 01P\ vP0T0670 P唣 @P #ᥢ4Ѝ0z,C1px,j,O-AMAd2 ,000PB,0 0000/ 80s0`0P, p $  ?(0 $0K 0s$00 0$h5 S` @@`嶝@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&L"@(♾@@,0S:(帡(0"P⍾P@0@00 +0@080s=0 0@( Y 嵠W|Ѝ#㒡!@&(e00T1 0/X!00 ᱵ*80`0000Y9(0S` ` 0 RH03/p`0Y80s Hȟ0Q 0 0 0  BR0S0pS 0Yp08 r  *   * PU0"0U  YP R 0S  a,p0    P P 0$ PU$0Y0 0 Ypp0 PUYj0Y) Z!P%:p0 0 0 00$0 0$0 0pS 0pW ,pWZ 0 p 0P Z$0 0 S&,0 0S +0  !2 P2S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp0 0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S 9P 0 0 , 0R 0R  `R  ,P` ,P 0 Q ``T R T  R X `( 0Sf0L0( 3/P <00S D0SS000(( N L0( 3/P 80<00S (0, S004 Q 0 `( ],0Q G0Q0Yg80sd 0*0 PZ 0WYpq  !QQ 80s 0  00UPpp~0  R 0S  *p 0 0 0 # , ,z, O--`M,p#@PVY p4pPT Pp0Z:`PU`J6ERUA x6x&xx.00#h R 0  80s0`F`pHU p /h0S 00  80spHY pPp /h0l0 0L03/, 00Y:pPpp0ڙ0P80\5ЍO>p0H03/,0$ 08RPP0$P(<00WP:< R2*p,0, 0$` 0S `0S< $`Sp $ PR( P`")PU` P0 Sa@D S Z0S 0 `p8P0VS:00S40000040,0(pWq닟8`0[:pp8`$p0< p 00<<) `8q ,0,( 0L03/0 0000 0V `V0$0( 0S `" )`V`P p0o  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P0H03/s0@08P0D00Z}*p0 0 `<080s_00\ <0 0RV04 @ RD0 0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  ( V00 400P m۶> ]n,! 0 0Q4 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc ʛ00040$0$00(0 00 0S(0  0 H3/P+ X$ 0 03/p6  0L03/ pPpP$0( 0S pP"W( W00 40 00040(0$00(0 0$00c<#$‚0  0  0H3/P0`s 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S~ P0 P  R0P0v 00040(0$00(0 0$00c<#$‚0  0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0 $0`0(0d0,00Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8iP  0$ 0S0p0$ p  Sp!`P 80 p0R:pYP Y:PpW00 U0#S 7p`Ѝ L0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0hp` o!8p 40U 00 0S 0P*p ` F,_80s0 L0 3/P 08400H0, 00,0+$0T00X0pPF 00 80sh p ,P=p@-@P(M{~(0S:(`,`0 00P0F0 P P`0(P⽕P,(S(P(Ѝp000啒,(G0,`(P-p Rj,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1X!S<1\@17H!L0X!\Sp(0 ,1P"#0T@0$'8L0 ' E0 W %&, 峗0寗80000, 0 0塗0块80000  0'X0南0H剗LH0P (P0*W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000Ɣpp <5P,0ᢑ XpW* 0GS0.(>P C$ 00S H @3/4pGWp @ 0L0 3/P 00S 0Sp003/60pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0]Q  01/ 0S 2"*)$Є  0<PX 0 Hp0  @D@0 ᄀX60X< Plؖ,0S$O&pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000ꔇ,z,Sp408e0 L \ ,l < u.  n 0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002(  Ԡ`0SQ,  R) 0 0#Q! Q0 2(<{# 8 0 r  1# 000 S   - 1 SR0r01/k,!0 /k,p@-@$P x1SP 003/p@Vx1SP$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0( ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0IrpK܍ЍIN᷒+R*<o=(02#8 ;c&@@d u-O-`0@PMM,0h1h0p 0S (0 S> 9 H(( 00 0 <0.%#@~40kP`0V,p0U 0000000 0 00000000p 0p`ލЍG],0S*< #0+,0B#X0S000C0C0000S0 0,0B$Pk,d u@-@-'0  !<$10(10,1P001.@-@'0 0! 0O-4M\T`Xhp(0P  咕"\ @,@;/,P R7P PpK 'p WpF2 ' 0" ( 00 0兑`gБ(04ЍO/Pɾ4Ѝ[;0p@-@Q* P 0 Pޓ40 Ppؓ <0dp@PTϓ80 P@ɓ,0 PÓ00 p ')*+p@-PBM `@᱓ 02 V` P夓 0P囓 Bߍp`吓P00S0`兓40Pp`80PS<80  4X0S0!H@$k 0 Pc\0 `0S 2 @`Rd0Ph0S "@l0S @p0SH @T`.t0P^ 9:;=&>?ABCEp@-`M<P@   1U%P 0DPK0 @0S  O  K8PU@ 0 #P 0܍p(0S p 嶯@h,0S H 嬯@D00S , 墯@$^ /1230p@-M01P@Q# 㭒  , 0`N 0S (0S l   ,`V D܍p4劒   0`N 0S (0S    ,`VPk $0fPb 0 P\0 PtV0 P`P0 PLJ0 PD 0 H   C-`RGMP@8 C"\0S0 `F` tʍ0p⇞ 0S  H`,p WV o$ ᲍`h Ϲ0`0"  %uߍ@U 0  0S  ⌍ `PV 1 `S0N  `8 0  0S @0S @& ߍC <0040!00@0Fo$ 0DL03/00 O0S !0׭{D` 0S F (B8`Y0,p x Q0X 8 < RFO    ᨭ 0@ /6@Đ 0  m R0_| 0⏭   `(W3&H9GwO.Q@-x @#+0 @0p0d' @ˌY@-D @#000(0,0000d @嶌ꐯb@-hQ`0@sKMP!   0׍1!S=0 届Kߍ0 00@ @@0向P(@UTpp (`0  0  0`0`pw@P@P> 1S 1StPJO 1S 1S_KO 1S 1S0PN 00, Y,!"#%O-,MbPp@eX  |0XZX2Y 0 DPp0 @Pe@  ,ЍPp1`SPe 1S !N 4!ת@p@d 0PPp1`SPe 01S  1Sލ0@!ᳪ@p0@d 1S 1S$1!壪@p@d 1S 1S(1 哪@p@d 1S 1S,1 僪@p|@d 1S 1S01D s@p@@dk,`P 6 z,C1H0O-P`QWM0Tv1 L&0@ 0T&4勥060S $$000S'6L@TP| }1AS 0S@  1P11$P |X003/$}1S}A0p 0x 0 01"+Q9  Q 4  0%X0S/X& 0΃}!΃L )!6X<1,!   X" 0S0b㄁0ʼnb/a  0x0S 0XX0P 0}!11VUi <@T0d"@T30S D00D0 C000 D30S \3L000@P00000T0D0 30S D00D0 p@ 2"b"`"0  }/T2 0"S0C 1šWߍ 0 p2 0@00 0)1S080.0$X80p$P! 0 S L0X 3/P h W pW 00$%1/pt0S _PWC0A00N  000 0" $!  8 0L0X 3/P ht0S 0_Sʚ  0` 0" 0 0p@080 0S,k,i,,Hp, 8-,t ,, H) L60S/O-@pMU䅟 MPi 00x Rp#R0`ZadD80  @Q D0 \P” L པPC 8%8  %  `V800(0S$]$B 00,0S$P$B 0000S$Ct$B 0+ 0 `0B/{P `ὠx 00 0; Q <0Sn0y0!##B 00 0=,0#Sn0y0 #B 0 00;8 R3#0T#Bp 00 0=<0X#Sn0y0#B` ( K 0 R #ܧ"BQ  0 R "Χ"BC x 06#0= 0S"⾧`"B3 x 00 0=$0Sd"⭧"B" 0 00=(0S,"➧!B x 06#0=00S!⎧!B x 00 0=40S!}\!B 0 00=80Sx!n !B x 06#0;! I1P/S L(⩇0(0 00_0SvU (} z0S `P  *00!15:%  P r Q 0, ($!d $ P` 00 8a4Q101V,,,,Sû'i0S@0@-S@00 0S/0, O-P2EM 2@T P0 x2P l|1S$ $P| 003/P ,2P $ ₥ Eߍ$0 R P 01/0P 003/P A10SW PaPD  <0 040000,00800 傐pP@2@0S- $P* 0 x0D 0꼈,,r,d,,,5h,CA-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0꼈,,,h,,,\0p@-T00P DPPp0AS@  1SA{Hp,,,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2",l0\ Q0/\P ^U Q0000@-,0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@Eāp@a< ((G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C  01/P ,00 H$L Q>ꔇ,80S @-0 /ዘ m 'G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $QK$00S U 0 |1 08ЍpP ៮P P Q K ᖻ P ዮ Ӯ OP k,A-M|P8 pU`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `pCXEH2 08 8/PD? 0!! `b7#`00  3/P"#"#00 03/p p0` L03/᯽˭ X` 0SWp`?`B414!44 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv V 0 |1 0?P   'k,G-`RM@Xr %PP dP`T `9QP P9  ,p 0S  yߍ<0H(00,0 00004008004004 04$0D0(0P uW[  pU l庘p* `\k` 8 I 8|Q ,Q  Q Q Q 0,0Q0 Q `% bp 0`?`a8SXPb 0  0**0P0嚳  0* d@edAzd@kA-@Mp`;@@ p@ݍ P@00@֖T 0 2 "0  /O-4MFpT(t$ ,`&X\p@T  0x YY 0 0<R- R 0Xppͱ @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0 pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0 pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-`|`k,p@-@P0PX0X XX0 =*|`'|PU"|p@|] k@-@ @p@-`P0@TPpD P  P @P@-  R0 >h!ї000㓛#000X  R  h,⭔( [: yT   P ؀!\R 00 : 0Sx 0 50<0< H0S< < 0 yd|dL&G{dЀ k0$\ (00t S S  S00/Q 0P/0S 0S P//!R@-404 44 R )r0@/ k 80R*@-0M@"P0 0! 0! P0Ѝ/00S/k,Vp@-,P@0S0S< 04 pk,@-@0Sk,A-pP@0ST 0S` @ P<0@P`V@k,s@-S@P ' ` P {Ѝp8 P { `P (iPP )eP`  P  P(   P` D4t Ph w0U0Q0SpPX w`X v0P00`0S `a `]P,00W80@00<0|P0$000(000S DP rPP Hs$0S(00,sVލЍ` DV00pp<00008``#404S``V P0pp`00S00PP 0P0 0@5 0. 0!$00(0080. 0<0`$0500D0;0p PUP PPTPWP 0X`MqPPT`,s0S 4 R 000 0#0P 0S ְ뼀 08$ <0S P 0$ 080S0`P P`\0S 040 Q\8<0 Q\ P   P` k؈,k,d111$ |d@-齞0P0P؈,,O-`ᴀ 嶐 DMⴃᶓ890 ( @: 0P30sS' 0lS`q 0P05 6# ep&?0$0>0 0=00<00;0 0:00(0姐pp0 0,0P,0 0H '# >p DЍpW0`Vp` O4G-pP8M@(P2 0S 0( " " 010 020 0008Ѝ70 0600500400300100000.00  ,0k P #00R R R d `AP 0h#(00202000X4` p@-`PhM" P@0@$00| 0 0(0 0P0 0@00T00T 00T01T01T00 (6/UhЍp` O4O-PM@8 SHo*@PT `PVr``PT\0(Ѝp!SQ0P ؁1/T 00̢SO-DM 000 0 0 0 {p 00@4p@T0@4p800,00  (0$ gp ,08<\`?! (0_%"T0$ P_5#$<0_.8̅P R0^W  PSuT h"?L1 0@LH0 R p ? 0 /G$7@ T S@``000 00  0 p  R02# !"8 0/RSYL0 V`0 0P0pZnYXDЍ蔇,/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    ;pЍO- @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0pk,,08S^5/ᠯ,, p@-@ 0(  P0R0PS 00Sk ppM-Pp`NM@< Рp`0| p ` @000 ;PP <%pNލ軃 ydG-xM` @pᜐ堠_P! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   gYZ( ( ᵇꠀ O-p@PBM M`/0.;P( F0P@0P0iP) Y  $;$  g P!14"S5 0Sto@ U01U01Bލ Ѝ Qg0P0  f?XY$0 0I0,%i?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P塦띥@ጦ@Q Q' Q0PUTi 0"0S0S0@0gP P `@@=02s 2 02@F @DURX A- 0MHd h1h!hhVPg@P( T00O 0R`0 !?020!2002p!04 ph0Ѝ 0S" $0Q00 L03/P Q 0L Q 0 SD S003/ >,P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T Ei@ `Č `Ȍ `̌b` ` p SČpȌ` 2aaa0q1P 9hp`T8BvP08} ^\ 0Sp`82S04@11111111108 q2aqR 2@S22B040TP 2SX4T0S  O-cMM00 QP ,00#.;>0P 0`cލЍ0 Jwp \6X&`RS000o?00@ , IY 2S 1S(2("((0@0 Ḁἰ  &      0S@p!?⩻D  0 eD U <  dPWbV  R $0X&0 .p*$1Wp!p'q ?p? @p0Wp!p'q??p$0d@P   pd?WU E ,   pxd#g?W U `d@ Us@-RU0 q@:`d0T `Š"; P0H0`04 oЍp= Q@-@ ^ @ TD@@@ Pp` TPPVPU Sp    L"4 0"8 0.4 0@.800 0",<< . 0蠟,,O-@|MHp4 $P   RD }$$P YY P^ 8RP QW# 40 RQ }_PbV VZY RP``P`V W0p|ЍRE  0 gZZ 00` ^ V ^Z Y  `VRU` P  ( U S"!RQ8"H  @08    0 4  D "< ! ", , "S01@ 5 @ D pE W2zP Q PY Ƒ Y ( [Q"R$PQ  R1!* "#(SW^ fZ D0@ S(0, 02o(0HHLPTpPC 80 Ă2 R020S PP e00S0 0!40S`1 0U0 <0 1R o 0,$  RQ   0ST0h h2 Q HW40ꠟ,X T} lO-@MP0Y00000 RL8H8H(HHR4  XD00P}/ $00800 0 U"oQP RP"4!8$ 0S40$ 00SR 0XSY t70XY`7$004 0Z00/$ 00(0800,0(0, Z00"0 <0 0@0<0 000@00400 (0S,04 08B4Y6u?v/0808 S 0 S4 1YX6BT@q?r/`0sh2`0 (  R   T R00S4000D0JcpPD0GY50\6o_P 0"P0S PP fdˠ0$ 8 @ U 0 o?0 R S RQ ' 0^Ѝwτ (0(00,0/ o_S㴂!P# 0 =00S4000@ P0X\0" 0"P+0S PP dqB `H ` 0  00 V0R0 2@ 0C0 0(<0"0 ^,0,0^ X0\ 0PPT0S PP c: 0T2S2 R800bP@0"2? 01@22rMUY $00l2l2 2 S 0  p 0 H 4L H0LpUp L0S000 XRH` 0@@H@ $  $@T$ 0T @ 0 p`  V`V X`\ T040o 04"PP@t0S A<PP Tc幟<PR3C H0P002S 02#38T 0Ro_PPUPo/ @T \ `TV R \ Qꠟ,# ,U}C-dM‐@Y`p 0P 04##0 PPPY dЍ003/00S 00 2 0!!2 P02V 0P ( ^P 00D0"#"# 0 cP8

S@P0  P0ddO0@SP0 0HL R   ?  ? /Z[d0P `@10d ἐ 09/0P@\Ѝ,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/蔇,>0@-@0M 410810!b0 P0u0L b0 K0PU ! 5/ٹЍ0蔇,@- G|@ z@-@ 0  .}S@ &@-<@0sz(00pp `0Co%,-$M?0 0 {$Ѝ0-4M 00 000P4ЍO--pMMxExU{ " `{@5 Ѐ0 p0 pW00( 0R0pW00"R 0*pğpT0S 0s 0SMߍ0S P 0 l`h40SP T$1~PH$HS 04 7{ A0( A{{jodVd`#0ek~3P 3R - BP   BRږ3c"B # e#2M~P 0lß R#3SPgS04c 100#0e3~0P  $P(0 0SZP=9 =:k{E2 AP09ˬ A { Q 5 P;!%#3ZQ/ a d 0@ e0  "}1PP0&!`S eP *!5"%+0! W ! }P0Se\!}PT1 0pp y0P Ԭ0 A Ϭ A k{I{7{z0W:0P9  }VP<,<`Nhp0  }P Y@.A,,,,,0X,H,S,QSh Zdq,@~  ]}@-0@v,@SRG-@  "700pP ąP:`X:00X0 2}P@-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  [PL&p@-@Pqxp  `ex@}xU700@pp@-P 4`Zxp@  0xPfx@p@-M@ yp$ ЍG-`p@T2 P  VP0IPE MPP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝp@-P R`@0 @ y0 00S < UP3PE ЍpA-@Pp p`" j 0W0 |0WxX Uh0X`0 P U <0H  0h08 (|Ѝ P 0SDL-T@-`0tM0F?oP2p @px xpwx@wp h2Sxp L0V#4 - tЍxh"wpp@-P@@xpPppp@-@0 } Qw0 S " 0PUPUp@]0S   0 0S ]]0S   0 0S ]]A-p@PMU `0S@PE7  0PU00ۍXK700S @ Q@BPE@C0 00 pL/0S +0#S @UX l q@-M@ H vp8lۍP  } p@-d1`0SM LLЍp@@>  <P  0 !   [vp0 S 09S g.Ѝp0 S   000 00P0 PS @ d0 J pDLG  Ѝp@p p@-@$`PZPp0 @ `P0 002 0pp@-SP@`xM  j0 00vp@) vp$  vp vp   vp  P  H0  p(0xЍpt u 0 0 s@->@P`<p @ p0 p`` P0)p @ 40 pЍp  p@-@PqP  u01CpP`qpI u0#1/pp@-pM0 p @ upu@pЍO-QMMھ700ۍЍ g  Z  @`V 'u@pP` @-`R00 ЍPp@0STZ@PT  Q*R@00 S   0 0S0 S *ZP `[[ c 00000`0 @@P0   @-@ @` L1p@-S@T1S"d1S,RU6lRUppbV7l[lbp1C[L10CL1SPʊ[0P11C[T10CT1SX}[0X11Cw[d10Cd1Shp[0h1:2,P0C2bVb[b-p2,P0Cp27@-@0 PP$ H1 0D1<1-@80@ CB Ѝ0@ Ѝ0Q@-@  W  bPtP p 00`? Ѝ@ Q @ 00/ pЍ@* Ѝ Q@-@  '   tP p |00 Ѝ@ 1So70|ZXP| 01@ 40pЍ@ Ѝ @-t0M0@Q0$)p Ѝ  ) 081/@-@d?&P0S  P 0800L0S S@ && @-p@\M Q t0 | p\Ѝ0@-800@@C?c P@-@<~p t10cSt14 Ѝ@ @d 0 Ѝ<Q7@-@  ,,l _ Bcsp W Ps Ѝ0@ P 11P,|1@ R  |%?AQP |`00CS`0 X\y@ T0$p 0< Ѝ0@ X0 X Ѝ0; &&p@-PDsp44p@ @sp p@s؆-p@-P@ ` 08 l, <U\Z% 0: 0 008 , 81pp@X =5p@-`<1P:<1x1S0p0@Tp 0S   ʌ0@-@T 0S @G-`Pm,H0$:0@   1000  qH$R $2/ 080P040>0S0&0 Pp P W  g03?0 0S %/0p@-8@` Z40 :0FP PpP  Pp%pp@-8a? $0080S  p, A p p@ @-@@O--M`@0pRPD@T0Ѝ LP R+W& 080 C "0   Z0800 >X  R @@ LFX   7C-MH@  ЍPPf q`0 P  , HopYP1 P P2 P7 PWP@ P8!88"@p$=! Q0S000 0[00  p xD!\10B0H1x=l l<xT Pʌ ", @-@  ,np \P<1 ,,n0,1ЍP0@D<1 P$|6 Wq Q/@-@  0S@C-q`@ xQ @P00@ 0S  L0 Sx   0@ Ѝ 0 pPti' @P 0@0PE/U  x PP 0S  $0$0> R>  **X  0S .@0 S   000x1  @  0SP P 0F0 S   0$ 0A-M P0 0E0@!0E;op00`+m`pQwI07S E0 S X `0E 0\!`1  `Px1  ލ ' R PpzP0 S   x0 mpP 0PPUsTxx }x x1p  P  0S 0| 0P; GQ@-@  ll|)p07S@\0 S 0VS0S@WO A-`R@p@M PP U 700 @ЍA>P"R 0S 0 r>XU$  *P 0S <0 *] p \ <0S <V>P  *@ЍAu@Ѝa ſ\O-P@$MpP  P 00A $ЍOvPw qP000 P`PP`VMQ`P    0PEPE 00[PPIc}SPPP P003#+Yp`r 8118100x1pW* ulPx1pF 81181kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY kp 000 0S 0 0pW81181$Ѝ  P YY  Gp 00W0 0 0 :0C WUx1  0@  R @ [ P W @(0Ƞ0 0 0  UB U  0HȠ0UB 5 0S W xx0P 0S -``W`ʁ5`0 xxP& p@-@>Pp0?R02P?00M,003?00> *> 0Cp耼p@-p1PSM"`! #@P T 0p1!V GR 0S X\kOP Dd@tAtЍpp>0S M0x1@T l1S C  @>0S@ 6`l1S   0 @ qLP 0  @  B.(0{#p ,l1S H G 0 R/ 1/,/A-@P 1 !  0SXpR0 qP 0`0SO000S \ \ 0 S   00S000@00P10 paU0=OP] Gk0P@-p0p ppq 00P R0 U  ] kp@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@Pk p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLiY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@vN@P0S 0S0 @@] kʚ;@-@^;00 Ѝ ^   ʚ;@-0 Ѝ@-@P`pO, 0B0 0p"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ ] kP)@-0 0PT0/] kP@-0 0T0/]* k//P@-$0$ $$#08D0]6 k@-,MP` ^1U0@0$00 i0p@000 0<0S ip,Ѝ8010C>S00@( ( 03(00@000 0<0S80 Mp @]J Yk@-XN@P -jpO@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p h00C0OPU 0`0HyO0HPLPU0 P(P0P0V00 S   0aO0 S ,  0XO0 S 4  0OO@-@@GOC-@PM pb圂T0SY 00C01@0S D3/X2X"XX(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0S/ L0 S* H+P% HLH0 R |Q    00   CCU 0 HL0SP'pV0S} R`ЍT0u0S 0S   ,r Q 03/PEU\ YX,]\ k@-8 0ʂ(@ ,p@ t@Ѝ@ &A-`M4PspM +i0 lp@ }g@ۍЍ4F P P  ӣ#P@@#C 0 ,$@4   P%@ &-@-   Ѝ Ѝ/@-MMP`@p0  kTP 0pۍЍſ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/% 0p/O%@-M M t fp P@;00 dSV 600@ۍ Ѝ$P0p 4Nd%H0/%@-$@@O4 @O%p@-dP@e; Pb4  PP   OT V00pp%@ &O@-@P8d>/@OM@-@I p !gp !gp`@-q@ }f01p wf01@r gp@-PM@` f  |0 Tgp 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MUuV0P0\ЍUl700@ p`R0 PU B0>000 <0&  ,>  PP> *G@-@T =@Q/Q@-@T=@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0!00 0   08S0 00 Ѝ080 00S # `pP `P{0P 0iS.S  `Pk04S 040:SL&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   9<@P @-X000Q/Px1P/$0/@-@M    0 OfpЍ~iO-YM `F/@H9X0:IpPpYߍ0pyK 0S 0S PP@ Y &P @T0SL0P 0@S0@S@@T1S X1 PAT1S@\1S`1 P5\1 S S R@L1SP1 P&L1PC_oSRPU@P04S 0s0P?AB@@$P00SLQU IPPdh1 ⷐP Pd1UvP H@ ` 8 0[$0D  H/ `0 S Y9X001H \0hep X0 RB000S0 15S4 S  CR.T X L@@RS! y r R02 > 0*81 000S up S 0 S `@@c0?H0-p 0P0H0}>H0 @000L0PPPh >J2ic@A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @dc-Ȁ 5S @0s0 50A % 1@ A  + A+": A !9 R50,@-`pF@P@ Ѝ 0PXIIp Q,:%P %PP ߲@-`RpP$M 0S0U00$Ѝ/@P 0 00 0  0S dU y6PP, T/00DU 6O-`@0p"S0W"SpG` Y PP u700 ЍTUYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R  T0 `T 00T 0T 0000 0    00 PP 0S& T  E0 `P0A\0SP0S  zET PT0Pt L&P /0 S S /S/P0/S S S/0/O-M PPЍO=`P ||ЍOH@Y@S   pW~HPP  ⫝P 0QA00Ѝ=0@S. P( 0S @PSH@`@hG0P 0 @ 0 0 @ @ p@-@P +H` 0SP$H$` PP(0S $H0(0$0p,e P,e PO-@/4M10C`pXPSg00 pHU- 9`Pp $<P@ !P7 7  '$ !/P`0@T\0S @U0 @3 0H050U) H0pl>0P G0 E@PA t014ЍZEP 0 1pA 0S ]PG01@U  CUH070 0  pP P! .R8  0R77@0U   0pP  H RU H0@1S᷃@H000zU P0H0p ,0 00 0 [K,0S4 _ czU ,0!00 0 k,0 S J Uu <1D80w40b儒000 0 PPP00 0 P  p@0  @P , UG <180w40b儒0p00 0 PP00 0 P  0@H0:0H P0<0UH# 0S /&`P /!`P00 V /0P0 Q00<0000H060U ,0 00 0 J,0HSL  Ah 0A  ap  P 4p@AK0  U uU ,P 0SU0 pH0 50f h050,0 % 00 0 m,00,pY2$ U_PPeUʣ700 5$'0 5'@pp 0 ,  0 ~p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 I,0HS >U H0P SPH0;00H090U `  n`,pP ?C`P 0%Jc CEH0Q7;0UlQ 7P0l1 x0P0l1 `)P0l1 P pD0PDp1tH000U10H 2zP0H 2r P 0H 2j P PH \ H000VH020QU D 0pP(a H0 S;70>H0209H0604H0;0/H080*UV <1%8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 {P00 0 qPP00 0 fPp@0  @U =PH <p HPWH0p000 SP0<00 -P WH p P  PWHp   \P  H P  4P   PWH BnzPP  ($wpo 00x % /k=\x #? MtmQUZb y&3So%6E^ v04uJ  sz@ ( @gD7S;@>HgL7S<H>(>A>> 1`P>>1`P>X  _P T0 ST47,`0C47<7,`0C<7D7,`0CD7L7,`0CL7O-MDM`H 0l=P4cxP E3&7 E0 + 0+0 0P70P7E H0E00 0:00 30000% _p W +8 0 E 0D0 E+ 0 P#Z 1@@\0Y,=P0047p(娾P3 @5:o ؍DЍDP yPA0 D  D 0 0 DDP078247024,0<'哸 R28>@,0D'哸 R,@=0H'87l"L'<7@7D7p"H7L708 sp0  l,@0S R R P\R @0@ R #P0 00 P?op200p0S0p@0p DDP 0 0# <00dDP P0( % 4T P9P4 Z#d h⼒pP"($$0@0S 0 S S0P\S 00@ :0p  6PphqdyPd p <P 0S P   P 0S P Ppp0 0# Pu Xs0D00D00 0  0g0 S E:$ E000X P ,@  dſ8) 0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HGU( IGaA-TpW0 T`@V0 L0LS @sP mjX X| |00 S HH0P 0RS    p@-P @Pp,x<@-p@-@Pp PPpT0 p@1@-0@FT 0@0T0S@-0 |    T0A-p `R0080810@: PP?1W U t0  t0 p@{0S h pp0S @p? @U4 }C.P P @$T T0Rt0t 0SqPt0 t0 88fPT0$0x x0R T^@RP%0S @     / A-`P Pc_ @T T0pS@p@-Q Mz0 T0S0 PU|0h xPc_`@P 0 @ X  Ѝp "   > V G-Pp0M $    P G@81A0 81'P  0Ѝ |B @T|   T0 R0 0800, P T8up 0SS90SSPT0c | `P 7 R|0   P @T T0R88xPY0Sx x0R `& [T 800XXWPR VP T T0R88FPqp0VS tc_ @TG 0`SS-90SS)"PT00S8 00 H*: S R  b p 0S 0S g@LT 00,V @P, < e s   E Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-;000 0Q0S ~/00 `  P@-Q000 0<0S i/00 n  P@-}H0H H'0S SoN/00 y  P@-D0D D 0S Sp2/00  P@-H0H H0S S,0@o/00   ^p@-@Q0 RP_0 0`S0 SQ 0` Vp@p0 p@W0 p@i" {  &0P@-x0x xxQih0X  P R !P BR #@@   p@-PP M0 t0S0S 3?@c@Ood@T $S 0@0 Ѝp/0@d`Q :0000P 0   , 'A-0S00@Pd` pW V/0000Pp 0  , n P@-808 88Qv(0 !>000  2 @-@QU ? C-`TM@ P `Sfp) 0 {f ````f1pWp0`V& vf @ 0 Q@ 6fT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0 -3@- P ckp@Ѝ0@ Ѝ/@mpp@-@RP`@p0Sp  ppG A-0Pp`@S:0SS 0  RS* R0 L`V1S* P a 0@DpR: Q   M a O-ATP` M zy@@PA(@%081 Z  xp 00`PȀ ZP UP PP KP FP xAP h<pPpZ P Ep @61@ R ,;p 0;1#3G0800 00%%)p L0S% S% p H p P p $  p | pw P0S t0$0Q0 p 4 pe x0Sz08!LϿ0x1[sTp M Pw Lp@ LP 00Dd hp0  Tp* %P %P0 x1`E@ p X00SXppW0h 1SPᡌp@$ܼP# |p ^Pp upp$Lx lp~ 0S P iQ [ T  PTp  r"GTp.P| )Pw $Pr Pm P P X00S 0Sa!Za!Wpb%P `V%R_ pZw0Sc   9pl 0!lpTdpQ0SS   < $pW 08!pCNpPH 1 R=Z  P; ЍZ p pr8    M 5    AD  + 9 D M , b s |     W H   p@-P@pp p@RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U p Q p@-P0U@S 00p @$P@I@T:哻p/ &@-P`1pSMAT  p@luЍ TPЍ@!R 0$ 0 0 &p@ S@aV 0 !p@B`P p0S lt100#40  LL0D SP (6 0 (A   R ſ R]   A-PP 0S @0p 0S @@d00 S U   ^ @ .S0.SL0_S-S```&00  @R8"0T0 0D0L& @- @0P PT00Q  @DP `00CS`0p S00 P0S X0X /XR&p@-h1@SP pPPE @p ⬳0.SSPP XP HP 4P 0  .᣸PPG p@-@P'Uc 0 7Q0 t2Q0 d-Q0  T(Q0H/@,8)0& (#@        P0  P0  P0 P0 P Np@t IPR /4tJY ` f n u }   ڒ k    rz    & 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP \p000 ,PQލЍA. !. d0h Pp`0SPE@Ep 0S:0@0D  O--,Md`pP. n}`  @P02 0S  P@ fP@,P$ X^P$0X2200,Ѝ P,P, R P,PE0S h R* 010 6$ R, R P 5$ R R ,Ph!@P !!! ߲  P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 .0 I@0 0IU:D X0 0 `TT  DSPO-@p0` 1! Y*QP T V700 Ѝ%P@`Fp  00T V 00  P     @3 \Eo   ' U/U$K\U0 T VPPT V\%0P00PP`F@pT V P`FpL&k C-QM MP<p`8p; @<pE \EOp V=p <4 4OpTG    0 Ep P; EhP E/   Qލ Ѝ   p20V00T2 0@Ep $ @pP0P@T*cp0S4 Yp`@T*T 0 Np @ Bp T @ /r Npu @ /r   2/Npc @@ 2/ jJ   .0E/PK \E/NpE 0S @00S@%<uNp52001H  "JaA- @pTPM ЍR` R 00P0S 0 -0 0t0#0Q0 U$ 0V 0  0!M  O-4MX@p 0S\`d` (0S:0 `p20"4ЍOj 0  ,   pp0,0 ,0SPC<T ,4p 0!00K,/4ЍP V0 000!0  弿 0,pjp000H!\ `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,P| 7 A G I u  p@-P@`P 0S P$`(0Sp,e P,e P : 0K[H0@-MMP+ (p P0@ۍЍ0;0 C@P ,P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@Q@T   0x@ `DPЍp`Vx1@P 0>0S *P PU@JP PYP{`x/0P@-000 00=Q$0  @i !  A-` (MX00>0@SP  0'0x B0dpp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0=0S 0xQPTA-`|VPPFPP2X@p`Exo,P x倂|"x20 V0  |20|2@-`@MpP! w (s (≭X( 8pGPU@ T700@Ѝ i///0@-$!M@ 0  *PPЍ0 3"Qp 000)00IGp0000@ 0;Gplp 00 " 0/Gp< p , "!   p@-QUp@p E,0x1p@,@->`GMV /0P0Gߍ@PF/ 9  0l0 p 1`0 DF?)GP> * 0 F?G ii@-@MP4@ $P P@Ѝ4!Q@-<0< <<孿0SSP`///6 T! $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  j  ာ PFp 0 00S p,Ѝ08i(p@-@MP F ` A W  (PFPЍp:iO-PQMM838#88>T0S$3#pW3" @H`"0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0 0FT0T(@)@@F῿@  弱 T0R  B  @ Y? P1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP ʿUPPEPP@ D$r ;Dp`ݍЍ  9  ⯿YI @ _!  >  C-`p"0M` 0$`  0q,pP @T*Ѝ`*PPA   0Y,pk0 S *@ ``T*x0V*[00*T00V:0 (P|P@ (A Y 0@Ph!@-`@DM pP@  ߾  !> U 134  R2$ $@0 WDЍUi@i@-|@QM  ⶾ00p |2 0"x2DЍ@-]MM`@FP#Cp PP VR ׿000S0S S SS wR0S H\pVPS CQRS 0  VxpF@P V$0 Bp 0S$H` I _ hDp 5 $ L k80Su S S00,0S  R000@0S  R00@ H @ 0 H.!>50H \0oDp\P0S L01S hhQc0 0 000 0 0pURZ1S SN F F$]ލЍRIx@P= @1 3P0 0- H )@)DTY$0S! HM PPN0 80~Qii@r!F @-40 000 0*Ѝ|!2S/2S00/@-@@ʾV002@-S0@0 @@弾V0002S  /!A-PM`p (P[P'@P. 0LL`0;Bp0 ,!F0BpP0Sp Cp PU0S p )B(@! (:( Cp | PxCp 7/PP mCp e&P Ѝ@v  qB@ lBpBfB@O-@p`0$M00PU  A0S;P  0P0S P弱 00SU 1 !  N0P00 0P0 PPP0PU:000y $Ѝ@-  C ЍgBp@-0M2S`P@x (ԼVP@0 \(B껽00ލp@ !B-$M^ * !  A$Ѝ@-@@A '@'@-@pp Bp`~B p@-A^ Ta00p``0@D^Q"000œ\p@Tp0,p/0/Rp@-00@ ^  0s# R0ppP0QRO-M@@00`1Q V00ЍP0p Q :8Q@SH 딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C S&P 0 B0 忻 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S8Ѝ@-@\0S J\0\0@-@`q0=`@0`0@-@08$\@0p@-800@P >0S0&0T0vT0x1 RpR 0S TT0Q  0800 >0S  p@ p@-`PK@I%Pp00,000S00 /0KpcScO-@GMpḀȐp Gߍ0RS*R?  }0 000K C%PP d0S  GRW ( Q  R p(Qh 0 00> 0200BS *ⷺ0 370 RS00 Tg K4 $ `BP0`  D\W Wd\ h00 P h7 ?$000FP@Dp$P DPW0S <0S @FT60000<0 @0W0FS 800006 S0@0 0Gq2!31 0 b %R  FR0+  %A C7 %0 @W~ 8    FRp2   0@08 R  FRb3   0FSW 700 0 02@,0 " R 07 ,04'R SH? FP%*p9SW (1S 0 F0S=00(  ѹ(100@0S W0 2S 0 FS<0 0 " ⸹ 20@W081 0 Z00 FR P0@  2S P E0 FSQ0Y0 0 2 0000Y00 @  -@W 00  ^00FSt0p0p@x 6S 0`FS^00 &A Y 60@wW0=(, "r  P W: ART ,00,S P R:(, "r   PW: ART\  ,0  00D0C0W0 0FSL900000@ CpD 4S Y 0 FS8M00 $A  40@B?S7? B?S7s 00PD0 KS:KUKe 0 S0P0"1P x0F R 0   ὸ @@ 08 S$S [ cSc25 * 7@-P\ R&@P\0S x0x208  Ѝ0PP @ 40p %C T!ſ@-PR1!5`0@ 0p\ 0C R1 00 R0  06 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000000 00up0 00ip0 00P a!^ C-@PTM ""P@, 000`0001iH00 P00 븀x0`  (9#0(10: P  P( # 8S@  ' 0ta P( ``(1 (1  0(t!p⥷0 +"70 (P 0h >``v` P( `"(1* (> >Qߍ 0*H  k! 0@-p M$M0i0PS` 1!pp;p@R0S i p ۍ$Ѝi@ 0 +Pp 81Q50 00}pP= P(  &$ſ u! @- 0080@P PU@ 0S@  `P@Ѝp 00O-IM PpPHLL `PR @P0mIߍO="0,0"7"600 0-400` 0 p00,0 PS2 V30a2@0 0 ,0T<`0 P <h^@PIߍO'@<0 Px VT` 0X`0T<0 4`<P !@  " G-@pPQP,b,`2S#PU`,@ ,x?P`?, Q 0S ,9$? }P,`0!7 / RC-)00`p@PT:p T  X ⢑00U * "0 p Ѝ0R0   @ <0 42@p < )@p p@-RMM߶000PS`B S@ ж00 0pۍЍpd p vp `F0D;, ?p VeH@- 81SsQ S0 00 0pPЍ 0SFDPD3pO-04MS@ h@@ `_0P o0 00 0 GP |3 00 y0 <PX3 0 0S0@0eQ00T0u @P0n 00 0 !`Pe 0 $ ( _X]pPv 0$,0(,8 oP@ Z0!   Q*"00pP 0$00S  $ 0 j0(0p,00t0$(,8 7P@0Sh0` 0h0 l <0304Ѝ 00 !0 pP @ |Z{0p$00S,0 P@,0$S  S S0t0l0P !R "R[p( $P(M,8J P@ ? SC O-P0M040@`0 `2''`pp'`W9 pW6l0S,0S`,0r0v 2S`,080w0v 847S`,0lr0v p"Rr0,p802 Sp0匳0g47S C: 0` fpߍ0(000 `2(p(`  `((: 0 Kp (`Z 0 Ap 00 `2,cp  : 0 .p,9 0` "p'0z0,804l0, 40pl'0k@0!04,0 40p]`]`d`k,0 !P !404ǜ R10 `"`P' 00$100,0G0 ` 0 X00, }R0SKUP 0H ` `  00,p6S  ,0 !P !0 `"AP 00@ 0  0ap,`Pg x  @ p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@8p7@ Ѝp ` 08p )X` 08p  ɲ00; U1008p@-p@`P81.