08PC}i'&<  'C}itNP''`''. '.C}i'&P@@<@T 08PC}i'&<  'C}itNP''`''. '.C}i'&P@@<@TU C}i`''.yAC}iC}iC}iQ$f C}iC}iC}iRAC}iC}iC}i]AC}iC}iC}i^AC}iC}iC}i_AC}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}imKJ%C}iC}iC}iX`hpx$C}iC}iC}i (08@HPXS$=C}iC}iC}i`hpxP${C}iC}iC}i[Q$C}iC}iC}i (08@\IAC}iC}iC}iCC}iC}iC}iAC}iC}iC}iAC}iC}iC}im<C}iC}iC}iHPX`hpx\$C}iC}iC}i$C}iC}iC}i$>C}iC}iC}i$C}iC}iC}i$sC}iC}iC}i$C}iC}iC}iAC}iC}iC}im C}iC}iC}i$C}iC}iC}i $C}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}i$QC}iC}iC}i (08@H$C}iC}iC}i $C}iC}iC}i$C}iC}iC}i$C}iC}iC}i$C}iC}iC}i$C}iC}iC}i$C}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}iAC}iC}iC}i@Wa0rZJ6v'[Un;hKJ66;|X;F3N'Td$R7[RP5alF5IVJڤE']Y"ϩ'!'. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF@4F%4 (@@""Z\Z\^$^-^-4 ,,^$^-^-NetBSDKwGPaXU@SRHffffffffffffUVS( _-9s 9r[^]UWVSZ(]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*t(w]9nUWVS#(E@@9s{*v;9r[^_]UWVSW(E u C.M 9ME @E -t/tu|^-9s 9rEt E$Jl$J _-9s 9ru"$JED$E D$E @$;w$D-MD$ D$ D$$1ɉL$J$&[$SW(5u1ƃ5$tЃt]$k_[SWâ(4uYƃ4t|$]<$wkt(?t<$ZktЃ_[UWVSh"h"h:.$Q @0&1t:PЍYxOvh:.j 5XZ3h!%h:.P h:.j 5j]CUEU MsMU HE]ruUVS1ۋ2&tVPEZYu 2&C܍e[^]US]Ph"h:.QPh:.h"u 3& CtsPhׁ"h:.PjBUWVSE tuhށ")1URhc@5 D.|¡$D. t Ph"jdu#~h#]]ܻ#}~h#U#~h#WVSuQRPh"KE t#~h#RPh/"K u5$D.h="K1e[^_]U5 D.BXUjhc 5 D.{ t5$D.hV"j蓝1USRj EPS軹 xU:t Shd"j5]UPEU Ph}" JtPh"/EEEPhc5 D.{ t5$D.h"j1UWVSSuE H1ۃv>PWZYtC2&uދ2&Eh"W轌ZY1tFEEPhc5 D.z t5$D.h"jf1e[^_]USu Sh΂"j]UVS13&tSP5ZYtFSh"jߛ3&e[^]UWVS ]u} Sh}" } ~Sh"V.}1{EFE} t!v"F1UWVS`] u~ uh"Uȹ1Rhc@5 D.vE 5$D.h"j裘B.DPEU ЋU Шu>M9Mt65EE1EEEK>tt,uh"*1}}}}}E뺉t9Wuh"jΗU9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4Š3&5$D.hă"E }t*}uuuuM9~VQuh؃"j1ۉ]Ek]lSPEYu h"jĖ1}E1҉Uuĉu܋uu}}UUMMPh c5 D.t u EX@1}WuoX5$D.h"j聖EuPE4Š3&h#"DCE rh+"J^ElU9U|C.<EC.]"rt9U}I}s}u,@)1ɉMMf>hC.h&$CXZCtCPh$lC_Xj B^CtCPCPh@"IC CtC"PSha"0C Cts؋C4Š3&h"C C$Ph"BZYu WXEw1e[^_]UEDE.]UEE.]Uh"jȔUh-"j蹔UhD"j誔UhZ"j蛔UE E EE]„Uhjjjuho"+bXD.\D.Uhjjjuh"b E.E.Uhjjjuh"aLE.PE.Uhjjjuh"apD.tD.Ujjjjuh"a`D.dD.Ujjjjuhރ$ZaD.D.8E.WXuWh"j=SUY_u Sh"jzxxuSh("]hjjh3&EP7uu뺋hD.#H t uhB" PhD.WPZ_hD.t(#=t hD.t hr"$XhD.ƒtuh"<t?%t4!t$t hD. hD.ڣh"j膑 xD.e[^_]UVSPD.uX$E.D.(E.,E.D.D.;D.D.rgjD.$E.D.D.(E.,E.X=50E.u4E.E $E.)EU}t 13A}uke[^]Ë(E.,E.ut D.D.Uh4&h&$j蒐UUh4&h&$jvUUSË@4URs(PZYts$h&$jkS4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@u̎8uK ]USQo$9s SoIZSPEPIƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h"j衏C4WPs(Xe[^_]UWVS]uVh@D.j2C4uu s(P(8jVj2$8؍e[^_]UWVSD.}t D.D. D.D.EUEUEU}uHjD. t?11ҋ}9׋M} ytEU`E.dE.E`E.dE.ut(jRP5E.E.P Bu@u 5E.h"MuShD.Ɖ 19|8uu5E.h3"/8t5E.h&$j 11`E.dE.utTU܉EE܋UD.D.5D.5D.RPt%D.D.D.D.1ɉ `E. dE.5D.=D.9}u;9uu6E9D.u E9D.tD.D.|D.D.lD.D.9}u9utTE.t%=XE.uXE.5E.hE"XZE.t5E.hi"jی)u}D.D.+EUEUD.D.5D. D.9uEr uM}u}tURD.)P5D.( D.D.D. XD.\D.ut5D.5D.hD. ;D.C;D.7벍e[^_]UVSˋ |E.yQj h#RPVuV/+VShL$3(e[^]UWVSljӃ=E.t%tPhЉ"h V2h PVc =E.wwVPh؉"3w$w wwwwh"30wxwF.YZu1SZ5F.h&$裍h",?V VX1e[^]UF.tlPyBZy6u0?P5F.h+&h:.'h">>1F.F.tP訨5F.71҉F.YX1F.F.F.1UF.t*PAF.ZtP\5F.71F.ZYuUjhhI.h@:.[2 tjF.F.F.F.E.@=uUSUE F.E.F.ME.Ћ] Ӊ)~E.@[]Ã06$ 6&1ølbXND: 0 &    t øUWVSӃu]1G.2G.G.@ujjhG.hG.thɎ"h&$<Y^G.G.G.G.`G.)G. G.1G.2G.G.@ujjhG.hG.)thɎ"h&$1<XZSjjhG.k7e[^_]UWVSƉ׀:0BtjDG.u DI.C1 mCE @G.98I.؁}ULQM5DG.'ZYMUuXg0X2Phn#h:.Qh&18I.H8I.t $I./t1 @G.DG. 8I.u$I. u DG. KF @t.5g01Phn#h:.h"1ttDG. !uh"FP!Y_Vu Pƒ u$b0c-PVh+&h:.[h6"RuSRUǃ Uyl>!u7R2Zy4b0-PVh+&h:.hN"P,R/ǃ=,I.uWh"h:. tE)؍X؍e[^_]UWVSW11 D:.yh@:.1^u@:.P@:.s=TI.9 XI.8I.؁}U|WQ!ZYUu[a0+,Phn#h:.$h&m+8I.H8I.$I.tjJ j! =TI.XI. 8I.u $I.uΨu١XI.uDI.1ۉ߉ uG.XI.0XI.PI.uL:.@t?`0f+Phg"h:._hr"*f%L:.1PI.-fL:.9t{t XI.XI.PI.މe[^_]UWVSWPI.C{ u)ÃEPI.<TRP Y^tELG.9HG.8I.ށ}VR_ZuZ_0t*Phn#h:.mh&)8I.H8I.t1$I.tjtjk 5LG.HG. 8I.u $I.uҨu١HG.5PI.ljD s} us*ExtXI.M| thr")[oELG.9~VHG.8I.߁}WRZY=LG.HG. 8I.u$I."%HG.25XI.NjM}t1s2PRd¡HG._YtD } )s!LG.9|X HG.8I.؁}tVQZYK5LG.HG. 8I.u$I.svHG.Me[^_]UWVSQ]utuh" XZ} 9EueF95<-}h:.h%s]^XP^w<\u7\>t.ˆUPh"!ZYUtF-"" /B000CL 1e[^_]UEH!$I.EPhht@j,< x$Efv@-Efv<-U=G.uEG.E G.G.G.~9 1;H.~hܾ%]&XUWVSH.}t~} t 9H.~[C ~KH.tIS P>ZYtF=DI.tj jvPjjjWu8zu19H.uh"%X؍e[^_]UWVSP]U u hܾ%%XU19H.~BPSYX%KMH.uSwPux?]9tWsZu̸1e[^_]UE B.DBuh"%XPt[jH.t P&FXPPj/ƃ t9u =@I.u5!5G. Z PI.