(080000&0S  0R  dp`Hp Ѝ@1@ ,0ep Ѝ@` Ѝ!O-`@p 0帀SP$H` "000 0 0 `00`0! Р80 `  $8 00003H081v H ЍO<0 $8 000x3@0Sl3H000s$80408 DS ,0008 R":kg{{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!W8 00R::kg{{'{*zd8 S zkg{{'{* z0$48 00H0S0ST h Q 0R<0S 0S11H000s8040 P14 P18 Pp10 #\G00@0S0i ,:0.0 0p e0h` # P0 620S00HL = P 0dh0 ЍO Ѝ??   - 4 < W w _  P( V l r " A-@PT R0A m`h0`  | R 0i0eP 0S <0S $s7    .p0 ? p pp0 00 0ppH0  00 0$0 F#5 FAd0h04 O-R@`pP\M$P X0 #3P 0 RT0|h00 p` hPP. cL0S0 0@S@0#/L0} ৆?I00XP X0 "2P 0 Rzgjzzz{T0-d0S  $R P $[ <Y y& H" @"p  $P(P Qo,  0  <  @ , D  0H  <48`LPPPTP)5pZ +pS 0 0PPI  ≰0v` 0h10 p; :E000+@0`0v* *P00 0\ 0`v S04S 1S0810 3p  X @0  \Ѝ7S zD ! CDC  "  x@-`@pP`0 h0X $7S R @`00 , ` 6 0i Ѝ@4   ꨩ'  S p@-P@ $i F0 00L0p@m  p@-PUp00CSp@0@ $5  (00j0L0p@  @p@-P `@p/800  B\000D 0<0L00p@8 %    [A-P`@ 0h 0R0P3 081HAop` P081( AP    * Pd0d dd  0d 0 P $A   E ! ^ h00h0 C-p@ PR0  R $ RP508Ȁ `5  i@0S ~PP t P0  lH81 0S; 0 S<$_3  0 <`/0  @ R 0P ЍG 0PS 0 PD0A 0 00 0SЍGЍ !  cSc   p0p@-800@P  Dh00h00L0p@ ^i @ \/0S/0> d0S  0R/C. /O-0M0000PS@~T0`Sp 0 ЍOs> R*P 0S 07S ǚ ǚY  S2  P!  Q 0 S:500 0p00 0  ЍO Y 0 0Cs0'0S0 S0L0 p p    0"P 0 0  BF0SY0A060@ 600 0p0 0 " `P  x0 S 081Txi@<6P P0S0 0<S<0P0Ѝ 0    0P 0Y6S700S00 l00 0GP Rd532Y@0KSK?38%0540 Y0S0   P   ( [  i0 }p4 @X0S Y0 % 2)  Br  Br0 0 $ 0P 0   0 dY 6 0 @ t3@S R@00Y$00D0<0<081(?00; P0  P4 000Р 00 0 &0P00S* -P *   p @ 0ЍO9600 0<aP0 ,0S * VP z p`81 @000H 0 000 `0`0\0S   0\!YP 0 8 R @1{ЍOQY 0 `Y 0 00Sh00 00 P0gPY0 $0 x ЍO W          ' : Q  2 ! xll ~   p@-@l PTi0 0 Lp@`D N\P d  p@u`$ O-`Pp 0x1@TT 0S R T0S> R *vP  u 0 F@' O-4M@P+P Q0 4ЍOPE ΐUPp @RL RIUD:paV@ U=:$ P3U0:" R-   P% 1S 0Q00R0<2  vo  pP /  4E4Ѝ0 C 0 B<(!J i p@-` MQP\@M  +0000x @p 0S TH ) ۍЍp 0^`V \@T4!$ſA- p`@PpAPUg/ 0 HA0S 0A\0S 0AA! G-0 ;M0MNp`p Dd`80 P480EL80H8$0ED80@X@8<8  XXW0` 0E 0-p ݍ0Ѝ`N!  p@-@PT [Y W(US@x1S0pSq -02p -02;022p R Rp07@-PX0B @P 0S.0>8 Q0'Q'+ " B r R "'    00 Ѝ0@@}G~ zgjzzP+S, @ 0V Ѝ0zD p@-@P0( _Uph0Spp@O-P`@T Q Pd0S  0 t0`d0P0BQ 0S 0P L.  0800 |#  帀81- 8 0 $ 0R0hd`h08 R0 , 00C0 A0800<0  P`00 \0 00S $0 pWp1s00 2   0P C @R̨ 00pwpWL0H0Ht0p  0/@-0P s0 @Rp@-00p0`PQPE@ `H @d@$,b p0P @-P 1S P/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScC-`x1TM@T. 0S pW$ P  ᬜPP@0Sh0S d0S4$nxƛd0 0S gPPTЍ|0d 0|0 00Fd0 00@090 qP] i PU9$0 00 3PP 00d8dX APP _|0d 0|0XxἛU" 8PP *|h Pp|70S P 8 P  JU` #P < 0$Q S "  Q  Pp h  5< 0  h`pP; t0<0t00 00 80dxQY Xu ᭛P ˛U ✛pP ⺛ȐY $0% h  5< 0x  $0<0|, e [!*q   p@-PP1!? 7p`d01S `0S \0S X0S  0 @T 0Q0 PSP 0U d0S0h0d0p@2 k!q  ſp@-@T P9P@0px!G-Pp`P@Ѝ0E @P00 4@P 0P000000 000*50  .$00 pPP*0 0pʥ0S p[0 *CP  0@R 0 0000@@! N; $ @-@T PQ0 8 00*:SR h0S dP H` Ѝ$`  Pdp (0Q,0Q   `P 800000( ,0?PR0S  0h dW $0Q 0h0d`s0SHAʶ6 W 0S/0S/   O-MPH0<`R8 0@xP00ЍhpP P 0 U@ UP R R R0 P 0S8Y0000000Cs u@UЍO=4 @PЍOa p    @@0 0)0 , S! 0S/G-P@M T 0p `x)00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000pz P] 00p0000 S0 @00:S 0S @\S000@:S @(,L&0@-P:P@A0 P\:R \:\P@\\ @R0/% 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO0E`VK `0P0E@ PPϣ 00pCލ Ѝ@@B;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S M' p PP ;000P p 0S#0 0 0:p8`@Z + 8'0P R 0'0SF ]@ Y@ &0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D  0SQ &Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0e P0@DJ`F ; 0S &4 Ȣ 002  @ ` P D,0合  ገ,0@PE P0S b&$ D0A00T*, PP 0P:SVr(,%@-0  0 Ѝ@-(@ P [0 0(,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ {0Pv Ps @ K[ Q0+P ލЍ {0P P 0@P0[0 PP U Lw+P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  (,L&p@-@PDp@NG-`= @P@ d Pi 00@^S0S:SQ @0 R0FAd3 P= \S@0S:S: 0C\ 00C Z @ 00CY~0TS @ ASBC\ 00bC|^\ 00:0 0 0Pd 0:SS0AR0@A P Pd p!!A-p= `P@ dZ PPd0`F; 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P 4*P@,Ļr G-A0SRPp`ʏ PU00Ѝ ᡐP00CS0Z Pp0 Y( ̛P , {P MP00SW  R00S 047σ,P R   S@T PR   R @,h,H,@0@-0S |P cP@,h,@-@ZP08G@,p@-P@PPp9YPp@,@-@EP Q 0@87ST @,h,p@-@ PS P@p p@-@P * 0@87ST @,h,O-pWP`@P @ ЍZ K P PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  ᆏP00CS0X Pp0 0 B hjZ ᭚PD `8 \P .P00SX00 S HP P00S  9P 3P x-P \'P D!P ,P$ :P,0@-4@0P r(P,Ļ} X0@-0S ;@@0@00DIP0DЍP,,@-@`0P0`Sp 0`.P PP Ѝ,@-@P08D,p@-P@PPpWPp,A- P@`pPЍ0 `(0P84SUP @,@-$ 000B;P Ѝ,A- P@`plPЍ0 `(0P84SUP @,@-$ 000B;P Ѝ,@    /0A-P<<`0@ ME0p0D0& SQ~ 0@/0PA/A/O-@PDޘpDpG``b0Y:0z  Z# 0@@DĘ 0DA\0:Z: [=0 S: p `$ Ѝ `p,A-@`Pp᳗ ~!᭗ x!᧗ r!ᡗA k!0@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pᄃp TT0 "p@ \<0@|404 4/,00S 0TЍ % ,A-`@ 0s P0%"0p0pGWp0P"P @P @pT 0@@PP @,p@-@P?@0 ?@0R:@@pP p,p@-QM$0Sp A1` 6/`1!6/& %R1 0Q! P` 6/* |)Rt10p(Qh! d'P\X\`P6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp, %S   >4  T; q     % 6 C H O-Q<08@0(00IPR @pǐ`,@48pT:(㙄)<0( T:(㙄)p@0(pT : Ѝ  婐030I/@`(4囐8p00 D3#00 `@4勐<08p4  b "0 0 `0@80@,000 4/0SD0 , !! %Sg p@-@0`,0DPSp1S@,0D0P/,G-0DAMHPMU`000PP, p0,0=0@00`o`ⴓSLXo Xw +pn A>004@ppG0SkX$0`S D#4ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00o\\ЏK `D| <Ǐ,`;PPDpAލЍ$pP ~ P 00PpWA C9RQ  0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0d0d :/1, !יlP 0H0,! % %-,!(,@,  0H0S/,0P /,@-DAP|0`SDM)0S&0S S f0P 0P@ DЍ pW*P 0 000O0pp@ x`0p嘚X0 T7/0S 0SP 0 P0DЍ@*,@, % G-\qPL @0P12C001b5R 0 0&0S  Jh0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R|000S0PS m&0S,P O,@GI,-!\  0L0#0,@-p0M  L0@31 ^AP 0C! 0ЍlB, @-L 0 0@11D ^Q       ,A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zᆘ$0 HD@,X#10000 2R01   000 S" V00 S Ď ЍA X 1(4/00~X0威0 +SV Q`ЍQ0S ЍA`\c  Z) l♍@l₎%0S Z c0@0, !A-Q`0MS 00S` @P9 0s$@Ѝ 4pW   @,K0p0|0S0S d@Ppp00FV@@P 00T l@Op`W 0S:S* 0 0p0pp,@,O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1Nh L0C R P!050%Pd @T: Ѝ 50 p[L0CY1T*Q@@,G-qT0So:\0`S& 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG   0B408@S 1:X 0@D8C 003 c0?o< @@D@  APP  _POPP 0 @ S :    b01"!00000P00-0P, %A-p0@@ `P PP0`0P P@l⅌%Q *0S  ᭖,$00S:@-@@R,@-PP` U(0SP@P )@T \0@寗T0T 4/ ʗ 00'0S 0 (( @Ѝp, %S -O-$MPpPdE00U0SPc )Z@ <3@}434 4/W(0Sp0eWD@XU0XX5 0PPW00 # 30+*[@C@dQR: @L{P5 KL ` $ J2 10X0D30 2%Q a*0S ^Z^1)Z @\ 1@ 1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   w%Q   ᣕ0@P0'0S 0 P0p$Ѝ*0S  , %S H (,-@-M@pP,aD(0SWTP )@T: 0@咖0 4/0#880 BP0Us@P  R'0S 0 |( @UЍr@P %Q|0S0S Pz 00, %S} -O-@QpL$M(0S@ P yP'0S A p!$ЍW $0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*5C4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp<`0<0 0 pP ]PP% 0   D  K%T#2QZ J*0T00S  DlULP )PU @0@冕<0< 4/PPꝕ 005,- %(,S @-L0@'0S 0 00 0LT Ѝ@Ѝ,-K////%/%0p00/L&0p00/L&0p00 /L&0p00/L&0p00/L&0p00/L&0p00/L&0p00 /L&0p00 /L&0p00@/L&0p00/L&0p00 /L&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/ & p0 0CSp0 S P0 /p@-P@,`ڏPp@ Tp!0A S010//!0P/!R/P/P/Qa/P/0p000 /L&P/ 0S S//0R/00p00/H&0p00/D&7@-@PD@P 40R0PPO0  Ѝ0S @ &PQ 0S///T%03P  /S0 ACP 0ABs0P r CoSPS//O-MX@ @ЍOSQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!`PE`0r>T 04SJ:`\H㌱  ᅒT  QX ( Q   ~ l Z P   ᳒T0`[?oT20S@ @ @0R @T`0-@0S S @0V @ X 1@@V X*w 00`00P 0!!00S00/(!@&k 00S00/!& ///@-@H1@P F(  @Մ@ &Qǀ-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A ݒ00ЍQ@P ϒ@p@-0P `| @P  \*. Q  Rp R  (  p 0 B L&T,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00z Ѝ0S/1>3 !/0S 000/T,0S*p@- @PQ P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!w0`A-PRp `@{P 0!ᵐ000A-@P`p쁟0 SV1 V00W W0Sc0 P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA!A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (P0PA , (0 ,P &H&D&A-`P P0PS\ ]\ xp@BX T 0| ܋PjPpt%0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00T, 8 0 s000/`Q'Q!//L&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0n0 "0 00 0WT,p@-P@,`׊P@tp Tp!Q 010//!,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P` &H&D&O-P 0R@pM @[ P&  $T P 000Ѝ 0@  NPP ЍO 0 PS@ ̍ 0 00<00S*^Q0R08 ]R00-R ((g Q* ]R -RS\T0]Sh-R0 S^:0S006000S80S 00000`d0xS ,ZGV ,0Sl40Si$0Sf<0Sc(0pw_  0(`c0 @`F p@ RUj 00C0e-R [RS :R =R| 0S: R 2S0S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``G0 :0I~P   0y S0<R$ MP    wP  $0  0$ 峠S0hS0`0`0-S]S0`S0`0= 0 S:0`S0`00S0 -R[ QX]QU -Z00  YJ 0S- Y0`S 0`00S0<Y00 Z0S  Z4 0NMP / {y400!0ⱐᲠ40  =P0S 00100  0P  +P{ U [ 0]SS0<Z*0 P80 P <0 S P p`v`00勰P00 0  EB#ЍORZ =RW ]RTR :R ]R007  &T,L&H&D&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@L&H&D&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xIPu 844U\ 0CUUt0SU 0`B t  | 0D OU &83U N 0  , 0000h30>@0S* *Q2  0  B  BI   B0  B=Ѝ 8 0S 0S 00t200}PT\QR {RO00r0PS;* ,R8 Q 6 2000/ ]U0 R  !   p0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \h V 1L  0 S *R \R )R003 0S00000+T,)>{^ ]L&@-0@``P?Q $0As R % S 0 ^Q [Q \Q 0S Ѝ{Q |Q?20V:0S00500 @0` V1@`(P G0 S*0)S  ) V 1L  40 Sf:0S00p4000 S**@?PQ{PR ,$  "!,Q 0S 00300\0 0S 00300?P  *P 0 B5  B   B0)  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0@20z`o ksi0V:0aS0`000<Q >Q q`x+P {N &   B 0  B  Ba  B5 "X A, k0 `S0* ,R-  0000< V0 R   0 S*}Q00@ R 0}Q 5000S 00!T,L&^ ]0S G- `M pQpG ӃpL7@P 6W: ЍPCPP P $PPxP @巈P 0uPP6    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0_IP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 f  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S*P8O@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U! R0>P P PS 00 00H0@0 @000 0 R00d000#J 80S@ 0Q10CRZ/TUU,g SHlRT,Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0{P` &H&D&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@ &H&D&O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  bP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(L&" O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0, 0(0 000@$002   0 X @ Q  0 R  R  PZ$P  (    R    ``S  R  Ug h V pt p r _U RQ v   _V R up  r   _U R w v  _V RQ ppX u0] v  r    _U_V QO  X 0FP|u  p $ V    upv  w( ppu  v X pX wX0wq uc v _VX 3"  Q$,ZS (  `X S 0P&v u _PU PRPU00000S 0R0 4Ѝw`Vw_SwPu4L&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0800@ 0 YS  D>31># R 0800@ 0 Y_  DS S- S* S( @` PS 0e800@ 0 \Y  DSU S S 0>#0FϠ2@P0  @P0  0P P 0/VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  V^P&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(L&" O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  OP ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E0  ?oR20SpG pGP x0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0/PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  mWP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(L&" O--lM%PQ0u @%Qp ppm        Q 0"RS. 0 YP,Q 4^ 8[ <``F0 0`Z01S` 0s vQBo \R 0C1!S` `0t0 0Q[0 000,@4H80<@ U PP 0 TX\ L0`x Vd 00 S`FY1`0 0 0`,UP XD0S 0 0D0,E`PD00D0 0R < 0JS : SVP Z Z `p4`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$0 0D0,PP5DQ/*0 F00,`PD% 0 00,P0HP 0000 0D0,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y*,Q 4^f 8[c <``F0 0`Z#01S` 0s vQBo \R 0C1!S` `0r0 eE & 0Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S7 0 0D0,`PD00D0 [ ` 0R< 0JS: 3UP Z`XD0Se 4P,0@P4  p4P &HP "lЍ,0@ 0S%00D ;0$0 0D0,fP5DQ/*0 F00,%`PD% 0 00,"P0HP 0000 0D0,H0SPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80S 0o <``F0$0`Z"01S`$0s vQBo \R 0C1!S` `0q0$0Q0 000,@4H80<@PP 0T X \ L0`vV 00S`FY1*`0 0 0`,7P XD0Sc 0 0D0,'`PD00D0 0 S` 0P< JP:$0  TP $0Z`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$0 0D0,4P5DV/0 F00,`PD% 0 00,P0HP 0000 0D0,H0SlPHtDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPppp pnpl-Ѝ///@-3 // //0p@-8P00@S Pp7fP p`,7@-4P@0S TP Ѝ0P `,@-@P 0S p@P/fP0 0 0/ /0 0 0 0 0/////0P P@-  /6 `,. P P/ /0 S/ 2#0/,9O-,Me`pPR0@X$*$0S$00f 0Z0000\0 0 0 R0030#$όZQ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR#  0 B 00Y00S  00C 0S000` 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SB0 S H$0 0CR0%2 L }[1000 S 0!03 BS t0 S 0 0Y $ P @ $0S$0C[ 0SW 0 0,Ѝ 0R3Z0B\\00S SC @PTP>: 0; $ $ {20fX Q0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ { {Ѝ3Q0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`&20G-M@0p`W PV P%Y P.X PmZ PNx P4 e_W Pf  ]_ X_V+  Q_ L_Y  E_t @_X5Z! L 5_< 0_[ЍYXZ-  _ _  _  _9Ѝ _ ^ZVY  PЍGP 8 (  @ P  , O-PQ0 M0R0p`TT00 0  @P @0S nSc a0CS0 ?oPL 9oPF  Ѝ0oPzZ V000U000oPLZ V070U070@oPZ| V000U000nPZ V000U000ZW V080U0800oS nPU000V000~0@DnP 0nP nPiZL V080U080]nP~ nP nPSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000YnPZw ZpPnP XInP  R X 8 ( H  @ @ 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  pp, 0 rp@ rp@  ]p@@@dr0 PrrPr0 PIrP`Ѝr00@O-1MM @PDL 8 "( Fp C. `pXP@D;@8 (o0Sl pp  ` ᰑ 00㨱$ !`%0p@ t0!0 xPvP 0S R]r001ݍЍVr0S 0K0S R! Pp 08D<4! @ P0 00Z  0o00h,R <>1ݍЍAp FtHx gt0@-P@M 0  POp Up@ P P Ѝ00 0Ѝ0@A-@@0s/ PP0P 0C*p` ``0`0qppX`p q``u0`0q 00L&@p@-@PCM0 /aP2 $HpPA ` ;@q000Ot1 @ 2{@P0F0 {@F=f0S VS00 SCލp|@@0SSq@d0d 0P@0  P@1:fq?00@`q00@ p@-QMP4@SMZ TE /.aPB QP0s+ hlP [QaP 0`)pO @ 0@fqpF @ p? ۍЍp+0si/0p0! +[p@0 P@0 $ P@1:p?00@p 04p0#S4p@ p00p@p@#|#| 1 %@"4 < @-rP`O-$(X,p.S`P@+Wu00Sb [0 0UP:[$" 2Q%> !4"0x"3S20*rW00Sa [0 0T P :;! "#.0P@AQ#Ou0 {0Qp w{_ T P :;$" #0P #[0 0TP:t' 00{S' w{P c 0TP: :) #0P@AQ#O[0 0wT P :[y'@w{ 0gTPy: )Z@0S20o2" U%> "Xw{U KT P ]:4# JP0S20S2">" R01Q"Oj0S20YD"""""""""""p@-@M@ 0P, ` F 304PIP S F"x&  RQ9F#0 S0F P\'0s F`0d   0 Q0*0^*{ r0s{P T80<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS $R" :"  R#Ό01"?!x"0$00$0 00 00000S <\ H NR LX \ @0Dh 0R{{AP{$hv` &0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#MP0L dS0 {{ {{{{{{`0{0{d 002(0S  R $ R' Ÿ\ :6Ÿ$4&60!$ 0Ϡ! !>0T"!!!0C 82 P02@.3H0/#0Ϡ R  " RD#L .@0L  ?8 H D<00 0#!/":N6@ 4$&60.$ 0x.>Â!!!0C@ \0RDL,"΃0,ώ #1 HL  LH @00SP0D 0 0T 0 0Ad00$0S"x$0S"x0$0888q7d7665`UDU 5""""l'.%Q(\)\²0 4080DP @:($^0<P0} 0=RH wH %0h00c @D0D0@cD0@#:6D 0 0@ . 0Ϡ.>! 0!!!0C" R 0L  Ό D"L!Q@X?#"  ?00 #1?B! H " H D0 L@0S 0\ 004 0 20DP :P0 0<R $0h00c 0D0@ucD0@#:6D 0 0@". 0Ϡ.>! 0!!!0C" R 0L  Ό D""Q@?#"  ?00 #1?B! H " H D0 L@S0 \0#0  0C0  BQ $0 h00$% 0dR  P@D \DDDQ&@0TP08<b  \0y Q00000SmPT8< LF !G 0 F!A 0 !;0S(0SQ <5@0P G: c 0D@b0D0.:@6 D0% 00@. 0Ϡ.>! 0!!!^0C 1H02 >0.D0LS@/2"́ ?0 0 #1?B!  D0 @0SHL 0Q 004 0F000$02p rp t t   0 RR  0 & F% F RQ#!F RQF# &(0S@0$0D000<\=QH NRL0X\r@0h@0D0D0x0 000$0q0$0n P#R R|  \Qp% 8&<N0dP(003( :60 0!$Ϡ0! !>)0!!!0C P?00.!?@ /" R  " R D D0 @ 0#1A0H h0 0%L 00@0D C00 00S ^0  $0h0 C0000S ^  0@D h0 BQ0 $0h0  vps; 0 *R" O-Mp@$g0Hl0g0W`0 T) 0 2c1 00 <0PP/ 0v> 0`0?d000P0?T0 0#?<0 00$$%"\˟$@ 0000  000T ;0h0PK 0TP dP< P= $`Pm0Sj Rgʰ R cʸ R _ 0 0c 0S0`@dp?O$@T'pET0}Np0`@dp00Bg00@D 00000 0H0X PQ h 8 v^D Pt PE PQPHJ004 嘐lpx|PVtRSY Y  h@p| Ux Zt 0Sp0Xl0[h0 Rwt XX8P0>C 0Cĸ0p00@t0p`VPu x0S f0pt0 0800@4p0 h00 0.P  ' 8 PZv> 00! 0#/!! !./᪐ B 0S.?)0S 00#0S<0 !hv.A BϠN ^Q| Sx000t Pt0|f 0 _qp  A 0qp `pV@P0 ?oR20SZf00ߍ 0Qf0h0qp@p0 Y Q#! !pY@1NRp. h0 P0,Pd000 `0  ZR 0`S 00@ f0h@ "f0S  0V0ZS0 dh` 0hP0? T00h80? <00h@0? D00hH0? L0X$`\SZP L`eT00e0S@Tpe0S: *ß䓟"bY02#:"b"R0 \TP(e<PP 0 lß0dT0BP30@p=e000h0 `0@4pP8P ? /( Rß&0Q 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 EIqp> @p(p Je#00 e0S @㼀p h @pd00@pߍ輀X) XXʏ 0d0Q  s!P dT00d0S10(` #ΌQ0"c01 2c1@T`dT00cl@>)\P(\ ףvɻ %I$@-@ Lp"TJat X00 R 0 R 0Q/  /   ܫ  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/|P @ H  Q j.0 0#  Q/00Ɠ\ 0@-pPo> 0@" \ 0 /pA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPpA-\@`@DP pH@P0& P @PPO-P M pP9 谟P n`P P @ % oP @P0S  Ѝz T W 4]  UI0p0St A-pPQ `@Q 8P 0@DDB(000S  :,H!@- M`pPPp) Fc 0 Y0@0S :c0"S" 0p000S0 7/ Ѝ&c0"S1Ds\0pT000S @ Ѝ1Ds$ QH , @-@k i@fO-PMU@p  PP2SPR  PV P` A T @ P) 0nS: P= RP0 p0Q Q P P 0 IB"Sq0 000P Ѝt0 00 S   Ѝ0oSP  m묠 <O-BMM@pzb,0  0nRP:TRPP  bRPm00\xP PC @@`Kr'0 PP9p c0P0 0 PP+p H#@P! 4 0dSPkPU0 Pp` @py  0I]P @PP0 PpO ๤P Pk ia 00BލЍP/U ` P p=a0SM  LP L0H0PP0 p<  lLa00  0LP`! 0 0 0a080  0~Lca !0 VH]00,a00  0YLPa00  0 PMLuwa0\0  0BLPjꌮ   zd@\ , l  -{M 0 { 9PЍ -{M 0 { #PЍ >-{M 0 { PЍ ?0-,M 0 IPЍ䌩 --0$ S   0/ 00p@-PKU@p`? $0$`0 6/p8 p@-P}KU@p`? $0$`0 6/p @-@P 0003/ @-Z@P 0003/Lt p@-P?oU20S@p00 03/, p@-P`UV00P00S@p  P05/ا p@-P?oU20S@p00 03/( p@-P`@PpT`$0$ @0p@/l p@-P@P p 0 0 03/pL -@- M  Jup@(0(003/ Ѝ@ Ѝ/4 @-7up@0003/ G-- M` P @T0Sp Ѝ_00,0 P@:/L0 G-- M` P @d0Sp Ѝ_00,0 P@:/ԥ 10!Ph /////x/p/h/`/X/P/H/@/8/0/(/ /////////////////// ܥ @ l \ H d $  ԥ ĥ l \ H 4 Ԥ Ĥ |  h @-@$ MP#055050%A0!0%9P$00$0Ѝ R/,0p@-S@pP($ARp$0S*> $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@Y PDM@p, fx]@ [a P @O [ [8$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S>3 57,05  50Q,0g 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0YR#00C RL00C F5$0qS<3 57,058`0,0= A/of[" R  :AoF[P  f[ AA0@ \Q],0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQj p`0t FQ)Q* AR  bQY fQ ?R0@SP p b7rp@S B:p: C cs3<2080 S ,0 S,3 5407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ= 305 7,5 0 ,Mb@0f`N2$0?Qa R^  2! a, A0! @ `3 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@ `0 _P$ P! QP3 ``` VRQI[  R `S` 0P0`\ P\=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`S<3 57,05 50,00804Q,3 547,5 5,y ?R0@S@`0%#jo%#jxz %ju-M{0{0Ѝp@-`PM0@ 0 4/ЍpG-PRM\  `UpP*/a@jLP D1000< pp Ѝ80S  1 000< pp`\0S Ѝ贠 V\0S 0 < @x0000< @ pp;\0S6\002\00  t h p D @-$$@M Ѝ5O-EM MaX@P+p `EF (X0P@)T 0 X0P@T 0 0EAP F FUEލ Ѝ[00Eލ Ѝ[00| @-@` pMPVP* /W 0R rR  P   P @0CЍP  rR 0rST 0 @0 Ѝ@w[ 0 d  4 A-`@ p 0P/S /eWP @0 Sp 0 S @A hZp@-IMM@`PP Jp 0: S X0 0tp IލЍp>[O00@IލЍp6[00x p@-IMM@`PP p 0: S X0 0Ip IލЍp[O00@IލЍp [00 -{M 0 { PЍ P 80Q 0 08080//p@-@P PP`  PP u lLP  p@'+<PPp--00 M (0  ЍЍ/`/,P --M  Ѝ Ѝ// -@-McO<@P@ 00  0Ѝ@Ѝ/.,0-@- M@sOP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$ PY P@ 0 @LYP 3O8!,Ѝ000:Q!0P00,ЍD.80p@-@P(M & (Ѝp0 00 ,,p@-`@POpp p@p@-P000 0 (M` & (Ѝp,,p@-@@ @  `  @PNpp p@k@,,p@-(M@PNp & 8 [(Ѝp@-@PP P  ,M` @Np & A,Ѝ+,C-PP,M/  @` p`FV`R V @`0 @T }N ,Ѝ00 0:2 0,Ѝ<+80p@-@P(M I& (Ѝp0 00 *,p@-`@PKNpp p@p@-P000 0 (M` "& (Ѝp),p@-@@ @  `  @P#Npp p@wh),p@-(M@PNp % 8 g(Ѝp@-@PP P  ,M` @Mp % M,Ѝ(, P $ Q80 @-8M80@08 Ѝ880/LL0000 0<BR 80880Ѝ/h(hP/0@-@0@0 M0S 0000 X0P x0PP d00!CH0P00 Ѝ0@M0 V0 W8 \2ATT 0`Fs 0Ry %M 0  0 B0SH M0Ѝ0 V  0  M ` 0 0pHX;0S2 0 Lv 0 B@ 0 B  BL`FtY  0 Bz  BL 0 pz L 0 c0S 0 BZ00Ѝ 0 P]& 00 #,p@-@PLppp@ 0RS00 /p@-@<0<00P  @nLppp@ ",808 00 Q0R00 /D",p@-@`PNLpT T   p@pp@-@P\ \  ` @1LpTT  p@p!,O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` eBp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ000,!0 00w(,@-@0@ 000 @T AP80@080@-@P }AP80@0800-M  uЍ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U P`? K͌T P? F͌(Z P> F͌(1S P1> C͌ X {P@> JB͌8W iP= ̌V WP= ^B͌`=@ 0S078d H0P< `P P  P P P P p PL Pp(, qP P`P (aP Px PP'( Q780D0x100C40S000C,0h0Hp0L`P$$0PQw ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @~T, V   @@dqXhP 0Z Piߍ P 1 S  ,00 0! 1S 0D 0| 0L@p00IP,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@P㘼P`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0տ0P@@X1(@P0Ϳ0P0$001T0ƿ0PPP1 PX0徿0P0000巿0P0, 0pBPBHPP@ 0T8`<@OH Us,` p@PW 0g1pV@10P00 00Z00 uZ,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UfT0@0p8`<T4 ! , <B B P $@0p8`0[/To0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ 㙻PP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR 0`0 0 0[0ꈰ  0PU 0P  0@TP0 @  0Z 0^ύ @  0`V 0 Jύ @  0X 0Q̍ @  0PU 0P΍ @  0PU 0,0$ 1@,  BU00p@8`< ,   , 0 H T0封.1D|Q>p@T[ 0p8`< T P H00 0R_ (0Sk ,0P0 P 8XC h!(0ST L0!11 @ T p @忼T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@.!(0R1P@PB30P@ T  0PP0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @IT,000 @,0,0Q@ 0@1>PpP`ܹ Pp W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `V,0 0@ 0 `Tq$0W1`V W  0 㑹0P`}0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a P嫻U,000 P,0|!0RP0P1`@A0P`. V  0 @ P50 0R80000S  0p8`pP`4 p[ A-Z`pPp YB2S @TwU  000 R A A @@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0JEl0T0Ѝ!f <0l 0̃ S/lO-C@p`ᜣM[ +(p( $Wɷ0CS0SL࿷3˷8зP $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0cDh' Jl`p \p  00(@T(0Ѝ `a@X dX !+!,!-%!.%0%#fq&i%`"j#%ok{ %|l%m<%ns%t$%u4%v,%w%x~#p#rd"ye"z<>pp<^v8#:0'ߵ#ܵ0z# 0׵H#Եp-ѵ-ε`_˵|ȵoŵpµr㿵y㼵z㹵{㶵@|㳵h}㰵5A-\`'^`@ p 0\@(`V(PpO-8g887M`  `P `0ǟJҭp 7 000 S00 U0S}Yp  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0״ $Q B q/ 0 ;0 ȴp4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3 `` pS 83003 `Q p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#V p SQ p  0 s 00bR40 ; 0'p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 p E  `Q q 4 00 0q0cR  0 ` Ѝ 100#?c p; 000#?c pv/` 0 `00! 08 4 00 40 s 00bR 44 `ȚA<QTK 0(  0 + 004 00/|O-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 8027P0@P@P@x@-@jBP `dBP @P10S. ,P:  0@S0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@S0@S mS 0C;S P   0@S;Co E E BO-0\fS`@pMDvpZP S0 prʍr 0H"Rp (0$00 03SN8PK ʭTD8P  0XSڄ%$ x%T 0l5"00\4S03`00S5 p0S2 4S, 4S 0㨄25X】匡Tp2 3Pm 4p2[& LAT# `P P @˰ȰoH5S4S 4S0?o2ᵰ04Ztx2 PsY  gAP3[x2  ^APx2?;~0x2X  TAPx278x23Y|2 PU t3|2gЍ0 D p$h l $ <%$(LYh .AP Z 'AP ["  APp2?;~0p2|20P?0 rr 0H"Rpp2[Pp p@Pp `E`PE0 ~2 U@0 q 2@ p@-`\@PT 0S1 RT0S@|0@Svp@sG-lp@`S0 ST0S"Q0S 0STA-@0M0`@P- 0 @  0S 0@0@j†K~"  2 0QU o= P*L . ]@Wۍ Odȣ7 -P PM 0 R  *’0  ЍX0 Q0L 00S P@-: #k/p@-0 0P0S$ :#`Ra# #p @0P:##C B")0:#!Ba##p  -L0LM0 0\ 0ʌ   > ЍP8 80 00\ T 0//p@-PĹ|`p`@0@ C0SP0P0:3S 8 80 0 L0:#pO-ll3 0dS0`` M*pB`P 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S h20`2 `kpw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR  1  S7K @y ` 0  S q`R Q  1  Ѝ:p  B/oq`R"n000#?c Ѝ 0X0X0 0 2'8  D|<|8|{Qzy1 yG-0S03P`@PY 80$ RF U ʌ3S23pSlW " Rpy *86odcτ00 0#d#lm0 p _F?2? 0p2ͭY?w 0`w b2P`0  0 0P`p@-D@D0@Ppp (0l0m 00 p`p@-@0@P:#Rt t# R- # 0pppP`p8:p$dp@-@0@P :Qld^p- pp#DP`p  :$dp@-@0@P:#Rt Ó \ "R-- , pp#P`p:p0$p@-0@DPSP @p (0008 <@%8 pp耿,@-H0H 0@0:#R#R"#0:(@-`0` 0@ :Q Q- :̾@-0 0@ :QQ σ #ppPo :X@-0 0@ :QQ σ #ppPG :踽p@-0 0P@ :QQ tà Ãpp#QPp :hp@-0 0@ :QQ σ #pp)P` :Q`p@-@0@P:#R  #Rp @8 %8 "R--  pp#P`p:pp8 :꼻$,@-<@<0@00:3S 00 Ժ @-8@80@00:3S00ꀺ @-0 0@ :Q&Q)   0,0̌,͂ $  $ "p"p#P`S :Q0p@-@0@P0ʃ#R(#R+ P-0 , 0  -0,$0 0$0X0 R0pp#NP`p0ʃ#RpDdp@-PPP. 0@` :QQ! “Tƒld l pp#P`p :QppLd0 0 l,0 0 H,@-@ MZC.qQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#c儤P`< 0 000:P/@-0 000啲踵T0T 00:3S 0@-pp T0P`/ጵX0X 00 :3S 0-pp@- cP`/($0$ 000:#Rs/$0$ 000:#Ru/ጴ000 000:#R s30/X(0( 000:#Ru30/0 000:/ܳp@-P0P`M0@0 0ssp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp謳ht@`A-RBP0@SMq QP 0S `[ 1 P00pp1p0 Q41 1`p0V0S  d100V0S  034ppq/ 03, pp/%ЍP  QÁP 0:|   000 00;0 ` 0@:00_d_ht@,`@-,@@0S:00L]@-$@@0S:00 ]@-X@M@ 0S Ѝ< 000 00:0 0Ѝ\<@-h@M@ 0SЍ : 0R  (00 Ѝ : h\(\@-@B@2@P$MQ :cVT0r3ppp.0Saqp 0SO1p0S@ 0  B0*1`00|PM 1@ 300 R 8 C 300 X30,0  :3,pp4 P`$Ѝ0`00|P @ ': 0R` 00 `900T @8 300  :4[[hZ0pC- M P  ᕽV L`勽㩽<0`00:3S \ { Ѝp h 0 000:3S/IT0T 00:3S 03@-pp-P`/@-<0< 00 03, ppP`脫@-808 00034pp-P`40@-PPP M* 0Q0@00xP 00 02000*C+ Ѝ0|P H00 020000* + Ѝ0h/0@- 0 @P0:R M# P P&tP 000 20* Ѝ0`P D000,PP Ѝ0h0 000:!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@TpV#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-ȢPp4S-``@PP3@ 0 00p) ,ଢ4, [ 0 + 0 0 ^ lЍB0  9lЍOG0O-:$M$pdZ0  r$ 0PUv P0p 0 p b Vp(:0PSH7 0  ȡ@P$Ѝ0SH S4 SpV  5p0004S$ЍOAp @0S S SpU  5p`Fp@0SF0Vᨀ *HVp P @FXp  G5p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ /TP/ { @p ` PPE @0S 0  `PЍ` D  P 4A " 2Ѝ @0 P P0  0 />404 000S :P /x<0<0 0 0S :P /4404 000S :P /<0<0 0 0S :P /ᤛ404 000S :P /X-DD 0\ ʌP 0 @-|0| 00@T 0J#4R B0pQ 7@.P f @踚808 000S :P h/,D0D 000SP:P4@//000 000S :P /ᐙL0L 000S :P @-p @_/PA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AlB0tQ 6A(.-0    p000 000S :P [/ܗO-00 0 MX% p `P 0 ٟp @˜P  0 P͟p@ 0 5@  Ѝ@ꘗP  P /p@-JP 3S P`4`30PV  0s3 S 0墝P 2 $R 0X0S 0D3 20X #$04p03pp8Hp@-jP F3S @P4P稞30@Sp@衞A-`Pf JSU?sW< @P3$S3 SW*0N, SsH0S0 WP3PSSpP4S{pp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `*P LTL VW PT VW  P000S<080 0 0 8xO-($Z Ap`PўP@8P ( 2T2՞P* T ˞P 0 2 @00 10WXT P  RX8 @(  !62@0Dx @-? p0   0 `T1@A pP`U@  00008A- Q@PP% pW# 0 0S0X,V000 R   R   R  P A?4;`T `TX *P Q Sp  QW02 dp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S ZP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p `pH0H 000S P@ ?# Q@ 080//ᘋ,(0( 00Q0/<,(0( 00Q0t/,p@-P0P0 0@R` ) p@O-p0 S;,0 0D | 0 00P0q~pI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPYox0 00k,p@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CM4j0 00i,\000S  Q R P (!00//( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝg(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0O-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dp `| up Ѝ@0 S RQ Ѝ,vP d,0o0P 00X p  ``F , B,(`aaA0  T p0D`4EP  Fp`,004@ 0T` p0Du@U   PB  0SQ 0 0PC 0$ 0\R =@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP b,PQ8 0 /$ $\/ P/|_PQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ETpL @10 0 QT$ D 0R U EBp: x0 0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q(_,PQp@-P0P`0*Â$ @P uT00PU pp 0QD]P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0T0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4zڌ`;@Ps |{툰 {4Pp,p IPP0_ Y4% 80!S0` ``pX08 0 T``0a$$ <@0H0|08 @!\08 `0d0h0l0p0 ЍP4- P' 0*Q- Q80 SpG V P  PʫR Ѝ @ Ѝ  A-0QM@PP(C p`QAR   B P1 \.X) P$,P?PP H0 DH00R00D p0$`P!b@0SЍPЍV@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @Ux$0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0$S,@-44@M00 MЍRQP-D00M  ( @05Ѝ0RP8 /00@-MN  P@N000 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AAlQO-DM(0X04 ,00S80  S l0( S࠳ࠣS࠳00CS࠳h ^@4 @D,  p04\00\0T00S@t80<80808080ql00s0SK0Cs0p008 P(@T ^700qQ000, ,0 (0q`0s0S#, ,  P(p@@^ @P8@hPuPC ^hP4@N~@t@~PpH~^ ( npH^, 1 00T<08 <`! 0!1a S 1  0Cs020Cs0Sq 80rD 0S 1 @t@PT 0uPs08<` 00 000 h00 h (000 0 000CQ00( @ 0 0AP8 h(A^ (  h   BQ 8000c(0 pRp 00(0 R 00SX 000 0 1$ 0S0 !1!0$1Ḁ{0Cs020Cs0Sq D 0Sp1L0|100 pC 8000` 0D0 !L| p. 00MDЍhCpPp4p 00 (pQS 00ã080@0808@8p@@pDЍ [P [M 80&PU0,`A0s0 ,pNq ,p  B   S ^030S@;A-U5P`0%@00?C5Mp 00TP 50 05 0@0@0@0  00P P50 0@5 0@0@0@0  00P 40 04 0@0@0@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0{ @0;@0  00P L30 0j @0:@0  00P 30 0Y @0:@0  00 P 20 0H @09@0  00P 20 07 @09@0  00P <20 0& @0;@0 004P 10 0 @00@0 00P 10 0 @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@000 DG~h\|x0@-h@h0@P M006S 0  Ѝ0(0 000  Ѝ0@x(Ahp@-tAPQ@`7 Q`1000S 1Sڸ0  @T @TU p0 0Z pp1S1&0C( s00B0Cs0SBB 1Sڸ0l0 00:h2P000S l @T 0 0@x -M 0ЍC-P@ p$P `?LH\/ ONI ^pGPE ࠡPJ@$ @ 0C@-B2@`P0 M@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0Tz0 @00P@0 Ph0p PX0 0L 0b @08@0  0pP8>h|~x~\A-@`PpiTV,1 @ 0 @A O-/dM ?, 0L00*#Rt,/@ T8  (   ` (`RU(080@80@ @ ?0Sc,?@8? 0@000D L00  0SF (@@000h0S80@0804 L00S8>, 0(0\,0!0 s0  S^LPIL00"A @ t@T,0Q0@t@T80(00S&L00S= ( R , LP S800,0 1-$00Q$0 0\( 0qQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00cp 0SL01H@804 0,0000[,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YpH @ R T0 00P P 00 SPR P)!R00S 00P ɟ`V0 0CSp SqVp4 0 AS0 S P0P ` P R  0R  `9,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sj9, 0@000h0S(00S8000S3 80 ;8, 0`V 00Pm0 0CS<0 HDD<0NN Œ Č Ȍ N LL\mɟ`VWY8 T0T T@00D R 0 R PP! YR  rY $Rg  0E0 p0_   0E  @000$R , 7@  c@000!R :x8 8000Vv00C000C0)X6, 00SA0X *1h"0 @, H60H 0  8 0P4, e `p$t00S000 @0p 1P11qW`5`%``0 @00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꈄ 10&0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0P0P0S^L L00S3(080 y 800  L,,20 p`dЍXL008 0080@080) R d1SdЍ( 0 0=x \X1, `p0, Q0A0Պ8! ,\PY @@YP 4P0@, QeJ   8@,@ APX@T `P `p;TXxT  rH<hPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0{8 0,00@ 0C}(@ 0 0800  { 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pc d1S` , 4@  TP:X X@ P S@DT H HH E@E0 0: 80R0,`0C 0B0X00@P `0 40 0E005 PU U R0 R  X R RR)0SC 0 R /7,  @000 @ ` `(0,0 000 0S 0 PC@08 0 0U0P$b pQ_ R$R $Ry X  QAH5S>  9, @` 0  `f@0 0p0 `Y00P c 0@` 00 B0W P0 P<00 p 0 P0+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`rUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` K0  `@0 0p>0 `00P  .0@` 00 B0 "P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 1@000<, ,>@ 0`C000` @000tW # v 0 U@`= 0 0LfP4Pj @00 pWU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`*UpH50S0X0S* 0 0 0 0, @p@0 0H`U~0 0 0 @000jP$pPdEhp@-P@PPM/ 0`0 R    80x t00 0 000P 0 Ѝp80 @000! B/ 0C?0Ѝp0 00,C-鬐M@P 048! \` d0hlp`PpPg80  D000 0 B0C 0/? 0ЍЍ@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  0 00t, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `~Vp`|0P 0@PUpT` @~T @pp  ! !@-@P@~T R/A-p0,SP` @T @~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S P$00C$0I|O-:z0Mx*p$P( ,pP H*00\c S@@s  nRXal HR @@i`40IS0c0@T ^OoB@TP AA  RR0|)\ 0  |  bR\ H)` R&8) R! CP'I@, 4R S[80S y0P0$ 0B$0X @C, 4R CPf S ^\ X( 00Q 880, 0,4(0RJ0H 0@0' $P)0S700S00l0S# 0 S , 40R#0l P, 0S 0P0$@P$@70 RЍ $70( U$(00 SBFf@`< & (00 S4$&P0C (00xP0S  P$00C$0'@`&  T60,@(@0 R 5060, 40RpfF`@ 0 0, $P,04 CS (@Re 0 KRaڠ5%0 p p @d% 0(`Z Oq`nR `F%` V ,00P0S d0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z p<40,04$!,1010y d 4`000P ^$ $@$#@ P(@h0 Ru ,,Zq  P+ p# J d# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R  P $@@ lP "  20,  , o40 S _ ) @20$ ܀(B@0S 0P0$ 0B$0$܀ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  l0P0$ 0B$0@,0(A@0S X0P0$ 0B$0 @,0( `d(Hx PL4`D\ l4(xO-lsl3phC@00 S M ۷400040,c`(,P Zm34@3`0T&#0C S402PK袟  ?0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS S P 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 :@P,P  Z@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004P`Dd(hȽܼ̼h@- ,(4 00@-  ,(4 00лO-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 080 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/G-MuPp0 5` 80s3  S̠`D Pr LR!1S85@450 50 `\Pᴖ 40 00P 40 040 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q _S~VZ]9 Q gSf2 Q PSSVi^* Q j^S! Q k^S Q gSf Q[-S 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  YBPUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf SUcht\1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //1P0= 00` P7ʀ :l“3\0 /@ P 0000CS0 00000000000000000/x @-@P@M&\\ Y #3t P P 00 &000 0vЍTh`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 0<xT@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\ h0\t0 000:h/p@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &ЍphT02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R R, !p@ '( V@ Ѝ1=00QM0SJ\1p20l P10 0O0剑Q:20h1=00Q!0S0p20 00 0/0剑Q:20t 00 00`0pU0!Q 00pI0!Q Ĭh0 000/p@-x0x 000@00CS0 S p0 S P00p9Pp00p@-0CS@0 S p0 S P00pPp0p@-,0, 000P|v@pp@-Prv@p0 000S  @-@J Q P\,Q    @/L,0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0P`Pp@ W -vP 0p#0C S-0 00$Ѝ)T0 S80  )2 0@z @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p KrPP+  U  P `X(0 SCJXC0 0(0C\00C(^$ЍX TP P  D0|0ap H0@D002 T `V `ItV `` P|d0 00,p@-@Pppp@p@-@80800P  @ppp@T,O-`6lM0@P,0 j Q 0pu`Pa Pq0P0[ W   0<0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0? 0005 000p`P0 @R  <0T R8 2 0<00800C?80tP0`FtPY00` t, t480pP p K 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!p! Bp G" RX :     HU pG< S8 8 (P4`< @p$0,0 1400H0@0 @0 0D-PU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0? t2, 8 P vI000 0P8p0i08 k800C?80sP0pGS00C0`FQsP00C00p000P0 0PS08 B! Wf 0 0H000尡pG WD0|0prlЍ80< p` 0<0T pR0`<0 yPo 08rlЍ`{yrJ0 00 W,p@-`@Ppp p@I G00 ?(,p@-@Pppp@ 2p@-@@ @  `  @Ppp p@,p@-@<0<00P  @ppp@ h,p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``O-ԑMS D@HP 0S p `@ 0Z  @ 4/ 0[ 7 $[0<S<0.S00#10>P0 0@0 0}00 P00 Gr R0S0 0?P4/ZXЍ G\00r R0S@0p0pP4/pW ȶTQ# @-@ RM !R "R pPĜ\  00@bЍ/0Q # @-  MS S PpP$R ,@8Ѝ/@-0@,M @ Ѝl@-@044M0 @ Ѝh0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LN!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   QO-M  m EPP@ 0 p % p 0 5S p/ Ą`@Ḵp,S 0 0  C@00 S  Qr%S+0@ GS0  %@0iP@0@ `fv` 00#1.Q0*Q 0S @0 SE^0 @00% d dP00 @0@00 S*L0 0 r 0   0 0  < @ 0D@0 @00 S^qo 00PЍ0 S0^ ` 00 @@D"0 C0 0 S^ 00000 h0!@ @0 @0g0 S!00sp pp00p 00p 0@p p0, T \0@410 0rp 0  0@ 0ppTp0 S\R W' I00 S0   n  00w0`f Sv` 0S0\S 0 Sa0 00 %p%c%+%cX$</>p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 ЍpF0T@ ľA-@0MS0D0@!0@P0S?  0 !~|!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0ЍNgA-@0MS0D0@!0@p0SE ^ 0 ~!^\RN  L !0 120B QP `0 pW$P@TP 0nSPЍ"0ЍЍHkL8>G-`0MS00! 0p0S[  0 `1` I $L0!b!bIO4ቐ გ1c1cL0 0#3cl 10B ALP P)0< X" pW $@r0sS7P @WXV @T {mPPPЍЍ-?L*S0 O-TMlj`PM ,$  0 : 0` @P 5U000P 0:P @P 0S  R 0X F #X =X =P 0000pP, p WJZp  D00Y*S l`P V30  Z l0S l0q,0@  0;pß $ 112cA112c B LL0,#0#pr!qpC 0r0P0q0p6@B P@=rH`@X 0Sp  l 0` l@X0`0TЍp  0 "$ L䡟‚  H !1 2ਁሂBP㈁K 00@>p  0 \1\ $L $$H0!b4!b Lƒ1c$1c 0L 0 00 壀((!h!b!CP㈁ 0tS0cS0Spp0@00 p< p0S `y k, NgݨkL>-?Lԡ*S ! A-P`p0\ %\0@pS sS lS P0\UUW Y000@1CP0PCV` 1E!H00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@jP 400@,%,`+P p` H˟,@ 0:ZAZ JQ  0JPPp0-00 >Z A0Js =R* =S00 C?QRp  Wp1PW -.R0 XZD cJqQ   Rp~ PA0JlRpY PA0Ja0Js Rq11OSts00qߍ|I@[/hP 00040whP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, T*R 0 \p 40P040 P PPp1  \1SE 0C111SB Z0! Jr 2( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a d7@D!&J0AqVZ ຠ `OT` a 1l!01ATe @DAAAa0Js RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RU 1h BY!r ;#P`!`1`Q,*P  0ᣇp^ 40040i10Js Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S%   ?R ;R P0S %S0 01S2 0C11AT/ #Q,,*P  4 @ , 40,0PPp1BA0JS30J1OS!l!011@00@`whPv 400`,Vp p2kh Pj 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT> `V ᗥ```&``VP``P``ý`@oobP``V P``@Q AOQ AAT @D1!ZAo!᪢Vp p2gP 400p,PZb00!J]o0 0媢V0`0R001&J0GZ @poD0`0>00:00-50 0|@V``pT@`V`pO@`fpK@opG`@pCoo@bp>|س'` } V8hƪ-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/<^A-PQp@M 0S XA gP  `V 0v0) V Tz 00 LPP0T0d 00ЍT Y 0 0 R Tx ~T`xP0S T`( h 嗂p 0S R s0r (0 000ST00P td p0 (0P hd p0 0T/T@)4%8 x ht@h\P (    0R @-MI0@S  ЍA-pPDP U) @`TV 0PS |@P0DV  RP JoA-PR pQ 00@ `P % P P |#0 ES  LfP  0 000Q  0 R0 R   Q PAuPP0 QV \`Q  0S  0 S o W0C  s0_S0S  0 S Q V0Cs0S PUD 0$XPFPF " X< $0 Ž20nP; sPG fPY P?oR20S 0 0qQ :%ZeP NC!SePJ<LePL5$ PP yf$Puf ;eP$$ W PP?o2?    0S V P(C-p|Q@x!P`M0  P 000S8 @ЍPP vp  01p R 0S 0P@ P@ @pЍ 0 P LPP+c P *PP004k@ jLjO-M Mp:S$0S:S@ 0PS:S``E[ P!* a `0  oP 0P:S ۍ Ѝ@ۍ ЍC-pP,Ÿ,MM @`tP9 0/SI P R0eX PJ P 0 ۍЍCt0P d!  .P"0 @ۍЍCy,0P 0S/S pP TeX0 ۍЍC0  PۍЍ p 02eYW L0L 0 $ۍЍ404 0 $ i p P < ,  ,g g G-p`@P  X0@eT  NP @\PPP P @T  @0GH-@-@ Mm00 Ѝ@ Ѝ/C Ѝ@ Ѝ/@-@ddd@dd d0d@d 0p@-PS@:pS cP!pPb @-Q @TnR  sR) fR Q \' sR R\  Q  0 ^Q  R Q A- @X p`fS@X P0P@0@nS sS@X@@ 0 0S00@PA-P% Ppp R,R    0S,S@Bea`P   `00pp@ ^ G-pT@`PP 4<pWW*nU< sUZ fUH0D Y+R. @cP" H0D@pH0@0 H0lH0nUp@0 H PL sU: fU& L00L0 @]P @P aa 0S0000W 00 H0@ H00 ,00H0@, H0@0H0(H0, 0H0 0@ SH0 $H00H0($PH00H0 \ D O-M PY p pX` `0( 80H00 `0P@^  P pY  X`   R , R < R! L R* JЍP   , R P   < R P   0L R `P0 0 @w0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00$A-`p PPU@R aP !0峀0 V00pp   0  0 0P`O-`0@ $M 0'P pVbPpUP5  P fa0P  0;b pP|@P Pv@@LaP&b $Ѝ bb0,P pU 0$0(0,0# @ 0S00sPa PU Y  @RPU  @RPU R@a0LP@U@0D0H0L07 pfS&p @P" PU!  @0nS sSpY@@pp 0pE 0 a $Ѝ $] ]@r  A-Pp ``V@R `P A0峀0 00P00 0  0 P_0A-P pW@`R |`P 0` 00P 00 0P^0O-LM<  <*, , 0ZpP |@P0|0`P 00lZPsT ePa\:PrP_PP p pP V 0T 0,"P`4 ` 0100#$090400S% $ .S  ROS> =\pP 00p`v= <00P5 P 00 R,P ``LЍ#8@P= pp`v ,0 S Q0S Q0TS 0 10000000 P0(-Z809^80 R(`PLЍ@0@SF p@t`00 0 0f0 `PYj (@[ 0 [P p;  )\[  R-Y %\^[\= @[0P0&0GS-v  0P (Y0 KrQ40E K/RS  [@ [D&,0  @ 00@&,0  M p00 D\D0 0S#P Pk 0 g 0SP v0 h 000  00 n0PB p (^801` Q  Q 0S00  p    00 ?[#v 0 S00P0@ P  0BP,  p0 80u Y80! [0@B PT@@p* 0 000 0s01P (d@p@tnp@t: ,0 Sc Q0S \ QIZ@RPaT` RP40 %00 (-^P00kPp@t0s <00QG Q 0B R 0 d a0 0]P<(0 P00 0S00 P' &0pl0  < +00 00P"p P7꬟RD  P T  P/$P00//p0@-MP0 0^\!1l!1"b2cNL 0@@0#@B!A@C0PЍ0赁Ng P0`0K?//ሡp@-MPn0 0nPel b N00PEK 28@0#AB@C1dPЍpkL >$0P00?//p@-M`20 RP0el`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$C!d!b8A@C1|PЍp-?L*Sp@-0P0M`2[@P 0Ѝp], 0 0S Q20Ѝp訵G- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00LlL@-@P D]B]@] >]$<],:]8],00!R  !hK 001/0K001P//KC @--@X@X0@0@0s H vPJI HH @Lp@--(M D@4`0 @@PR  k{UF{{v!00 (ЍpP P # 0U 0k {kUkf^!00 P ~P P# 0U 0 0"uP  0cP0O30{kUk 0 cP  0cP0L20U 0:"2Ť2"NPh  0cP0x20U 0t 0"<P7  0cP0t4 0U"  *P5  0cP0x10kU ! 0]"1"OJP(  p0cP0ʘ 0U"  P b0cP0d10U 0"81"P  P0cP0 10U 0"0"P  >0cP0<00U 0-"0"P8  ,0cP0Eʘ00U 0 0"P  ??L8l D G T h  D 0cP0(00 0<0<0U" P  0cP0xp00{kUk 0 wP\  0cP0ʐ30{kUk 0- eP  0cP0qL30U 0b"83"SP@  0cP0O 30U 0@"2"APG  0cP020U 0"2"/P  0cP0Hʈ20U 09"h2"P-  z0cP0D20{U{ 0  P  i0cP020u{U{ 0 P<  X0cP0!10U 0"1"P  F0cP0ʀ10uU 0 P4  50cP0n@10U 0_" 1"PW  #0cP0)00U 0"0"P  0cP0ʸ00U 0"|0"P  0cP0Et00U 06"40"P  $ G| < T P , 4 0cP0$00 00U", iPt  0cP0h00 00U" WPr  0cP0ʬ00*{kRF{U{ 0 BPk  0cP0\30U 0y"|3"0PS  0cP030U 0"43"P  {0cP020U 0"2" P  i0cP0_ʐ20U 0P"|2"P-  W0cP0PP20 00U" P  E0cP0 20 00U" P  30cP010ek{U{ 0x P}  !0cP0ʄ10U 0"\1"PK  0cP 0810?U 0$ P`  0cP0b00U 0S"0"P  0cP0fʴ 0U" 4 {P  0cP0Np00 00U" iP  0 G8  x T \  h $ `  0cP04L00U 0%"`0"9P   0cP0ʌ00 00U" 'P  !P  ~00 00U""00 o1010s 10 1U""00 \P10X10 d1U""00 L10 1U""00 ?10{kUk!00 23030 |3U"!"00 "\30T30[ H3U"!00 (30u 3U"}"00 2020 2U"m!00 2020 2U"h]!00 20Z20x20 H2U"DJ!00 H206@20h 1U":!00 20 1U"-"00 1010 1U":!00 10,10_ T1U" "00 p10 1U"w!00 @10i810010Q( 10q 0U"!00 o00{kUk !00 _00 H0U""00 R00   \ `  0 `  ` D  {kUk!00 #30z 3"ZI _I  3"U"00 t30{kUku!00 D30{kUkh!00 30\`"00 ["00 " " A " PI : S@ F"00 A"00 <!00 7!00 kk0!00 +"00 &"00 !!00 "00 "00 "00 !00 kk!00 "00 0Sg !00 0S0 !00 y0S !00 q0S !00 iP  c0S !00 [0S !00 S0S "00 K0S !00 C0S] "00 ;0S= !00 3 -DT! @ t $ 0S "00 0S !00 0S !00 0S }!00 0S u!00 0S m!00 0S) e!00 0S  ]!00 0S U!00 0S M!00 0S E!00 0S =!00 0S 5!00 0S~ -"00 0S %"00 0S !00 0S !00 0S !00 0S "00 0S !00 2H "P !H H  3"0SO!00 k0S !00 cx# ip# |"00 X"00 S"00 N"00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &I mI "x2"2l0 02L0 0 2,0 0@2 0 0\20 0v820 0m20 0d10 0[1l0 0R"1L0 0IM1,0 0@/!00 P10 03U,10 0*\10 0!;0 @@=0 >0l0 0 ? x L P x p ( h X H P p 8 \ @ P 0P0 040p0 02X00 0|00 0`0 @@0 s0 @@0 100 0u,1P0 0,P1 @@0 ou!00 10 0y!10 0p10 0gG2 @@(0 Z82 @@vX0 Ml2t0 0D20 0;+00D?0$ R'4000  0p@0>0U 0PEt@T$0Sp0  0@p=0U 0PEt@T$0Sw  '$   0   0s  0h @$ pRup@=0Up 0PEt@T7p0pp@=00SK <0000CST0S2 < 007s@ Q<0E(0 S0(0@l< 03pT<0U/ 0PEt@Tw0Sp <00<0LQ`D0*;;0\0T  0T :C0PEt 0@S9U 0P0,P0` 0U@@ ?N?P?5? J?daM? H?A?L?P  8 $ :?;?0p0P0?0X00 p0tP 50040 :@q 850050 7?R5@0p 0V 00p!500x505l 02^[PEt@TU*U0 C00ST 0 000 6Q0 0S @0p 07s0D@CqV$0(\$ PEt 0@\7U ؂>6L070 0s0P7s@Db 0@D'qM0@ph0dl70n0` 00P00X⽿p0P0tp0 (0$P$(01 80080J80080 0sAψSR: @3 0@|0089@0I(@ p \ p T d \ h P 90090 0S90?Gp@-@)PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  X U0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04T0p0 p0 0 0 30 Ѝl0Spp l0@@@ ?XJS???tGP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-`Vz@ 0!(3/PPw 8pWG  ( 0(3/pP00 f  @T 0  d!RP S>0R`*p  BS>00p0 (08#@8pPoRS B P T W B T p 0Bpp00  @T 0  d P S>0R`:oRpS. 0A pp $0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @Pᬰ!X 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00p;J\S10b60s0P0X 0 C∀0S 0X\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 240%R00S0000020(0@0,000@(,04@080 00 0 00C$0 B T@[ q W3> BI  p Wۄ2  B37RL q`36 B Jq`36 BA@g @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  XT@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\k \c$`\``$(@$$, V,(`@  %$(@$$, VpLF$(0$00W\(0`@]m Q??? LD, 0qR0C0s0\0@0qR0C0s0\0/O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0C  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0V00S8#  #800#"0 B 0 0 0 0 0 S0 S00ӈ R01q 00  R000 00%*W6: &R \ R80l0 C 0 B 0<L0DC0C t0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC '060@D0 0!1 0Rppp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000&-M 0 BЍA-PCUo 0`0@ 0S@  00 0h!(3/@PR P!@C 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 , @@ L DD &! 0 0C006& 0&;> 0$0;/0O-Q$M R0 t 0S!q"$!@P`p,ß  0+0* @$)z0(!y0qx0aq0t0@AP1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ 0(@0S 0P0Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4@H QPQ paQ"$&P%uPQ@D"T% r  Q% "r Q Q T% "r  Q% "r a Q d& "r QQ&T% p!T%$"C0S |0!qS"$!$ЍL!Q1C1@`pv04d/8/ /...- A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&- A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&(, p@-@P Pt`t`@P  !1Ē   0" C  @pPpP+ p@-@P Pt`t`@P  !1Ē   0" C  @pPp* 0@-1@4P 0,C @$!0 RG- pph Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G.7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq(R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/ b U/0S0`0//xܧ 3G66@-S k>@@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pp5 DMP[Q @!M080I j\PĖ PĆ0\@ CSP$ R(㨆 pPp 0Q= q[P$尐6H0C6RƆp 0€00@ jX0@PQ- 0ඟ0 pJ`{P09 `;ST`+0HAX{T4T+ pQ}Qp0Wq 20|~6{`0,Z`;p HT$@P;0>0 0 0p0S01Y0嵏  0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00Q0 0S@\ R @02^02N00 R0@\DЍW@  xP 01LY 1R 6 G2#6pP^p N0j 0=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-M\PPRf!   `0  +M @Nk@^ᶰZ἖p S 1>@0ny SwpFP0N`ppP`p%TPVPeTEtp漖0@P0dy Swp @0`pp0`p#406@D@0cUSupNT~F0PDt@`@`@@0P#4``0F0d^~p@D[pF5 [0@Q p[ ` Q^kp徠἖0pj9Ys0pJ 0 00#4 0编0iQq0 `V0἖pW 0@S p`W0@T P`㶰[ Y0ʀ p ^C @0@Pc UYuP@ 0PpP0CPpP%TPV0PeTEt@ S6`F3@Ps0kp0p0@0P#4pp06[@cVd 0C`6A0@Qe pW `r 0@P9pd Ws0 @p0@D0p0#406@0cUSu0 TFP `FPDt@k>p@p@@P.pp[@nVd N` 0@Q# p[20@S P`㶰gtwp@ p@ 0T0 `W2 @p0@SЍ༖N~C[0k@6 N~4[@k0F| P`㶰00@S P`㶰%0@S P`㶰0T 0 i p@` 0 `aO-ʀ6MS 3003`003k^0 0300300! A@b9 Ts0@p000@p#406 B 0c^&6S0@ 编0$` pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಀAph>Ys0H000#4060cWsw0 p0@sW `D Br @g>Ts0=@000@#406pGp0cR#6 SvekN&0Pn2Rs0 P`0`00 @#4PP0&N0bQq0 k0&Ѝ 0&;p0v7 <),))))00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I( , &&lA-@ k΀`P s0! Qr p p "$  aS2s Ak> u 0  u0#Ġ  <##4U0 0 h000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ MJ, R 0Kp&]EP+(+;0N  q/ ! R7@P j   Q& R \3 "[k. Z0-q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦| qk>0#40缦0j\3s0 J Z㼦yzk>0#40缦0j J\3 Zs0漦@|qk>0#40缦0j\3s JXM⼦k> / ! Zq ! 缦jR!r J^ἦ b _ J  \ P+R +R ,RE R  Q ,Q3 "[Q6k S op3 s0000 #406 cPp 0Ck N.V6 0G. 0S0 0xS0   0LSZ=00IX  && Ѝ R3 "&][Pj 0 ЍO y: Zs0漦)@q:s::s0 r :s0q#r 0{ :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P p@0 C`0@ITUT @&P ;&/@- MP`pX*@P @堽   Ip P N. @P  Ѝ 0@0 Ѝ0@00@4.T  Ѝp@-P'*@P @o@p 00p@-@*0P 0^000 00p@-MP`*@P @ @I0 0Hp -@Ѝp0@-T @Ѝp0p@-S P@0 C`[0@hHTi 0 pW&0P@p%yara0p@-S P@0 C`60@CHTD 0 p2&0P@pt%tcid0S p@-`@0 CP0@HT @pp/0S p@-P@0 C`0@HT %,0P@p9%p/yara0S p@-P@0 C`0@GT %,0P@p%p/tcid0@- M@ Gp  P Ѝ0 Ѝ00 0 Ѝ00@- M@ Gp  < P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ Gp  < uP Ѝ0 Ѝ00 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@Pc%0PPptcidp@-@PW%$0P px00ploobp@-P`=@P  0@$p@-@^@ @-@X@ @-@R@ @-@L@ @-@F@6 @-@@@E @-@:@b @-@4@{ @-@.@ @-@(@ @-@"@ @-@@ @-@@ @-@@@-@ @ @-@@3@-@@L@-@@c@-@@z@-@@p@-P` @P  <0@#pp@-P` @P  *0@#pp@-P`t @P  0@#pp@-P`b @P  0@#pp@-P0`PN @P  0@#pp@-P`< @P  0@#pp@-P`* @P  0@#pp@-P` @P  0@|#pp@-P` @P  0@j#pp@-P0`P @P  0@V#pp@-P` @P  0@D#pp@-P` @P  r0@2#pp@-P` @P  `0@ #pp@-P` @P  N0@#pp@-P0`P @P  :0@"pp@-P` @P  (0@"pp@-P` @P  0@"pp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P0`PR @P  0@"pp@-Pv@M#(0P p:0P 0pgntsp@-P`@P  0@{"pp@-P`@P  0@j"pp@-`PA@#<P pP U patadp@-P`>@P  0@@"pp@-P`M@P  n0@."pA-P@"X0P p'`P  P `=*gntsp@-P@"(0P p0P 0pgntsp@-P`7@P  -0@!pp@-P`+@P  0@!p@-@R 0@!p@-@ P"$0P p00ploobp@-P`g@P   0@!pp@-PW@P  0@!p@-@s @ @-@m @ @-@g @ @-@a @4 @-@[ @Q @-@U @` @-@O @} @-@I @ @-@C @ @-@= @ @-@7 @ @-@1 @ @-@+ @ @-@% @" @-@ @; @-@ @N @-@ @g @-@ @~ @-@ @ @-@ @ p@-P`@P   0@!pp@-P@P W 0@!pp@-P`@P  0@ pp@-P@P 5 0@ pp@-P`o@P  0@ pp@-P^@P  0@ pp@-P`M@P  0@ pp@-P<@P 0@ pp@-P0`P)@P  0@ pp@-P0P@P 0@{ pp@-P`@P  n0@i pp@-P@P 0@Y pp@-P`@P  L0@G pp@-P@P 0@7 pp@-P`@P  *0@% pp@-P@P e0@ pp@-P`@P  0@ pp@-P@P C0@pp@-P0`P{@P  0@pp@-P0Ph@P 0@pp@-P`o@P  0@p p@-P]@P 0@pp@-P`L@P  0@p p@-P:@P 0@pp@-P`)@P  z0@up p@-P@P 0@dpp@-P`@P  W0@Rp p@-P@P 0@App@-P0`P@P  20@-pp@-P0P@P k0@pp@-P`@P  0@ p p@-P@P H0@pp@-P`@P  0@p p@-P@P %0@pp@-P`w@P  0@p p@-Pe@P 0@pp@-P`T@P  0@p p@-PB@P 0@pp@-P0`P/@P  0@{pp@-P0P@P 0@ipp@-P;@(0P p0P 0pgntsp@-P`@P  K0@Fpp@-P@P 0@7pp@-P`u@P  +0@&pp@-Pe@P g0@pp@-`P@<P p]P U Kpatadp@-P`@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P@P  0@pA-P@jX0P Lp#`P  cP `%gntsp@-Po@L(0P p90P 0pgntsp@-P`@P  0@zpp@-P@P 0@kpp@-P`@P  _0@Zpp@-P@P 0@Kp@-@Q 0@A@-@R <0@7p@-@0 P V%T%p@PP"0S "p"0l@-$@@"llP 0R @-P Q o// c c P е0 t@-0 jH | h @-P Q @軵@ @0@ f0 U( (0( g0 L4 H   L  0S p@-\@`@@ PoPpP p@ A-P`p# f"@P  r`P pp"P` e"U @$ "$$ Pd̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RᾌP0/S7 0(00>S: SA 0S p03  0Bs0SR 0 S S6 S4 /S 0 S S,/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 0 ܭ S =SB0"SP0SM   0"R "R R@C$ >R;0< G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Po \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R<\ BR   ;R<@{  @!1 0 "R /R 0jP 0 +r  R:Y  Yy*     SP00 Rf \Rc  uR_ <P Y +r PU6I0 r    0 # <  P,!