뛃=@I.u 5G.5G.WZYu5H.릡H.PP_XuPI.Hnt*ptlt PI.8 tK PI.̃=@I.uu 5G.5G.Y[9H.;H.@H.=H.PRPY[1PI.Hnt*ptlt PI.8 t PI.̃=@I.uG.G.9 RP>_ZBPI.Z=G.1Hnt@pt)lt1 PI.8 YWiSP+ h PI.뻃H.PP[^CPI. Znt1ptlt"PI.: PI.ăH.PP6ZYG.U=G.Uƅ=G.Uu h"G.;H.G.=G.9|9}h"pu PI.PI.Hnult PI.8 tσʃ=@I.uPS?H.PP]^_PI. Znt-ptltPI.: t\PI.ȃH.PPY[PI. Znt>pt)lt/PI.: ^P5G.5G.1 PI.뷃1=G.\Pnt,ptltPI.8 tPI.σ1=G.u7uD-G.=G.H0V PI.wr 8 t ك=S<[t<\t.RfZÅu!h$ { uh"*[1C뵉) K.9=K.8I.Ё}UtVWZYUu[40qPhn#h:.jh&8I.H8I.t$I.tj\jg5 K.K. 8I.u $I.uΨu١K.5PI.ljPI.=DI.tj jRP9e[^_]USPI.< u h" XH< u=K.u$h3"XJ PI.R8tڀ u ӡK.PKXu1K.t=G.u PrX9jlK.Yu(30#Phn#h:.h&eK1҉G.50I.S5K.¡K. t+h'hI.PR %5K.U1K.R]UWVSVPI.PPI.M1ۀx%u8HuzPI.=$K.h‘"[s9}ePI.PPI.$K.PI. \PPI.$K.2<  K.PI.M8 u$K.8I.ف}|WRZY= K.$K. 8I.T$I.tj8I.H8I.j$I.U5 K.$K. 8I.u$I.K.$K.$K.e[^_]UVSVu] 1PI. u 1ۉK.UPI. Uu 1q8u@PI.JπwEp01ɉj hPI.5PI.M vF08"uh"'1Zgu@PI.됸e[^]UWVS 5$K.]K.=K.}+$K.;K._&M 9}y;M)9 ڋEE8I.}RUujZYUu]/0 Phn#h:.h&N8I.H8I.t %$I.tj%tjK.K. 8I.U$I.uΨDϋ K.M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEW8I.}RUu3ZYUK.K. 8I.u$I.t K.M9u}EMELE B19uu)d9|T8I.ځ}tVuZY65K.K. 8I.u$I.adK.Cw9|T8I.ځ}tVu5ZY5K.K. 8I.u$I.K.؍e[^_]UWVS] SZ=DI.tj jsPӸCjPjuJt 1E1 K.}t9U3 98I.ށ}V5K.Y_u[+0Phn#h:.}h&8I.H8I.i$I.tjQjz5K.K. 8I.u $I.uΨuك=DI.tjj ] K.NjEpSP  9~U8I.΁}V5K._Z5K.K. 8I.u$I.=DI.tjj S舶 K.Nj󤋅  ?u9Ћ)ȉË ؍xK.9<t ttjPju'Ho8I.=}tV5K.ZY5K.K. 8I.u$I.~2 u)u thG"HXDžS=DI.tjj S, K.Nj󤋅 K.f Qe[^_]UWVSH.G.HH.1ۉ]1G.+G.9UH.@H.P藯uu PuƃUH.PP[ZK.3E8I.1SȰYu' 8I.$I.tjtsjH.t PFZPPjƃ t9]u 8I.u $I.uuEH.GH.E  Euh"XE tu RR x1e[^_]UWVSH.EH.E=L-t =H-uhb"FZo=(K.t e[^_])e[^_]UPEEjEP54K. U"h"Ph"h:.jUWVSf@8uVu1Q9#1҉hW3à #8#)tSWV e[^_]UWVS} 54K.BfDž<Y"1҉uJhPj ux"8j"8th#-ÍjjP @u;"8thϔ"jt#f8utSVW2 y"8#Qh%)AjWejfDž=8K.t fDž9DžjRj" fDž9fDž94K.jSV @u^!8tfu ftR.@ufDž=8K.uK"4K.@uσfDžftv@u KfDžMe[^_]UWVSQ}u VWnX[ZÅuzjj[XZu h "j!;s jEPW=ƃ ?tE8thh"ji!E 8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19}9xu90u,]9Xu]9XtyB݋EEEE19}9xu90uU9P uU9PtGA,Ck,QMuZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPY_}ËBt1UjL$qUWSQ-`K.v=@K.ڞv]=HK.]5TK.5PK.hՕ"jQ5\K.5XK.h"j9 5dK.5`K.h"j5tK.5pK.h"j 5DK.5@K.h3"j5LK.5HK.hI"jE$h_"jEPP$hx"j =xK.tJ=u@K.1 ujoeY[_]aÃ=xK.tUE Puj UWVS}u _Ph"j'3 K.B9tTK.e[^_]UWVS$ ]5K.t(V $VG0Y^ugh" j0Pu  =& yW p4$0ZtWVP u WhΖ"O5=&jj0։( y0h" jju ։ƃ A Wh V$=&ƒ jjW(=&‰ V,=&h I_Xuh"j[^jh h R(0=&y R[Y߉RDZ=t*w=bt%1=bt" =tu h>"11 Њ Јt u hJ"jYu V^ƅ/ t jZV8 jZVP1 fjjP% K.2tS SQPR(c%,9kPƉ4W8t t10hb"j  ^9s1BFu h"j 1e[^_]UWVS\]ƍ}ZE5,=&(,%%0^4S8HEPSUe[^_]UWVSĀ]p$tV9V/9Y^㋃p tVf9V9XZ㍅xP1RPuu蟵t5-9ΉЋt}"Q75-VPh"1e[^_]UWVS] }AƉI1RPuu t C|WjVȃRP<tCuPhė"j71RPuuf‹N tvkk ыEe[^_]UWVSTERELIu EEE EE؉1 t1҉Ƌ] ڋUӉe ƉߋEE$EȋEt\EU 1 t1҉E܉UEU}9}}}sE܋UẺU1}}t 9u9uEUẺUF uuuE,P# E =K.E ‹EJu EDEO1 t1M ϋEe ʋ}t}\SQE,#hz#5K.Ãt#EhSjPVHt h"R^SY`K.dK.E0PK.TK.E<1҉UEt E\]̋u)։]uEEIu E E1 t1WVuu般9E #E1҉ t1EUWVRPS9E EEEEuűE,|"Eԃ Et8"EL0wEԋPatELhaRuuPh"3CPEԃP2‹EԋXX9t"ERQuuPh<"jE؉EEEE̋UЃE܉U1ɉMMMċEE}$tWW}9t }O]K}9:t ] [}19]9Muu܋E,!EujP1Eă1EEËEt@d9s+tNjuE‹Euu}OEJUEMQRPuEPE]tXpXjuL5XZ9u9]EE@]k,PuËEY^k,tԋUEVFF E܋UFVEEtP4@0P,@(FVEƒEt@P@ltȉF Ek,Dԋup(ut H}P$]GVEXE`1 t1u}tE]9tE}?Et\]̋u)։]uE‹EyJu EE1 t1WVuu4Puuh"jxEtP @@1ҍMQRPuEPE0ju231ۋE;pEE9shI9uEtpp Euu܋E,ujP-EċE1 t1u}C놨u  EE]k,PuXZu E}ȉ81EEE9k,]Kt[ 1ۉX]]u LL\HX M܋]HX]]tK0[4K([,HX]KH B9EutC E@ b]k,D$uu܋E,{ujP`,EċEk,Z(EiB$ t1EUFЋ]EEt  E}U}ԄtOO9M}1ۄt_9]u 9MGEt\ű})׋E?E9Iu EvEEÉ1 t1RPWVPuuSh|"j/E]ȉKEԋP9Ut,E:uRuuPh"jE}8E}ȉ8}u}upK.tK.EE܋UẺUQEe[^_]UWVSuEP#F VM]_9EEr )ӉM؉]܋Fƒu]uFt 11ENjE9sPu h"jN͉1+MF@UtR UR)M]E9s )E]1]9؋]sU܋EЋEÍEeM1SQRPIFVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW}EEPhE$=&ƒyERPh"jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QYRPh/"1ɉM؉M܉<EPURvSOE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]P<E1Em}@K.@K.HK.HK.EЋUXK.\K.ẺEMEPh$=&ǃ yNTQWPh@"0FPh$=&ǃ yN"QWPhf"j1eY[^_]aÍL$qUWVSQ9qK.K.,K.K.?1|K.K.1K.K.1h"VW ta#DtNJC7K.뷃b$d<&K.K.CxK.CK.u57K.e57K.R57K.@K./57u|K.K.57TK.X7K.h:.h"YXp3.)lj80h:.h"XZ=K.x8th"5K.t hQ"jtjj)h "kh+jj[_@u h"jj h ">hj00h"@P詺@ uh"t|j/SHZYÅu@\@K.׉hj1hj%j`$8K.P蚿K.1urh "jjK.؉8hDj[803PtP3h("jW5K.HOG9=K.=K.tf95K.~WK.4!F_烽(ta1ۉ(,,9K. |K.d=K.tjK.xrPK.0jK.dh1҉ldPh K.$=&à t$v8: ha"j1 1ۃ=K.