*-"-  ƠP  * --  (  " "0  l 4 O-`Ÿ M @ 0Ds0S<_SS @S  0>S 0 T  @P (0SP  R @ ЍT T$ @PV` kP @P ` `Pf0S  0Sx& DG--PM `"@PL ,1pC 3pF 0F fppSp>0@ 従P P1u&  0  `p 2:Ѝ00 `0p``2%`Ѝ m1` Ao/A-PP P`p @@P@@@P p40,p0P4080<0h\7@-5@ Q \7@-(@@8 ⌡<7Phᇨℨ@-@@O-4@T p`, qP @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ P  @-R 0P< P 4Q ,  D D0D )0 ͪ, ,0, (0 Ī$gD L (p@-@M4 00R1SP,0SFR 1`V. P` 0 0?P 40, 0C40P& `ЍpS( R)%ЍpЍp 0 Z0D zp p0p l0D q\ \0\ c0D hD D0D @0D _  y  XiA-P`,p@P W 0 !w,@0`,@0`C-`0@SPpMD  P00Ѝ!0 rP ,0ST |!0 hP ,0S(0S00  0FP 0S>0S0"S:0:S 10}S "S000"S 8P  2P @` 0 @`P X, ,0, (0\ ⲩP$ #  <0p@-S `  Q P@/0@)p 0  0 〈b@ |H0S 40 00$ $0$ @-0 va \ 4 @-R 0, B4 P @ @ @0@ <0 [, ,0, (0 R| X `O-80M@ Ѝ@p` PP @ ` @ЍĒ  2~PP0 z *004QY r 4 ,R\ 牱Q1v  a P 0YIV  B B!,0 P 04 `<0 04 <0 ɤP,UM<U7U+'Y& 唡 @0 P  *PP( & 0,S<SS= WeP# @ <0P0`<04 y< !⪐,0P RYP |,x x0x t0F/∨d d0d W0,L L0L 0 vT.^-0 82  p@-@PP0S L  Q <0 0 p@ 0  0K/I\4 p<p@-@P 0`0VPP l l0 0  0@S0<  pPp( (0( $0K/|\$,| O-0@SP MR z`40SM x `4P@ ЍP pP 00S 0q 2 00PX 0S. @0R* P# [` P 0P 0S P'\ X GD` ЍOiP 0  03/P  40R 1#PP 0 0U/⇧& 00C 0P `@zh h0h d0U/nT T0T 0]/e[ [LZ, 4pYȻ  d@-@⛞0,S<SS 0  0 9' PG-V Pp0`WSW@6 404 S @  S3 F000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P : } {404 SS@ o @D D0D @0c/Ϧ0 000 ,0c/ƦWL pT!( t07G-PS @- Y`' T 1p 0R G   004 00R% OP  0S 0 GV'd d0d `0i/⁦0,S0 000 ,0F/p@V x1з | G-PP' 0 0R"4P 40S @,0aᄑ1p  ,0`p40@T:8 408  T0P 0  Q@-P80080/DTp@-@P80080p@p@-@P 80 0R@ pP4@pSp@-@P \0 0R@ pP`00S@#:p@|Sp@-@Pt@opA-PP 0 0R4p`_40S @40S ,0} P@N* `GRA-@P 0`0VpP80S ~P @T @ @0@ 0]/⑥@@4RT X\A-PP /o0`0"Q@@T @0R p K@P @T @ 0  0]/WxQl pt0P \@- ^ 400\@/ 0  0F/8P  0P o@-x@ T\ @\400\@/ 0  0F/4PL T @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0R S!*,\&0 B!p@400C40<00<0B @ h h0h d0s/ƤT T0T P0s/⽤@ @0@ <0s/ⴤO( 0u  v pw P/?o0 2 R0S/0@ S/N0P -?o82 ^0S 0 S /MP/0 0@0R/lMP/0 0@0R/@M P -/o<0"0@0^ R  R /Md A-`P @PpP (0Sp0P  pA`HL `E,LO-0S@9 0@S7  `N P. X8qPp@; P 5 P / P HXPU0UU !B< #1 0@?,B PO 0 s0 ڣX% XP0@#r 1P/0 0R/>0P -?o82 ^0S 0 S//>0S /(0p@-S@ `P`0 P0 P lle `@@ @@pDDD@W @0000 \먢 L  dA-PP  P`p @ @P @@ @P p<``` 0,p0P4080<0H=@-@ @  @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 <$Р hQ| HVPG-? Pp0`W<W@ 404 S P l j S /000P,0 10,0$ 10P : O M 404 SSP A P@ @0@ 0( ⡟( (0( 0( ☟\ 8 p@-@M#S,RP, R8S 1CaV) P` 0 0P 400C40`ЍpR S   ЍpЍpd d0d k0< VL L0L |0< M4 404 l0< D0 (  xA-P`,p @P W 0 !a,@0` ,@0`p@-00P4Q8 @Q r4 <0,04Q<0pPp 0 0P 뼜 Lo@-P MU2 0`Sp@#  LPR00 Ѝ 0 2P ,0S @t 0 @iP  Ѝ0]S$ $0$ 0` ⴞ| 08Rp@-@P 0`0V PP l l0 0 0@S0<  pPp( (0( $0 ⅞7@ 4|w0G-S@PK Tp 40SF   P@P P 00S 0>bP7 0 03/P0  40R 1#eP' `P 00C 0EP  @ꀐ pG \ \0\ 0 8 808 0 6$548 Ⱥ ,40S 0C40/ 0  @-0 뤘 @00p@-S `  Q P@t0@np 0  0 ѝ4 dip@-@P 0`0VPQ0S R <0 0 p@DD D0D @0 ⩝0 000 ,0 ⠝t3| ĸ X wG-S )X@ `V 0P 0R 00p W` V 0S  Gs@ @0@ <0F/`0,S2X A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p1@-P80080p@-@P 80 0R@ pP0@p0p@-@P 80 0R@ pP4@p0p@-@P \0 0R@ pP`|00S@#:vp@00p@-@Pi&@dpp@-@P]80080p@Vp@-@PQ8@@@Lpp@-@P 0 0RP`>40S ,0AT 5p@p@ 0  0O/ⓜ,/$ aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@?@D D0D @0S/U0 000 ,0S/L.,  p@-@P H0 0R@ pP`@pX-A-PP1 0R@`4P%80,0!qW% P P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/, Th ܮ0P -?o82 ^0S 0 Sd/+p@-`P pP@fP (0S p@  + & *0 //@-~UP0 p0  O-IMP # @T p `0 R 2/0iU\ P Y  9/0  pDPV @T!1 0 ]003/Y@ 9/T +UT T @T@" 000Q 1/0)U' P70S+ 03/P. Y 9/U@T 0 0(  0 0 Iߍ 0 0(  0 0( Y 9/Z 0 03/X X0X 0( 뼏 xH p@ Pd $@ ̯ ̯P0/O-@MM(p fT 000 0\0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `nPMߍT00 0%P 0 $ \00 Mߍ0 000 ,0H m R00 ܭ# 0/0/@-@@A-pP`PM1 @T. 00@0W   WT 0 /R C 0CW /RW  W0 0 B/Q d!0C@T@! Y0@ 0.0 0  R0* 0 0lp@  U 30P#!@+Pۍ&?00@ۍ S0p F PD H p p 0P@ p@-R 0@S PR :   Ppx0P  , 0`0` `90 ઙL0L L:0 ࢙808 8;0 pt (T (4 Ԫp@-@Q PPpQpA-0MSz@`PA7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0 rP\\P WP PU /U\U fPnPtPbPUx 0  h# QQ 3P0 000 0 똪0 ( lL 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ ℘ #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@> 0 Q0` G 0p@-SG@`PU Q Q aP<\Pp PU Q PP QPU Q CP QpPQ 6P Q/.P p@>( 0 0| 딂 L,cA-PP` Qpp0` XpWV&@PR  "PK <V`p p0 8/PcP``<``Q P P 0S (P P 0SPP P P P 0 #P <Lp@-P@PP \ Pᤙ0@ 럙@p zy011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 4$0$ $B0 ,Ѐ  ܡ@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0  DG-@R0(M0QP P 0 ` p Pl `30T?o20S00(Ѝp`0 ؠ0     Q /0     P /0 2/ / /    \ /0 2/ / /    \ /p@-@PP`(M/ 0S, R00@$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0X P0V00(Ѝp@ R 0S V00؞0Q000 00/@-@ p00T0Y0Z0[|@-@T @-@T000 000S/@-$%p000 000S/@-$p000 000S/@-ۗ$p000 000S/@-˗d$p000 000S/@-㻗$$p000 000S/@-㫗#p000 000S/@-㛗#p000 000S/@-㋗d#p000 000S/@-{$#p000 000S/@-k"p @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#t 0 01/(001/0 01 /0S@-@1/00/p@-P0P0 0@0PS` Pp p0!p/<000 000S-/@-- p@-000 000S/@-Жx pAo//0@-p@P M 4 P Ѝ0 0 ;0 ֔vtv @-p@M L P pЍ(0( (;0 ๔wt@HXv t0@-pP@ M T T T  0 Ѝ04 @ Ѝ0 0 :0 tu p@-@ @ $ 0 80 z^t Ltu ėp@-@PP $P(Pp0 70 el,u p@-@PP (Pp0 70 R t pp@-@PP $Pp0 70 ?Ԡt L@-@P  Y.<+ < 00 ;0 !\Ht @-@P ( 0 70 (t @-@P $ 0 70 $Пs R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@F P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pގ80 0 @  0""048# /UUUU3333  68p@-PQ@t : Sj E Sd0 a Sp0  S?0c0 r-w-!- R00K <Rx  -   r-w-T  Q5 $Qx-$1r-@w- T" T T-x 00p Ss0  Sw0 S?0l0Q s! R0s  tTSS   S?0b0A0a0-0$0$ $90 ,n ,O-8AP@:  نpPA PA  0pP% 00ۆ` 0@T' ᅏP0=S AP` AT BX ! ݇᷆D0D D>0 A >00l C-@``"`2`M 0P$@P@Lg p`XP \@`@d@h@l@Xpk p p` o{{o{ P  {p[ p0 0S04@R08@<@@00000/-0k-m-0T-ZL1L0 00@000h-X  #ԓ0S op@ 㭓 㩓 H ЍCoЍ @갓0 0 ㏓ ㉓ ㅓ ܏܏܏ĎO-PMp 0GW"S00`0v@IP-TPg +T@`0@ ǿ 0  w 0 w P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R 8 "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0` 00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 ݐSW p pqW ꙙȊxg Њ00 0M0Ѝ2/O-PMp 0GW"S00`0v@yP-TPg +T@`0@ ǿ 0  v 0 v P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R h "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`:00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 SW p pqW ꙙHd 00 0M0Ѝ2\ /O-M8@<ЍP@0P@ 0fY( @P@ PU 凃P 0 0  2 y  @Pt@P@h0h h0 <P0 05.0Tdl? fehexm|e> PeXe- M  ЍA-xx1 0!M@P0<80P`I p4 81p4!PP ! 1 0 <8 30:!ݍ0 ᫆  0 PpPP@T Cn` 0P8TPP @T@ΐː404 440 ཅX.t ldf< lfA-!1 0!M@P0<80`b QPP 14巅P?p4 d1p嫅 P30P0 $ ( ,  0 0 pp囐PP!@T Cn` 0P8T劅PᕂP @T@0S  #[ p0 0 <8 30!ݍ`00JPH H0H D0 :-8\jd(: Xd`dO-ğFM MPQdč@`ᐴt嘤 T V [ ZX ( 0H0;d 0@P0S  0H6 PW 0 - P(00jP $q Pxl Ps$ Wj ,c Pj( , jP $ W ,  b T#L3 0 d4 30Fލ Ѝ( 0 P3فPԁPs / ᒂP @@W  E0Sv ST2" @0 8tt p X0T f  P(( Z "2  0]TC!1  0RV:!1  0G[1!1 _ 0<'!0  80$0Sd / P!P  0  8(1(! @0 }8 /A  ,  bcbbbb7 b7 0bt7 aP7 Da`y$7 (a`z6 a`{6 `h`XaWW``5 ,`5 $`5 `5 `@-XX1 0M`P000@P8  nT p T0U0P @ @P@ 0 0 0 30)Ѝ蔅/000U00000P0?s00P P0P 0( uu0@+ p@,3 ^L] @-@P @  0  ~0< R$3 ]\O-((ǟ GM MtčĝĝP ! $ $0S 0Se 0Sn 0SU IPN C@P80X D,0( p= `ph6P000p Lp@!  Pg00S" 0@=S`T`V`W`V be`Pp0#S: PU (j@000C00ل0 @p0 00 <5P%ʄ@( 0 Pp0 00 4ՂP 4   $yo $so 0S000C00  0pP40 X 0pP$h`0  6~ /~0X0H@45PPt0H0 Pڶ5 ,0pC 0PU 0Pq0Se Sc P~ P} P}  P4 R1("2 0 t4 30Gލ Ѝ0@#"0 X  (@t  040040 S  P 0pW 0 ({ 0   4`Pᓟ PᏟ P!1 H 0΁x!x1x 0H ā0ST!T1T H 0ก8!818 0H ஁$0St!1 H 0ࢁjꢃ0S TN$0~0pu*xt\\[h[[h[}8YY- 8WV, VV, VXV, xW0Vd, XVVWW$:WWC-Ÿ TMPPLЇ@`pB VK WT X] !t,@Ͽ |0 j x0 00!0 0$0(00 00 NPLQ PA,@K@m@0 @ !0 0 L0 306TЍ 0 P 0V 0 P 0W 0 P 0X 0 P 0@Ջ X@r)s) S|S) SPS) S$S\) SRK-M]ЍO-ttŸ \M@PT`pတ儰删Y Vb Wk Yt $"4P  x0?s0 0 0$0(0,0000 00 娋Pc0Q Q,P\PPmPP 0S 0 @jH!01 0 T0 30C\Ѝs0 #@ 0 i\ 0DV 0 j\ 09W 0 k\ 0.Y 0 l\ 0#@ dB@(PqSS 4S& PP& P\P& P0Ph& PPH-MAЍO-pMl qW 7 [@ 0S( 0 0Go-0P qPf 1 S S   $@ $ S^  000 S SR S0 R R R R  RQ@  B RQS 0S1 @+S6 -SYQU @U0S 0S 0 0_o0`R0+S4 -SF |PPUpxO XPK9 Pp S 0QUP @UG0S 0Sg 0 0_o00+SR0Sa @SA0 wPP P P0S @S0 cPP`I|PPUA " 2 0 2 30zߍ P P0+S3 -S0S  P`P%w0+S$ -Sv0S 0+S& -S P gl0S P S!@0Se 0S  n 50S Pw00 0 0 d 0~x x0x td 0~[\ \0\ 1d 0~.'H | LJT `LI( DLIO-@@ßM M`PȍP@yu T~ W 2U0&N 0AM.0; PY 0SV P +)k+jt 0  0  0X PP @P=P3H0: SW 2"0 &P +9 x y!1 0 8 30lލЍi P 0 @PP - 9100SPp1p!0 &`!`1` t 0}T@!@1@ <t 0}Ww$!$1$ t 0}m8 P \0S  S 0 0 &0 0 &H0 0 0 &0  @PJ&phK8TJS\Jg J 0G W' 0 :~   0ᗈP @T@T 0 pPP h0Ѝ @bPx x0x t 0S}` `0`  0I}V@ @0@ < 0>}PJ( DGD^ GD GpD]- $M!Π00  0 (0 0 0 30$Ѝ%4-|| $M!Π00  0 (0 0 0 30$Ѝ%HG-p PP`  B}0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00Cx QaCQWCP00Cq PUaCQWCQACQ7CMS00 D0C?o2R0SX ? R0T*@D T T-@A CRSb @ A BR0G?oD2Z0S\  Z?0X*Y 00As Pa0ASW0AA0AS70AQ P,1,!,0 X|00Cq P 0 T:aCQW0CACQ70CS 0  }07|   DACQ7Cz|0| | C0&| D@`S| P[@0@ @`0 |D T !6*O-0"02 0TMP0L00`w Vk 0  00 0 0 !8 PPP @p100 0 p@P< 0+S+0S(({P,00$00 0(P 0$U,$,0Sv5 0 0 L0 30*TЍ0 :P XPZ5X|00h h0h Y0@ IzL L0L X0@ ?z}"렷>E>>< X<| <l<O-!1 0pIM010uWW sPPN @`p 0 `@P; 0+S+0S(P  0 P  ]0SX4 0 0 1 30Iߍ P wP4{00< <0< 0P y["0Ch<h< `Vp:0/4z0@- 0 0MPP000@' T  0MP ""  0S0 0p d0 0 0 30Ѝ0!@P000 040 uy"4< : :@-!1 FM0 M@P0d40p/ `V PPd@"h+ P K{0@F{ @Rh \0 0 d4 30Fލ Ѝ4 404 N0 &y! hx 88@-0 0dM@P0\00p` P  TX P0 0 \0 30 dЍ0 000 h0( x! 08799@-<@<M@ e0 hЍv70P1Spp//0@- 0 0M@P000P' U  0 @  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 x)!똯 d6@ 6G- M砐 p@ U$ePH0S W0Ep +@P2  PUo0 ;u0 UB @P  U0PUo0Dz0@?z@  n 0 0 4 30܍/z0P*zTP  0oQ1p xP|`  뀮X 0- M Ѝ@-0 0dM@P0\00p`    #X P0 0 \0 30 dЍ0 000 0 wu 뀬,| 33O-/? 0M@Q000Y 0SM X@@P 0\@?P `@ %   " P l%X!;d \p`D@lA @87lA$d @b 9 HnM aLP,hPpb!5_T`l`:b.͌6o+(d! P% PPbQ tP5_l & d!, p' )``d!" x` 6o* d|@n,4O-p'`pp%nQ $pPp pnQ%Pp !7( b n ]>a,$bA!(@bA$͌e!@M l 8+,`&'pbq p)7 +0).)&,o.e)8`` `e.d)` !6o) *"( 4*" *(((e8P*/+ $ ("*, " 8 0/" *p'*''`$pdq p dq' p, o& o&o&$ `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&4`_?`/%/"(`!) `0!,`/"!! g1pd,)_%0 !_%:_%`PodQ `P%P ` n o],daa@n!o`,o po&po&   $M` oe!na  `4.+0`+(͌..`dA. pea$ `& `l$me.`_l P!_O%f _%)_% O$_%,$P_lQ_% ,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )`o.o&.o& `(p..4p0p]j oaa.o&$p!!, o&o&坉o&eQ0`ja% `&pi%`mj n篃i.!_p /%,/"_%$p"0 _%p/% _8 f!.iQ " _p%4((p_%(_%p`%fQ 珃P%-a P] b./f!`a!( "/ "''?a1,p8!++4/"/"p/"< 0 !!!m@e(!&f1e1fqp?0 nfpn10}e$Pa1n1a?f1?8@`O#?#?#]?#O$(`0g1$a1gA@?n1@0 .0<`,,0 ,`.e.g ea` Mςa ``e `ςmg 4pd.` dςe Ϡ p_, p,_%p%

pmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8 +LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$bge( p苠8fd.  f+d,dlʠeˌn{( pe+n{'pXP`"{d{g ,k+T`h+, dh+" h+APfjAkkAkP%P4]+AAA`[`b*Ln+lK'@n )lK$@iMXhKg"hg.h 0ll;Xd.dˌ@nˌb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Ckp7Ca;}d{0lK(0@$@dJL0nKd;f0h;'0#0;l;ae <$ k+* g$.ꩠk n8hnˌ P+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-Pp 堑? 10@@i00T0Y?W@` @@@`VVT(@T(pG   Gk ` k`i=V0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@-k$w xvQ / 00 R/ xB@-d @4  R  *4 8/0W x0 S\ R `0S Р@- d@ 4 *8/R1mxB /*(0"8 /:$& /--M  Ѝ Ѝ/0  0c . R0 00//m@-Mp @i`P`W P0D>S 0!3100 0iЍ>SD 0!3100i00i00l/-p@-MiP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( k66X6A-@PP`p; =U( X0ES  S0 +0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0`0+00+0`0p@00000 0]0 `g00X @ Dp@-PP@F 8a `0RuSpWS6X0CS0 p à 0R Q PSPQPQ  0    X0 0+S -Sp0( (0( b0 gF I@ O-0 xSpTM 0@@ 0`004080<0w o0(0h @(ih@T%|7(P0p00000TG @ @D 0 a0GS00 h00h0@h@PTЍ+W = W0 -S0000 0` X B R  = G/oS"!"   ( P:0,Ph , }h R, ("@P0 @(偑  ( 0S# (p W:,Pbhp , Zh0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,P2h` , *h Rm, "@(`0`FP`(`   i`(=W +0G?o 2R0S$ Y,Ph ` , g0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,Pg ` ,h g0S,0(`""`FP` @(`傑0X0 00($ KR; I?I00 KR<I g0 @$$0`0Sg0"SF  V*(@ T:,Pg @," g0S(0,@0CP@(@T} L2-+ 00 ` 0TЍ'pC  001!]0 ee1!]0 \ek긱1FsVg00(0UpL 0Xp+`-@ +B XR R  +B0 -R +R XR 0 -R  X@P`Qpt0t t]0 ex\ \0\ o0 d`hH Z T X0 4  d 0@-@PPM 0{ P@{p`Ѝ0(0( (:0 d   P 0 @-ve/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`YVP+UVU PU  0  Pw@P PPrBbP \000p@400Bf0P;fPįp@-0P@`T @T0rS Ppp@P0+Spp@L00@-$2$M000P0p 0Sv 0P 0P 1 00S$cYp@4 P! xY0rSD 0 P01 0  d1 P @00S7$Ѝ0@$1$!$$0 @X6e@CY0 00S  fde@P0 P0Tw 0P$Ѝ0h0h h0 cP0P P0 ~c\p.80(0  ̶ 8< 0@-Ÿ$M 00P0  d 0Sk 0P0@ 1 00S<p@& P 0rS: M0 P0`10  D1 P @00S-$Ѝ0S)e0 @00S e@P0 P0|0P$Ѝ0` `0`  0bD D0D  0b$Zp, d @-\APP@ MI L1p0S+<1@T4 `0`S( @0S0V0, 0S%Pd0S   @p  Ѝ0@T0S p|d00XuL  0@ @0@ <0 bWp**)̲ d,G-`PPHM6 p 0 sp@  p@ HЍ P 0 \p p@ HЍDd0S @XH0H H>0 3b/E0P Rx@, 4O-P4M@P\pt WhX0S, `00 S 5/000 00!S5+0 0 00!W`W0\ YZ X00U`5S\500 0 0 0@0` P(0`0o5`0$0X] 0S20`gW ,A 0`F]VW@P ,(05#K 0P` X $ 2@0 4$*&  # #. B@T#0#"A $1?Ϡ "!,:#  `V4Ѝ3+00 00!p3/0 00!ih30$0H\.d0La#0L0|2pST0, P `@!\P 0`V ^ @P,y ^}[`"$:600%$0D"%>!!!0C,"0T$P%"1 #1O"QX00 0" 0$0 0?S%D P@ 0`1T101! T$?01>! R01"_0`A(0 x10X00`d(00@t`dP(0 _\  R11@$Q5R 0A`X0 0A$0PE `0P 0  `4`4 0 9@ 0` 0 8@ 0`` ܰ GzGtQ(\)\¼ SQ̤ X,X O-PP@` Mo Tw V p0 8T:R P- Ÿ P2 1L PPq@pQ @T*RP P 1L P R 0Q_ SQ Ѝl P @@0 L0\? 0 \ @ p R@p\ p W R:\#Yp 0 0 `T0 0 _V0 0 _vp,@ \?[*!]-P (  p@-@PP U p@IX X0X 0 _U8 808 40 _p@vIH P EG-P@U T^ Pp ppq W00"1gP:  Pc 0Sb 0 R 0C ` PP0 XA V  0s0S0 0 Q 0  ! 00S3*_oRe`VqP( U  ! ` 0 0 D_Tt t0t p0 9_\ \0\ G 0/_/a00P` 4  lA-1 M0M@P040`P$ QE U9  0s0S0 0@ $03/H!@1 0 4 30GۍЍQq1p$p 0^V U$ 0 G0 ^ 0 0$ ^ 0 0$ ^0 x0^p p0p H0$ ^GHdHФ hC  l HED <D O-xxƟMM lMPč pTDe0d XA 0SJ VS 㰰v`Uc0U@@ R R0 0C?o2 000RU$00 S0E0@u0S0000SfV H0+0K 0@ 03/[o 0@ 0000,00G(0 03/P    0S00* z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ xP (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  00s0S0 P@T  0s0S0_04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0L  2/0S0?  000.SP _ P 0 @JP? @ m  2/0H(100+$0 00 `P0!1 |4 0E]p0D_ R 0]F0@!@1@ 0, 1]0S!1 , 0%]V!1 , 0] 0 , 0]0~$ &QI_0/ 0 0 @  03/0tFF0oFF*(Cd </ , p D O-ßKM MPčp`Pؔܤ; WD UM YV \] /\@ @ 0\/\0 V'"2 0 4 30KލЍRb/\;/00P/\V\- pd"d2d @ 0\WD"D2D @@ 0x\U("(2( $@ 0m\Y " 2  @ 0b\@Pp P<P 0   R  R 0T/S 0: S+ S 0 0 0 0 PX! +0s0S0 0@ (03/0S0: STi*/00 R 0P夰0P H 0\0G 0 []/0 0G?$?\ \0 @m $nؚ do` @SO-şM5$M 0`P000P 3 QE @0~S<   pH 0S/S;RR 0B0 4ZS 0H*0; ߾P4S 0 0CPR3 IR*0S0;R) 0X @H p S    န値倴*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+Z@PU P#<3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0m 0]S  s000-S]Q q0]S  0@< 0T20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 JY0 [0!^0  @E  p4xMN0P H *;  P =0$10QqAp@P0 ZU 0X Z 0 0P |Z 0 0X sZ0 0lZ0\X gZ@1@/;?**<9[-]! $@  O-`QM@pM R W T   D:[I^ @P}\ @\ [\ {\PU PE0]\\ \8(/PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(N 0SV 0F0C  0Z0 0 @ ]RR ]RR x| |0| xd 0YX WdX X0X Fd 0YX< <0< 8d 0YL؏ d Խ0| Tp@-@P`PM( V1 0  0 S 30{S 0\ {\ P 0 Ѝp0}S0S Ѝp@rd d0d 0p GYVD D0D 0p A0$00 0cp P2W<000S[ iVU] \'P7 0 0 30Ѝ `s?0l0` Ⰸpp  $PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S! I BqQ #S# H BqQ #S" G BqQ #S: L BqQ #SR M BqQ #SH N BqQ #S> O BqQ #S7 D BqQ #S  E BqQ #S F BqQ #R 0S:U 0p0S8 Rh BD{P `0000  00  T$   440000   $   30000S0 @  # 00   5pW p[ pV000_@V@W 0\ V000S V0 0VY 0  [ V0008@|V@00fp00,(@ ((@(@00,0sX [  tPk~0Sz[u+ U1!_0 CTHCV00V  ppe pw0`00X0`0 0SCQ Tqp Y*0p0^0  V0SY00Q pp0S03  |pE`00C0'  pp9pQpNpK~[> 4pDkp.pkA$x$ #  (@H{ PDԨX$0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF6pP P ЍpA-P`? A@0S' A@Q0+pPpPP 3M@@哽P  p0 @BAQA p0 p0 ,0, ,<0 HSD3D0 0P`\ @P 0S jMPP[[ NP200xS| "l2 0 4 30BލЍR@P\ `Px 0S \200#SL \ QP 0S $2$R0P\ CP_ 0S 100xS0xS0S) 10 0sS?0wS<0!S 71Q0P \ 0P 0S nd10\ 0P 0S n410(10P" 0 $L0xS0S {00  00 00004NP4Hs h(hr ,r t@0̶`dp p xt<|o ȝpxTD4tp@-d@@0S P Hp@P@P 4 P സphHXlqp@-@P$ 0PP 4P PPMP SPph`h`PLp4 404 0 Ppl xp@-@P$ 0PP 4P XPPMP Pph`h`PLNp4 404 0 PPМok 0p@-\PP 4P p<`<`P@ p0o@-@@P$ 00O-<$M@P  0S Zp 9P0 p` 0 0V;  8000s?Q WQN *Q0@0 t8000*S' .Q S /S#! /APP$Ѝ[S5 \S" 0S@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLX /X| 0!S^SV J  Ɵ  P 000@ p0]S2^ -Px 0]S00S /SD .SDB 0S} = 0U/S:w\Qu 0@q/P P]S /S \S$ S] -P7 0QV]P 0ZJ q  0@PR ?=@P PV@S 00P, 0-S PVP]P0p l P]P \P^ S0S00@00  $ P   R   U/R S /S P 0-S P0Q^S@0@00oQ@ 0]SM-P ]Ho0⪢XV@T S0TG 0Z q S[XQ 0Z q  0@PW828"80{ PN0S;2"|0 EN2Qm0 @xPb 0-S P0;0/d Q@KS pP@J0V0  ! @T0 0 P`/T @0 ! @@T S0T0d /?40]Sc /Sg \S  c c @0P@-@ P O 0 Q 4Q|?o2ctPp@-@lPJP XJP T00pT 00pO 0 p O-0Ÿ M pc P   ӹ ѹ10 230Zߍ pPT 0 p H  bP 7 R @; 0`  0P ĸP& PP 0 pP 0 P0@T*p@ N 0 pP O - R  hO-0Ÿ M ^pc P   K I10 230Zߍ PT 0 ;p H  ڶP 7 R @; 0`  0P <P& PP 0 #pP 0 P0@T*p@ M 0 pP N - R   HO-0Ÿ M pc P   ø 10 230Zߍ `PT 0 p H  RP 7 R @; 0`  0P ᴷP& PP 0 pP 0 }P0@T*p@  M 0 {pP M - R  (p@-X@0`P@ \P0S SP 0pY p@-X@0`P@ P0S SP 0pY p@-X@0`P@ 8P0S SP 0p,Y 0 00 J-H- M 0 S 0  00\100M0 R0    R 8 00 0 0 30KH Ѝ/-H- M 0 S 0  00\100M0 R0    R  8 00 0 0 30KH Ѝ/$ -- M0 0:(--M  --M  A-pPPp` V" Q @Q PD@t0 0000AhL0L L0 J404 40 J0H{U 08U 0P R   0//ܚO-<'<7 0 0S0 \D0@0T9  T04 0R/Q T:\% 0 \/RT0C"0C/QT :0 BPU0P!T0l0p`@@PX vI0<@@0/S (@@ @@NpNXN?A-M`PD,A0P@; !0C p0 00    0 b0C S'0 p8J0 0?0@S` 0S 0S&J0"S D6!@Ѝ T1r0:J00 K @-@P1 0S* C@T. 0T)  /Q0C T !@# *0P@/S |0 B@T@!l0 0H  T @@4@0@/S(KKX=0{-DM  {000p 800S DЍp@-`P-p P@p V U p@p`UP (p` V.x<yQ?o?o 0C-@c^?c^' ^./ "(0C0;: `pCc&Pc2680E270G2&1H010 /0 @- / ,00-+C@ P@ 7KE0 0/0E0E0C 400-+C@{$PG{6KE0{7 Q/ 0E0E0C /0P!Qoo G-@`^?`^) ^? 1?1>(@04!50;:@p@`&``4 3V4X4G1Y01000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C J|@ @-yp A Jq@ @-np J;@ @-8p J0@ @--pPP `@-nH00p@-@PP  p@$ 0 10 WFdD Du?0/R//R/?0S/R/P/R/p@-PMP`V d@T 00+GЍp{ : { -p@`($ 6 lB 00 R l,@-4H00 0S@T,0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`FA@ 7P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍXPP @@ @0(@$0bhHO-ϟ 0 0XP(<Ѝ 0 P(000U00S SD 0$`Ph08P p`C Ps@ P6P p W R0 0$`0P 0p`C PW@ P6P pW R0 (000@ 000@(X(PN(PzW0  GS( y +St -S 00 00$P P䅐ಐ P:U X$P( 2c2c2,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pP?0  P26P1 p?P  (6PP% 0(P 0  R9,0X0!0 B 1X/0 00|; 0  0P(10 ,0 c0,@ 0PS,0(111v>C 0C,0   !/"b!!A0,0 X0 0000 0 : ,0 :,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(B 0 00X0 009 0  0\P(X}XD9\0   0KP( =0 P( X 0P( 8 ,, ,0 0CXP0(o000{ 0 P(a000m 0, ~,0P#/A!b!b0C P0( I 0 Br0 SW0(0S0X0;7 0 0P(B c0 ,S 0PS(, 6 0t0?2c11!, 0 0 0000 X780   0P(X ;0 mP 0 0 S0 (0X(P3 0  P(((P000 c0 ,P(00000  R 0s @`0PPv0 P@ ` @a0Ka1c B  B0   0000 P!/#b!!"A @@şK/"8bP 3:,bQ # 3 P b4$  Q000000%0 2?3c112B x$xK?##p$cR3:d$cR#300T$0010 !00C0 00@ZP8 R0PR00J0PX$`p(P*0000PX$`p(P000,P 4!/#b!!0"A ((K/" bQ:3bS0#03   1 01 B00DRd , 40 00N(0~0 S!0r @WPO"  IPH 0 40N~ Q @(P0Pv 0(P00(PP @ ACLC|q \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0!P ( 0$0A010PE0,P ( $P( PT#/"b!C;R, a2ba12,> QXlQl'lj0S; 00@70S 0@0 㸁,0  0P P(00, 0C$0(~,B2000c^\0M0c$P   0P  P(00 , 0C$00(0W    0P ,  "P ( (0 b$ @00 0M0Ѝ!A-1@0QPHP P MK Q$`10 P1#L@p P@@ (. R! v P`OU Ѝ0 P0  P La@` /UBT 0 Ѝd   0!A00, , * ]\\\gfff\\X@-0M@ 0P 00Ѝ@-0M@20P s00Ѝ@-P@g̬p@-LL1 00Mp0,00`@P= U2    P00Q Q Q  0 0 ,0 30#0Ѝp  |{A 0 \0\ \;0 l?D0D D:0 c?Lt,t,t,M) ZB) Zp@-@PP U 0DPp P @pD0D D70 =?U(0( (80 3? Z<) $Z(Z) YG-pP`' X/ Y :V @P0PES  R  D&0PEV R  RS0@0D@ D0D DH0 >X(0( (I0 >DY,( LYPY( $YR@- 0BAs @Q 0CR ?@O-阡PP p MU WC 3@PI ?4PI  p3p`M g:4101S Y54 Ѝ0:30P@!3P- 0 0P 20 0  ?= 0  ?l0l lD0 x>2v@00808 8C0 h>3W8& W|M% DWRQ@-M @PЍTT O@@Ѝ֩ЍF@ 00O--M⨁ Mpō@P`pG x1PR pJ @\CKX0 ^00pt0 O&00 T>5 q@Ѝ0,  (@P 1 P 0 0 5 30ݍ Ѝd0d dD0 =?00@?00olT@<# LU0   M Ѝz--M  uЍ Ѝ/ -- M0 0  ЍЍ/O-锒@P p`M X X00?_3000P @ P 00 00 P! !  E1XPG  1VP WU V[XPVppPpW` C 0`f`0 ppP `PFPPP1 0 0D=W`!00!1 003 Ѝ埩0XP C0PP00 2 Ѝ0 =`/pPP V (pP `P@0@ @?0 <b\! S@SL>h Q@-@ M2(0S2 N00 `0( `1/qpPp0)  0 0 PUR <0PU2 ЍPPTp 0S  0CP2>00Pp2@-P Ms2(0S: 00 "p0( p1/qp@`0/  0 0 @ToR <0@ToY21`V ЍP@T` 0S  0C@ol>T00<2d>0052p@-PPE 4A0S5 @Tp1 Rp00P0 P 0S P0婨 0c0(夨 0P0 埨0 S,P 4P 8P p@苨T0T T0M <0Sp000 0K0 <eEN NhN pNp@-@$PPޥ6Tp@ץ_@- @@Х3T@ʥ_ܝp@-,PPå EU@ἥpl_@-a@P`ME P 10p00S `  0 XR` ` 0@@S8  V8 CR 6!0A0 S0Q^*:ЍV   "Q @^ #R.S*@A a  00C0 F0 ; "^ #RN^^ N0 s0Q@ĻL L4  R  *4 8/< 0X\S 040:8 R РS /\wmxB@-@`P=LpL0ppD尀 fT   ܅50HB@-P`@=0 2A-逆pP`@P( T0  r0 SSS0v S00 S 0050000005%0 :T5%0 :|%0 0  00L50000  8 70Ls0 20-V00 ^V00;\ 40000 00B0!0000LS 0100C0 0?V`000 00000 \ \ 00y $40000  70Ls0 0 h", 3010P;\ cP3`b0001~dP0j R SXc\Q t30100 M \; =\H \7 00C00 LR0h0100C09" 0 0  Y 00Ls0f" 0W0Cs0_2 F0nR!  \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00Ls0! 0W0Cs0 0 #\ 0 0 00Pk 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP@cP'dP<00Ls000Ls00<00uP00p꠸X I JJ I  |  O-`RM@p , [5 X PI 0 0X P@0 `D-PF V0F7 `  [ 0U, 00 0 }/09[ 0 /09 0@SS0T 0 0@D0 T0 E0 Ѝ:00Ѝ S :00  \C(C 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@p%0081003/0P !p0 $@ 0V0 00 R (㖢P000P3/0P! U  R  SV  0ST厣P000U ꨑ/>3LRRXRtGhQQ=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@$00810 03/0P !p0 $@ "0V0 00 R (P00 0P3/0P! U   R  SV  0SP00 0U \PЎlPP,E OpOA-@P| P_3`Px rpPh  00^c<!"#b!0CaqV8 X p4PXU $001p00S M$\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(bP` p  0000StlP0000H0003/P 0/>3dMM؋LMd=LA-@P{ P2`Pw rp Pg  00^c<!#b!b0CaqV8 X p4PXU $001p00S #\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ɠP` p  000$0SӡP0 $000D0003/P 0꜊xK0Kt\JDJSR: G-P0`00Sp 3/0Y @IOP Ӣ T 00 00 Y @IOP T P00 D0D 0 p`P/I ܇(ISR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP x T P00 D0D 0 p` P$/H̆lHO-PPM M Q \ /\E ᄼP1P:p/\ p P/ `K`\n @ /RR.\)  B R}/0  D06  I ⹼p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/R_0W0[0娐 !uP-U  )1   RW  q60/\0#p0 @/R0 X0/ ލ Ѝ @ ᵡލ Ѝ.00B7 X 0/ ?    MPH.700 (7>00#7007007?00700A-@P Q P`\P፠p@P ៻P`V 60"S \600@p@-La P`M=  000QP0P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P 800  6 0 @p@-@P`P3 V( 0Pp:P @R0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 S4(0( (0 J46P 6(, 600/,Ap@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 4U8 808 0 4pH '5 #d5O-ȟ M MDčpĝP$ 0v 0S 0S 0S t4!S Sdh`P @P5  pP 00S RD@ 0 @+D@ ` @PT"0 S* Z :S `\S S S 0U:H'PPE TpP+ -P`0@ SZj0[P0#QQ 8P6@00PS0 006 p0040(0,@= P :S~ 0pS t40@0 0(<QP<4` GC pP> :00`00 [00S  `U@P  X 0 `) PȸPu0Sᇟ00`YPE*0 S :S `b[ ` Pf `b :S& 0@S  0D`F00S:S:00` F0H[0 E0   N0 PCy `#00p@ H PEIpG[P P p ,@ pT z E0AX0$0p#3 0 D4 30ݍ Ѝ@ @2Pp 4 00&P ⲜpP `3P00PS0,@`TB `@0T<S= {40@v4@00"2 0 g20S"2 0B [20Sv"2 0 O20Smt"t2t p 0C2c  0@ᤞ0S> 0K0C 04 8 0S:SZD H R0 0  Q!000AM04@@0. \0:S / 00UiP e0 E0 -I0 :SS008$ 0:SS00@ 괅,94 p   L@-0 00 -H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 @ 00 0 0 30KH Ѝ/܁ā84@-&I0 @ @0bO-@`$MllPὗX20PY 00 0@`QbIP p W  > P G  pGpPH0 S#: -% U10 r 1$4S1$ !t@00H H0S "<100S (!0 0 0 306 $Ѝ U r pP Р P 5SX0(, VT00#    )PH FH0SRN똀| $baTPTar ˠ@-(@M@@0BPЍ_  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T -P0 0# 00Ѝ -0Ѝ0-$M  00 0NP$Ѝ0-$M  00 0>P$Ѝ0 -M 00 0 -Ѝ U \0T/C-DD sMPPp`/ V7 @X0^00pAtAU0O⑕4{ PP0P >TA{''0 0$00 @8 |0 0 1 30sߍ`0` `G0 T+VD0D DH0 J+zHz  0   M Ѝ\yO-ϟ MPÍp0_ Wg 000!R !X P  %P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS  000P0C0 pX_P o@0 0 %P 0C PSJP =- 0 *W=- 0 *a`0`F p0p0S8@0 k%P, 0P0CS0 0000偼0S0p0@0 0 O%P0 0C P0 SP 00 pg0p0SP 0Sb0 0_00S 0p000Sp000b  0 P\PY+PS  PO00SVp!p3`0 S` 0дP P` 00 000020p0S 00hʠ@0^T@pp,(0*TIP 0', 0$ 0 0$`-Q[ ]QP0 ` Q: @$00!0SVp!p3@`0 0d:P000 P& 0  B00  `*0 ⱖp PTPpG@0SW `זP 0@0080偼0S P -00SG0p00p0S00 P 08pG0Wdp 8pFWp!>᠈ m@(0H0p0 +0BMS00 [m0H0 00CS0c000pWH%\0XS 00 0 (G" 0        0H0 0(0L0 P00-0F SJ*N0 `p(@叕0V '  0 '(0 4 8@` p>(00S 8P V ,$00SOV`@ T@0  R  R=  0 BV0 5 R P/0pH  Ry @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00nLH HHQD@$(ypxh 00  d N  4  d | T X L lh `pG00P0W0S`J 0000P T0$@p@00Lp00 0P00( . P5 0  B0 0  ' 0p P p/ ߓp ړ0S $0 PS0pS`F V P0 0@00XCP ($@X T 0@0 0\0S2P [($@  0(pI00 ?Jk00 :V+$  ]R Rt@Pp00@0 0mP00s$  ($ n4X y@WP0 0NP 00p,004@cP P P P P^ P 3#0 /&000C ,0P[ 0$@(j ` @vV @ ](0\0LH0\ -P-@0 `V`p ,X@0Vp@H0  PH0 B   H `V  0SfP H0 p H00CPXX0p0|5Lp0@P0 00  ?oV20SX 00 0 0p B0V 0\ R-PV0 n P O ˒ P 0  B0?0C  &. 0(  {p0 P s PX P`Fp0S P [[ (0 {1(0 SA-@P`p0 0@@-@`P MDp @0p0 000@ ЍhaA-@R@QP`w v (200S8 0P1S010s G000Pv`$ pW@0PE ጐPP_ 0 %00P0 0 C `C0000  Q  Q*RQ2 <00@8 0 B`0*P%00P0s0 ӎP ˠ0/B0T0T T`0 $~ B0 uq`a  p@-@P[ 0@\p@-0P$L`T M 0S pW  07/@P Ѝj&@ Ѝ$0$ $08 \$0p 0 00M 0Ѝ]A-0P$L`TpM 0S $X 0 8/@P Ѝ1&@ Ѝ( (0( 0p "$0$ (00 0M0Ѝ\A-0P$L`TpM 0S (X 0 8/@P Ѝ%@ Ѝ( (0( 0y, #0( |00 0M0Ѝ\A-0P$L`TpM 0S 4X 0 8/@P Ѝ%@ Ѝ( (0( 0D #04 ,00 0M0Ѝ[O-MD`PpZ@@` T6 0US``$ZG 0SD [A 0 `;/0S+ @$lV 0S H[ 0 ;/@PЍb%@Ѝ0$lV 0 0 N#0H 0 0[ B#0h h0h 0Jh 7#0D D0D }\ 0+#\ , P XH @-$$@M sЍX@-0P$L`T M 0S 8pW  07/@P Ѝ$@ Ѝ( (0( 0 "08p̿ 0 00M 0ЍX@-@`pP$tt0l尀  T  m@0 R$ ϪW<t+03O-ğ$M `H0 O 0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT   ^DQ #2!Q   "  R  R  \00t0!#300@ 00@00 @0`PU*$Ѝ@0 0M  0ގP-0 S^^?0@0 0`0  ێP 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0mP0U 0 Dr RQ0\  @`b$W4 qA- Q@Pp`! rP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0* P0 A' ' A-P@p`P.T T t0! D32 0 A_T %<0$"0@ !1 (0D,TSI6T' O-@@ȟ SMD(ȟPP x`pt  ?o2V0S Y W w@V0P0  N0P0 [00 p1# 0 S@ P!T- U T 0 1 #P00? PPk@T`P @  !TP 0@T0P00HC1S@1@! <`pPJ 0 (0!0S V <0 G0CPap1  * 60 0  Rp1  ' 50 0  Rp1 00p1 00p1 00p1 "00p1@\00p100Sp1 \ OP@T`|P454%40 B @L5%0 7  㚋P* N4$z0 '  !TPP{4$0 G 4$0 > Y4$0 4  p T$ `p@T 0p 9/P#"00ቌ凌兌僌$3 0 D1 30 Sߍ@@l0`S$O 0S,0  VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^]*  P2 0*A5)q @. 00 (0<ʌp ax ~$0~s$@ 20 ,0` T 0 0S0"700 0P{00, 0R 00$00S$0000P04p0S 0SV W1!0 ?4pn!00Id1 @`,@(Z(0 [PY4*( Y  $0`0S$0 DQ  ?P T`Ip@bH H0H X0 }, ,0, W0 shF {|{@F zT{p@-PP@" T+ Pp MaP 0S SY_P p@S_p0p@/L L0L w0( <T, ,0, x0( 1dE zxz8E Lzp@-@PP U p@ QaL L0L g0< U, ,0, h0< D lyyD yy0@-PP@ M T# _P Ѝ0`P 0Sl00 bP P0P 0L T0 000 0L C xxC yxp@-PP@! T* 0 0S p^P `P ^P  ^P p@^L L0L 0\ T, ,0, 0\ B xwwB $xwG-PP@J T  R# R `V$ V  0Lhhqh pl 0Ph R R4 0 00 0 `V000 0`V 0| F0 F0R%  0 0 0 I0l / 0l `( 00 00 0000 0LwB 8w%dA 0A vDv  @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`2 V' T ^ 0S^  S 0RR00p@@Tp@0@ @;0 (0( (:0 t? tdd? xtC- MpPÍ`@PL TA A<  XP7 -Y` F0S d!\1 0 3 30Nߍ(#@- R? R0 ! ~ p0S P% 0p 0 0 0 90 0 0  U  RP R0ꯩ s`s> 4s s= sTsO-hIMdğ,M IM$J͍$@@P p`WP W0 $4 I0$ 0 30Iݍ,Ѝ0SJ=00SX30 2 > J=00h00x x#K 0 ?s0 nJ- 0S VU0  SU S RMJ=000:02嚏0 0000H0 ,0cSP @,VU  W3 0S\0S  0S0s S0S RJ= 0 J=00XWH O<  VP\ 0SG -jh03?Q #< <0K8 0J=00t0 Pt J- 0SJ=  0rvS S{J͍0 *]&$ 00ScLP P P J=00W0  VPJ͍YP ꆨ `< q; RoO- ğ M@pQ `@#0 0CPS0 #3 0 0 30Ѝ#3 0 0 300 HD@pЍOWX] 0 H#? s0ʉpPT0S0SG ? /r "s0 D൉PT7VT00QWX00 R0SX 0Sd S2YP00SL"0 T@@O 00QWX00VT;! 0 o X: pYp 1嘡嘱 P0 pY 0@D    KT00? 4!0 ?piT 1i #Y>p0萟蠟PP0 p   "P030#?pW 0@D D P^T[pF\  xs<8 dml lk}dkPjT|j(jiG-p 0 FM& P@`p P  RW  P Wr`ov` J0@Sp0 0 0 1 302Fߍ000 00?1} 00  0P Z /r RX 0S P 0 $A-@P`p 0 | 0P ;p@-MP`P@@P@T 0S  R0S P5@PЍpP-PЍpp@-@P pPpPp0 @0 B01 f0S/. AA0Cq.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP0 PoE@0S0S 0S  Ѝ0$0$ $n0 y+ Pa@-pQM @Q`P Q Ѝ0SSp P*pV0S" S  0`S Ѝ Ѝ00S S<0 P 00 _Bp@-PP`@ V T! 0p Ppx x0x t0 +V\ \0\ X0 T@ @0@ <0 ,* __* _`_) :4_O-ŸM2`C @80 0k[P00  03/P 0@&<00&,SS00 40R0ST X@`$`w R? p:00(,P Tp*0 C 03[PPf00  03/P] P[@[[[` M40S?&<00S !T? [ [[h5`z_0D0 Z@P200  / P@) c`P% %E0 D0R4  4 Sʆ[ 4S 000`0 T &<00Sc 0D'TS@pW0(pY,PD Zu H0P0P08p`h@ 0 eZ3 { 0{{ % %  0E {000000YP qP0qP R R 0   pR seZWy 80LE0S5 0[00,[0030 0&<00S3@ЀP@V 0 8(5$%0 5s (0SP #0S 8eZ00@ $0R vTA TThT @圀P@V_(0S <0`PC80D\K Y<0 C ,0PB 0P,0(00(070@ZOt00S000e@0 1z_0 0 Y@P"00  03/P Y 00`S 1@@80RC.P@VT&<0P0@` $0%@P g hдԢ XP O0O OOp NNH < <0< 0DD $0S\ \0\ 0dD 0S| |0| D 080PRCPP.@%@0.fPU0@ 5YPa0000S 0R $ R[ $R 0`wdO-@ğ SMDP0a`P apP $0  0f8X0`00pS0  PO 000 FPK @@PX 0  5Pcc@#|3 0 D1 30SߍY 00lY00 Q0 0 .Q0Q RS% d! St*+ 0 Pcc @S Rd! Sf*.[ 0 P< D |Pdq 0 DDQ0000 0000 Px0=S CY0S# S S Q 0 Pc0s70SS0S )Y000000  Q000S0000 P= Y00 0 P3Y0.[0 0 0sx X00t 0 *.0G0 kPX000 DDQX00U= cX00Rꈫ`\ .IO-`@VpPM 3 0 S_ `PL 0(H0L0P0T0X0\0`0(000 00000HSC S$ S0 0% 0#(,pLp0  0Phh0000 0000 d1S zЍ 0,p#ᄀ넀kXgmX00jXP P P 0,p#bp;P h08 H0  < 0 S6 10T0  0BP  0 p5 P/{0(,0(0  {$0PUbZ 0 Sd1SdXO  00S! tGO-Ÿ @00@$0` pY i;92 I520Y0 0 S   S  R  R Q\  ^ \/oQ" S R0S   0PQ ,-0 0S Q0S %0P 0 PA  0 B   (DP(IY! 0( P p0`4P8p`P,@<Y  0S@TM 0Sb 0S S 00SO P(0 0< RIP RF RC0S0S ;0S,\%`;3<! P 0 0PU `V  ;00\ Q  P U V  R R  ' p' Y ` P 0S   0?S C" 0c6#PY  ^i \S㔐Q^ @ pTp0S 0`@ p$p T d;42 D52H 0SE0 S > S PR  PO 0@P0 0`P`&0e/0 8(0 @YP`(0@ S0 `P@T $PP@P e_c_T$PY@T@ pTu W 0/0P` 0 PU`VX  ^PS 臟PpH0!L0 0PPHP$p`PPPB *_0S: 0S "_ 0`@\'\7\ Xy/0QRSP㔐  P   P \?oR20S b R㔐I GP\BR PLV `$p(,PP00 00SqP@T0 ,6$p0(,PpP S 00 0 P@T 0S00S`;`9  0 qP pY 0yP-w 0P R 00S R00W  P5 0mPY 00S"S㔐R0S |$|4| 0t}/ 00n,@ p0`4P J^RSQ \`@ T P@P 3^1^TS㔐b ` `$^@ 0&P 0  0P ` @P ^ ^Y@4#434 0,0 ` `S_] P]`00[P 0 PP__PP HpW0!@%`!!:P[@P  H HFeH`L WP @L@*`@ ]0 "(` h`$ P,W 0@VP` @?HI댠 p0W|0E0B l0 0 0  Tp`h{ !wP vPU0E D $0DwP00EJ$H|$0U St S 8^ $P"/(<ȎH<P<   Px9  76c D6(5u'`Ii Q D 0P03 P Q$P0Q W : kvh,pt0(` 0 0q"0S0 0]H@P P0U 0P\P0U \0`$p(,Pz$PEb.,> f xwP1x00x0 \`@`@HP0U00L0P\P`O-PLM` Zi  @㰱q p  PP0 0 0PF ``0S S S T@P `0S `(0 ( (`%P00 U `V Y 00  Y``VU$@LЍTT T0T P0".Z8 808 40". p/,.h ,..i G-XMp@zP `P@ h00  Z0 zP 40S0- XЍ PP [@ 0 zP [8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0@ @@<  0,0, ,0 ꉫ#EgܺvT2 8G-PPp`6 W* 0!ᣑ000? 0"@@i>V0: >0iS@I"p ` *50V@@p`F GH H0H 0 , ,0, 0 h, p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@"` `0` 0 ^T@ @0@ 0 Sv Lvl @ PC-0"02 0 M0002"00 @00$ p P`0R   0XS 00 Q !. 0N `!P1 0 0 30 ЍQ  Aa 0s00C 80BS.R ^U* 00ꂒRP 0ES0 S S^*0W >y000@^0 8< 4^*0 8<ulut- MgP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp 5(0!@$R0@0T$0B0S \@0S ( !0$ R0Dsr$ A- rM`PpP: UB @X0^00pAtA S0OHS01 000TAΌ LFSP5  0 OzpP& 0@TP 0 0 1 30 rߍ0 <0 Uh0h h=0 P ^U00 0P0ꆑqBpT  , 0   M Ѝo -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/|op@- MP@c0x x` 0 l0  `@P@X@j0@lT  ЍpGo@-HH1 0M` !000mop @P 0 F op %n@ 0 0 0 30'ЍnPpW @@T PU 0StP@_TZ=00@Ӑnin 0p@-P0@ 0 p0T(0PT(P,PT 0t0PP 0$P 00 0p88asP 00 0ppDp 0@-@ 0 0 0 0 0 0 00@- 0 MP @0FT 00P 0 NA?o20c Ѝ02 00 0p@-@P 0U0 0pp@-@PT0PPT(0PT(P,PpO-p0Ph `Pa 0@00 S S0 S S lPP 007PpUp 5 (P@P 0P00S S S@ 0AS A@PQ% 0 PS0Q0000RP  zRPP@0@;@PP0G-@ 0`pM,0(Sy: %(T] TppU 00SQ 0 RK@D@T0PF   RB 0@D@D0P0S+ T0V  0 1  @D@TPH 00S#0A S0偠0  b0S000  Q0S% 0p@#S0ppS(0pS(p,p@Ѝ5RP  (,@(~  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0:p 0$  $ 0 1 Ѝ0O-PTMe pE,P@ @0 pp p`T  P@ P  @U$(P P P p 0p`` p  p`  p   Q00p`<0< <]0 UQ&  @-@P @HQ( (0( 0$ @1 0 00LЍ 00!007 0 0@-S@ 3/@Op@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \0 \, \. P@^ ^ N@N P@\ \ \ \D@u4P@d\XTLHy7d l @-@P @ `K0 /0 = 8p@-1!00 P@0 00D@1011.T 0@\0 S@ P pp0  00C1000L  00t@TU ʚ; C-P Mz뀐pM%ᙞlaapGQQNHH0  @ N 0 Ѝ̸ Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2S p 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`i|S O-``!0P@@R@@ǟ MM|čƟT ਄L<6K0P40 0 0&6 0 P@ < 0D00U000x6h0H0p0,0 0  P00T00S <0`1  RD0PU 0P 0U V HkV0h0S  ,0U?p45P00P 0U7 W,0?p$p5p0= 0Q8 W@0 k@V,0? )R 04pUpP   P*4 #+4 p08T4P p0/4 p08&p`4@p8 0?0SLP MJ0P40[0 ;#3 0 |4 30ݍЍ_3P `0^0S 00T00S <0`1   NL :k40S 0#2 0 |4 304ݍЍOULPp,0!(?q0r kUY" 8 " \```PT@Xk@F`DV7xT0Რ SO?s t@3 Z 8j pJ  Jj T0 P2L p 0J00 .JV* T@F0 `DVT@X\``ꌱ0   Zl0  0 @10d` `ppG  pGjT0 d`l0L p 0K00 .K * TʴJM jF܇PlPTEdxD8D(pRM |LLTxlLTO-tM@@ `VPPh0 0PPp 0  0`14S, ἴᾤ0  (6< 0 V 1P80q6< 0B>PU  0R40008  j`1S   ;`1S0 0  0YPJ0  0MP7P  PAP$0  05P0  0)P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0ipW 0pW  0Rx 0pipWf 0pWa  0R0 ,0]ipWGpWD 0 PS00 Ki`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0001p 0001p 0001p 0xt1p 0L htЍ tЍ 0 10 0  0 0  0~0 wx0 pHDl=L;\`9xTtT4@-@`00AMM0 400p00 >PP0S [D 80 0 4 30AލЍ.겅tAA0,@-@ M pp P>`PP 0S <0000 Ѝ00S.S 0S Ѝ訠p@-|0|AMPt 0 ` $ 0 @P  8 00 0 4 30Aލpd@?p@-P@Q`  @Q dPV 00pV00p@-@ M`p3PU 0PU  0\W 00 Ѝ_00P0 `dW00 Ѝp@-@MP` 0S 0 @S 0S@V00ЍpO00@0 P<V00ЍpD0@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ083`Adp@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@`21p@-MP0@0@=@T  0UЍpt0 0PU:P@@Ѝp <```@,00PЍp108\`@0@-@ MO Te  T T 1 D0R   T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P( 0@lT T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPP  ,D08l@-@( P 0( Ie 0@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0H.Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D F000T H0 0 <0 30 @Ѝp@Ѝ/.0 TS1_@8T7O-PM@PP i p`0 Q  ЍSs SRPP -\0  0+\0 0 30P0 00L1011 .\ 0 @T@ sq'R Q"  S#3 @ R Q" 0   S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0` T000@0S Q# 0R#300@0S Q#  00R0#03!3 T 0T @ R P"  S#3 @ R P" 0   S # 3 # 0T}0 0K 0N0 000J00  087O-@Q0 dM R 22/18R{20\0QS0N0<0l2a!##\R2b1!A`2aL6RX2eDPQFW0E0@02h8's2a>?2crlqqHL01NਂhLΆbfXT P0H` aNe& a" ][P0 T XF Z H Y J (0L0$0\04 0@0,0H0 0<0p 0D `40B[ EZ EY EdЍ00N\0@R@(@j  0 0dЍXZ HY  8igMbQ(L5 @-@P 0D .R S0@*ST .P@Q QA.@P@@$ $0$ 0( , ,@@-$MP>`@P`-^0pv> 00pp< pp_p  bPc$ЍC-@P@ `p MPOP @U ^`P@Wt Ѝ @ePt0 0000 ^0 P!@V0S0Toᨂ# $l.HC-@P@ `p MPx@P @U `P@Wt Ѝ @ Pt0 0000 0 P @0S0Toᨂ#"|-<p@-@P00CS0 S u P `0 Ppc`u0 0CS0pSr P 0 /c@-M@y0  0000 !R !0@Ѝ@--0@S@#0@0Q R#  004S 0@R Q R 8 @0Q    +Hp@-DPD0P`@0pp 00p@,X0?,*Hp@-@ @ `@0Ppp0p@,))HA-DD p@0P`p0 A|)HC-P0 `0pMrp@ H 0D @ <8 @ЍB9 )HC-tPp0 `0p MHp@ ( 0  @ Ѝ 9x(H0 00/'H0 00/'H 0 00M0Ѝ'HA-TT p@P`M p 0 ]Ѝ'H0 00M0Ѝz 'HC-tPp0 `0p Mp@ ( 0  N@ Ѝ8&HC-|Px0 `0pMp@ 4 00  T@Ѝ8d&H0@-P@000 00M 0 0Ѝ0%Hp@-D0D 0@0pP p@No8p%H((  M  0 Ѝq,%H(* R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0 0 $$O-Mp`@PpM WC*00V>:Y ` <1 p0 p, `}P 0 p- 0 p 0% Z ` p0 p F0?V0S0 0 hЍl0 op ^000000Ѝ@,0|( DșO-M 08/0`Hk= 0PE$P=00P눀4>Hd P0 P` 0 p , 0`%p =000S#=000SH -0 = 0 BR  p  R 0S .S 0S 0S00S.S=<0=0-< R, L C+A0X 10"3" 00;A0==0;A020 0;A1;+A0X!1 000!;A>A C1;w=000+S =<00SpA0@d 0 0t`P0 p{  0 d d0 pm 0@T0DK*P `pPb$,  0Ext H%P*8D܅ ą Ԅ 8 == ====L P\VUUU x4<ܸ|pD \4|t s L@ܰTDKC 0d 0 0 0  p  < 0 BP0DK 0T$*PHqp\N `P倐P 0$VA  R @0 Y$ {0d  0 p @T0-< 1!?C0 SX!(p@ ]!p=<00SG 1p0D;2d 0 o P`0 pv <040@C 0 P`4Ph0 p` 0 P`#PWH=<00S =<0x30 ! PD=<030$0d 030 % ! Spu.=<00Sn =<040=@  <<0n p1@m1@000<`Dd4( 0 P@0 #p -< 4B !?C0 S}0 p2=<00SV 0d 050 ! p `VEpD6 1R<@0`P $0@@@@= 0Hp 0X% {WP *( 50@@5 04/$0pG= 0p0VHD 0 S@P00 p @P<0P`40p@C 0 P`FPz0 pr 0 P`5Pi0 pa 0DK 00CSj 70=<00S0 H[= @ 00$ T` *0(P't p07 h07/=@D @P 0`0H[07d 0  ! Ep! 0YD2*`@xp0p DPY V 0  %p `0d  @ 0 p `F@P 0 Y!p(@P< 0@P BP 0 p PDK!0 0@0H0L  h7 = 00@P ( 9 0P9 05/P`/0@)DK1#0Ypv! pp< 0p BPP, 0 p| LjDK`/PD[ d 0 ] 0 pf /PD[ 0d  K 0 xpT /P /0 @/;d 0 @P2 0 _p; H=<00S `+0 S00 =<00S K0@d 0 0 `P0 8p 0p00d D; 0 0 'p  0 d 0 p T< 0DR  =<00SJ :/@7/P4/PP0@D;<@2 0 `p0 p < 0`p BPH 0   <  B}P0Dk 0PCUt@pQ@T 1 W2 T0d  0 p=<00S .@.p>@@2 0Df P`0 pm 0  Pe N@0 D}pY 0  PR 0 DlpH 0  0P@@ 0D; 0Yp5 < 0@` BPr+=<00S 0 C? 0=<00S 0   <  BP0D 0 SP/ C 1#00 Sn!pA0 H{= ` 00"VP *0(/ @0? 04/0-p`F H{D`P!p0 H{= ` 00c"VP *0(. @0> 04/0-p`F H{D`-0 > R =<0>0=<0p>0 0 C`>0 0 CP>0P$ 0 PU0D[:=<0=<0>0P  `PV V }p@P 0T00 Ep[ 00d0V0@D0 qpLP<  @PLTT $}p`P 0V00 ESp/ 00f0T0`F0 Ep 00XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQs 00000  0C Q700C20L0L L?0 404 4>0   O ȑY|O A-Pp@KU`, T @ W0``W0 .pPEVp P7000 2000 S70Q00 V00$ $0$ g 00xhN /o/yl///@-` @0 0DM0<000p2 020 RP/00000C0< 00 0 <0 30DЍk  O-h2hrP0੒ 0 M #r DrgqC2(00B刀B# C@$AR i!dP @`3@CG*TNXWnY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 Hzp# W0Y[0S    00000000SW 0 Wp@@ 0 DLp XW  0 M?p Y L0L Le0  Ѝ @: %I$  4J HA-`pP;0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@W( 0 p@-M P@ ȍp k`\ p Jo4 (0 0 8 30ލpj 8 0-@- M0@R0  2LPP * Ѝ@Ѝ/ + Ѝ@Ѝ/jPRp@- `@PmP[P0 ?p@HI00pPRp@- `@PKP9P0 ?p@H'00pp@-@Q `P+PP0 ?p@H00pp@-P@HP p@ p@ p@-@P 0PS <0S P 00p}00pQP@- 0R R  j00p@-PP Q@ @Q Q Q ARt032 R00pP @pP Qp@-@P PsP  U  H{@{7@{{5pHHj,UH D10jS#knP \ X6C#: :H L0p1R 006L00H0\H0  @  0 00M 0ЍJԹ GA-P@U `0pS @ [P 0S U@Dp@-P@dP`P0 S :pSSp 0R:pp808 8e0 ں$0$ $f0 Һ0o- Lo\op- ,oA-P`/@,T*(P/ $P4 pPW 0P P B $$P W 0 P l l0l C0 ⏺T T0T D0 ↺< <0< E0 }p, tn$nL, pnn(, pnm0 0@-@PDQO-^ `Pp  A@ 0S 00CS 0 \V0 S  RYWppXpQpW\`\\U0 SP\p<+ Q@-P0-r-w0-0x000% 00 000S wS -S rS  0S /xS  / p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@ስ0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 w/|j0( j ??SS $0$ $p@-0 c/,j' Dj?S S S`/Q/AQ/Q Q/?0 H0H Hp@-0 =Q/?S0?/0?/iH' iQP0 ?0/@-U 0  p@-f#P 0P0(@`D P`=0Sp70@%2@`p@-@P`M P0ES  aЍp  P`0S 0 0 Z0 0h% 4hp@-@PpP Q 0S P[%0PSU%p@R%A-PPp X P@PEX `P@`( (0( 0 ø`$ @ 00DA Bs QR cp >` S0T3 W  0p| px 0@`> p PPL1L!L?0 @0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333T  ]00 0M0Ѝ4  | 0 Q?0S @-z^-- Mv ЍЍ/G-PP`P VX ᒫ00 !PER !U6@  {PG0 豶PU pWW@%qPp X4 00m  @@pG  p᏶00] 胷 0@0 0RT0T TB0 oV808 8C0 e:- Z `ZA-@P7H`H0``@p @T  U A̡ *p@-@P00CS0 S u P `0 Pp@`u@-@P  0`00@0 60 d X- M ? Ѝp@-PP@ T 0 0 00 pD0D DD0 T,0, ,,0 ״x2 XM\2l lXNA-pP@`& T/ V8 0S 0S 0P Q0 00 R` FQ`00x x0x 60 TX X0X T0 V< <0< 80  WtWT WHWa( `WWbO-ß OM4`lPP `p@dh V Vt Z.` ?P 30 00 [ .Q Q\.Q _ :!!PX [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V K P00 0 ` `岯0 0C SA: 0  `0  +00/00P!@1 0 41 30GOߍ:[ 000$0( @,傯0 000 `0P  P00 ZZ00嶵00 0 ( 0ਲ਼C<4 PPI U.R{  :P o/\L (  ?Ԛ hT x"SBO-`PM@  0X0 X0^( 0P> 5000 00 P @ p ɠP 0 "00P > R  R 0 @`V  pWI1:pG`W:\pG`R C0 1 ` Z`pG@ R  0 0 00@ߍ R R0 S S  o P| ` Q PD 'P@ !T: p P@D X0P@- #[0k0 ᏮZ  ڳ[` pG Ka  ͳ pG  Vb qXV P 0(P ` `p R R R RT T * P  RPD(P@D PV p@`V2  寯P' T <:`P ឯP !T014@1:r 0 @ 0^0 0@ 0 @ 0 @0`pP_, 0@ 0@ 0  PP P 0 `@&Q# 9N^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 0崭 0  =P 0 ^  0 0 0 D0 30LЍ<Ptpp P@ @T@ @0@ <0L ƱaZ M<( L4 (LA-PP@M8 q`p@T* X pp00Y 0 <P0   0 Ѝpp @T Ѝ<P @, ,0, (0\ r6d6 LJ O-ʟ UMMLō|Z|ŝPPpxe刕( 0 (0S 0 S00 ,:0 0(a0P,0  0p P?s0WS#@``O ,0)09 0 L5 30YUލЍ5 00P0  03/P PW: 0B?o2\0R0S<0h ẬP0``P`0,t欠\ 00 H05 00 0T0R?@0 0 pDL48X U^*``0 C 0 Q@PS0  03/PK @ Z*P U$0P0S5<0S0 S  R08P0$ 0S!0S H0S0`M`$ 0`V`*X0L0Q*@ 䌱H0``0L@H0X48HQ 0, d0L P0U\ Q  RO ZO[ p P p H `BP0 0 0P[ ! R soQ \ V Spp0XP 50 0W  H0S B@Gq 0SPSPڰP^!P"@Tp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @lL0 C0 0CS`: 0S?0 @0 c@Pe0 z $0SB@呫Y 00@TW @@0P妜`@(`L S  C'SRF0@j0`f0%P `3#3 0l ଯ(0SW#3 l 0࠯M(0P04D0,0_?R0 0  PP0 ; $0ST D0,1Q<*,0`00P @ `@)0` CR00V048,0@PPp0`P@ CR00T@'P`@7 03/P `v/,0D(@C 0T00Pw  , D00D0D4 0(7PI0  PP0 F $0S|H0S0` T D0,1Q=*,0`,0Ἢ0SL@P`z, 0% xv p  0 Nύ00K@1sHf ẛ0`@0P``,0[0%P xSPQ lW,0D(@C 0T0W0P , D04 @ <. .C -C p A-@PPMD 0 S`04 S/0p 0PPA P< 80 0PZP"  0 0PᬰU 00S S Ѝ0pᘰЍ8 808 40 _ 0 >G-30BMPP040@ 0 00S0/ S  0 "2 0 4 30Bލ @tA~ ` p0v #0GL8P@T*X( $"๚2P 0    ! /8@PH `PC 8 0 0@PJ` 0 00 00000 0{0@OT@ 0 p pIP ֮00S 0  0pW/   0  0 }# 0 v 0 0 ੭_ѯ 0 dʯ 00S S[ Y.V \ L>>= (;G-M0`pᖯ@P0P0 V 0   0 pPᕯЍ 0 PP 0   0Sh $ \:A-M`pP`@P , 0 (   P0@dЍ0, 0ЍA-@P M`P@pQ UV'0S9 0S0S9 P`4418(!<P P0 0pP 00 ЍU U, / 0 0 Ѝ0S  0 00S000s S 04 P` @8 808 4 0ˬ0{ 90$ H <8O-$$ğ DM<h@P 0 (PP `pԓ 0 p`P P ,0 0P0Ú RR RR 0 R R$0 S S  ߙ@P p 30 00S S S@ 1U e*@ Ǚ@P 0S 0 0$0R 0>B PE @ Y6:I S@@1 F @ I@ Y!:  7 U@In E1P`P@G   'I  U=p˧` V`~| 0  0\!H1 0 <0 30FDЍ(PPE pP 0PE P/ 0 0  0 0 OpP`0 00A? 0 30 00000pTTp`p   | p@-M`@P ),0,0   0kЍpԉ@-M@ $$ 9 Ѝ脉@-MP` @ᖭpP0P0 ɠ@0@ 0   @0PᕭЍ40@-P MP@T 0t  P00 000 P 9 @ Ѝ0Z@Tt 00ȈC-a@P`PMT U\ !0 `   p 0S  >  0C ^0 .SGW 0  @Ѝ0 XR   9S *@ pG W0 QU 4 8<03?0`0` `m0 ֪UD0D Dn0 ̪ @S Xy L X $10 0 0O-ß3 0,M@Q0$00`P RN Pj PX0`:V000 0m Vo 0 0#@ P@`0 wP ^ PUY @ ZpWP `$pVJ氐0S V0FB S0 s\b 0@r@@2pJ04 VV VT S/00"1 0 $0 30o ,Ѝ!1 0 $0 30c,ЍO`:V@ p P :Z?U6 0S 0$ S氐P`$$q$ p 0I4 U V V 0@ QT00@ 0 0@ ?0S@^$pk@ `.V `$pVP\qRVihw ` h 4/Tu |u (4 . |-@-1 0,M@P0$00`P& V.  0 0 0 p 3P* u 0 0 $0 30,Ѝ蕫 0 X0X Xh0 V<0< <i0 |Rxs ,r d ,< +O-ddş tMQl@p 0 R P P/ \/ 0 %5 0 l0 307tЍTd4P`I0 ATx T 0S4 04$4 0 + 0$40(,04801@ R@0`S U P Q 0S0@S Pt0Su00 Y0S @\T<0000j:000@T `0= Zf 0Sf* 0CR00_:᝕o"2 0 l0 30 tЍOP@PUE*0: T00S Ct"H 0 2[P3@T` 0Z00S RZ  @T0`zu YPs S 0 S P0@o Pb0SF:k 0 Y Y Y@L!0Q 0  HP y8 @R0P`P`0H =W Tr T0 2uA0< P@0 j0| : J0@

$0[' + 2P&p 0;/qp 00P @ P &00 0 00 兝Ѝ轟p p.P 0 Q+ L WY pp 0.P 00 0 SM  00 0;/qp 00PPßQ <PU;Κ0 {p0 ;/qpP0 r 00 0PUßR <0PUß`X0p\ Ri00dX0P\NS  00Q] <P800CPU0&Z   "  RPPL0i?  P;/qp@ 0P000P @ P p00 0 PZ 00 bP)0S&: I y AJ0C0œ;PPT 0S  0CPß@1@!@G0 ҦAPU0 Z 0CJ P'JPP @0P #0000 00ᆜ0 0 द0x꟨ 0 pH0H H0 0|l  l!    \ O-P,MPp@P` T 000S000Z004$0 0PP`W0 00@P $ 0R00SQR+X` P  0P 0E0  VP`P  [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pd z ᪗P 0S   00S S0S S ^ S@@T000S00Ni0\#00& ^@ [ @@ S@ U@0@ @h0 y0M0B8\ `p@-@PP` U 00F G p 00p0 60 QUd0d d70 G0 0@p@0TS<00   -M0 3/Ѝ/0@-@PP M) U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0@0@ @0 (0( (0 p L 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H 0 ๤, ,0, 0 ௤ X p@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0 , ,0, 0 x 0| p@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0$ K, ,0, 0$ A ` 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D00 0 000 ,00  l 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0@ ɣ0 000 ,0@ ࿣ t& %0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0P 0 000 ,0P } F E0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0\ E0 000 Y0\ ; xe 0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0l 0 000 a0l  0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H i0| â, ,0, (0| ๢  0@-PP@ M T 00~P00 Ѝ0L L0L H0 T0 000 q0 l, 0@-PP@ M T 00P00 Ѝ0L L0L H0 hT0 000 ,0 ]< t H0@-@PP M. U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ0H H0H D0 !0 000 ,0  <X p00@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0 ߡ0 000 0 ա P  h(A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 8 808 #0 }H ̡ 0 *  A-PPp@`M4 W= T& {P R P P P @ЍPX  00@R X# ЍAs 0 & 08 0  0.W 0  0# V P` I0@SP} @@| |  T  ^(  ` _ pp@-@PP U  ;p@zL L0L H0 U0 000 ,0 ڠ0 h   < A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0 0  0Xl l0l h 0WP P0P  0| D D  X   0A-@PMP` 0L U@ 0pS S  pP R`V V V ЍW  s0SP 00Ѝ W`" ]0SPV 0 0 l l0l /0  A Pp 00 4 L  Lp@-@PP U p@T }P P0P L0 U4 404 0 ֟(# X? ,0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0C/U0 000 0C/ L W 0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0G/<U0 000 0G/1 {` p@-@PP U p@QX X0X 0K/U8 808 40K/ p@9 l,ȿ p@-@PP U p@zX X0X T0N/U< <0< 80N/p@bP $ xdp@-@PP U p@X X0X 0R/ÞU8 808 40R/⸞p@꨾ | p@-@PP U p@'X X0X T0V/U< <0< 80V/⏞p@ |<ؽ ,@-M@P0.S00Ѝ:@-M@kp  B0?R0S Ѝ(0( (0 Z0CЍld 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 /C H0 00/C 4p/0/ 40/0/O- M0 R Pē0 Pm \ Xh@.000\a @\f  X\@PAR0SI <  cSB!  S   XH`#SpP@@P   pGW`W0P@W `0FS@0 R R S*   Q @CT00S<"<2< 0 2T S .(00@ ЍAS0S010! 0 X@P \P!S" Cr <"+  X 0@Q 0;S@S \S ! C]R X8!#!! Cr  @ D"!!1Cs0#"1 D0DX0@FSP0S pg' 0`a0l pg'!"p0`T0_껞000S*. 0 f|  8QL<O-@lğp$M W0P Dd`XV @ppW \W* .W 0E0CH XF0 R S.R? pWP 0E0C 5 X3S0 X ń- PEU*0S0P(pW [W$ <P @Qq 1P @Qp &P @pW9(00$Ѝ] PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00 !  0]R' @R " XWQQ   Y I b"r RyA  PRA .R pW@Ne@؝@՝00Q    Y  " ^  @WX  P0R XW(@Qp59:fX0  0…1^S X ńY PEUV0SPUWX> L  0G-TA Q@K*`0S$ RB @RpP00/ 0Y90  ܠ 000 P00`S`00@NT00X0Sx x0x t0G/:AS 0SPQP!00P0Y-(0@0d:   @XRO-P3P#RP3 M0U 0p`\ @W @RH R R4 (00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ 0 0K/͚  Y*@T*0Pś 0A\ R!ɑ" 40S04 0L - M} ЍO-pSP$M Y p 0 pS 0S0^@w @^` \rS0  H Y B `@p p@TW @0S @S] pZM `TP @`T00 S Sn*p 0A>Sc B P_^p0Q ^ QC 8(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00 (00@$ЍAT{0S"@@A@pZ @0Ġ?  0^q0A>Sp0pSߛ000^ 0AA^ AN[ ^( SQ0SP9 Zp? 0.$ @C /Q R 0 0R/⢙ꝛ00@G0?Q0S 0 0R/⇙~ Vs*p+Y P HP @ @0@ <-0r<꠫ XJ4 j x4p@- M P0 `004p @ !p < 40 0 1 30ލp@A2 1 A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލAL1 0 Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?R00C赚(00/C/A-@P`TP% UVT ᔊP @TP 0?Sp 00胚(00QSp@-`@P hP@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1AP@(00;007?00Q @-A?SSRB 0@S A00(00/-- Mt ЍЍ/@-M@ p TЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@ᗒP-TR +T} Y @p^`00D" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+ꇙꂙ0S \0J0 ЍY@0Tg UGp Pa 0A0C0B QSnUPP!