*;,K.,@XRjPjj(($tLPhI"DXP 28rt)rz rz04z('JJ 04zh P&UPK.TK.f8ZY9tFS‰Yt"Ph^"jF jPh"9 Phw"j$ ‰Ju tH‰R840Ph"1 tH89s`u[1 t1+049Ɖы0|9Ɖ4}LV 9Ɖ4|9ءK.40K.<0X108014߭0ݝ0y11WVRPb߭ 8=&ܝ0W=K.pݝta\PV ݅y؉RPh"M\`+EU5K.9Ɖ# >jVZY@݅u؉Ph̛"jK.ܝp =&ܝ0 YLRjP011RPJ$01tZL9rKjQ#^X090Q_|OlaGl막9skQ k4 JHJZH XH J HPW4 |0u|0tGlDhjP88xuxuDPh"Y[, 1҉D<5K.K.8Hȉ9r09rÉ014840Ph"840Ph"jS04 41119q09Ћ4N8JZ8<<u 8^9 +4i۷m۶R<8SPh_"DPhK.SW(~JFD\`HP\PhK.W\DH[, X049Ѹ4}u01480Ph"1ۉ8Y98r;D\`j\PhK.W\D𙋍09ΉЋ4}88SKut+4i۷m۶QRSPhɜ"kDPhK.SW$~FJ,TY8$D8tK.11҉VPh"B98~k,D$Aۉ<014߭0߭@K.@K.HK.HK.XK.\K.1XT011198t)k,ȋ0I9Hu0;0Putvt_|TRXR81RP}؃RP10P @ 9|0,PQpQRPjW'k,Љ1;P}0PTQXQ8)Q t p룋Tșڋቅ}؋ቅ  =K.t 1PK.k,80$98p09~Љt$DPSh"pPh$=&ÃQSPh'"j#tV:t&PhL"j~,.gPh^"j^,G$)08<11ۅt;k8tGpBuREK.-Xe[^_]ÍL$qUQ K.K.5K.5-<=&EM MuQQ$RPh"ʍMɍaUS]CtS P S tSPSCr s 觡ZS蠡 K.X]USEPsH) K.K. K.H1҅u0K.Z[9t K.uK.u h%"j*X4CXtYZ@]UWVSu EEE#-K.K. K.M11ɅtJA9~ʳ9M}#tK.h9"h<&hhH"7}9x4u }9x(u9p$t버tK.e[^_]UWVS]uuu SO trNj@thj"h<&h1GGWX9w(~6Gth"h<&hhH"wVw {G [^WYK.-;K.X=K.u =K.uBGWuK.GWtPK.WGtG4WPZWXK.j@jzVjzG _4E UG$W(G,W0wE #-G8K.tz8GC GtWP { _ Ge[^_]USEM Puh"h<&h4hH"]P ʉPHPPP s E]XPs2H K.K.K.1ɉH K.HK..1ۉXt K.HK. K.HK.P4JH8K.9t!tXYX tAP]UWVSUu }uWVRcËECUtK.RK.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQ0=& RPWVQ4=&e[^_]US]C%CSjSZ1]UE UMQ1]Uj8wUU P L.PYtHJ L.@ L.UWVS] L.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdnC`${sL ]e[^_]:UWVS uE EEEE% L.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRPQYY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jkËEEC1CCn]C^C !f1C C$hjjEhjjM쉁jhjjMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE螎Epd蓎u苎S腎IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPPYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu uL.EE % L.S0tK0J4 L. L.C4 \.C(tS(P, \.C, \.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"h<&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"h<&h)h"@륋B 뵋EEPfEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"L}t/EEtP1uuRPh"]9]tSuuuh"uuk} WY[9t$PRuuhO"̨u1҉U u XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRP\e؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"֥C(S,C S$]9UrSPWVh"訥nWVh "蔥 Z}t5EtC(S,C S$9Uu9EtPuh0"T EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRP+YEuuWVY9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWVX9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi"ۢ.uH‰?9u*_YӉ9u9u :9r 9r}thz"mh:./ZYtFpVtFHuRPuWEU}t h"sXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"象$\./t `d)RPh"z tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8j[E1ɉHEMAYAZA ?Z1ۉY Y$XZ}th4j[ËE쉃\XZu u =-ƉE} t h"mrX-EPjh WVuh4j.[ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4j\ZEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"qX@Et} t#h"pXu uuS9u uP~X SG~X]tS2~_13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhySXZ؍e[^_]UE Puj- UWVS]FHE1RPuu WRt C|}WjuȃRPVetPu h"\ u~ 1RPuu PtDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuQ€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhצ" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuumEt C|}WjuȃRPV~tPuh"u Ep 1RPuuCtփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSX$\.t C0S4C(jj\0uu Se[^_]UVSUE 9| 19[^]USPPhF"h:.\h:.h}"-CtsPhC#h:.\j@OUSSE] t$uha#sJZY¸tr1EEPhvd5D`. @u35@`.hfE#j]UWVSPu }t}~^hx"#SךY_DžtFh!A#SĚ_Zt)h"S賚ZYth"S袚[_t뫿}}uhg$vsZYuUEPhud5D`.> @u65@`.hfE#je[^_]US}tQ,Shzd@5D`. @u5@`.h"jөRP;9=vu.UWVSQ5.At t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$B.1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉M..ÉEE1RPWV 8E)Ɖ1UQh%HXZ}Ut.H9u.H99stBRWh"H e[^_]U塨-=.tvPh""H5ą.5.5̅.5ȅ.5Ѕ.h+"iH 5.5.5.5.5.hT">H5.h{".H Ph"Hh"Nȅ.̅.5-5ą.5.QRP5Ѕ.h"G,h"dN..5.5.QRP5.h2"G 5.5.h"G UWVSQƉo1ۉjEPV >u#ËE8uC8"u w܉1e[^_]US跖Pu$#Ph#Ph#Ph#PSh®"h:.J,j=UWVS ÉM衔-uhU"5- hk"jǘ׉ljEU}jؙ#E#URPQvBuAtV--=PuR< 3P5d.R< 9-uNE!5d.}e[^_]UWVSEUσ}u "}t"EU@uSh"&XZff=Ut+=\.t fuuSh"d*ff=u%Sthڱ"6*fLJ_f=Ut1=d`.u Sh" *Y^d`.tSh7")XZj(VP{3 x0XŃ~X .t\fLJᵃVe[^_]UWVS9.u.5.X1Xƃ.e[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEa"E$EtEu"11}=-E..U1҉U܉E1ɉMĹEEUԉӋERPSQ2PE؋UEUuuRP2RPuuЋE؋UEUuuRPi2RPE؋UEUuuRPK2RPuhi"?C,"uuuuuuuh"C h@:.jdh.s( u h"jhf#h.EY[.]슀.< <$u { Ћ B.DQu<-"j EPh.