^`C@pa00DQ0 0R0   ЍY @~0T- U% Pp8a00D~0T00XS$@ 00DAAs PQ2Pp>cj p>cP0 ?0 @Pp>c00DX00XS UPpb 0L00XS UpbPPp>c 0=U0@PP.@ p>cP433  00 0M0Ѝ( A-00 rMPPp`, V4 @X0^00pAtA0O `p00TAΌ 00`L PP'0 @t0 0 1 30rߍX0X XF0 V<0< <G0 '?' ' ̠ < 0   M Ѝl&  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/& O-@SM \ YXb 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8 P 8    U 0C  pSQP0 0@pQ 0S  ЍT 0 @00808 8@0  0 0$ A-@`Pp㥋0 {0@㥋$0$ 0 M Ѝ2# Prp@-0 000St@@@pdddPPkY@P@P G0000 0`# p@r4 rp@-P@Ꮧ p@A-@`Pdppp0php  T  6<0   A " 4DAA-pP@`  F (}000@P p@-@PiPpp@O-@b@R`MP % Bp@v r@0p RD 00m~n 1PZ 0S` P U [@0Y P m0@[gP b 0`V P:Z YP4a`0pS PP @T IP 0S 3/0S 0PU@:W 30@@00O Q|00t@@ЍXЍ0@0 0Ȅ ! p0o nln @-@!BM1M 0pPG040@@@ @@V=aP`d ! R !`0@  P0pA@ P< T1 0N>?#c!!"N .  "bQp.5:bQ\. 1h.#c!!2N 0  ]0@ S 0!Yw0`0S00p S `l0 @ pE``0 S00C  B2=Q/0A!b0dP  @YG0`0S00@ S 0   B2<Q/0A!b0dP  @Y'0`0S00 S$0 p@`; Q00dP  @hY0`0S00 S0 p@`\; Q00dP  @?Y0`0S00 Sa/0 b !P :Q00dP  @ Y0`0S00 SB: Q00dP  @Y0`0S00 Y*  0 p@n``p0 @`~9 Q0 0dP  @Yo0`0S00h SPQ / b !P  @)0 dP0  @YO0`0S00H S(Q0 0 dP  @Y60`0S00/ S Q |((0 dP0  @Y0`0S00 SU*P#U&P(Q0 0 dP  @`Y0`0S00 S7 Q00dP  @HY0`0S00 Sj0 <008@0 0@D00dPH00L0080 0X0!' Y0 `0S00 SD 0@E0@ S0 Ř Y0`0S00 S-Y@0L& `0S00 S00`&@1?2c 1 R11Aãd0Sâ/c1S0c05dP 0Yh0`0S00a S 08  @8  p480 S0R`05I0dP0 5 0@Y=0`0S006 S0 p@ `'0dPS004 0@~Y0`0S00 SY@ 0,$ `0S00 S0 p@` 0@S 8 @ ?qp  qp 0 @Rh 0<S-Q S b 3Q" "2<0 0"b@ Y V YH ` R  dP Y0`0S00 Y"`0 p@j`0@S 1Y} I` R  t S`pUP 0@Sh P 0P  Y   R ` R  wPP0`p @`E0@ Sf 1h Y<0`0S005 Y0@SV 1 Y)0`0S00" Yl L   lP)\(\ ףm8 $$  * ؅ P  0аH`~ n0$ $IQHy T 8  0@ XP(\  cd00Zl  t  0$ (P, VRO gR 0` p `0L, ?A1c$ (P0?"dN2c 1 11N @0?2cQ  111@/ d0 S  á/c1S0c01dP 0Y0`0S00 S 01Q00dP Yp0`0S00i S( ` `o 0P 5 dPC-MP@`np<0@000 08 @pT `p[pFЍU"00Ѝ@-$$@M Ѝ O- M`p@P뀠P 0 X0X 0 0p0 @ Ѝ@ ЍL O- M`p@Pf|P 0 T000p 0~@^ Ѝ@ Ѝ @-0N~ \0N~@ T \ԍT00\ˍ00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q BW@122e3cPBy:E.€Q_uk9"mnףp= ףl Sc$IųQ\(\8h g Q(\)\g  c 080 (: 600+$0+>! 0(a`  o`!!!0C0Xÿ0+" ?00 #2>`T[ c 0 (: 600+$0+>! 0!Â!!!0C0(AX Oÿ@1+" ?00 #2>[?W'`FPGp1#1 :#0! a,V"! / 25:$" 0"4#2><"Q0 3 #L201d0U\`25? B4sppp0/S[0 is c 0㠄"(: 600+$0+.2(a1110BX2 o;#0(``T[`o@t c 0x0#$: 600*$0*.P3$1110B@Tl3 I:#$B0Nt3`0 `cR`@ V0#T Ba!kYC(1 ? c 00<0$$(: 600)$0!)>P$ 0Â!!!0C0p$Xxß)" ?00 #2>r/E B 2?A1c1c0R@ 0B 05P!@ 502c(%2c2A@" "b1C S/  0@ p0\X%X:#包  00u!ό#1 W?0}:5$  *4Ϡ! 5*111A T 1#0 0! C2 ! 02">"@T0@000|&  0@00U``PE0S0@P P$ 0Ѝ& t)1?c 0 0ゃ0 '):60 0($0,'(>!!!0CD'0YL("1 #2>L<0`0@<' 0 @<0`0@ΉT 0 O-`@PM 0S*  U 0%? [P5>psŸ !" 0<0  0 S 0 P00_00<0 S" 01P0 U 0< UPp1 !"3p ~0U 0  R!yh&0P l6m&N0!/Z0S XϠl a^ZQ `S{ʟ  VP@@%y .X )  W.y 5:IP % ^, Ό3# qdO0 QS@@yWEVPP `@E`E`ȟ(ȟШ K,(aoZ.h 11:hh@h$ ^, pΌ3# d S 0 @W `P(H@ 1S\` VPE 0'!:60 0 $0Ϡ! ' >0!!!0C 0Q d?##. 0Ϡ 0,όក(~C1  ቂᢍ  ǟ 0 Q0 pƟ ' ^, Όp3p#p q\ ` V PE   Uʬ&0 0cPS;Q$0(080` Pp@`PL40#XTu YW W0d#Qp? 00?0S 8@<W 80<8p< 0 5/PS `0Z\ Q@X Q<T Q8P Q4L Q0 p0`S P Q% Q!S, Rfl0Sc pW 0 S J1F P,Pex`0S  BrIՆ00Ѝ#XTxt[ @<8@8 <0RxSR SR W@ 0wYW? pW<8ph` 0W#@ 0_ER$(0<;0Q$00(0;0050S<  80< $0(80 cQ< 00 4$ #3@`TFJ#M @A 0S2 0N080+ 0%+P;0P0姮`Eo Z*Z:Z$4Z4*Z\4$*Z#Z1 "*Z$!ZZ$ ! *ZZ *Z Z$Č*ZZ *ZJZ$Z`*Z *Z$ Z*Z D*Z$ JZ 1\RI}QG*1YE @ $"@ $"  ` @,@T7^F 0FA0  9 0PS-`Y00æ0@T x)`9 F0 0 30EFۍߍ0/S ;0BQ 0R/S  7P H@J00b݃0@TT PS PRQ  3 `4p@OD$00U< 0\ 4 Q"<$1^p* ⁑YN R`!X0@$004 \͌Tv Q0\ \0$0\4 \$!?8:Z Sc0I08*S R^ R^P 8ZCPQ L|p@W P 0NE+C;E?.h @a0X`@@X d~P0X0 @0PW a0兡`P~P  p<~P0/SV0/SSP(0/Su JF̋h R Q R RRRpRRQ BN  h$0N$0 ph   Q$( (P ` PJh@,00(0S- 0\ 4 Q"<$1pYPV QZ$`P @ P0\ \04 \$0\$!? JZ (P,00 $ P F̋S n"1 R 0oS0" !0S  0G0B 02" 0SIL01 R p 0Sj !0Sp R`@2dl01S oPW@0W.0 S -<=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``U0SZ0@?`cX0SP⅑QPYP }SCPPA@QM0`0 RW@ 0# C !pۀ@pP  /B 00Nhˀ 0 0P0W @0|Y TBM(<02$ ' @ 0| (L hhNO-0|M<SP 0@S >S 0S >S`@0FS@|ЍS*S0S -S0 C R0`@0FSHpP Z 0S10ƒ 0 "hh0Y [ OX10\1 001[ <[!0S0S >S@p0H 0 b9N h&lpt h(*[[ -[00K S@JQ@Q,Q ;Q^HNL d ;Q,Qc QvH^(- P m6Ship@019mo\@ pKpPhiRp@L)apkghtlwN   @h@@  @ P 1 0 0U1  0EP00 P ,R d0(0P R0HL ahlpgtl&w&$` ,`ട$ p"$ bQ.:bQ # 3!d "b"ba/ ppcWY0[Q 0`K @L tP  Q3K p`,#0 胟 p,`bP # 3!d "b"b#/ cP`cs \pP 0\ 4L#+"@bP*<#8# !c  p R ,`0 ՙ 0p4`<@ p`@D,8@Z"28#!BcRf:"cR0#03D 1d "b"b#ZTV 0@S 0*dŸ Ytc, Q  \Gce Q!Q*S ?0101c0 p/ 00c@S`(0X$ 3$ (. ! 00!Z Z Y,0p4`8<@@ f. g,0p4`8<@p HQ B°!0p`, HlA )\(\ ף{P@ 3PL? A-pQ@X 0Sd! N,00 01h6l6h`P0`P 0:S  `P `VpFPU N hi0PPT`VNLg@_ `S T 0:S*S+0Cs013ZS@Sa0CS`P < @-88@@ P@ : Xch}0 00P/ p,0, 000S  / pl P/ l P/@-@@ @@dl @-\F ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2ZP2SU PU Ѝ\00P2S `@T 0400P2Sh\8,xH| A-`0P0Q0\\ MS@P1 V9 T@p`0 80xq|q8O=T@D @@`@p8P1TA`NPPE0@ 0 0 1 30ލp0p pP0 vVT0T TQ0 uwT 0 됥  c c>\ c-(0( 00M 00Ѝ  --8M$ 00  0 0 0wЍЍ/ᰣ 0--M0 iЍЍ/p@-0 0@PXyk`00CS`0p S u P `X0 X PXpkpX[`u< \0\ 0 `00CS`0ppSr P X0X /X<ꤢ --00 M (0 X ЍЍ/( --4 M0( 0 XЍ Ѝ/ܡ G-@SpP^ 0S:X( (S Y" WH k0` V V,* /v0p0J00PQ`wT 0 @00 `pp`0P/0`Vp C000 j v0 0SJ 0 00j0 Q0 t0 =0 tIyqPX0X X0 t0 0Cj Ifq*4 x_ T_H_ _--M  aЍ Ѝ/ -- M0 0q ЍЍ/@-aPP`@M8  K/pP& l@P#  <0P S 0p@ 0$  0, 0 (0 0 Ѝ6{v0000@Ѝ 0kЍ808 8>0 `t 0] ]@-@P j 0#C@"j0 ;0 ?tP D]R\@-p@-@QPJ 00!R ! 00! \ uP 0B RQ`' Q0AP R 0 U00SpgP#gP `gP0 \0\ \0 Ws 00B808 8<0 su 00D\\ \( [A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!pP  w0S< 0[1!pqP  w0S p w0SB 0[1!pS w0S, 0[1!pD[O[Mw0S 0[1!p3 P>   w0S pT 0[1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% [1 0!p0 *R# 0B Q@ 00B SP i  w0S  qp q  w0S `p  ;  w0SV 0[1!pw0S Cp  0[1!pwX0S 0[1!pw0S 0[1!p}wM0S 0[1!ppw0S  pw/0S 0[1!pWw0S 0[1!pJ pu pn pgs R  0p 0Z  [@ 1, pJ pC  w0S p6  0[1!p  w0S 0[1!p I w0S p J w0S 0[1!p npD gpp T 7 [p$ Tp MpI Fp)_ w0S 0[1!p] w0S 0[1!p , wt0S p 0[1!pnE w0S p$R_0@' p7 w10S py  0[1!p?w0Sj 0[1!p2w0S pXw[0S pL@ w>0S p?  0[1!p  w 0S p*  0[1!p p P ^ pC {p tpD mp P = 0B Q^@ 0B 0B P$R8 w" R 0Kp0 [1@ P  P  P  P  P  P  P  P q0 S p  0[1@!r P $R@00 P  P  P } Pz x Pu s Pp n Pk i Pf d Pa _ P\ Z PW U PR P PM K PH F PC A P> < P9 7 P4 z2 P/ u-   P( n& P# i!w0S p  0[1!p P Q  P L P G P B P =O-@ϟM M0Pƍ0TH P@ H0S 0T00!R !00=0h00 Q 0SN   RT p H 0  0 L (/찍 4 K/@(嘰d 00080l0`0$00@T& `%T @T0PFU$0pJ!(0PQPw00$pT  0 @P `~0-1,0`4 0EZS00 P*bP   R00s H0S P`p>+h1RRhONh>TQ.`Cnˠ0MPQPDH T,TdD@|8HLI`P$`aP`$`0@ 0@004p00EPqp00E S$UF ,pS2 U zUP 7`0P00(00{0$080S 8P0匠0@0S$00$00ZZ B,< 0 6 30n$܍ЍUX +;   0m>U`X QP @n~@\X<D-$0\, Q00S@00儰0AXP\ 0,0\K0~@DT#L^0`P0Q ,pAW%S@0$000(000@T0St _paU` P X0 D -1 00 S0 00 SP0100 P000p0 `P 0BL00?V0X r -!S 80S 0P80 0p0S-0~00s<0 P00(S0  Y0P 00M(0S0  pY0P 00<~0S{ 0~Q00t YY0P&( - t QS t IY0P(  t T800NS `U~&o`0 @P0\@X@<@D0S<0SP 0PS@@Z(x_`P(pP@FJZ   0RP0 S Y0P00JZ0  0\0 = 0  SP00 P0Ϡ 0S-0q~0 0@S࠳   @r R  00P1s 0P0\X\ ̎@X  D@@h  %LQ0#"002(c`38 TD0P 00 S  P000 P000p 0 T0P 00 i0-10l0XDpdP0pPE-S 1,0P`-p x0D RPPS 00C? 0@4S(0?0<0@8`\0X0/GP000 P0ot@dTR堀P(PpH@DT$   0RP0 S  8T0P00 0S  (T0P 00 ,0\@0l@^d? PPb T0p@4  $0@00P0PP00,P 0p0P P0 00~RP0 !0倀P000 0P P0P00P0hEP0 00~RP0 S0  S0P 00(0f$4 0 \a00CL0/ 00(;?@P@P00ppP00P0 R ~P0!P0 R ~P0P0 R~pP0@TP0PP0bJl(l8l 8 0v`+P0PpP0P0 R~pP0@A  S(@0(8  0R` B0?V0L @ SP00P0$00 00H 0p 0SP0 , P0P0 R~P0@ #P0 R~pP0@P0 R~ ϠP0qP0 R~P0@#P00ppP00W @P0 R~pP0@P0PpP0kgP0 R~ ϠP0Bc8 FP0PϠP0 @X< R0P( @ < P 0@000S0 P0pO0\0X0P`00E SOpqp00A S$Q0#S/ 1 0P`5 J SP00P0$00 0a 0 0$ 0H 0`p;S0P0`1 ` 000 P0 0H 0Ip% 0SP0  P0 0pxpꖑ@-@`P MDpU@0p0 00t0@U ЍI A-@P`pU0 ^0@UO--@/ pj0@30P     O{(j2):0!**R7 0P000$0110@00S@(@P  p0 0[0S0SS I00S Y Y R R0P0 4[4 0090 0pG04a^ pn0G040S  @(@9U Z$01P00P0 0009 0 00400A-@P`nZUTp 0S*P @_Zp@@XZp$S QZT@pMZ@:L #*460/Q /*460/P@-@00 R@P@Rp@-P`0@0R@*0Pp@ R 0 R Vp@ 0@!%O-0@ MSX@DPa`101 0TYq`":0 6  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-0UM 0,@P.0L10Xk{ k{ d 0 L      WYGY* Hԑ@-@-@-p@-`P@ TP P0F R b@P  HX00pP P(0( (?0 2WP|pp@-@P R`>PP  $Xp0 :0 W-M Ѝp@-@ P` !LN;T !@Ap- M ЍP/D -0")2b3c1@2`M1 ЍC0@-@PPM {  0{ Pp`Ѝ0(0( (;0 V  @ p@-0@Q r P p0 S P1 ph PP   ! W @0O-`MpD,@0D0QP0+5X! @0S Sj @ 0 1 bP  P T@@  0  WT`p ЍW Qz@0 Q AX0P @0   P 0`00QB@`VRTQ`p0 0"!` b  V0 XT@P@0Q=W 0000! @TQ- 0P0@20d  000W" 0 @000 @M 0Se0T0 2aPPlv"! 0#000 @ 0 l`@Pr 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   0VV X@@pp0 `f360@p1W@:b 8 PPO- -4M@0  P0l0x0 0&P t0p-P 000P0 0 00@ S040x ` 0@t`00@ SVV!Ђ0 @ 0SЍ 0S0 EP 0l0 00S $`,(@S] ?o280$0Q0$0吊g{V VGڐ*5 f01k5UV(0 S (0SH( %0fSt(0| FY 0 S (%Y 1  @ pwPxK |0p0LY|0 9 |0pP0|0 A R< Q0 uCY x YpOyk0p000400 S|  <00S00<00 00 $003 (0,@S A,8$PQ۟䫟˟滟P?@0 0HPL0X@H@A 0P0  L ! cUx05 P x   !WUp@|2 0PDp0 W,0@0$ 0 @p`C0D,p@`@Q0C @D@`@T00S0S@D`FpG,0SDQN(0SVW 0P0 5 `P 0S0S @  @ PpPppW/ 80  R P" ZO<00 S0l0 $@x T0 @DTQ [ Z0MNpT0 0p$ 0#[00S|0D0I hd @PY dQqsWx  ! x PxH 0Sg p UbD0p |0Z0 0C?o20S )K{8Ik{^Zɋc 0S     &?@V瞯<?! x4?N00XS ptp0P P0 0<x Qt000Sl00l0R  x lЍ ,$t0t00+S -S( 0C ^0Stt00S 1C\@Z $ R3iS+ $IS( NS,dt`? P% 0l00 00t00(S7 000x P PB \ ,$ EQ0 0,0x tl0)2S "4{LL*"* /B B*  *0CS'ʐ: # 0:II0H   {0  0tV0r0St00S n1CQ 0ESJ 0 Bt@qH  i  d3Y01{ @ )2S#{弣*"* /B B*  *0CS'ʐ:# 0:II0H 7 {0 ; PK [000t0PP p.000(00t00@ `t00C ^^t,t00C ^^0 ,S0,0 V`∀V!Ђ PP`VV! 0Ct00C [ft00N0C [L\Zڸ@(Q@a@nS  x Px p0 0p0ks& 6@08  ,  B1kl00{0 G GjPw|0 00*$&%&*&! IH I `yP  PZ1 0IPT0 uPxG  B\ 0S> p $0 0R0p 0 0P01  P-  q` 0P0t"@ 0P0kxR Px <0| 0C B<0|  x=0P 0ꨋ{ ZNj Z{相80吪SI8" 80S0T00T0␪相T000cT0Pya @P B\\<00 Sp  Bp 0{k{I{7{l0T$P0X@l0 0S |0 0WUSHQO |0R! 00SB S< SR xA0x00 l0000 "aQ!*Q00  0c230 0x S 40S/l0Q000l0y @0l0R"00r @Bx Pxi |0p0C|0EX A??NH0 00 l0x0 R"000 000S0 EP Ru 9!0(l0 0IpT00(0<0080q\ pWW000 0tx0Pl 0x S 0t0,0a$`8(0@0|x<0| 0 <0|  U $PX@ppEW. xr! Px |00C|0$Z{相80吪SI8 80pS 0T0 {Nj0l0 0@,0AS$`( `300c8040 080H 0l000 P6 $@T p@DP-$PX@x <0pP0C|0{Pxt`P t0$0Ct0Pt0 0t00000x l0} !\ \ \ \Q&tp`0C0,0㈀ 0ES0$0,q0x000 0P 0l Q"0x 0J<^@0HPT0 0H PpT0P `t 0 `, $ P:S4( 0P:|6|0 0`$%0 85S(0Á!{'l 0 H P 0 `$,`$Y 508  f{({' A1kl00{'0 _$PX@0 B0T0 08pT0{|0 050`R!00$PX@l00P00l00,Z$PX@h 0S~ xp0   ~\0v !00 00C lp |0Z$PX@^!0[l0 00 p<0SpW`P| P pAk 0 00lx j0S0S 0$PX@x 00000|0P0l0*$&%&*4<(! IH I9[! 7 0l  # U  RIx t Z[ 0l0k $PX@ 3 S 0l00_ Px  pp1JpgpPp00p0!0l0I<00 lS |00CxpP|0b!0l0x0 R70S4004010l0|00CxpP|0Pxl0,0 @-00HG-` 0Q`@PH PpPa0s z #8 *8"80 V# F0V B 3E  ^ pG0s#8)80ᴐ^#Y 0U 0 Q 0PP   ! N @P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   3)N0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ{;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:i( O-M<0p sHJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0SnP [ ?HU 0  UE\ PN Q UP   U 0CC10B/P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0N"00IZP0D^0[ @S0 QL 0S@00S P3 4^E *@C #`P `D21 2 Q\` S00 00S@0T@DUQV`Db  218 PE 7 @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E EP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq ^MP@"00ЍSn Sh S4 `Pb@00@0 00V@ !KT 0 PeS5 0 0@0saF PeP\  0 S S FM@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@H0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S 0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P   /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPV 0 BP @` pT  0 BPp0U`98@-- M` p@KU0  B00C2S*ސ* Q6cZKE A Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ uJ0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/ጴlHA-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q @ЍA-(a(1`pP0MS3 U10AT !0S 000  @T  0S0 00Ѝ  @00D1S@000IJ0S 000廲 pD 0p@-@P0p R pPQ`00App@*D `ᜲ80 0QApp@萲 pDP0  +0#10/sQ#8sQ#4  00/sQ #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P$pP   ! GIl`hP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  H  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1x @P4 P1 p@T `P@T10SfP@$ 000S 0N0I@T 0C  pP@h06iV0S <0+ ,0R0i d @pqDjG-`0b@TP塢ڃ0TP$ Zp  G p0   a!  \2)R0L`0C\0030 `.pG \ `$-0P!1^$23\ *G-0@`@DTP  !1QF*32\ H*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@ H 00P0S 3 # Q0 A B  02NS cP 0!0P` A-P@Q`pE: 0` P0T @ *\ l10E T56 501 P56 +C0T `6<#511<?@--` M@P@P : #z:S W 0  C.G B 50c 0 Ѝ v0P c2# RW C>C0C01` Ѝ0S0/0 R /@-`ap`@PMA H1P4PP2 pP,0S  Q5 p 0: S.>P 0uPP0@ 0$  0,  0( 0 0ЍG00Ѝ\PT0T TE0 EG00GO00T 0\d̤p@-@P \;00CS00 PZ;pP0 =0 sE `(d @-@P 00CS00 @ 0  I0 VEc_p@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SG 0 p` 0 >0 Edcbp@-@P8 0S> : P00P! !' 0S 3/PP೼000P @ P G00 00`@00aa:d0`` 0p2)8P404 480 DF 0P04]ta@-@P 00!R !+P 0C 0 ;0 D\`@-@P 0 0 S @70 ;0 |DD\`ؠp@-Q@PPR 100S4 0 XV 5000S: 0#$0 3/0P:s007p00P @ P 00< R 800pM<0PᖮMJᑮ7P00s08l l0l J0 D  0@000 pF 0 @00P p _ZD-Ѝ/@-^@S S S  `0@  D0@ eE 0  0@ 6@00 00 0000/<P@- 0At @E41S O- P`c`EM  A 4/p17/9? !0(l (|  p;o7@p:/ `;o$ 7:/(p,$`;o0(, 7:/4p80`;o<48 7:/<`@D L;HL@̀FGpE`JK t (`DI | HpŐp$ ǰĐp@`Xư`0`pA/`pd APpMOĀmX@Q 0pkPSQ 0pkPHQ 0pvkP> Q 0plkP4Q 0pbkP*Q 0pXkP Q 0pNkP@Q 0pCkP YEߍDOD,Eߍ/ᴝaQ@-P @41S  P  P0DA-4!@ pPP/1S 0L1 @P!PPPUQPMoP PQp EW Dp_oRDp|Dpp@-@P 0@ۮ@A-@`㛭P] VapPᎭPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V D0@BC@SSO-P M1 Sw$aVp$(q SSp A`TO X`A ( Pʀ ರ[ `(q^ 0P@  Ѝ Co$B/0S (xp Ჰ[ Q @pT`xP0TC G(VK ( 1$! AT$$(0 [ `(0 A^& S :0  @PyC@@,A \$R(!r8 V(, T001000 ^A([$<((~ Q ذ0 0 DA $A !`($aW夰0 3A0(S 0 WqP_ D0^0x$U,TS(jjSO-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 oPPu2  $`oP$`  0 `P% 0@SP㲀0C  P\ \1 \"  gP  0 jP@0`00,Ѝ 0 jP0 0 †Ằ[ PಐU I  ogP(A0DS V(Qp  0poP 0 @-@ ! \ @$2B,,B00,1S@-@0@ B00,1R@-@1  @0 B,B ,!O-`ᰙ0S ]M= pPw'@P Uq  @| AP 0 hp3 < pɟ00 8p4  D~@@ z@ PXP V P0pS40X W!3^ TH ^^@47<P3h uD H 0$ shP 02 KA<,0(@ H QPV\^ aP  0p pt 0} V( 0S% A/ 1++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^Բ  9/@P OP៪3@P]ߍ|Ÿ 0( P p1DN90  !NVq Q+U0 aPP$4Q$Pc @Aq!弡Q0 0 ` 0! `]ߍ? ?Qt? R2 < p 800p4  Dx>@ t>? Z ڮ??@Pq?Pn?P?Pd0a?p?p]` Ta`DO-(P`P10p5fS@(Pp5 Rؑ夨P- (4 ,0[ D D S 1"1 Ohꂡ hP ر !% J= ᮩؑ@-@ 13/, (Q0@-@Q .00 2? 0 O-fMS` $ [pW 00PЍ p 6 &0P 0@P 0Q10$12PP. 5@X0 20S00500500|50 0t50 0l500d500\5000 S S >00P p [ 20 2  00p 0 0gWp W|3Wx# 2[ 00 20120qSG  000 1S 0 9 G9 @Rr*X w?w?Á Ñ 0 -P0 "  x-P 1S0S1S -0 29 20 29 20S 28 2CPU00S #P+C PwP   R < "4 " 8 p0< S0'4$<'<(0.4<.,,4<(, 4( 80<0480 < 0480<$0 4,8 0 <+$,(0 4+,80 < ,0P0SM p "0!0 ' &@P8 Vi V1 Ve (0aV@ 'TA  v&@P 10CS`*0Fs @崒 0S 0S 0A@T @崒(0QaVU @b,  1& E&@P 0VSa V0F &@ & & @ ⴒ[ @Iy洒 U(01ḑ0CS㣠y'*z0YV+ ` &V &@P 긑0(0 @崒 /`FvVv @: 0 b4 @2"b0 4 @崒, 1g& %@P 1ᴐV0CSy`!*v0Ya V0F1ᴐቐ  10@! C& %@P] ` ` ?1!b0 |40Cs 0 0 0Fs+0!10@崐 & %@P0 10CS`:t0t tb0 O4\0\ \b0 F4'xgg&4f%Dfb!ba a`@ `` `p@-@`PP 0 00(0`00Q(0pO-,@(ƟP LMQDp` %00 2^V  600%5 0 D0 30cLЍ0w R*R* ^p 0$00 <000S0 P8080 0Vk 1S6 $P䑄/  0尡0 0!00 BR{?ⰰ0弰:1S 0[S P 0 ᰰ0000S !L% n P 0崐V` S0! 1 BR,*0  P 20 2r(k i0w Qx $`P_ 0 p %R0CS㣰*{0Y* C00C 1! 0Cs0 ! 11 0  0(0  0RK 1S RQ  RYF  $ 20 2JZ㪠o*zJ [i PcM0V㰐0`0 2 i Sf $ ap 0,00 4000S0(p0000(01 S0"1!{/010CSP *u00C S {?尐!0 b0 2a0y漐ᰐ0`0400\0\ \b0 2D0D Db0 2/ t hZxZZ ZY`YO-(0pM I @aP0`f0PP P FPD1uP0y1JZqa@0 R 0 1Q@@10CS㣰N* 0Ks0S0Cs00 VqS10C1(0  0R/ Ѝ@ Q! R b0 `(0p+ 0  PS  p 0 0 p1 S0C1ȁ,3,#,b0 1T> Y3 0I 1pP(00(0U QPEUP*0EY*0 p1Pu YQEQPEUP*uP0EY Vp崑 (00(0B10CS0I*S ```@0 `p崑P Q "PP @ PArP^(00 (0C#0!0!0 "PPm 1P0CS㣠=*0J 1RP(00  $#0 b0 h10 1p:P(00(00 0b S1u00C SpQPEUP:x0x xb0 B1u`0` `b0 91 "k|WW" R `P  0! 0 P%" "(0( (b0 c0R(R(Q8QO-Pp@Q$M "00 2T T I200$Ѝ(  @h 007嘷嘧0 0  `P]  R [t@Y* P 0PeA 2@D @dT㴐: 0 bt@0Y:Aᴐ@DT@* 0t@ @DOoS0CB0  0jp= 0S0C@0  P 10CS0P*s0SUP@  pP 10CS0*s0SG 1 :1@0CS0*s0S#P e!k `!fTy*t@T~P\ 20 2$Ѝ050%0b0 /T A!5%b0 / 4!T` ,!0 0L P+  0SH @`tl S: `V  !q, W@ t@@DXL  q Ws 0G 1g P AᴀW@DT@:b0 1/3#b0 (/   D pPRPp 838#80b /03#b0 /8@W1 @t@ @01p 1 0@1@p01   P@ Iy0  P 0 o@T ({ T"000{` m  Pm ,` 0R X Y qV@D R q0V" @0G 1PL WR  B1r T 崠0@D1 %!0I@Dst0p崠1 加1 0p # P$ 10CS㣐:0 b0 ].  }P |P`PMl MM0 M,M ,M 0X0 0UXS 00; Iw0. T:+[) P0K/S  0帴0P00: S /000S0I S/?00(1(!(X0 -QP PV# 4- :p!/0SY  \0 RK Y cPz/00W qp xpP h/@om G@ $FR Q0P:Q0Q:P.@-@-@@& $ @ @0 p@-@8P5#)P/$ p@%/ 0@-@T M 000 @P 0S  Ѝ@/ 0O-TM Pp`0H0 @D8  $(4PD 0,0`< @@pLp PP  좟쒟肟 `p  @$ "dXb`%0#  `!,l(a `& `zcna'b(*abf` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah猈b,)` &`dL(bdl+`|.plXp`<%cjgpl& ```ga*aldH(d` &b()`b`j+g .pl\c:%pWpl̠o 0 lo 8343A-@P` Aq08q0P00P 0p0S   L| PS00  000 0 S$1  @p  P 00  xP 0 0 0ZO-رK[@pu*{0 80 Pa{`FP 0` 0 VH*vP P  C{沱ᶱ PaP`F ` VB*vP P00 000 0 OVv`:*V 0 rPP:Vv` *V 0 0sPP:1 0 b 0' 0 0b '1 0 b 0'h h0h b 0'L0L LL0 'p(/D0@ P(0$  p@T X6*1#0Cs0 11 " r S 0K 0F 0@SD@ a,^p  l8 00`8,000F 1yPR `V 0`0 v`0CcS00 p㰑1 0CS*0S 00p"@ `V@ 00 0 00CS00 1!R p0p  0  00 0VS00 IY㩐*y扐1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 0#S1 0Cs01 1   00000 0@00DpS, 0S 2  0 t  g ca0S @ R3@p00 ,w 0 S@Dp  E A =\Ѝ3@S00 01040封HX㨀*004 1xpC0wp0qqᰁpHX㨀*0x03@S00 01040封H⨀Xx*X 0 0 sP:400 H x0 岁ᴁqpGpWwp*W 0 0 sP:0 0]  IY㩐`*y0V* C``F  001`01lpL   @  e`V@Dp  0 00Q00 0 P 0 0 0각HX㨀p*x戀1040F각HX㨀[*x戀1040`!1 b 0# 2  03 d?W@ Z 0 0t!t1t b 0#+X!X1X b 0#7  ;1!b0 !0@K{0' 1 0p1p@01 P01 @Dt@ @U0PE10Z!0s00 !<<L,t,<R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/D @-@P L  0 0@ (" 0"O-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ4D 0G-1?p@P` @g(XS ! 0@0 0$0@`F0($0`Gp& ?V:@F?@( 0@  @T 0 , 0< 0$00T$0?`@p?V @?V@F?@ 0$ <@@ T 0$ ?@@@?`V (X! 0$ a0 0$ A-@PP! $ap:?`V7 ) `0(0 0`0$0d0W 03?R0Ah   08R(@R )@ b (`8  )8 b (`R @-I/ @-@-@P P Ό 0 0@ ( 0"R @-"/ @-p@-@P X00m]\`  0 Pr 0$$p(O-$6LM0^_~?800@( ,0  0 ( 48pH`D  ,$4`400刀` 0  _pA 0PW:: w` 57's0_UPP6048 W00S  0 \' YPPU PEWY0– 2\8 Q(( Q 8PS 0 SR7@T 00$0S  00@8Q 4Y  [` TpJ 0S8 0 5 ,P 0到SqT2 c/00< SG 0 SR@T 00$0S ,0S !$0(0S (0@Tp 9 0到S c/ dh R   P 0 SRPU c00$0S  ?00 0 SR@T O00$ R 00"00#3 0 2 30ߍc/ d' p 8Qc 0 SR@T "00$0S  i00@Jc/d@0h@ +rX *㈀2 `0 R(S Uᅀ00*PFY`l2 08`0p4p墀Trp/ᝀp/0 S ((Wࠓࠃ\^` `0\ᆀ\440 0 8 \R8 \P0` @ eP 0 SR@TF h00A@ @ h3`}(0PP ` 8@P@@ ` W x@  0 SR @T m00$0S  @ G % \ H  A-P`pX@M@`@u}00 0,00(000a0@f}Ѝ @- A0@ @ €1$p@-P@Q 0P ! "0 2pp@kp@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R00 B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@-$!$1 0MQ020# 0S0* /!PR*  R @ 1@r0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@6    /O-p?o2P00#R00,MSP KW@  0R0 000$00 0000SU 0SS0哨(g 0 00(S@C0 $P#  7/P 7/P` 0S 0 0P`0`cV0= F B R Q @E"PBPEUP!U Y*0SF* Sc:P 0Ct0 0000S0  RR㢀@(@ 0 P   `7/ 0P 0B  P @V, 7/PX X  00R0X 0 00 @`0#!0 R0 0X   S X 0 0 00  "! R0 0 S*S:  X  QX F ^ @E"PBPEUP!U @  B*7/P  7/Px 0 S 0SN 0#10S0S0壀S0哨( 0 0 X BuPS 0 1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 C  7/P P0P0Sy,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 'P 0 C07/PK 7/PPC7/P 7/P7/Pm  7/P e@S@8 ) 7/Pg  7/PP0 0 0@哢)YP `c⃰Z~* P  Uu@P 7/PmY Y   0 T0 0#0Q0 @0@ @m0 (0( (l0 04ԕ-0 M0 Ѝ4R Q0P:Q0Q:{@-cA- 4PS@M  $3/0dp 2 QP00 cy4P4S  $3/000Ѝ00A- 4dpV:@T@T 0P0 S  00 S  0z@P0`0dp@A A-`M pj@P0: St}zPP ˅P@ P 0 tdЍ100PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 02A x 0@-SN 00AS 0E{O-4 MS|@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0     Ѝ P@ 0  QP300 Hx$R P1)900@000dS0  pq0Vp 0  $6/ Ѝ [00 ЍU00QO000Q 000A/0@-S@  R   0 z0Szp@-@PT @T 0 `pp@T˓P`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//@-P0Sp@M:Q !SV@Ѝ0A 0` P Ff @ЍT 0 @00O-PP X 0S L K 0SH p@ap-[0T B,B R`  0S7*V5* 000&P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D03PQQ    D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:|x0P 00``F0``G  0Y0C00 00oP   0 0C0 `  000YP nd0d dG0 XH0H HH0 00Z 00V}tp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 Z0 f {0p@-PP0 *@`v +p@M 0@0, Pv ]@vp pR0 q R/ S/p@- Q@PP: 100S 0  R 0   p.  0R00  0 0c00 P @P cx0 0 $0s0 ,0, ,<0 p y@-0aPP`p@M) W1 T9 p pP0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0t0t t0 WX0X X0 T<0< <0 x,܄@-"2 R0lM@PP0d00< 0 C 00  h"\2 0 d0 30lЍ 0`0S& pku0PQ " WP00^0pS pp?PP000!1 |0 - 0S!$p@ OPC \10F LL10/R  0 p8{ {7{ 00{ 0SP ` 000p p00` pp| |0|  0 `qPqp \  lw(Ԃ(p@-@0MPt00TauV( u0T1S Ot0T1Su0`u 00UTX!\!R Ѝp@wt\!u00Ѝp@nt00UX\! X\!0 000S/| pp@-0 00PUp@0Lt00TQNuU0` TQUP @tpX1P0X1=u0T0`X1L ph0h 000S/@-@0%t0X10CSX1 @tT1Oyt0@t p0 000S/g4 p0 000S/p@-P@0sU0 \AQ\ X10CSX1 p@s`u0T1OEt0p@s p-X X0 04M 0,008 00 0 ,0 304Ѝ䀲` 8 p@-@QP  p@$ 0 90 t,@w~O-M8@@ 00DA Bs QR cp >` S0T3 W  0p| px 0@`> p PPL1L!L?0 ?0p 0>00D,00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333Pdt00 0M0Ѝ0 0@-PPM @0  OP 8 ,0 0 0 30Ѝ0Z8  D0 S4 0 /@-P q0 S 0,/00@-pqH0 S8 0 / 00@- q0 S 0,/00@-pH0 S8 0  / 00(@-p xp0 S 0, /000@-\(pH0 S8 0 / 00<@-Gh o0 S 0,/00D@-3oH0 S8 0 / 00P@- 0o0 S 0,/00X@- nH0 S8 0 / 00d@- n0 S 0,/00l@-08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000 / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 ]bQRp@-`P@ 0S0 0 0R0  0p 0   0XbR S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00jj00d f4 ,0 0 0 30ЍΨ l - BMMRč `` T @P   P㒅O2  ( D0@- @-xxŸtr M Mp$ȍP|`@M TF 88" ` (R(" @$@ P0 t!1 0 $8 30jލ ЍBn!`0 @p [ ;0 xB^P.`!0 |nL100@A@  ,0 2 P0 \ AL+\ \^  \\\\\1l } ̞CX}  ,Pl^2| ~ܝ]{ 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL000 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@N@N0 00/ -$0$0 0M 0CЍ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/h p@-@p@-0@ ,p)pP `0Pp8$//////u //1O-0pPW`,M 02 00000"00  ( 05/,Ѝ@PM 0S XXX S0 S0S3*0! 00S S( S000S  0S S * RpC 0QW 002 00 0 0 00t0t t0 P0X0X X0 F돃@l<( VܔU///O-̟ M00P0Q0S Y [00x< 0 0 0h<00$00%SSppSJ 0 ,p 0HZS00 X 7  0`P, 0,@0 R000  Q 0S00 [0ʄPU*0S [0Ԅ0ʄ`V* 00CS0C [ ʄ0S*00H00H S @  Y 0\0sR^{- S @# %%:P b`(a B0S`tl!h>0dU00`0d?* 000D@D0P0 `prpo@pl 0  `, P ,@0q *XK 00H S V ! 00H S /L|HP @T R 0P  0CR P0bP 0`BC p-x $0pRPRP` p@ 0  0P00Q0< Z"* 00[ʅ Q 00CS0C0 [ʄ0S* 0F ?   0lX pp|  0000Rp&\{0S P`@0  0P00Q0 Z0504p x< 00Ry @0000d0SP0LS0B 0? T0SPA`B 0 Se  0000 +00ipf0S 00`{] <~ 0+ ) R ǣp @#2>!d00 a< 0c  0R000000S# P    pFP`  @ 00CS0C0S*0S/ Z  04,4, (0u 00CS0C  [ʄ0S*0S[ [0S000SS0S j  0000w 00CS0C8` P @ 0 Z0J0 #2 0 0 30Ѝ     000D0@A0 |3 0   [000z 00 S|*.P C,  B0@~0  0@ s0 0!@ s0pp-\A@0p000i0@s0~!1  0! 