&Ɖ׋]hP.&S`E؃}Ph"S] tuhP}#SH t I =-Ήʋ .1WQRP0Ɖuh²"S u` .ω%.ƉuuEt5.1Et 5.Et +5.Et +5.EÉ]hf#S5DYZ؉E8 t,h.迁Zƀ.uh.hƲ"IA 59uE|E9Ɖ]}.uuuuWVh"AuЋ}u}e[^_]g_USE Puxh"@D:.HD:. yh@:.`Y@:.P@:.؃ t7@t( D:.y h@:.`Z@:.P@:.h"j}1Y]UWVS M -u h"jJƉ׋-ؙljEU}ؙ#E#UƉjRPQ]pBu @u--uhuP4 mR5d.P 6 9-uUjWV5-oBu@td.KE!ÍNju5-R5-y4 9-ue[^_]UWVSRá.u ƀA Mz΍. S}8PRn- . e[^_]UWVSEыEU u1#ˀ Ɖ+5.u}};=.}=.&"EUEUE9 ..}=.Euy.KlE9t 5.tމnʅu+.9UE}M1E܋E9E܋U}t+}t}u w{ƆoK"v"ȃ[^_]UWVS EӋEEh.@Ph.E 5.t h"j薏E9E|E9u|.] }) VRP+5.31fǂU }u@.5.֋M)}CsKSCPKSs FS.Ee[^_]UWVSEU} u }7M] M]9 .ą..19UtWtN}1E9ϋE}79}E }&"=.}u1BuEP.]Ã}!؉˃u=.u =.t=.Y}t. }mhjJ.[^u hN"jEfǀUE.EU ..EU ...t_}t E .Hu.=.hk"YS".=.;..EEU EUEUMxa] .tEV1;uE |9EE}=.}tEt뚃}.E 9.u;]t~.H.1+]9~ Fu%uF PPR' . *.1RPEU .+E.XZEU ..EU ..>"ɳ" -""e[^_]UWVSË@SuHt+5.=ą.9u9t h"VY^sǹ󥉍1󫍍@u({u "{t"Ph޴"股XZߋe[^_]Ã=|.u x t!1UWVS|Éסԅ.tPKYj/SL^ZuS5-h#%hԅ. > S ԅ.Yԅ.u hN"jΉjP.XZy5ԅ.h&$^XxPS'`ZY@tϋuи 9E} 5ԅ.h"V 5ԅ.h"Ah hd.S\- 9t5ԅ.h&$CY^4f=f.Ut5ԅ.h'"S>.ZS'.Xtj,e[^_]UWVSád.u1ҸD$d.f=.uf=\f.ut#d..d.\f.f.fއ.U.1tއ.[^_]UWVS á.fE򡴅....11t;f}t.E .16t.t9r $uf:t@9Ezti 9tܻՋ p.t.u$f}u=q.ׅu q.4=.t u)h9"Y d.uh9"hs%4XZ=d.t]f=\f.u1f.Ѕԅ.=.tPhn"k_XPh"ZYt 1=d. =d.uL%t́%1gd.tp1f.҅tSP5ԅ.h"=.t!1f=.u1 1f.q."5ԅ.hK"ZYu D$ve[^_]UWVS ˃uu Dž" Dž"@uhh"œZYߍ1jh"S9 t 1/9Cu苅9Cus Pj15 ;Cuă=.t.{ t(s$s sh"2e[^_]UVSPE-;-u*=\.u!URhmdPb y h#қX.11@uhŶ"B=d.u111Hd.~ فd.@uh"r^E.01C;.}. ...@uSh",Y[1҉U-;-u*=\.u!URhmdPa y h#Xe[^]UWVS(ÉEU EUE؉u=.EA"e[^_]711ɉt<u ȉh jhh?&P'O&tPQRhJ"x0 fu1k t Ph#hY"<0WVh#hn"0u =-RPSQPh"/Y[=.u! .9u )ȃ11ɉ=j-.j)n.XZt1.f}Ut24"J "Ph#Sh1"K-EPh{"<-~uh#Sh"- =.x@9uHh+&jjPRDRh"h#Sh",(R@Z)uh#Sh˸", 6)uh#Sh"u, ƒ< h=.[``.Mh#h", @ tSh#h3"+WVC$u``.vj!7XUhN"j} "CQh#Sh1"+RhY"+=.xx4"붍e[^_]UWVS=.ujjju u.B=.t+5. $ֿ#uVWh;"v* PVWhK"a*VWhZ"O* EU RPVWhk"/*PVWh"*$%PVWh")PVWh") ?PVWh")%PVWhƹ") PVWh׹")?PVWh"t) e[^_]UWVShEUȉM]t'BuUE$1ɉM$1uuuuE.E̋EȉEE #1҉UUE.fE9.~5 .EE̋E,EUE$1}$&E$1ɉM$1uuuuE=.u(}t"uPh"u(uuUEtuS&}t.Efu ukE }PEPD Ex.}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u.E1E EU EU}}E̋@ E1E}.ą.+EU EUE}5.=..E.1҉EUġ.19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡 ..)9E]| h"u}ĉu} 1E} lj}.1҉EUE9EE |K} u}t?1@.t&.19M} |.9M} |1EEUEU U.t4.1ۉΉ.9u} }9M} |1}E}u.9EE ą.|=.uh:",^1>E.E }uEEjhjjjщ¸H"E .EuE1ۉ]]]] }t# ..EU...ą.EU11ҹuuRPQUM |%FEU+EU ;E}EE}]u)։]u}tq=..E9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령.19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu hN"}u}tEEM9Ɖ}uM..1RPuutҋMu 9tۃ}u E9uWVjjRUZ;$EUEPuhm"hv""h@:.jdh.1u h"jth.cYvEHƀ.t'. t9EEHPh.h"v" uh.EP8 EUĉEU EE}tjuuu uUEKjuuu uUE.tuk=.t Ph&$jSPouN}tjuuu uUEjuuu uUEYt Ph&$js}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE .. .;] u1;MtuuEU G_Z .UׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }P5 2=.t h" YuEft=.|=.h"Z\E̊@EȋE̊XEȍE@‰.p1WVjjj" E1ɡ.p1WVjjj2"Ã(Uȃ?1ɋ5.1WVjjjA"}̊MO_U? ˆWGEȊ_EȍG‰.p1WVjjjR"xE(1ɡ.p1WVjjjb"QËUȃ?1ɋ5.1WVjjjn"-}̊MO_U? ˆW(}t/=..t Kx .u}ˍe[^_]UVSá.u h|"$X1ۃ=.u Sh_#Y^jjڸ.CXZu҃=.u=.th"J$X1L=.th"u Sh˻"Y^ .RP1҉XZ=.tC.9.A=.~hѻ"B5.j5.5.RP믅<f=.t3h"~#^hػ"[q.t=h#r.Y=uh""k Ph"XZ hv"Xhm%#X=.nPh#"_Y[=..PPh?"? j=l.t>u Sha""XZ9.} hz""X;_ .RP1҉u Sh"Y^jjڸ.XZe[^]ËUTkPh"h:.HjUWVSĀ|xtH.wSh@"h:.jS%'EZuhX"+xƉjRP|K9u9thj"3jKSu|h 9t"xthu"h"2Xj1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4`E&h" .fEEE . .19E~[tP9}u1M;u&}_PaR.4`E&h"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaR.4`E&h "7 }9sf}wfE@f.u4`E&h<"Y[|}tFaP4`E&hh" ttt111E}.}....fŠ.E]9]E@ƒt<u.E}tхtu|EZE]9]uu2,XEe[^_] :.yUh:.j XZá:.P:. UEU 19s f3P]UERPZYUSBHBy;B| X RQ^XZ]UWVSQ]u uh'"SF fw4F&h"Ph."S FPjh8"SFPjhD"S Sh&gXZFXt ShQ"gY_FXt Sh\"gXZFXt Sha"gY_Sj 3v(hj"S?v,h|"S1 v0h"S v8h"Sv4h"S$vS6EXZEE FEe[^_]UVSSPPVu ujVShr%u,@uLSbt"t"=b0,Z"t"PSh"j+cj8UVS]u VSYZu Sh|"j*c;/t"Sh"XZu E"e[^]e[^]UC`Ph"h:.7jUVSPh!A#P[^t,PjPuVV3t jP6ZYS.Xe[^]UWVS EEu EE}]EEE1҉.!&1ɉ ..h"Vug@ NtJb$I&1=..ċ...뗡7.jWh`I&57u h"jaP~YYȋ.Jp3.4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP<XZt1h$9}PPZY uċ2jWShVx%r@uL*_t"t"_0)^"t"PSh"j`t@t.Z=.HDž"=.tDž".t "$P=ȋ.t A%=ċ.t "=.t 1$1ۉXP]h"h&jR_Sh"h'"VRu h "j#_j/G P!ZYt|# Sh"h?"Vtj/C P!ZYt| XjUVS]u VSeYZu Sh|"j}^;/t"Sh"XZu E"e[^]e[^]U[PhW"h:.j@UWVS]E1҉ 11ɉtp1h"u u< athg$J&57ECpXDžp57CtX57=CxXDžt뀃K|wK|njuhK&57ju h"jE]P_:p3.P;UtM |u4uWEp ЋttKxPWZY@u Wh.