0  0*@(   ' !0 0/ p!T0 0 DpXꔢ( UUTN̋H lKu4J\O J@XA-@P@ `t0pP@PU J0S 8/`PEuX@pW$0$ $:0 tPH\ 0SS S  0R @-o/ 0R0@o/O-$$@CM Mp4čP`0@  0 @0 44 30*Cލ Ѝ 0p `0pP gt0t  0p➄L+  [e 0Ve/в =G-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  zP# `VP@ Q@0 R!R  "R0 R R QO- BM 紀ḏxMXčH1 0!p P` X' 0  pPZP@P U[[0 ZPq6PH <0 0 4 30BލЍLD t O-LLAM P MU@čO2 0Y-:0px0(S`4 0t@?s0T!T/ 0 0PU ZZ  0 P @T t   0YPP D0 0 4 30Aލ Ѝ0x0(S  O-M Mtϟ0 p  [ !R & R! ` 0  0 ?8@X@0 50p t  0 H  . R< R30` တuP @R FP p ᰐ:P R!RC1P `XP00S 0 0 0[ Pp@uopp0S 0PS 00 9 S 0S$< d d-  L X- T p P Ra0@0040v?D0\84 0` S1S @ 300S S00X01@ 021帡ZU0H0tSp0<0400SlATi @0CPh D0PPPyf 0;S<@  hP} `@^0PYP , 4 @0 4 D 0 D @0R\80S  H0SQ :<00 p  R  H *P{t`pP|@600P @:/P |+: 0 6 30Oݍ ЍY 4@PD0Py !}D0P0 w  0 ; X0\ D04000SR0X0S@0`S\0c  塽`@V  0p`G0?`50$0 P /0(`,0/ 00 ,   F C|PP1 UC(0 0R0O `1  0 90 X0L80Z   80m080F$0 0 0 SP@0b0!0l刐?A9c! |P g0S c@a0P dȟ00( @ ␁  ,80P80D Q"  (<  0 0P bR`1  0 70TX0 800 00  1 01 080<`0  @{P'  0 Pg`1 q 0 70X0 80_0 M 00 X\6Pa0&0@ 8 XV1a 00 0V$00I@0 ] 0T(0P0 `@vQP  Š20[000Q` ]0 0 v(0 01$000Pv 0 \5@X0 0HP80* 5{P0D u@s0P dğ00d$ @` ⢀0 3 (0d0080cğ00$ @  ⋀0S0(0ʡ@0+S .0CS98P60 @v0@  *@(0Pj#P AQPRm `1S 0    R 0H080{|P8R4`!!! Q0   30 @| X0Q 0H R/ - qW *`\RP|@0p t@7/P `V q0 T2@X0 0`!02 @XUS0 \01S@ 3`0`00S S000`P1; n`0 {P00 `@zP101@PDVhP p0< 00 y<00P{00P 㸠D5꤭ (> <}C{ zyyxwPwhvv vT5xutpLp\p(poponnmnnllPl,lll,lk4kV$0QV@0\!R p Âp QVp "@p O-@4;_M M0(+0 ; 0P050M0VU 0 U01)`,7 05p d!  d!. 0`1q1110VPP  @π0ʏ0z p d10 d1u P% `P IW`0DPS_H Y p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000009fvP ~?080}o 0p+05P 1#S;S 0(S# 0(So 0(S> 0(S 0|(S p8 R00sS1 S S0@(  ,8 R1 S S0S00 S S SS@@ `0 V_A0P@00Q"0A'A+S? 7R1 S S00 R00S 0P0 S S00 ,@@0S S 50 p@ @@@@@00@00806uO 0N( 0GPd4P R`P 0d4P 0R@y[W@L0d!S 0 0 2d1p; Qo|B1 |Vqp @ όx0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0,P % 70 %004 0 5 30_ލ Ѝ4 Rq W W Zʰ$( 0$00,` `ጴ  V V` VV00;V0SJ`V H4 @0p ;V  00@`V  PP   hP 8 Q$h!P ``V;V #0 00@`V;V   DP 8 Zl`(,`| 3 R1 S S0Sq00 S S SS@@f `P mU _AKP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ000004+}_[P.P `U0!x3!|3p DPeDQ a`sQhX`- P 8 Qh!h!2/R1!RjP!>@>H>>T!>0A-0PU" 0U"0PUP!q@@ ``FnQP  (fQP 0!E`1(,`P$02~Pk''`k O-Ff@0 MS`0 4 8 t& ( 0, \F\V@PR8 H601vW00g,1@06 B0R   50,@ 앟ş 1 c0@8' 0p,8 @ P 0,0 P| tup80Sg0S X 8 0SnX6S 8% 8 0S$up40S S 508 RU 8 0000040S4ğ0 , 4XA4*0210S P10q S^ X40, L40$0Sp 04041%40 ,< ,UjP0880^ 30, p ЍqR $0Q*# 043p084,P< p!@,%4%1Ru4#! 30@)!^ ^ ćrp$ S:p 0,"@ !0,0% P^8)20,  p20,@  \20,@  H20,@ 420,@ 20,4 20<  ,0쑟 0,0, 10, 꼑 ,0,10,0 R 00! 0x1x0 0 d10Pp ,8p ЍBp N=p 0y^4nqp2  Z 00K Rj`c j$ @jjitiTi0iih;hD8h(hggDgf`fxf0fffeeeee\eHe,eed@d7<7|6O-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝc|b@-$0 0nkZ .A-@@`V 0 CQPqNP pG #PNP 0`0 bL4@-@00 R \\  $0!0D0 0@ ($ T`a a@-@PL  0S  T0S@OO@O`P/0-` 00 0Q,000 P0($0 <`p@-@P0`D P 0(S  1T  0"00`p_p@-`0PL@P PLP 00p/2 A- 0@S  P p00  ( $ 8PP(p`P0_^^+O- ,0吻S 4Ms 0 x+x   / +~` P @<+00{p^/  [@P^_@@ T@ } @Q0 :Q , @T  :R^@Z t:0 hZh:P00<0 0PH` `@ 00H4S   !$R; PSk0 0,0Q090( RC 900 RB ) 0S  Q )0 0($k\Io@(p` 0,90 4 R B ɟ  B QR80  P`0N( ( ( X 0 80P ` |zPp4Ѝh8 0|`P YP @@8p0 00  ( 00DF0DS:7B0`700G@004  P`0 0 0H0C 0 1 ,Pp$p$p(,(\q*ppQj(pW pA$pW PF@`@`A$ppW0@  ^(0 1,P. @P&t@ @(`P, P  LP P  BR\`Ap0@(`P,  P1#0S0 0 PPp`@(( Qp( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000)h4000C?00w( $0L$00( P A ,P$ppV (0$0 100!0@`p $P1(P$@ kP@` p$0 V$000\JW 20$1,k, /0, 02B0@ (kP ! R-P( 01 (0jPP$ 0 1(P$@<0 (P$@$10$*[XU 0ppP10<0S  pt! ^O0}ς00P +.000P,! / 1:Q0@ Q10 `@ @0`9P^V ]8 ]dP\L\8\$\[[[l H[[.Z \8Z ZYY4YX+WV|VVTTSl''&SR&@-@P  0Q ^  00$0000 0@ ($ QdQp@-l@@`VpPPp0U1pPE1PSp ( 0$ 0p,QQA-pA@PT`QV06I@P  0P"P` pp``@tT$A-p`@IPP T  000P   YV$4$@-@@0/t 00(/tO000/`O004/LO00/8O00/ 00(/O000/N008/N008/NA-``PU 0AP pqpT0APK404 0 ,(0N\NH HJJ/-< <0  M00( $ 7M ЍM t"@-@P 00`00@30 50 R,"@-@Q 00 2 @ 0 G-psPp@M 0㺦p T 0S0{00 0  0 0$ -0{PP 0` 2$ "Z &= " 29  0 0 0qp} X X 000@傤 cj <R 2"00@rZ 2: 2 (dP0 0] 2< 210 010010 010 0100100100P 0 R00   0YT 0 2 13/p ЍTg0-00rPP 0`2 2x00@Z~@Pz0S}X 2: 2p rPx 2 @0 2D001800 TE 48,C-@`pQP M 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH mP (0 $( p 2 P7 ЍP Ѝ00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR @-@`pQP M m00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ @ Ѝ00PO-1PSM3:00 X'*q`I`[ זp@ p W 0 M PtZ 2< 2ЍЍЍGP O-MXr=*`00A̱P坖pP W [K DG@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0  PpXB Ѝ 2< 2 ЍLGP ЍG-pZ RbM* U0U @ RD0  P XЍ@ 2< 2ЍЍG-P഑p 0@E `` I`Kt1Q1v`01 @Q?zQAq @0 R 0 1Q@10CS㣐3*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pl0l l0 &T0T T0 < <0< b 0lH,p@- @VP P y0@P p @p@-P`@Q 00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-P`@Q4M ]00 Vu 2+ RI 13/p)  0[! 2$  00 3 p`0 9/P 0 9/P  _0P 4Ѝp$  0+qp 0 ǔP 2: 24Ѝ?p`(0 0,9/P 0 P' Y  0z S40 ེ 0(10S0 1$10$10 0S0P 0 P0S 0ܙP  00S 1$10$100O-MYP@000X00 ``FV(:S 1 !r `p pGwp f 0 F pF000H00 B 00p0@000 ``FV>*Yv`G V `!0p pGwp >0I`v`0s0抠G0Zp01`*0ಠ0`0p00^PP~ Y```0S0`0F2"0y 402"0 *Y0v`0``FVm*Xv`W ```2 0 0 00000``FVL*Xv`? Vp1p!w 0S Br p0 0`H`Fv` ̹0pwp0s0扐F0Y`01p *0ಐ0X0`0p0 00PP @00S80`0FMЍЍ0 00 0 0 0 0 0e 00 0k 0#`t0t tb0 0tl(0 xTp(G-p`P@ S  R0 {U@ T6 P X0SJ0SQ 0R0Ӳ00ô00 00As0R0 BY001*r 00 000aUU800C80| 剐BY001*d LP P0P  0D 0R0ಐ0CS4O- R P0@ Br( R(,W =0P P I# @P 0R  Br( Z`pV Z@  P@@p@-P@ 0^\ ^ P0Qᶗ Pp\ p pG-@` 0PS 0S  0 Qᕗ@PS"  00S p\: 0 BS P= 0 \yP   00(!S$! 10$1P0 eP @0弐p 02p 0 S  10 B\r ἐDP  $1 0$1(!00 O-\0`0CS0P@Lp M P n< 5;P& 0 0  eP 0z S0  Ѝ0 0S0P 0 0P000@- M@ P p10 Ѝ0O-@pM 0 0p`Hp` o P PK0SRD0Z 00 @ @ 0 pWM0@r s pGW0J*0@p 0@000S p0Cps0W㲀Ḱ0=*0p00ᴀsPP D0ZPPЍ0 lP 0  0B 0  080 ph h0h d 0*P P0P 0H 0tfLt}LG-Ÿw?`0 0MR,@pl2SL:0JSI DPz P崐2Sk1! BRE:0CS㣠j*z0Y* C00C ଶ101@0p扐0p✶  20 2k8!01 0 ,0 30C0Ѝ P0 ZP崐 Z y0 pP202 p 000 p$  ` 0 p (,0, ,b0 kw P HDA-@pPQ`M 00 2   Q Y:1Q|!0" B1"0001 0 VA0 0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝ00Ѝ0PU Q:(0 $P0PU`P7P   Z9P 21 z/:`@-0 -M >Sl lP 0PS @P000S 3/{3 %SrTT4 8 80 $0Q/ $0S/P  H<<0 0R/$ 0S/ d PA-@T 0Sip`/LXP0P@Q0@ @@X{P 0A/PH .>o>@ &O-@$MpUe|:xTp$Bpd4dD0q$4SO 0! 0  0RpC BP b0@S3S10 3%63 3$$ 3$ $ 3  3$$ |3$ l3($ \3$,$TC 83$8 4X$Ѝ $40$0($0,$0$0 R20`V! P  2RXPP40 p00Sh孇P\R0 p0 00CS0z p`  RF(4S VZ  4S8 0V0$R0S  W6@) 0@ `4000`006@IU0`00 b 4S !LW6@ 4S $9ip ` V V ,4S ^+ip I'ip4S VMip -ip `000 ^ip V?@0`hhjS ?P&4&F-&?@ &&L&`ĻRH??O-@PMp`PdH9 @@00,3,#>p: RPGP P h f0@3 hP>  2H@ P PxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  勀PPXPPqT! d`P "  ヱPP* ẲP}0SQ tgYPdqPgRp`@ 8V%,1 B R  0S V X c 0S X  R 7/P  R .3$ 9 [$ 9 \RY?SSa%R@ -P&c@4@@@@ HſO-yMP)c80`Hx00 00 (?p8`K[( 0RI Sd 0 0 LvPePRPGPʂjf0@S (H0@ S aP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SP0PK 4P q'f P M?6pP/W  0 10S ~Qpv0S x&0S0@0@P0P/S XQ 0: S00! [sWQl0: S 00000#/W00S %(0S0(00S00JpW   *0P0H X50 0"0P @/P05%0CS0 $ `8 / + `p;PP0S ~0Sq 00 x  B R\ L` V `,Q% /0 !P@`00 !P` J/R  S/R/  # C  R:  ` 1 t3 0S S/R$ 0\SR& P0sX/ HL!R\0X\!R\ $X00: S  C C `yP0: S P1: S  : S!  Sm  Se g S^ S L0S !hPN,0SL ! SG0(尥 0Z gZ80 S801!Q p-PPP1: S &00Z0S 80X!0CS!80T1T!T_fP R X0O )0S !h0S !Zhٯ Q[(0S0S 0 0 Op!}Sd& @P&@A a%[Aa% mA ſA@A۽AA Bû=B&]B 6pBB ?BHO-@P`Xq6D&=p<868V@,F iP60Pfi0S0 {} P3NP :i4P0805HP40iP0%/(0@iPP8[}P0X T5T%HPNP8P H04 0, %43/00P08004 <}i4q 0P01iPP (iP 0 P0 k@0D 0 kP0; S @ ,0D(0#!H0P85/0TP0P( N2PP P0Qs帓0 CS 01#SiP0 0( ,S* B"!0 0 |i8PU H003/p0SDfH0803/p(^PP  h`0ld 0 GS * X  o0 $03/0  0-Q3  R H/Hj0  0 -1/ /P0 0 0 0 `0d 0 `0d P0$ ,!i 0,ذܠ0Z[   P  00h0 l 0 h0l   000 Ri0 0013/s SSh S>XhXP\`0O ( (0, PU`00 XP\`> ;7OSuFP&  %'e%h&'FF%'H&'FH&'H L &'F5DhO-MM_4LRGw ';p 0 Q 0  pH0(0`7G@-Pn 0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S P{PU R0nR oR0P<0,k`P  1P8h{`P,WPPP{K QNRN , 0|5 PrPpda4 1SzH0S?80S<@0S9 P0SP rP4PD0S 0$, +p P44X(D`尠XV 0PU 0040D0S 3jލЍS ,0SP sP 娠=`0@0S0H0S 0  FSlP P 3R㓵( F P3m W` =0Z 7P l3  \I1P TT 0<40`FP LPP kPPT0S-0: SkPPP4 01!P4L  0R p 0P0 T0StH R 0 T0SH"DpkP4T0S 2YX 8SU #  WpVJ    !   !  $ ! ( , ! 0 4   8<  @ D  H L  3]P   -iP40SP8`S&'-JJ8 ,JQJaJ{J@ &KP&[K 4KKHK:YKKs@-0DP000T00Sr0C?o21$9p0 1000C00S8 000-S30 2R(0pP EP SP 0 ,OLsP xP  4 3" 3" 3" 3!00000C0r㖺P#$!x"Z@P Thd*~T(cQJpPL 32S ,#,O l 2 0S 000S 0_xP 0oPSPC000!S 0 0S <hp000S 7P<}4N0Ƿ A1S bVQR}P2S 1"PO:Ua`0:EQlPQ100S S }!0`0001s@Px Pt rPo  Pn 2S 0"r r r2SAx}ιPR2Sw |0"P¹P( T0"p(N< <N('P&[OJ @ &FO-Tb)'WObO+'xLP*'XOKNH&lOOL&@-@MP`/P@@@P8B8r',"g8p 20 ER!bIpsfxwPePLP= PP0; FP f0@ S0 0!?8p|1Q=0 q E - P. R1 R3 R 0!BSQ/ DJP*0: S&800 "x000 0 0 0 0  Q C.K  J@P0: SpGP -@s,'t SP&QH-lO-`M@ [0IqpP!7p 10a1S 000`F0PmP pP Q[P xw`i[P+/[A L p@,0Z 0IP0 0IP 00*0 * R 0Z /0 0 U:Hp @TJZwIP U:}HpSQP&-@HO-JM M@wZ 0`R!57p1 @DTL0 aS T  ЋVJiP fP hP bvP00`0` 0QDIpP0: S ! PP vP 0Y/S / J>00$CP@T ᭽0p/SX/P坽0 S:L p` ᴩ kpS-'SP&SA-`P@MYD4 0廧 HP  G HP  G HP  G HP  GPh0d3P0\3P P$P@3( 0oP+( iP3( cP7( ]P;( WP?P ( POP( IP P8$@Ѝ(P (;PQP"㱼(0S (,P(0S ("P(0S (P(0S (Pq0S FP|!0S0S p T壴`PLa @1R`ᵼPU 0E /R +P(PU  00,0/00(u0 0CS0 ㅕP0$0v00S tu0s00凗ꞗ'@ &qsP'LysTj%-sטMLs.'" -'sp@-@PXe.`LP PP =`t |5ph00SVP{u1P $ 0@HS=P&&&FO-MPXd..`pXFP&J5p D6@X/,60S ЍfP WP! PP p `RP dP ,vP iP0p0 `rPxP pp0p0p$ppq [,1@ES $V8e  0P0SP$0`S 0S@ pP܄ ?PP40S t ᬻ@[*0/S /޽P0.S0S .S0SZ<  4 0 R  @ 50C SN0 0$S P PT.  00$ @J. 0t0S $ ?RR00R0SV1 $ 4.  0SX  P % 0!0 0C0~ EP 0S' l'0S 5S 0S 0SaFP0 0] 0 0XX  FPQ$EV0SJ妻P D0S H0S= D0?S9 @0SRGS - V 00PU .FP$0 S`0S;D '0: S R7   S/o" R 0: SDP0S F P SGE 0SE >P 0S 0?S 0SS'~P&d;" ~@~ſH~G-P@V0,`p!3p 1 R1 p0C@P FpP vP0p`DP&p0S VP /}P 0S 0S DP0n&p0S SRP&'H0@-TM 70 $ CDPD@EU0!E0T000D 0DP00GC,ڱP3 SP 30S S S" 30S!  R `#6 R D#!SRD37?E 3! $3 003 3  2I20S ( 2 20S ?0S'002@T$AP0"!@s-tB00CS00 b 0 8 D0S60016 R0S 10S< 0PR<G0 01 10SO 10SK(l1X1PLH10S D10S `1 T1 u0S 160S ,r@1 D01uT(0S0F0S 00s0S0S 00Q@|P@t Top'ShDk%''''''% Pl%Xl%'j%'xd$ C-@MP PU*2b@@0 S zp ָW"1pC 0 L1 02Pl7h *DPT$Px "DP<$88 DP$$T7 0DS 00S8 @0xL"0QD0@0 0Q%@0SV L #}PQq!a0@S0 @qpBP `q@@L  !P P !P 0@0 00 T@L<(LL(0@0 00 0 峹PL&%D0S lx CPXn$DST&P&pv|Bt @ht@t@L&x6 -Hgt@-~TAzDO-MpuT$*6@0o0C?o`S20@@@ @3#e.p3 X XT 0S9 Z`7 [``3 qRPGPP $`3H@ P `hP dP fP00vP003@0 0`00`k0T 00B0 S; : ӭP" @$ A0S #S(`$<2  ա`P5 p000# @P/ͽ0Sw '. ᴹ0P0  p0p $ Bp p0S<0 0@00tp50C S?0 0S &$ p!* p0 R qX  Pp P    3/P00 S X#$ p) |p[p000S iCS'l%]P&f6 -6 (@'@@ſHO-M M`p\hIp^^[5 00 5\5005[9p 00峮P $宮P 舟;Pc$Q oA0@6S 0Y S~x(/pQ `QX 0,(LȟS SS 8o05505 00505057 P P$ 70$ꐷ lp0"S loH Zp ꙼0"S  Ip0"S P 06op$0z05000001 00 00g0e0c ^< ^  ^ QS00 00055UU * YBY5S50`FV%R" 2) 0%0;_pPp%5S 07AP80: S0558%0IS00 YV05L'V}*咭4P$040Dⴋp`!PsPP ?`$iBl/%h0t\D00000 0V?ŸPP#2 N?????UPc`0 0S #Pnp@L'cꤻ0#S  '?!@ O0E?o2?  ? `V<DPPo!f/3&`vtV :*PPc@hC00CS0 tP Pp PNU0 P00CS0t0 V)0S:00S:0-2V51)1S)1S $$PdPh!iB.%t 0VjDP 8g|&P! )P0V08 t)P$m0`FV|P@3nP  f/ 堹T  $q$P' 4; 6 (Ӫ-G9Jc|l%P&l'6 טMLH]'&& -SĻ4&md'P@-ʅ0 0P @`P@p*C p3`00CS`0 PYD@T ЍX0 X @3(> &&Q&O-dM@` $- P 0t̄4 $0J-p0$p@DTlUU!Z rUdU `0=p0@$@7mtPcPSP PP3d @" nP tP0 aPP dU4 RU SU" QU040  mpUY [/lUT  3  $ޤL$ #?p< dЍ $Ф$ ?pl 8ä8 ?p( 8❸ 8ⳤY  H⭤T@D!PP`p | }`TE\8 >pL&P$4"4}!( h "0/X!  fP Q !zl0P0xlTK 0@SB|B#x08J`P8 pᗵ0PU ,8 ㎵ ] P P }P0ZS |3#`V  ` B0P`||Q-P&؆~DD{D|D(+:IU}DftH@ &yaratcidO--0`pOaM22242222322$ .+pj>"42`FS 20000b2p^S Rl2SVV10 dbV% ``L0$p L pP  ``L0$ppd2S P=PX0: S0d2232d2o``Sn`}0 X=y\Ppn0S4 f0 zPRP3P/P94S@'P <1@P A@P<P 00j0000\ ,2,00SP TCk<P0d2M042J02G02D02A02>@[ @@Taߍ02.202*02;/PP000S 3p$ 0 0[ / PP000S 3p 0$0U /P000S 3p萝j0*2Z000 0B B/xP 000S 3 S;3p*00HZ 0` xP 000SX"\2R(RX2Y/ ᥧP P<PX0: S 9 PP "/ᎧP L)0  Pjj^9;PPX UE;=<p X:{\10  [ *;[ ^!14(S;̲03T 8  <803M,87 P 0@B PR[ 2SX 2S0 0sT ^ :p d2SL C<pV X!\1 @\1X! 0 \202T7,2P7 n%P&(Dz> > -> ((0:(HWn (U}Wa((rdAedA(>( n%6b(X(sBS 2"0g 2PSb@h 0$    072S2 bV/0@t/@2S-2P" n=0 0?1@ 2P 1!` V!0Tp2<<23S 22hAS``t2S :8$)0 1P 44:5/1P ``00"0,00!`0,"0? 0,! 0 `0("0(/1P j $@gB 0`V5 `EV ``谝@L 000S&VT"0  770sLP <Y:z 04P(`CQښ. .a0C 2 0e >(-P&ܵD @ &D 8>(0>(,JQJ(n%S(>('G@>(zd@>(HedA,JpG-p@`㠁Q!g%p$V】 0S 0S h``10pWA P 80S  pW$ZЍyPmPPP fP = n0@ S0  0 0000000000`JV 0 LPP=P=P 5X-C(P&QF O-(4M$$` 7P! G6P50pCࣟ00PPP#$p4W00S 0S 0S Pp3 a X( 0S00pP Hk0S 4e,bWPY30S ЍzPOPBP FPG a2P@*P 00 ׬P2 ѬP2000b 0 ah!:0X 0庬P00 8峬P00 0 c~aP}x000t00q00n0 mga1 P :Hd00000X000T00Q000M000IpG00000A000=P;0SvXPvU 0ЋP`IPv.aZ 4&aZU(\M(-hQ(-P&` U(F G\D.n%LO-@MP8@GưL(PUPE10ů¥vPlP,HP1 TP3@ ` 5p@&ɰ  Hqp@0 S < <0@Zt pch2m@ P ` D"#p8 R 0S00!S0  1 ,0Q ᰫP,00S  0( @P@F00-SG 80@0$0 p0M@P@Ѝ$0W0|1 4n?$040P ?000R0Sp h```8ßp\0S60S 00 0@@`p @$@ @P \r 03/p T-+0P 8+P&

2P0 p) P.2T/2@P D-2@2@P0"0 0200@3~ 2 H߈p HQ z2P q @  p1a 0 0 @ p0 @ t080<0@0D00P0 0 080$@P 5 80 HL@P@T@X@\@HP" H000 0400,0@@,0( 00Pp"PPUPh0PP 0/`ЍSTSQ*SRR/S>3SJSx%<L`^(O-`pPH6MDF(` 0 0&p$6U K V0S`@@0VoP 0SЍuPfPFP RPZ 5g@P P0P 0 h_0#S { P` $$0`0S  $$0`0SCP _0#S (rP $$0(0S x $$0(0S|00y0P ᔧP4q 4q 4 4` @s0KSq0|0Pz0 C@Q 0cR pR bRJ "_JK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX B@600S_ /P|0 0C?oR20SV X_00 0$,0$00S 0U00S 0 ٫0S0P000010S1 0S 0P0 0  Q00s  h1000T,0 0/80P0S& SR 0@0@0 #  R S /P(0s  /pfi00S N/ 0/ -TP&_( o mTT@THTTTT3UL& UFUO-P@`p'M M⌦$PP|&#p-p6pp0@DT00S 0C 0T T!qH@Py XG 爖PA.p`.0S  fAP+ a@P5P 5pP50S $mPX `]ToP %000P00pP P P"5P LPpP P( ]}p q-HP\q/]00 000#0 00$00 0UP@(TPPc] (P(BY@X *r1 PP(!hP( MW`P@ p ብ0P@ 0(`p` qGP 00 00$0 00@PWP }WPWP uWP @PYP <TP 0OP!<g@GPY iP( M@p` ^P( +Ԕ /Pm``ᩣV!:r0 0-p` `!`/P-0SDࠟ00 000$00 0 0P0@(p .p-}-s0Pa0SJ(S'- 29S!S8 1Z/Y V`P'ݍ Ѝo WP&_(0Xto -W'GgWWH eWX _(zd@_(edAp@-P@?p@-P@?p@-P@?$@-p@-P@?p@-P@~?pp@-P@t?p0O-nM M800l`4P)P 0H~0 P 4iPF  >R~p>(0$   p@5= 10>0S=D$R$r R  $xmBt $Jŧ<$.}p|0A: x0@ <$0|(0JW-p00 [`PEB@D4T@@ 0$0<@P < $P   x<  h<$$r $pL P 0<$0 00 L 0 G0=0(00 L0, 9;0@q [; ;$h0 00 0  `;Z0!00 d0 | (; L0(00 ,0*H :$>0!00 0  :(00!00 0  :,"0(00 0  H:0`:@4:0S P p: 000 X !00 0 0 :0!00 0  :0!00 0  H940c 00 L0  D: 0!00 0 X ~888Ȩ@0S C.0$ DPZDP0@4 P@ 8(Z\8@,PD40 PD40D4  H 0P(0u `800 1 1 8*48Cd7@P00\7 000  0OL7$G: P]P/ XP VZ0S 0T470 04001<4 4*8X/p- PEU UYx V 0.p 0 PS 4S<4Y1 H4L$0 V-,pk?HL4P80ؕS $EnF?ᤠFHdLV0.= 0 $?ᕠ`t5VLHd4SH$L4R0 %*pP  V,p  4S@  gD`P  =Y  KPP;l%JPP\%\V+p (:: S4%8) $Rg*@P %4$QpP$  ӡ섟P0HpWZc$R0 >$0@0p!$Tk = x,0崡P,0 r0 4P ⳡP$803m`Tk 40S0X44S.=0@+R$)SR' (8 # *~厡Pb 0T40S僡P 3X#0S T4ShtP`3 s(8`+" R H$L4\* pY`` 0 L4H$Ϡ2#!0^pH2 C  Y$0- ;kxpnx j 0P0 T  㴤dL$H?("f4S 0u.?V N`0$$4RT SQ  V   0Q)p 0 `VS  S!0$Qf +S0$0 Q$ Qq*4m0a(RccvcZ P&eEe-G@ &c,ic&oj?jVj|jØL&dj!d8k[k>dy%ZZnOdfd jddGfe(dddWe3fje}eſ8a(eeee=a( eff Яۀ Xfffff-g|gy%gghV;ghcRh%hHL$ P,} P+P *+0$PiS0[ 4S$jP 44崀S04144 0S @4S 0 O0@4,4S $4R#1ѣ1,40 0(0Uu (t (0S 0+p@% P' 0d!|&-;]P`E}L+ NwP9X+-Q :$4+041$4+T4S$ )d0,"|, )(((PS)\4$8: H4d4: x0<$+0@ 0)p`^|P Z +ΟP՟PM  <p  T< = +0+- , O-0pMI Mh4, (^pP_8`4pGs04WZ h&  "YaB 4S<44S $$4R0XT('p D hf)p , 4 SP,0S x0$忝 t$W0 0L 0$峝pW$ t1SC $$4P<*`|WZU CUOd7DPEUPP bPEUUPP 6 ( 'p00( R0C0s0So p V044s04d0 00 l0 6V0(00 4V0,\0@G D0 00  0m70*00 +0a +0*00 +0U0!00  0I0c 00 x0 =@50!00 H 00,00 1 1 $40(40SPV00; \$3G0P0D$EVhl(p 4S &PP$l$M`P#T  H(@ZP<4(0(00`V Z<0 00op"#7$p = 0?P0 r0 4CP >P #0U3}p$p4S80S4h 1S !1B0"D 0S4P $3" b1p1   $$!0#?[pX2   U$ &up P tc $ t$4嗂s'4S 0D9+?X   $tR $4'S  4%5X0; 4 $$ X  0 &p0sUXX0:S Q4S  0  &0S Z &s(!ٛX0⫱X+e( -qP&je}ei(3fXfl p~%qic&o?jØ8k[k>dGfqeeee(6 effWP ffff-gO-GM MP`h ˠ0t@$$p40PEPEUqi@@5P 3D0403003 3啽(3 _p0,0p0T3000D30804<3<#L  3D@ 3!.t8@|1Z 1@2TȌp Tpp̌ ňpp7Pt  R 0@ @ 1 0@T`Pb 0C S_0400000,00(00$00 0000000000 0000000 0+_0p R= @@g'ĂW> 's8;p 00 L0#p8; 00 L0#pD8; 00 ,L0#p8; 00 dL0r#p 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;p+,,@|p L0E#PX;"0#10@00 0`K`QHD  `   ` 0 #PqK0S `` K0#Pd 0  00 45#P@Wd C#0 TT&``\5d%\"P`|5|%|"㫝!2`(10kkkk,a0a4aU 0P````㒝<;SU">@˟ >Uz{ A k:L:۟"@ 3-UVz{ A k9I:`"2Rgd@' { d30S 0 ' L N@^IN2 X0弅9!pV00 @@+P@0W0 00Dh&@X2 ppW T p (2S"PL0"0:CS0LJ"`dpjL1堋{8 {'NjCAZAGޞ@8țINT{({*X PU7 I0S3 "<i0xT0T000p+t pP 40S  Ǝ"t;<000[ W0 0 |+" %d2"SS% 0 " $@-C6?8~A@@q){)d&p|){)Ax{)@ &r)%< `G1 PS& 2R`嶐@pQYTT0R?L0 d0 0 d20 !  s  `040hl0/?ph{{7{{{|3{{ {  M@ )*3h2 00h232@0d@Wp |!<0 0H 0@02 0BS= (SE; ? 0;$p@0S<h2!0@0Css0S0 0 0@ s04r $ 0 @t 2币  0h 0S h;    0;$ 0W |>!<0 0H 0@0p0V 01 JjxP<0[9W 0 0RZW | !h<0 0H 0@0\ 0 0D lHo$p0WpHf$@c$p r)%-݇p|)&,|)b$ ш$ 0CS0 0 P \0Q.0 p4$ x|($0䋟p@0|xtplhd`\0 Pb <0 PY 3Q0 #%#0 sP;  #0 cP* #0 YPd 0 PP Q Q ,(x$v 0 >P x0 4P 0 +P 0 "P 0 P 0 Pd 0 P @0 P b# 09 50Sj CS^ S W |3<0 0H 0@0'p?#H4H`yЉ&K Y֊jxk7MŋًF%-|)<;ASIZ0KWI7L#DD_D0J0ZD0 0I) 0K J0KX ) QJY0KWD01ʸ+Y vP WD0 "D0J C <帛?WT"pDDD0I0YD0  0J#1 KJ" W"O-M`P@0-S@4P- @3 pģ# p*30SP a`F0P[:PQ9 JKP9 qD L4P@ 3C d0@S  Lp@20SgK@HGG 0_ 0w|tX }`LY'VD`PP`4b 2 R 5 N0 S ) $U+ 0 :!0!00}W p8 0pB0S yWy` p00S&P0pt@@ 0L Vt8y`a,|* P&HTNΌSR+O-PAM Mʭ@`ႊ뼦P |P60V00-S% @P ᇒPK@ p0K0\Z *`F0S0`@DDA@Du% p ,0S@bLpP53 Q  IP -00  `@Z-00  D0B5S0  00S TKPOK0 04P HK0000|400 |4 0S d-K L4 00 8!P ~  E300S Pl0$0g0(0d0,0at0C?o#2p R0S0$0P㘗t㕗P㐗X x0Hx@DT43a00@`FrS= RS iS1 tS xS  㨢в+ 0p 0@00@00S  0Y 0S p 8< Q (0 B/S ѽ[%(0S ƽ 0@2[ic0S (0S |尽1 0t0\S @X塽+(0S 4嗽 0@s )71a ~Pp+ 0 pSPUVlטML8|* /*-Ldx*Є%>̏ڏP& @ &`4܄%D&Yt-Ґ O-PLM'P N n. p=&,# PER a0:  @@0SCIvPcPSP TP LP d0@S0 0D003030800H00 30$30(30,30<00",00@)0,0p qW3Sp)P  @ Px< P /P LЍOu3S n00p,04 8<@ 0RWS[Z0DSPQL  0gS @{$;0 0EY0P aR @L0Y S I0-S0 @ 3R:  "0 0|: ` P0 0\:0 0H:43043{0830<3@30@3ppzzyyx||{U ,0U ,0U ,0U ,0U ,0 0 0U ,0L00L0U ,U S S0X0X(0CS0 0 PD#8 D#<#  P Q0P0083 <00b0 X0X 0W@0W0W0W0,0  S,0  P 偐PiH0Sx'xxq0>@PH0ST'THe02 ,0XS`X `43 S`,p(/ܓaWF cW1 gW0Bp03S\0S^ 0gS$ H0S! YP 0x&x  00S_ XZWZV 0S00 z 6,U0S4Q8O<M@KDIWLЍ0000H3p0P xH30`pϓD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0t ,0 0Rp B p hz<0S $3S 4p0 00 R  B   0Qz< Q $0Q p0 40 R  B   09z< Q $0Q p0 80 R  B   0!z< Q $0Qn p0 @0 R  B   0 z< Q $0Q\ p0  <0 R  B   0y< Q $0QJ p<0pGSz $3S0S uD0S\ @|p707S B,00'c<sr=S  f  x      Wڀp깓0S 00S 0S  Q 0   |ytpW %8 30(#0<   ȷ*#  P&̓ 6 TSϵJ %(*X*~ 0*8*@*H*P* *kh*\& {ǀ**'4BPanҴ]G-PXMpn)wPHh  2FDP b0@SS0 p80 6`(pT80U _0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R &4&R <&R 06h'SddQaDPA07=CP  P W0S  fP 0000|P6T&0 QL|=P:P061 (VUvpXN0+Sp@(86 000H<00 0/15T& P 0p00 :X2P00G00Xp h5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0 qp(4 0P 0PQT3DċJZp=V w`2o`F#/P0 0SU030#:U 5%$P6+P pt=  XP&T6K/r043PvTS0 0 S5# G@>r SPEX!EK/r0P/r 0 0<6SR46SR 0&2RRPT2 01or|6S lSP W0`W  0P q,6S m/&`P 40PQ!V度8q岦<6S:46S: l1Q0@6D&S1 0 00Rt!  H&hRd! $&RX! 8&RL! 0&@R0 XPʕ0P) S%:0 tilrP9Tx TkP 8h(p4bP 8T(X(f b嬇P 8h(d40EDS00  `8( D8X(T( 08,8 x8P 00S~ `8d ;?7, ,, ,q 7,m 7H(ib8Pb7, \] h7L(YW+w PR:?@ 0 7P(G7WbpEP|78 110101$1P, l,,Hp, z,t,Lr, ,z,@ &ѸJUklx,$,-z,"<-ty,~O R O l,-tQ ,px,( ,O-poML0 @U 8@0 @$p`T4 W\Y pP 0  %P(0: S) 0T0Z0S㸠f Y T/L@P@   P y yPG iPf@Pp U4pVaVb`FV` zV" ‹!0 h 0\Q 00 083 1  0?x200t@r pT 0!0 02QX 000ss` pP00 0P* Pt%kf`Ph!!% A" R !0Q50!4P =5 ݁㐋  P"   P80S | |/0S s`0 0/X0 Pp 0 0  Q   S  R#4sp V`P0S T > ㆁ [U@p,X YP&HdĻo-XN&ht@8S$0O-PMp00@t|Ph `|PTTB Pߍ(@*.e7$?PX1?/0201 2211$R("T122Fp?p8p^&[0|n0Z00 `.0X>p:0Hn0C 0 0R080 ChN0 l10 B1!1pqq0 PPZh0[ = 0ZoR =-00+g 0 80 x=0YSVPMP 6P@ ?P7 4P<8=N@P fP j@P =P <0X1hx<'hVP㼼0V30 [0000z00u( 7PoXlPi 0pP 0P 0$Q^ 0 R0 PP  0p徫뎳 84'0I00`1ZᢎpXX 9e1SP 9 ᾝG:0P 0@ @ Tp  p }( P0Q819:d!X*`1 L p,< P-$ (010S  0yP` 0Y) Y)  +t)^0 x~`0+0` 彜O  t9t@\kp$T  X a0S` ( PO 0S Zo F0080`8"/0    2s$8"/0 2sc!"# p: 0<B P# $ F 00 8@卙p 138#ỏ˚PXzLw 7@.p0S h&0HX0S<$0S |0 Q  8 0 'znpl0S &dap_0S &0 P q |wttl徛ˏ0 G S 0✟p<7 1cp3 P $O0$A>0 0T1 6T@弗pyX幛u$0 T1 5T@嬗p婛Lp cp P 000Tl噛+; T[0@00 P  ,Q0 @40 ᰌpP F $ $# 43p ᲎+ⲶpY 4@Qp8N!R`14`11}P0d$}!P0!=00!R00SRd1`1Z  R! Q01Y; /`1 1pW4180; X >< 490o(ޏ(⋩1PU 0S 2P P 0S  | 0S ᔛp R080SX R   (001ޗ0 S   0 `Vfa\m0@0@u hYdoU02 {u FXs%  P&S - j@-pt +NgZV{ !Y,7dxc.mtp=4{&  Q/0p@-x@0Ppp@ P T0z5p@ 0 0$010꜁t$/O-1bM!0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ ${`  $; 0 0 +Hp0Gp( 80G( Gp` x8_S0؀00 00 P00 @G0 :xP x8##[`@*/xP0 l8 40GPU P0 l8#40LHHH0ƒ S$*0@- R P@ 0\ R^ H00"@ 800 0^ 00"@0/Ԙ@-M   zЍ褮h  0S/ -PM00 0 p 0 S 0 0 Ѝ5 /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/U */*/ |*/y*/v*/s*/Kp*/+/jk*/Oh*/he*/ib*/v_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260115NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d G?]>bRf pYvV (>2 >$>h>pk<S>З>4>4Qh\>t>t><>z>8>0>>> >,?4T ?|??Q'  PT2a2)?$7(?$7/>M1?// //////////"'+16!**33 $(*,. pushdnepopdneTEED <@@E}E@@EEuE  EEd@@c?(rxd@@Eunblock and -DNO_CONV?l`|rxllll%,l2llllll8lllllllllll l"(/ll5ll;100 0prtstatTTT(IT@TTTI(1TITTT1sETw#Fm%c9wOdUsage: %s [-] [-ESsx] [-p string] [name] 49;9?ACBD69`hn<|AJ.O? [SV"ekqty2'3Rg!4&4,4411999999999999999999999999999999999999999999999999999e9999ln999999n999999999999$9'+-/91ANPRXPZ\^9b??????????????"%?????????????????????????????????????????????????????? ?????????!&*/?49@?lnuz? abcdfiklnoprstuvwxABDEGHLMPTUVXYZ2 )  A "33"eVeee././@LongLink+LLL<LL!!PXHl'Zha!U8A3>DN#+T QIffffikfXZfffffff\fff^f`fb  Ӂ~2FEWZk# _̂^̂F̂<̂>?@NI$2Vkks{PATH=G   6:> vtjPED[[[[>0>&*->>>7;W[_cccc $/:EN%% ~  & 11C    q ĻF Y ]T; sK8gNG .!ɜ6n %F                  , ,-nS &^ `o`5$ yst~/yPɘԍ~(;ɯPPxӘ00OfkO|<%L%x<tGDoxkd xFx X(\lXiǘdX|HϘ$ %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4 ,8ƛʛ'7ϛ՛6 ٛp R  n+&:\#x%#s #H#"# $ŜL$b$ %#%o%̜8&d& %Ӝ#ǜH# D%cX%}%59=AF#E3N#M3U2T3[3Z#{ @N@&%(0?G8 @ V. C$CC$C~x~ p@@  jb@ɝѝ ٜٝ؜OV]dl s@ ====0==0=9 % /"&),FBXi|~֭ޭ@@@@@@ @@@@%@, @*@0@9@A@ȭέHMSZbhnu{@@ŮϮծ $ʭ*19@GOM^nīԫ 4PcnA.27?DJPV]ȯdh̯5n t| $V`jszAïȯ̯Я5گޯ* ¬Ǭάլܬ &,07KAJQZclu­ȭέ A.27?DJPV]ȯdh̯5n t| $V`jszAïȯ̯Я5گޯ*D[D[[V[D[[M[[[[DA.27?DJPV]ȯdh̯5n t| $V`jszAïȯ̯Я5گޯ*u147:'@*TMP-1  ,M 2Sf  - X t S>cw !L7#L7$&L71L72 3L74L75&6L781979>:W;q<=@ABC2DYEoFGHJLMNOPQRS0T9UAVYWs\}acdefg&h&i&p-qL7sL7tL7uCvL7wIx]y7Ws*A]u7?Я0LoL7L7L7L7&3E_o0Me(C^L7L7 %L78hL71 9Z][-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]S>W $V`jszAïȯ̯Я5گޯ*returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check `gw*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read /n%@ 5n%Cp:n%<n%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-%&&0&;&i&r&&&&`n%KKKEKKIan%@ $*)*7*J*_*q***F^b`drJ Z K K (K O O @Q V W $W 8W Z XW W W W |Z P (    $V`jszAïȯ̯Я5گޯ*,rn%@M 2Sf  - X t S>cw !L7#L7$&L71L72 3L74L75&6L781979>:W;q<=@ABC2DYEoFGHJLMNOPQRS0T9UAVYWs\}acdefg&h&i&p-qL7sL7tL7uCvL7wIx]y7Ws*A]u7?Я0LoL7L7L7L7&3E_o0Me(C^L7L7 %L78hL71/wn%@@SPzn%@.{n%@0|~n%@  Hn%*$&(B[   3n%Xn%@ Tn%SFH0eC)5SFU0eC/5ЯHah!IdontNeedEFI95>5(s*K>;0H5|nQn- q+S5_5|nQn- q+n5x5|nQn- q+55|nQn- q+55|nQn- q+5*=rGy=iG}55;Mt?55mWC 3KOO55yD<#*=(56YbBRuoqr6!63Dh&0686\ M}-K6\6@Mjy֬m6~6-чHȯ6-чH6ZIчH6IчH6IчH562IчH6L6 %?a77S'@ )Ѹ77*1@ )Ѹ671x )Ѹ;7E7ST.qBHo6֯iU7`7tn%@q9n%backupstore_gptstore_tbl)? o%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps===[%+-/EYYYYYYYYsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusADprintallmaindo_setifpreferencedo_setifcapsCzip%yiɘɘɘpp%;s%ɘɘpp%% t% Xt%;s%Dks%n=(t%Epp%\Cr%Epp%Es%Fs%Epp%Fpp%!F,F7FCFOF [FgFsF@FFFF F0F@FFF F FF F@Dinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstHGHHq9H` ADH` H` `HH@HHH` q9Hmedia_statusmedia_constructorHHG8u%GHG8u%HHt%HHHHu%HHGu%.H.hu%1+ paddr_match<HHpd(HtH settunnelIpp%Iu%print_link_addressessetvlansetvlanifJHv%KJ,v%KKxS(GN=dfJLdddddddddNdddddddddddddddPRTVXZ\^`bsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsPPPPPv%P pp%Pw%PP$ pp%MXw%MM * pp%w%P8w%Pv%Ph pp% w%wM t * pp%88w%Kw%PMM ZMZM LKLK ,V4invalid major numberinvalid minor numbertoo many fields for format' !ffs@3X@X LXUXaXiXvpX@X{XX X4X ^VXXXXXYYo )Y@5YFYTYkY@YS>>YYWYY?YY5(;ZEZ'irXSPZ^V iXX V@XVV@WZ^ZcZlZvZzZZZ bnorripbgensbextattbnojolietbnocasetransbrrcaseins;ZEZ'irXSPZ^V iXX V@Xg@h[VV@@~X{X;ZEZ'irXSPZ^V iXX V@XLX UXg@h[~X@[VV@aX;ZEZ'irXSPZ^V iXX V@XVV@ & 2;ZEZ'irXSPZ^V iXX V@Xg@hVV@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror &)<##03CFI !;ZEZ'irXSPZ^V iXX V@XVV@~^^78 ^ ^@^_ ___ _ @]]_]]] ]@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv $m;ZEZ'irXSPZ^V iXX V@XVV@~X{X. 2 0 #:NSao}>(IWl:hahhhh9iiiiij6jJjjjjjjj#kHkhkkkkl;l`l%s: can't read disk label; disk type must be specified%s partition type is not `%s' WTWTbSS /+-$ '5GIUamz -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit  #'+3;CKSW_goy@exBvxCxFxIxLxNxOozSxaxbycye-yf?yhyiykymynyoyrysyuy@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:Ŭ@@@h pp pp ?` @   $1м|^t0 Non-system disk Press any key to reboot bj #'@PSVgmphNVhNjhNzhNhhhhh h<GhZahzhhhhh(-Shejhxввhhhhbitmask_scan) !&ADGINPSV]bg9?LhLLL2hw.disknamesfetch_url%Prsendrequestrecvrequest2B_{ "*.>PTdjS***************************************************************************************************************************************************************************************************************************************@[9>plEt9Vx'1HBHHHP ,:EMT]eit| NetBSD gzip 20260107 0000000)  " $#!%Z^\`[_]a.CH @j18RnMkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQ^ ^ : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. 2&*.)/35;!#%'+-1]8;2"$&(*, " $ & 1!4\V$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataSĻFI   {m$ b$*-5?B3}}}}}}=}}Zf}}}}}E}a}}}}}}}}}}}}}}}}J}}Tam}}r})}Q}}}\  . ' &26: #&/)  #&- ),/ $     #3( &" ,ź*n,ҺS(,ںSlw,z,{,|,6ALp,^m)o,ze},S ~,S ,Sr,,l,z,»z,̻Sz,ֻT,߻+m,l,`D,,`D(p,$Lr,-Ks,;CJt,^iKq,|eIu,Sgu,Sfv,t,s,Sr,μtx,eq,S,S,collectevEsP=====NB $V`jszAïȯ̯Я5گޯ*NAME=W>YSmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds!, $V`jszAïȯ̯Я5گޯ* edit_fs_type_ext E L    8 h 2 2 1L eH u8 edit_and_check_label  $V`jszAïȯ̯Я5گޯ*disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzj v w z t z 0q m x n `q xm tm ؇ t } !>$*>Y/YWY|ȯ3 5Y?YY867A5gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC)5SFU0eC/5ЯHah!IdontNeedEFI95>5(s*K>;0H5|nQn- q+S5_5|nQn- q+n5x5|nQn- q+55|nQn- q+55|nQn- q+5*=rGy=iG}55;Mt?55mWC 3KOO55yD<#*=(56YbBRuoqr6!63Dh&0686\ M}-K6\6@Mjy֬m6~6-чHȯ6-чH6ZIчH6IчH6IчH562IчH6L6 %?a77S'@ )Ѹ77*1@ )Ѹ671x )Ѹ;7E7ST.qBHo6֯iU7`70 DWo75~ïA[ mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new` H < hܒȉ4lԆ؇ `xLtl@mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free!***************************************************************************************************************************************************************************************************************************************Scontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2*<dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discover  dddddddddddddRX]|22+d]222dddddddd.4jn22v2:2?K{21FdgN2/ddd *s%dvdJ!6K`splitvadd_environparse_optionbcde\f0 g h/i jk< l% mF n6oM pc7qrX s_ 1tug l vr w&xy zTy A B CXD E F G HyI;J K L;M N O P QST U V W X" Z11 4: 6 C ) |N~T }_ ] f v               S         "  ( 5 k  ; A I N ^ g 2 s      default_configread_configrt_compare_proto`S`SPPrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrtQQrt_buildrt_deletePPsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initC  # , ;87 script_buftoenvs ݱ"  make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os\MW ] a f j q if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp   SN- dhcp_bound9  B J   R - Z dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa OOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ!!!!!!VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B 0EPE pE EɵE E  EF 0FZPF pF FBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ T&   ! ! !(!   ɵ    Z@  4!0!,!cs_pathQX  bc_base_maxS bc_dim_maxS bc_scale_maxS bc_string_maxS coll_weights_maxS expr_nest_max S line_maxS  re_dup_maxS  posix2_version S  posix2_c_bindS  posix2_c_devS  posix2_char_termS posix2_fort_devS posix2_fort_runS posix2_localedefS posix2_sw_devS posix2_upeS stream_maxS tzname_maxS atexit_maxSaaaaae%JaaaaaaT[ xx Ty yɵz @{  {| ,}Z} t~  B 1 ?8jfb  ns"p^61dWD ;C$$cmv !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDҵ;15MS7) q:e%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nn|:pZnF$n20QKGC?:64*(++#+/'++ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c~QQQQQQQQQQQQQQQQQQQQQQQQQQQQQ~QQQQQuQuQQQbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K| {`ijXFo]H" 64" TB00r | {`ijXFo]H" 64" TB00r " 0C0)8M%'wYj7ghL`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc1:74_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&_DB?\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname0%%%%*%%%.%,creatTLS allocation failed, terminating <Q5vf9.z4 }Q5H@5UCmm};Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcG unvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array _xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rs J ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labels/b@o@9)d-|""9 *Ҹ, charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl=bk54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchaUQY9~~zejjlN<7]%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mn /usr/share/zoneinfo/Etc/UTC_strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf333333333JiJJ yYZJjJJJjzZZ  , OOOOOOOOOoGJo>AOc&`0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponent^gYce\Q_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG@#d  `\XTPLHDiea]BJ|xtDD0)m920HB;[[9############9YY99Y#########################m]_getpagesizeqsort_r__sfvwrite__sflush__swsetup*!*!__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup|333333333}J<<}0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk {__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEX\H\hX$,08@H T \ d p |ĴȴԴܴp ԳܳN`'P'<   `    (   0 4 < D L T \ d l p x                 ȳ  г, < xX ' D. ,D h    X / <  0 L \ | @ \     l 00% `    ı <( xȱ ̱ бԱ ر ,ܱ, hh    XX X  XP     $ ,4 8< @D H L .L P |  T X \\  d  l t |           IJ̲ в 0Բ 0ܲ0 0d  PL!P!9XP!`xT!h Y!p]!UL944 4$/ $/$/ $/ $/ $/L\LhtL8!ԥ!!!!T<<gnts Hrbmn|t0dtcidDp` <<yekdT$ atadloob x Բ!Բ!ܲ!ܲ!yara,<tPL(  ,DPht   ,8 P@ \hL4X\dlt|4<\ht(8DTTX\`ؾ!DHLPؾ!$(,48@DL\TX`hpx (08@HPX`hpx  4DP\h,D\p,@Th|0DXl  !bbh,dtЁ`؁,,dt`؁@!!!!t\d4X$tttLpTXLT t      $ @ H X \ p t |     2          , 0 8 < P X l p |                $ ( 4 8 X \   !  "  #  $, %(& '(0)LP*TT+X\,px-./0123704cLPhpx# 4$,L%\&hl'((|)L`(,48@P          $ , 8 L T d l      LL        $48DPTlpLTXXLL$$L _%C!!!!!!!!\%\%[%\% '$'(','0'4'8'<'D'L'T'`'l't'''''''''''''''''''''''( (((84(LLLLLLLLL@(H(P(t((((((()()<)P)d))))))))) *0*@*T*t*******+D+<+\++++++,0,P,h,,,,,-$-4-L-p-----.$.H.\.p.......//0/T/h/|//////000D0X0t000000 1 101H1\1p1111P$#  $H\`LT(X L$TXd!!!LLLLLLLLL '@&!@%"--&--(pD*8'Hm& &d. &D& -@%-l$#- &-T&F-P lY.į &dYf.&Ԯ-8!Xn-Hg.d.$8r4g.--LY.(nkԤ! -D&@%&---P&-tq-,-c- && -`g.-$A- -0&H/ -L&---<&&g.-fxkV.@& -(!8--!| &!L%/p&!H &--&-a%f4oK-\- &HVH&X&na%%&F ''HSPf%.~ nbnj(ljCcfnhnknlnmnononpopopoqorut&ovw.ow;oxdxzK?zCoB~CJToO^oPmoStoTViVoXoZoZooooo oo o \?op(Ti&jh&Lmhh$jp(ppqhpuhh$h< oo ooo/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin'}-+?=###%%%}''Va`hEVneFvIiL%lmCnfpbuŽFˎ֎qsh&ovVVx'@=Xl%\ `q%h ;pp%#=8d q%h rBpp%>` q%ds%q%q%h Epp%(Y(q%h %E$r%(Y(r%h ^E8r%\r%Xp%ds%Xp%pp%hq%q%t%q%@s%s%r%q%$r%q%pp%< 8+ 5< - v<  < 0 <  <  <  1< - <  << h4 A< 3 G< 4 &< t- M< B V<  Z <  e<  =< D d< d <  < P #< d [< D, 5g<  `< 0 g*< > d< = j< \' 2<  o< 9 v<  ><  ~<  >< ' ~<  <  < tC .<  < X< R?< > <  a<  <  < = \<  < 1 < 0 <  e< > < 2 <  <  <  o<  c?<  *<  < . <  k< & 6< t- < `* < 7 l < ,@ < d b< 8 < D <  <  < 7 < , >< ( < 8= < 4 b<  <  < A < * < ; < ,@ R<  < < < 4 o< 8 ^< | < 7 < ( X<  < + < hB < d < % &o<  < ,@ < d @$! %B   oOHH 8G 8J <<! < >d" tl! p " |" $3d CU  +U  ct .  @ @ s ?5 # #а+LEVFFPca-lcsh԰+ !"$'(+-.03569:0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ%%%%%%%%""%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it) % % ($7#/";>ɵFSYb;m *7u   #28  (6!9-7#A&fL)Xb5ket:~|%664 +,-.* ?ER"/./<'HFU 5DY  f&   WmkRkRkYcWbkCkc kG ky wb YMYrWca%+9&Z&x&b%@+\ &&B%+&'c%+/'Z'Z'd%+''%A+''Dx%(] 'ep%+' ((fh%+>(V(F`%+r((gX%+(( )hP%+<)U)iH%+\ x)))j@%hV ))J8%!X+)*k0%HTY (%HY K %P+)*N*L%T+l**m%+***n%"+***o%T +O%V +p%H0[ P%[ q%+'+O+{+r%"++++s%!+&,>,S%!t+[,k,t%Y {,T%Z ,u%+,,,V%\ w%"`+, -<-x%(\` s--X%Al+--y%+--zx%|+.."p%ta :.~h%!d+C.g.?`%c #X%X ..P%Ah+..H%H+..@%L+/0/8%D+L/~/0%(Db /(%8+// %4+0%0+`c d00%,+00%$(+c 00%$$+c 1*1% +J1d1%!+}11%!+d 11%!+11%(d )2%!+82L2%+f22%+22%e 2%+2#3%+D3X3%+r33%hd 3%!p+33%+424%+[444x%+44 5p%+5U5{5555557535566&686D6N6X6b6s6666666666s#6646677$7K-7=7Q7c7%i7*8p7y7777777777788$8108=8J8+ (press RETURN)V %%%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=,,-e^H-i^C-k^UK%D%X %t+ % %St% ST%+ S D%D (%L }%  4% %0 SF 4% $ SF% T&  % d%D%SF%( & SF% X' SF$%\ ' SF%, `(  %# T%F $%SF %L ! SF %N " $ %; %T%d/ S2$%F S2$%FS2$D%FS %S %S %S D%S %[%Zcd%uSF$%j( SF%fh% SF%j () - - . u   d  , u) - -  u8* e,* d g+ h \ * ^* ]+ _D+ m  <   CD D D( $D< /DP .Dd 9Dx C C C C C C  * 4+ d+ Wd Q@. R SD TX e|   O P` Q R S( TUP V xp | y <* =* >* ?*  C8 CT \ <    0- t- S* (    X    T F F ;F D CX Cl LFd* rFt* F* F* !*    ` ) 0   , |, , ) P + X, , j$+ k) p  - T- ) > ( T+ T* )  D* )   + 4, , + )   t P ,      x+ ) L 0  h <             u   | T ) ) ( 4 &@ '( ( ) t     %\       g v$ L t   g 'GHGXGgGCxkG1mSXpGsGwGGnGGGOIlIYKsLNN OWOP*PyyYKLYSYkY{YYYZZlZZZZZ[[\4]_]]q^`Cabc=een[eqfgg$h8hYhhhh$ii:YBjj k5kJkkkkkkkkk)l5lGllmmmnSnnnnnyn]pspp@qqrQrrTt;uuuQvnvvv!wLwxxx4y9y]yyyyyyyy zz)z8zFz\zezzzzzzzzzzzz {{/{F{X{r{{{G||||2}}}~~  ӂ݂5)G[wԃF$1CTfv˄!V`j&'t˅ۅ4HUdy†ˆцh #2GS_szLJև͉yFr͍ߍ2 !-6Kr#QuЏŐݐŐ AiEd}ѓ9J "\x}ۖ9Ma9Xp Y?jØXfј16(04EPfC՜  w1'INant xlzln x1::KUbn}ş%FZ4xۡ)0mP=¤6v` cܥ9tQ<+Aa¨J^ө)2CWI )3DTȬ׬' *;Mjalwέڭ *49>Pcv|9' ƮѮ'8@Kvlcyٯ"-:FKXgzز"Z Xi{ҵܵ>ܶv ` _ 5e/ d u| !z  m6E;0 10&7' ()*+,&.1/ftp@T_g@*S Qta 6>c #c ?c 7@a Q` A!T^ B&T^ C+T^ D FF8` E 3T^ F T^ G 6T^ H |T^ I] SY] S|] Sd  1uԉ 1e̠ uԉ GUdq]09\p ]9\  " -SSSSSSSSSC         5 5  s5     >   *            B9  $ KZ ( !9 "H #T $` %m &w ' ( ) * + , - - . .</w /0ܧ1 2 3 4 5F6 7 8 9  : ; <! =- >? ?M @[ [<\o \ ] ^ ^ _ _ ` { { | }  }6~   -dd-ddTdd:dd:dd  $@,@8`@HT(4<D#L#T#\#`#h$t$|$$$%%%%%&&ȶ&ж'ܶ''((())()0*@*L*T+`+l+t,,,,----.ȷ.Է.ܷ///6;;$000<0D1P1\<d<p=|=>>?222ĸ3и3ܸ3978 : 4,484@5L5X `! p" |# $ % & ' ( Ĺ) й* ܹ. + , - / 0 $1 02 <3 L4 X5 d6 p7 |8 9 : ; < = ĺ> к? ܺ @!@"@#@ $@%@$&@0'@<)@H*@T+@`&`l'`|,@-@.@/@0@Ȼ(`ػ1@2@3@)`4@ 5@06@@7@P8@`9@p:@*`;@<@=@>@м?@ `!`+`,` "`0#`@-`P$``.`p/`%`CCDDEȽEԽFܽFccdd e\e##$&4&D0TdhlptxȾоܾ(4\`dhlt|$0 4 @@D@8PX`ht   @@@@ȵ@е@ܵ``  @ f 33333333LL 3333\`dhlLUTC33P%Q%| L $33Lg.339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžp&|&p&& R% 33UU33UU33UU&tq(np4oX&&tq(np4o& @ &tq(np4o(& &&F- HPX`dpphPlp|x   @ 333333333333333333333333333333333333 33 33D &33 33!!- 0000000000000000 Z.3333t333333&&& (root)`33 _%C!!!!!!!!\%\%[%\%\%,!0!4!8!&`p tȎ؎ĉ؉܉ P`$@xԍdService unavailable8<A0aeabi&6KZ  "D;Ĩ7xܭoAYrV`.T`0 AP:D"MP(onѽ$/y;ogw|Rnݙ-R8oTmGt,m#F럜|QVf? {|L?n0ZVḎUqw"V[ͶRt{˽\0.<2\ޜ"\g4ׁgo m`j3ݽ}le{Vw^kx-:Zՠ{k3\ھSvU+:ramdiskbin.debugbR.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink / B(H((fRP@%!V@%!$b@%!gA%!ttt_%t/!(ya%1!`&!&!LVLg.!p!14!!!MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17494 17520 17549 17653 17759 17944 18056 18171 18275 18962 19221 19361 19397 19567 19608 19744 19767 19804 19849 20100 20196 20250 20349 20360 20397 20434 20461 20470 20504 20511 20536 20563 20598 20612 20626 20655 20669 20686 20695 20717 20735 20752 20763 20782 20808 20826 20849 20866 20881 20896 20914 20941 20968 20990 21029 21047 21079 21307 21381 21424 21470 21617 21773 21817 22096 22123 22482 22666 22818 22999 23146 23304 23325 23373 23383 23391 23402 23413 23423 23430 23445 23457 23494 23524 23563 23616 23674 23695 23702 23721 23742 23749 23771 23793 23813 23835 23866 23903 23925 23939 23985 24014 24048 24088 24123 24151 24199 24208 24217 24222 24231 24240 24257 24261 24266 24272 24276 24314 24323 24350 24370 24393 24412 24439 24461 24493 24509 24514 24524 24547 24569 24586 24603 24616 24625 24634 24640 24667 24674 24698 24719 24743 24756 24775 24800 24823 24839 24845 24857 24887 24895 24935 24946 24957 24968 24985 25002 25016 25033 25249 25553 26001 26217 26481 26753 26805 26841 26877 26928 26945 26983 26997 27004 27021 27024 27029 27038 27050 27061 27070 27091 27133 27171 27187 27218 27243 27278 27334 27374 27395 27415 27456 27485 27533 27766 27801 28008 28027 28064 28125 28163 28202 28358 28373 28419 28467 28490 28526 28536 28546 28557 28562 28625 28673 28717 28778 28811 28912 28930 29069 29091 29214 29228 29238 29261 29366 29422 29538 29569 29574 29600 29639 29649 29692 29702 29718 29733 29751 29774 29804 29825 29851 30048 30091 30095 30101 30107 30112 30123 30137 30166 30198 30210 30257 30307 30347 30374 30390 30399 30442 30448 30456 30460 30480 30497 30509 30540 30796 30845 31421 31448 31480 31508 31560 31566 31572 31577 31598 31614 31636 31665 31806 31940 31953 32089 32091 32093 32095 32112 32125 32143 32170 32174 32180 32185 32193 32199 32239 32241 32251 32266 32283 32317 32349 32387 32416 32445 32467 32510 32536 32580 32716 32718 32798 32844 32892 32997 33099 33138 33205 33212 33273 33337 33341 33348 33470 33539 33827 33965 34106 34187 34234 34240 34263 34309 34312 34338 34381 34446 34508 34578 34646 34739 34958 34983 34987 35023 35041 35069 35111 35155 35219 35269 35345 35367 35419 35463 35502 35536 35566 35597 35622 35631 35643 35651 35662 35674 35693 35717 35766 35783 35807 35850 36172 36175 36189 36202 36214 36221 36232 36239 36246 36255 36265 36282 36298 36348 36356 36364 36374 36385 36403 36420 36441 36463 36472 36482 36509 36515 36525 36544 36560 36578 36598 36607 36618 36625 36642 36661 36682 36692 36709 36715 36731 36746 36761 36782 36804 36823 36833 36838 36843 36861 36880 36899 36905 36924 36944 36964 36982 36987 36993 37010 37026 37047 37060 37068 37088 37112 37129 37137 37148 37169 37175 37187 37209 37223 37232 37253 37271 37280 37314 37337 37364 37396 37419 37439 37450 37482 37498 37509 37522 37545 37567 38075 38105 38136 38164 38178 38379 38601 38768 38855 38872 38890 38907 38936 38983 38994 39013 39035 39114 39306 39334 39452 39474 39615 39634 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17262 17288 17310 17417 17524 17725 17798 17882 17982 18477 18715 18866 18900 19035 19079 19218 19259 19304 19351 19595 19728 19790 19884 19889 19923 19957 19972 20000 20033 20040 20065 20083 20109 20116 20131 20146 20166 20206 20223 20243 20264 20286 20301 20321 20343 20358 20371 20385 20397 20409 20423 20446 20469 20487 20530 20581 20618 20803 20866 20902 20951 21042 21172 21225 21485 21532 21893 22043 22212 22352 22472 22604 22644 22691 22701 22709 22719 22727 22738 22749 22763 22788 22829 22862 22895 22930 22984 23009 23028 23050 23055 23061 23090 23107 23134 23152 23173 23195 23214 23224 23254 23280 23307 23356 23384 23411 23464 23474 23484 23490 23500 23509 23529 23533 23538 23544 23548 23583 23592 23623 23640 23667 23688 23708 23727 23753 23766 23774 23790 23821 23852 23873 23899 23912 23920 23931 23937 23961 23971 23983 24001 24012 24032 24048 24074 24096 24112 24124 24144 24170 24176 24206 24220 24234 24257 24276 24295 24313 24331 24554 24860 25278 25479 25719 25903 25981 26036 26103 26143 26166 26200 26211 26219 26242 26245 26248 26254 26265 26277 26290 26320 26364 26377 26390 26427 26441 26452 26463 26474 26491 26502 26549 26572 26621 26862 26895 27150 27171 27204 27257 27283 27310 27466 27472 27515 27535 27554 27583 27590 27597 27604 27609 27658 27696 27730 27787 27815 27860 27877 27978 27983 28060 28074 28084 28108 28231 28312 28422 28450 28455 28471 28500 28508 28549 28556 28570 28583 28591 28610 28643 28663 28683 28899 28930 28935 28942 28949 28953 28967 28979 28994 29027 29040 29095 29153 29189 29207 29225 29243 29280 29286 29294 29298 29319 29336 29347 29369 29547 29591 30293 30317 30351 30370 30415 30422 30429 30433 30457 30468 30473 30536 30657 30780 30793 30927 30929 30931 30933 30943 30952 30965 30992 30996 31002 31007 31016 31021 31048 31050 31063 31075 31090 31118 31162 31209 31225 31247 31258 31291 31311 31360 31460 31462 31527 31576 31625 31729 31827 31868 31959 31966 32027 32091 32096 32102 32211 32270 32521 32662 32789 32857 32894 32901 32928 32974 32977 32998 33043 33094 33153 33222 33269 33374 33517 33542 33546 33580 33597 33621 33673 33724 33796 33862 33960 33977 34008 34044 34078 34102 34126 34159 34179 34189 34197 34205 34215 34226 34240 34266 34314 34337 34357 34398 34697 34700 34714 34726 34733 34752 34766 34773 34780 34789 34799 34816 34832 34880 34888 34896 34906 34917 34935 34952 34971 34991 34998 35015 35032 35039 35052 35087 35104 35123 35143 35153 35169 35182 35200 35220 35241 35251 35271 35291 35304 35323 35336 35360 35383 35396 35407 35412 35419 35437 35456 35475 35483 35502 35522 35547 35565 35572 35579 35592 35601 35622 35635 35643 35663 35691 35708 35714 35725 35756 35764 35777 35799 35821 35830 35851 35869 35876 35899 35918 35945 35963 35983 35996 36011 36032 36046 36053 36067 36082 36101 36646 36679 36707 36736 36744 36781 37093 37270 37347 37364 37382 37397 37419 37469 37479 37496 37518 37577 37735 37759 37889 37914 38040 38058 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16083 16113 16130 16238 16348 16488 16562 16638 16716 17208 17428 17539 17570 17697 17733 17861 17888 17928 17974 18190 18314 18382 18482 18487 18523 18559 18573 18596 18629 18633 18658 18677 18703 18708 18723 18738 18757 18782 18794 18816 18833 18846 18858 18876 18900 18915 18932 18945 18956 18967 18987 19016 19045 19069 19104 19139 19166 19353 19402 19434 19482 19579 19712 19758 19950 19980 20302 20431 20571 20711 20828 20963 21007 21050 21058 21068 21080 21092 21100 21111 21138 21172 21207 21238 21273 21309 21356 21376 21393 21411 21416 21423 21448 21464 21485 21502 21519 21537 21554 21567 21598 21623 21654 21685 21720 21747 21800 21810 21820 21826 21835 21843 21858 21862 21867 21873 21877 21912 21922 21951 21967 21993 22010 22029 22050 22066 22079 22084 22092 22107 22133 22152 22180 22198 22209 22215 22221 22242 22252 22263 22281 22303 22320 22333 22354 22374 22394 22405 22418 22440 22447 22472 22487 22507 22519 22536 22553 22573 22592 22769 23053 23363 23543 23754 23942 24008 24055 24110 24154 24174 24203 24215 24221 24237 24241 24245 24253 24263 24275 24290 24309 24345 24356 24367 24406 24418 24428 24438 24448 24464 24482 24531 24552 24597 24841 24867 25121 25136 25162 25219 25253 25288 25430 25447 25496 25517 25533 25562 25567 25572 25578 25583 25622 25657 25687 25742 25775 25821 25835 25914 25919 25973 25987 25997 26021 26107 26155 26261 26295 26302 26317 26344 26353 26392 26399 26421 26440 26456 26474 26506 26525 26542 26699 26730 26737 26746 26754 26761 26775 26793 26812 26822 26834 26875 26920 26949 26970 26993 27012 27050 27056 27064 27068 27089 27106 27115 27134 27280 27322 27832 27840 27864 27882 27926 27931 27936 27940 27971 27984 27993 28039 28165 28256 28268 28332 28334 28336 28338 28348 28362 28377 28404 28408 28414 28419 28428 28433 28460 28462 28477 28488 28503 28531 28575 28622 28638 28660 28671 28704 28724 28773 28873 28875 28943 28983 29028 29103 29169 29204 29285 29292 29353 29417 29424 29430 29529 29585 29861 29985 30096 30158 30196 30204 30226 30275 30278 30299 30344 30399 30458 30527 30574 30679 30822 30847 30851 30885 30901 30926 30974 31010 31071 31125 31206 31228 31267 31304 31336 31360 31387 31413 31427 31435 31445 31453 31467 31480 31492 31516 31557 31583 31600 31629 31953 31956 31970 31982 31988 32004 32016 32023 32030 32039 32049 32066 32082 32125 32133 32141 32151 32162 32180 32197 32210 32236 32243 32251 32268 32276 32293 32317 32336 32355 32374 32384 32395 32409 32427 32447 32467 32476 32499 32519 32530 32545 32557 32576 32595 32606 32616 32621 32627 32645 32664 32683 32690 32709 32729 32754 32771 32777 32785 32795 32807 32828 32844 32852 32872 32892 32914 32922 32933 32956 32963 32977 32999 33016 33025 33046 33064 33073 33104 33120 33147 33166 33186 33204 33225 33239 33259 33266 33285 33300 33319 33864 33897 33925 33954 33962 33999 34311 34488 34565 34582 34600 34615 34637 34687 34697 34714 34736 34795 34953 34977 35107 35132 35258 35276 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..