$jG\ptECpNtECttt E%Cxe[^_]UWVS SVpPtWu u1hWpSh"n,@uSVh"jG6\r@t@1RPhJ&hSSh" (jUSP]jEPSxU :9uySu h"j~[]US]S Zt@ h$#SZY]US]S Zt@ h30%SsZY]USP]jEPS}wU 9t :uy Sh"jZ]UVS]u VSܱYZu Sh|"jZ;/t"Sh"lXZu E"e[^]Ue[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RPrY^CSt RP]Y^CS e[^]UWVSӋEU ΃tt RP!Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]UWVSEUˋuE $EE tH$HD11E ~E}ufCRVڋE E lWVڋE E }t}t#RP_Y`}tDɉ"%XZ"t9t h\"$X9}+uh"$^_ދ9|<t h"$Yh5.h"Džx ;rh"%$XZu8u t h9"X 11  ˆK1<1P1HL@DK@#_tM⋅9t Phl"#Y^Ht2{{ @D0{{@D}"Zt⋅9t Ph"Z"_XzG1t{${Q!^t&XZ$t CpStCH\Ɖ)ULƒu 1Ҋ t1҉RP @ȋ+tC@SDC,M)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t Ph".^_@ tFC8S8tGpBu_ Ex.-Xe[^_]ÍL$qUQ p.l.5h.5-<=&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s ZS t.X]USEPsH) `.d. X.H1҅u0|.Z[9t .u.u h%"j7$X4CXtYZ@]UWVSu EEE#-x.h. t.M11ɅtJA9~ʳ9M}#th.h9"hR&hhH"D}9x4u }9x(u9p$t버th.e[^_]UWVS]uuu SO trNj@thj"hR&h1GGWX9w(~6Gth"hR&hhH"wVw G [^WYX.-;t.X=.u =.uBGWu.GWtP.WGtG4WPZWXt.j@jڿVjпG _4E UG$W(G,W0wE #-G8x.tz8GC GtWP { _ Ge[^_]USEM Puh"hR&h4hH"jP ʉPHPPP s E]XPs2H `.d.X.1ɉH .H..1ۉXt .H. .H.P4JH8x.9t!tXYX tAP]UWVSUu }uWVRcËECUtp.Rl.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQS& RPWVQS&e[^_]US]C%CSjSZ1]UE UMQ1]UjEUU P.PYtHJ .@ .UWVS] .C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd{ Cm ${sY ]e[^_]G UWVS uE EEEE%.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRPYY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCaCC !1C C$hjׯEhjȯM쉁jhj趯MAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE Epd u S IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRP$YY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u.EE %.S0tK0J4..C4.C(tS(P,.C,.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hS&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hS&h)h"@륋B 뵋EEPEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"/}t/EEtP1uuRPh"]9]tSuuuh"uu } WY[9t$PRuuhO"u( 1҉U u XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRP輡e؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"nWVh "w Z}t5EtC(S,C S$9Uu9EtPuh0"7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRP8EuuWV%9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWVԝ9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi".uH‰?9u*_YӉ9u9u :9r 9r}thz"豲h:.<ZYtFpVtFHuRPuWEU}t h"XtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"Ġ./t `d)RPh"] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jE1ɉHEMAA A 21ۉY Y$XZ}th4j譠ËE쉃\XZu u =-ƉE} t h"zX-EPjh WVuh4j;ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4jiEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"X@Et} t#h"Xu uuS9u u] X ST X]tS? _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWh4SXZ؍e[^_]UE Puj- UWVS]FHE1RPuu dt C|}WjuȃRPVetPu h"\ u~ 1RPuu ĕtDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVhצ" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuzt C|}WjuȃRPV~tPuh"u Ep 1RPuu݈tփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXĠ.t C0S4C(jj\0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRP變 e[^]UWtBRBR t RP^sY_}ÊtBRtUWRP3sY_}ËBht1UWVSӋEU ΃tt RPrY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRPg e[^]UVSuE H$X(1y9)tNp1SQRP e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDž Ep 19}5uWSh"* EzBD1H)CNjE_dE@ EDžpā-pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G``E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hS&h("jEÃd$S\DpTtt RPnY[B^UEMhSQEjXZSbdtuufnY[EUEUDpTtM]19 }9Erp@dxÉ1 t1RPuuv{1E URjW1RPVEEtH`Xd EH@E_Ή)׋EzEtIu EEu1 t1RPWVz1RPh"E‹EE@ EEEJEtp`xd @@ƉEӋE‹E"EE.E؋EE)߉ЊM1ҊM t1RPWVz]K!E؉wEtp`xd @@ƉEӋEB‹EE܋EcE)߉1ҊM t1RPWVy1uk]ӃK 1;{E@ r EFE@4uPEBHEMQjPjjRqt Ph"k[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋E1MIdQ}u}u E M̉H}tZCr{<uX.C`.d.C@CC sh'"hS&hCh"jS1[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋENUr,z0 t1EtpHxLp4Ġ.6AM̃HEEЋE1RPuufƉ׋EƃEۋMtEPjuރWVQtPuh" EEЃE̋]s E1RPuu3e€}trzuЉ}#Evkk BEEԋEMq,y0 t1}trzrC4SPZ}u }u1dE ]Ћu)։]ЉuԋE‹EJu EjEu1 t1WVuupeEЉUԋ}ЋEFHEËE1EURjS1SQV]tPE1RPh"PEf‹Mq EJu P! 1k}t)؉}u"}uA1 rEF1ۋA r EFA4QPX؍e[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVoFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh@"hS&hhe"MЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuha"hS&hh"MGuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQ-aӋEE}tEEPjuȉERPu"tOPQh" EE@ EEH1ۋEtGW SQRPi_*EEG1SQRPH_}vkk ]Gju蕦hDuVuhDuVuy(hQFuVuehEuVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jLdƉ<WdFYZuWhx"1= .PE fF81FF u Ejh"S! uEjh#S t}~Eh"EPhrWh"EPhrW =.t="}t"PVh"Z }uE4lW&Vh"Z e[^_]UWVSÉ`dhPzlb1󫋅dhx|h"VhrS`h!" Z|xh:"Y0tplhq"Y"u"RPh"Yh"YDRPh"`Y0Ph "KYXZ"4t"Ph3"+Y84lW&hF"Y1:uu Wh=#h:.'>ECWPh`#uV e[^_]UWVS=P.th:.h{#^_1;5(.,.sxWVY[uۀxtV4. s؋X tf{u0=T.tSPh#h:.b=SKZSrXZ[5.t[^ tO{uDf{t h#SVY_=T.tSPh#h:.=SYSXZ[뭋v$롍e[^_]UWVS=P.th:.h#^_.1.t#{ t{$C$SXSFY[مuȋ.th#SU[$XZe[^_]UWVSPP.=@.Rut6h:.h#n#th:.h(#Y^_5<.uY[jj3RƉס<.EXZ(.9..,.WVRƉXZ..9ƉsIWVYXuWVh=#T S1PhM#h:.;fcWVQƉ׃9u9tRPWVhd#h:.];DRWV5XZu h#SYCu h#STXZCt S XfcXSPDfcY[<.U9Pu}@De[^_]UWVS=P.th:.h#Y[f.j+C jjPEU(.,.RPPEU5.5.PƉXZuuoPEUuuPEUE9EEEZE;.E.sff.j1+OCd [E;.E.rj9<.uB95..rC$ <.S9u<.9(..9ƉsQWV`XYuUhc#QXURUPhM#h:.E9UfbWV^OƉ׃11 9uEWVXYuUhc#aQYURU~PjBUfbXZ9<.t *B_WVde[^_]UWVSjjY[u=P.tQh:.h#蹅[^>Ã=P.th:.h#蛅XZCtSPNfc_X[u릾1;5(.,.WV ZYuыXtCtNPPE xu SbjSXjPPiPfc[룍e[^_]UWVS=P.th:.h#资XZ1;5(.,.sJWVKYXt3fSЃfC{u ЃfCft h#SPXZ[Ƀ릍e[^_]UVS]S^uSh#h:.6 1Ouu Y[19Åt 9t@uu hC#$O ~u}t h/#V!PXZ؍e[^]UWVƉjhRP.t9xu9pte^_]UPhX# 諃ZY8u"h|#h#5.h#h:."6j(UVS@fC5.=~D.)fĬ.5Ȱ.jhh.aHHt -X1.1CPS.Pz 5.C𣤬. e[^]USjjj0uFh%PclZYt1;=(.,.r%=T.@ mVZX=D.E}tPuPuS uSEZY~/9jPuSjSh #h #h:.\'EPSEPSE=.tPuuuhc%S#E PSY[ff~ u7 Z5İ.AXe[^_]UWVS}E U9ÅuWuu h #!?hhWƃ y@Wh!"h:.&h:.|As0l> Ph#h:.e& 1S ѡ..0BNj[Yځ~RQW @u55Х.5.5.h #h:.%:s0= Ph #J=D.uURQV9 @uG5Х.5.5.h #h:.%r0{= Ph-#h:.t%$j%W;V5XZe[^_]UEU ]U:= -#tjjh -h -U= -#tjjh -h -1UWVSƉ׉˅ut;5(.,.rWVh #= .RPWV .s{ S$=T.t [$t9{ u9suh' #S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh6 #P=XZUWVu} u1tC;5(.,.s..RPWV.t;x u;pt@$e^_]UWVu} ut;5(.,.rWVhW #; .RPWV.t H$9x u9pu 1pp P$WVht #; e^_]UWVSujj[_ÅtJNJ/t tF@PW3aZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P諳_Zu1,VeY/txtEVh #:XZEe^_]UVSu~.F.9s%)P6S( jj&9tC/vKSh #:XZ؍e[^]UWVS}u h #j:[u^YƉ<.uE5.* Zu h #3:X). .9r ...uS؍e[^_]UWVSu.uE5.) Xu h #9X.Lء.19r _$(uËC$. 1ECIDžuQ}u} ujjY_t Vh #@9XZVV]_C[ٸ1Xj/V襱^Z@PPT]C{G C_ Y^Et5uu YZYƅu h #8_E UCS FC^5}u} t)uu ZYt h7 #8XًE U7؍e[^_]US]S\Z..]UWVS]f{t hH #SG9XZ{u&{t h[ #S.9_X{ t hx #S9Y^CS utcRPl_Zuh #S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h #S8ZY3.C$.Xe[^_]UWVS]E 8ƅu h #Sa8_X9stsF C^ j/u 辯ZYx3WƉWb[C$19VPP]fSЃ߅uЃ fCe[^_]UWVS`=P.th:.h #}kXZ=D.(h"u^_u,k06 Ph #h:. uh #g6fc 195(.,.rIMWVZY‹Mt,AEJSBPj2UB0UR̓1E1}E9(.,.EuuJZYDžttj$GPEP,uGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP/눃EUU1 .9~(.1tBESjjEPH/G΋E E̡(.,.EUMԉuС .$.E؉Uܡ..EU8.ESjj(EP.C @t,i014 Ph #h:.*uh #4S6Xe[^_]UWVS=P.th:.hG #iY[}uXjj5,.5(. .jP' ._Zu ha #4^jjjhm%fHwjju}ƃ y,h0]3 Ph #h:.Vuh| #3xPV{@Y[y,h03 Ph #h:.uh #t3EЍXjS%' XZu h #Q3YSWV  y.5h02 Ph #h:.uh #3j(PPV\  xVo@.Z =P.t R3C4,-h#h:.t}t?SHK))PDPPCPVwrB#uSHK))PDPPCPu^r"#<SHK))PDPPCPVq1#4@{h#PNZYth#PNZYt^CDtu%Pu讵ZYS#$PjV胴 ^#PjV޳ n#@uY{toCDtu%PuUZYS#$PjV* ^#PjV腳 n#@t=T.t/Rh#h:./ =P.th:.h#E\YXg=P.th:.j XZe[^_]á8-x=H.t2UPXUWVS}u 1.L.=.t3}t h#&_=<.n1ۉ1.=.tj@.KT0 PhX#h:.j`jؙRS58-3Bu@t…=P.th:.hq#S[_=.u <.@1҉<..PYct8. PVh# +hh.5.V  .h5.u..@ .e[^_]UWVS8Ã=X.FC=TtP=ltIʁlt=Tt1#=.u$=P.th:.h#R_X.t=.WȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPZYChs,s(^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC0 PSh#=H.th..PYuW5D.u5D.EhhhNhf ~jVEPS5D.=H.u=D.tNeEPh..P SOƃ tVURP.0h#h:.TvӃ}u}tEP5D.XZEP5D.^X=.tuuuWhV"Su5D.ZY5D.Xe[^_]UVS E졨.EEEf.=.t=.Tt h6#[hK#Y=L.uh`.Z/L.EP ËEX؅t185Х.h#^XUv"E-EF .9ӋUu9u.HtW5Х.h#CY[݃=.u: . EEUPE0 u]ËMUʉU^ZF(.,.uuE(.1ۉ,.$M u9t5Х.h#ZY1L.e[^]US|=P.th:.h'#C;ZY=H.tjjh. =.t 18-@jjh. 8-y&';0 Ph.h+&h:.<.H8.B.. \. .9~ D@1ۉ. =H.t RQZYRQ58- :0 PhH#Yt!hh]#Ph#h:.j 8..=P.tPh#h:. .uF . . .X..uh:.h#vh:.h#9[X=.tBT=X.tk..11.=uI)У.=P.u =@.tu. . .$.....EPhm%肥ZYy#(90 Ph#h:.j=E荐w<-<-PtPh #h:.uj=.t h:.h#R.au,=T.t5.h#h:.- hA#X=.th:.h_#58j0.4.=.u4.]UE Puh:.b UVS]u =D.u0VSZYy#70 PVSh#h:.y=P.tVSh#h:.Ze[^]UVSuD.u8jjhVQKy"70 PVh#h:. %=P.uVh#h:. ؍e[^]UWVQM1y;5(.,.s!WVZYt xt@uωeY^_]UWVQM1y9s!WVQZYt xt@uωeY^_]US]h#h..XZCth#h.@YXC th #h.)XZCth#h.YXCth#h.XZCth #h.YXC@th&#h.XZ.]UWVSQMSZt$1tH 4.r11Sh/#h:.@ eY[^_]USuhF#h:.h:.  .HQPy PWY J t .Hy P4Z J: t .@ t1yt nw1y]UE Puh:._ =L.u(h"#{u"$Phd#h:.sht#h:.S8E E#]UVS]s s:Y^1t 9tF@h#SXZs sVh#h#hh.*.e[^]UVS]C t h#ShXZfK SnPV/3S\PPt!C$;PV$e[^]UVSu~t h#VXZV X=D.u8hSPZYy'fN@10> PSh#h:.6=P.tSh#h:. e[^]UWVSuj/VZYDžtDt>(- CtsPhC#h:.h:.hq#(@-XZ CtsPhC#h:.h:.h#'j)UWVS]} t~C7hx"#V+YZt:h!A#VYZt-h"V YZt#h"V^Zt1 @uhg$wZYt|1j}Wjj5 .e?E? EEEPWS5 .5$e[^_]US}thjEPjj5 .].?wPh#XZ@ڧ"@t#RPh# ڧ"y#P5.h # ڧ"}y#P5.hH #l ]UWVS(}tE 0^iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5 .e[^_]UWS}t&]U1E5jh'jjjS5 .e[_]UWVS ]} t~7hx"#VYZt:h!A#VYZt0h"VYZt#h"V^Zt뮾 1uhg$wWZYt|1j}Wjj5 .e?E EfEEEPWS5 .$e[^_]U }tjEPjj5 .7M.ʃuPhu #VXZB#tڧ"RPh #7 ڧ"Et#P5.h # ڧ"}y#P5.h # UW}t?U1jh'jjjR5 .}UWS}t]U1Ejh0ujjjS5 .Ve[_]UWS}t]U1EEjh0ujjjS5 .e[_]UWS}tc]U1Ejh'jjjS5 .e[_]UWS}t]U1EEjh'jjjS5 .me[_]UWS}t]U1Ejh'jjjS5 ."e[_]UWS}t~]U1Ejh'jjjS5 .e[_]UWVSEEu +EBU܉EPo XۋUu h #j"1ߋMEfEfS1j EP6 U:t6h!#jj"TTdDG9}ujh0uuSjEP5 .]e[^_] UWVSEu h Zu h*!#j!1 1ۋ9}J jQh" ujQhI!# uCu 9}OjSh,% ƅtIjShO!# u'jShT!# u4ƅ7fDžjh0uhj P5 .ƅx9t h]!#V`YX$t h"VXZt#t h!#VYXhI!#VXZh!#VYXu h!#VXZV5.5 .5.5.h!#@t6t`f@fÆh!#V蓲Y_ \f@fÆh!#VdXZ-f@fÆhE"#V5Y_u hv"#ZESh"Vh&$ pރV׃X9uEe[^_] e[^_]UVS ] }t%3hh#V ZYthw%VZYu E'j EPV ;E U:uy 3h}"#Tshh#VZYthw%VZYu E-j EPV:E U:uysh"#j+EPhU5 .G t h"#j/e[^]UVS ] }t23hh#VZYthw%V ZYu E'j EPV:E U:uy 3h}"#Tshh#V ZYthw%V ZYu E-j EPV9E U:uysh"#j8EPhU5 .T t h"#j<e[^]UP}FE 0EEPhQ5 . t h"#jU}tjhQ 5 . t h"#jU}tjhU 5 . t h"#jUWVSEE܋] h E^u h"#j+U 1E1E9}t3Vh"#C ZYtNVh##2 ZYtAVhw%! ZYt4jEPV> U:u=v3h ##j1EGEEjh0uhuj EP5 .C E=vhP5.h'##-E1E܋}9}t}E܋E}܋}]܋TʉȉljщÉ1Љ1 Ӊf11 Ӊ1 SQ5.hE##{EEe[^_] UWVS] }~j PW5 . Rt$Nuj@EPjWU0PhS##j<j$pPjj5 . EЃf=t Rhv##XZ91׹󪉍,ƅ8fEf;}~lj 0P36ƒ 08t3h##jD,ƅGʉLj Vj5 .p ƅ9141}u"jh##s u ƅ5jhtj4Pj8P5 . <h##h:.o[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5 . @u h##jE<u 5.h##<u5.h##h:. ~<tP5.h##h:._Pu󥀽_y-`9Y&CSh$#h:.n j mRZ<h$#Xe[^_]USUBBPJ R Ph.$#t uE7$#]ShN$#QXZ]USUBBPJ R Ph.$# uE7$#]ShN$#XZ]UWVS } 11;]}#j4hT$#_ uCPQ1󪍕JƅPƅTJjh'jJRjS5 .QjPj!gW,jPjAPjRjVR VRPW5.5 .5.5.hX$# oQƅRjh'hVjS5 .ffЃf=v1RLhW HLRhW LHtmQƅRjh'hVjS5 .ffЃf=v1RWhWh$#Whm#LgQƅRjh'hVjS5 .fff=v1h$#X1G9 5Ct9C LHD04\Z&h&h %& {y0L%`vRh$# 4@Z&h!%YXD4Z&h "XZ1ҀHu6C9s!DLPh((#LBYXj XCPShSSe[^_]UWVSEӉʋ}EE]Z&qtE8uE8At;ˀ}@utQhT&#WR迿"QEPh{&#WR訿 WVR  e[^_]UWVS@EU u}JvXuW4`&V u.MP @ j@MQ4`&h%WV~xPw(t|f@Ph&#qf@у@t%&#t3#RPSh&#WV藾T&#t3#PRh&#WVv3f@Ph&#WV[JuP @ W.X1e[^_]UWVS]hpVjSPh'#T{vTh'#AY {yj h#'#)XZ,C@tPh8'#Y_,C t PhH'#XZCȅt Phj'#_X{w j VCȅtPPh}'#躾 S C h@Vh'#蘾C t Ph'#肾Y^hpPjSǃt Ph'#XXZj pX}it;} } <;u GVh'#YXujh(#XZjh(#^X79tR;U }MuRlh(#躽ZY1ɋlhlPh$蕽hAlBXXh?#Xe[^_]UWVS] }uh (#W^X1C9~D3Ph'(#;FZYj PX}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u @u h##jEtU.<uRh># <uRh?#h:. #<u jSRPRh?#h:.jve[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt32uBIttyt ut< }]9t` y_v4m tN\ 0H2N0H2N0H\um tf\\M t@BX[^_]U2 Ph9?#h:.&j走Uhw?#GUWVSÉ֡.P.uhh.5Y_.h?#h?#hWиh"W5_Zu h?#Ph?#j$ <.u ?#t#h.RPh?#P1X9ډ}Hh8.9: $h?# .Pjh.k;9}4u #r2jPRU Utj@uVRPV3hME#[GjEPjh .RU: Uu}u7}u1}u+E9Eu#/tj@uVRPV3h]E#jGM1EEe[^_]UWVSVUu=l.ˋh. `.u'. T.h.hmE#hY[=p.u %tDh:.jSuLu5Ћ-Ph % u Ph!"XZ=`.~tj XڋEe[^_]1vs9}E8Ph((#蔦GYXt VhE#耦XZE e[^_]錥N@e[^_]UVS]EjjEPuVuu @u e}t ShE#j*`. h.tjYY2=p.u Sh!"ڥXZuuuuuhE#迥e[^]UWVS]uEEU E$E䡀. T.=t.J`. h.t}jjEPjuV @tdMt]QM XtMMMjjEPWuV׽ @tM;Mt W, _j.`Y}e[^_] }tuh.hF# = t)tu*ShTF# uShF#Sh(F#Sh~F#XZe[^_]UVS]E jjEPuVuu @u} t ShE#jQEUEU `. h.tj sXP p.u EP$P5Ћ-Sh[&&IuRPh$ϣ uRPhF#軣e[^]UVS ]EjjEPuVuuB @u}t ShE#j|`. h.tjC=p.u5Ћ-Sh %' =p. h uuw t P蓩XuuhF# e[^]UWVS,EE̋}uu<=.t3EjjEPEPhF#E܍Pk((U܉UȉMQM5 XۋMЋUuwM1Bt(jjURPVW @uEԋU1Ƀt();EtuhE#juދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhԋ-uhF#jUR UUС`. h.t6j(EYU܃(t Gt9|]e[^_]E =p.uuh!" XZv$v vvvvv vv6hF#,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|PhF#W|<Dž|tW XuCxjjxPVph轸 @ult9xt ShE#jl%EpuEjj_X=.t=19|Whԋ-ShF#jUR$ EjjUG ŋ=`. =h.t jL=p.u4Sh!"+Y[%t h%#Zt4Wh.G#G9|j Xue[^_] e[^_]ÍL$qUVSQ$EjjEPuVqq b @u}t ShE#j`. h.tjYd=p.u Sh!"LXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h8G#eY[^]aUWVS@]=X.t /Dž SbXuhtc&h&$j1h9%RY^t{q18jPSyƃ t 9u C8"uShHG#8uv ShYG#j; h9%jx 1PSPVuu莵 @u1;t =l.1ǡh. `.tW EZ)P<$PUEIV耰 tRh. `.tj ‹EX+aP~$PًUES* e[^_]UWVStx|h.0p.$.Yl.l)ȉp)ȉt lt|uH1ۋx9t担t#tm%RPh%PPCC뿃} t~|P#xvԋ-RPh %PP|P#xvm%RPh%PP Dž|-|-Ã=t.=p.th.h!"cXZh.h.hoG#K EPj$wLc&PhyG#&_X}uC|@0|9hsPhG#Y^P|p4hG#ޙ |p@hG#ș|0.XZpu hh#h.hhG#0pt #6hh#h.fhhG#h.R9%ƀt2hWh.,hhG#h.9%s2hWh.hhG#h.9% s2hWh.hhG#h.9% s2hWh.hhG#h.p9% s2hWh.LhhG#h.89% s2hWh.hhG#h.9% s2hWh.hh #h.9%s2hWh.hhG#h.9%s2hWh.lhhG#h.X9%s2hWh.4hh%h. 9%t7Vh#j V谕hWh.hVh.(h.|h%PhH#踖|@H t PhH#蝖_X|p(hH#舖j 袕 } =x.=.u }y|xXDž1DžtxThj`SPPQt芮 @hu\t|@9uߋ|@(9uΉdQhD ^dtNjh󤋅|@XPwPg Y|XX=.uE t|@XhHw9=p.uh.h!"XZ|@XPvh$H#PsX}|@t E iUE/Ã}tP@uj- Ph.h5H#j訊s u|xtjh.h.|x@u^jjPjxtݬ @u<. T.=t.h.hLH#|@@EHs$`b&|xtG|@8dx. dul-t.s j|xtjh.h.S . T.=t.h.hgH#"tx \b|@4h薞 _)jjPRhx@Pt\ @ht*|h`t5|@4`$R艦 ^KV8 ]kЉX1ɉh`9htkh`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT菝 ZPtރ NjTCXhsR¥ X1T.d1ۋ|;X4,F\s. T.t%xQuujPtAC`jjPSxt˩ @jjjjPSxt蕩 @UjjDžjjVSxtU @uI8 u3D XjjVSxt @u jٺ.|^_9S? [DžjjPSxt裨 @tgjjٺ.|8u脛 Yuh.hxH#5؋-> KjjPSxt< @u jڸ.Sy XZlƀ.pƀ.e[^_]UWVSƉLHT.j=P"Y[ƅPt9sx?u @ƅPGh#VO[Z.tԋ-Ջ-8 8V tG=^jh`$S/ T F<=t:ԋ-  ƃ=d.u hH# 41Dž81ۉh 1tpƅY1j,V ZYDžtG1ɉLPDžH1ۉ<1ۅJj=WϢZYÅu 1l@llh#WZYDtj,S脢ZYDt @Dh%WZYLt6H#Lu%PVhH#2 =X.8j.18jlPSiic$Sf_ZuDžhDžPmh#S<ZYBhI#S'Y_uDžhDžP.hH#S_ZSVhI#qhZ;$WZYuTj18jlPSghl 9u SVh5I#!8u.8h!&WwZY18jlPS9o48l 9u SVhSI#8u8u勅48,0,90r48hcX$WZYtVhH# TBlHwR$xb&TЁTāT븁T묁T렁TPVhwI#1H{DžHplWVhI#DžPDžP DžPDߋPDu DžD<t VhI# D$b&1҉jlPWRm<@l 9u SVhI#8u<@4849Ǹ8r9u1ɉjlPW<l 9u SVh`J#8u8uT r$Tdh dhuaDžhUVh~J#<t-u F0j PV" x;3ue[^]UVS@Ë5.=X-tjtSvlZYuFl6j j5SHFSC$PFSh %P.5.F PhOQ#j@]STySgee[^]USQtP蕝=.uSZ]UVSÉu=.u VS5ZYe[^]UWVS׉΋]Uu E E!UuUW%t#[^_]USt<0„!1=.uSZ]UWVSLEӋu>h_Q#V EZY)ƒ?EljDUhTSPEUDEj URPEU:*u%jjWSRPEP{'tEuj>u E9hTSV e[^_]9`-t3UVSRPjuVQw`-e[^]#.t ú(.=.u,.UWVSƉӊ>uuV.HtB1.hf5<.V=.1҉.hf5<.S9=.~؍e[^_]UWVS,E9.L.];S5$5/蠠Y^y#P.H.D.=.u. .Sb|Z=X=&wAKw2if7[nRf7D=,w$==!f7=Xf7=KwJ=w$==` f7 =%f7 ===f7wf7lf7af7Vf7Kf7@f7 5f7 *f7 f7f7 f7EۣP.EݣH.EܣD.eẼEfE1E. 5$5/XlSj5$5/&E.e[^_]USEPhht@jp 1ۅu E]u+hgQ#_ZtP<.X%V~<.hbQ#_YtPZy<.<.1ɉ \-=<. <.t@.0hrQ#T_ZtP薗@.['$~@.hmQ#$_YtPfZy@.@.=@. @.P]UPUE`.1J$`f&(f`. UzQ#U}Q#g{UQ#UQ#UQ#ۍUQ#эUQ#ǍUQ#뽍UQ#u.f`.UQ#uf`.`.1UWVSVhQ#^PL^_ZX-h%]YuO&1҉.Ph`.lY[Ht .Q#t .7#X.Q#T.Q#.&.## .Q#."…y11(.$.4.8.,.0.. .t1 '/E`.]ڸz%t7ڸ#u#.ڸq#u#.ڸQ#g.ڸQ#VuQ#.ڸQ#u L/e[^_]Ë<..}<..m=.tg='/t =.uMU=`'/t='/u<..(='/u<..1҉.]1.á.t 1=.úD.<.@.<.8.US='/t =.ul='/u<<..u.8t.8t=.u.='/u<..0=`'/t.='/t9<.~j CX]6]Uuj54.7 ='/u.8t <.Ã='/uUjXË<.0.,.qUWVSu }1+uG}-*u:Vt3st!dt1k1uUE 0e[^]UVS h#j&q hcS#Ch.h.h.h.................h>S#C1[<=:tjhrS#jq FWZPÃ$g&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=`.tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=`.u~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US].1u7.u'-zu='/t-[]_[]US].I1u7.5u'0-%u='/u-[] []UE=`.tE] .]USS]uhS#h.R5zw2SYt'؃@PZu@ShS#S5.S-YtS5.j h.N"E.ySEPEXZ.]US].-uH-[][]UU 1}DuЃ=%" ]UWVSSEIuRP贏^X[RVZY1uEVLXt S腏Y-h.jEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhX#9hX#9ShX#P&NucjhX#VNǃ u.hX#P9ShX#PMu0ShX#VM ShX#PMEWob Ete[^_]UVShX#8P99ZYu3h#VlZY1t=hg%VWY[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPV Y[{%=eh!A#V[QVsa GShV2 #jhX#V跎  1҉p1ShW`2 t t u@hX#WYZhX#WYZhX#WYZt<"u5vptp~HpSPV O tu QM膆ZYMuGCQ6X W0X _Xu s XZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á4.t);4-t!Ujh.P4.@ UWVS]=`.u(.$.uD .(.Àu$.Шu[ШtSS$.%uF .A .(.9~1Ph(.ZYu'1$.P1$.:Y=$.1$.=T.t 15T.s-f]4.9L-  PS.Y[@$$g&e21҉P.51P. 1P.\.t \.8 1P.\.=.vx ugx V\.=.w1P.X.+5\.X{1=P.\.8eu15P.Q1ۉP.e[^_]1ɉ P.e[^_]a1҉P.T1P.\.=.v6x u0\.=.x ߀x z\.=.w1P.1P.\.8 u\.8 \.sT.]1P. 4.h-y\..h-Y[ t9ىM{ RUWh.b UMuʉY15X.zWh.$\.._X\.8=P.t L.tPzS 1ɉ L.[V<EPZE\.t\.tp..<9s; u Ce-Ed-E11E쿀.9stub}t6E9s-M܉UuuWR UMuE|1}t8EE18Et < u_ 1EG눅D.H.tPmR Xj\.)@PvH.\.)RSPS\.Me-8uCS;XuS%AL._WAL.WR Y[\.ML.txt/P.Ph8.-1҉_Z @.@.\.9D.si@.u,15P.H.1ۉP.pu5@.CYd\.=.v d-8HuhX#'Zu%1P.(.e[^_]e[^_]UVSQM1uu.EQЀ w[jjjj uuuVtjhX#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1$.9 .|.á4.t @@@ Ã=.uUj11ҸXUWVS.t`- 0- @!/1bDž{P{@$j辿WPt V{DQ8QuZh"VX?XZ$fSftxRPdZYx,E%=ufSfthPX5YXhY#%Zud P]X~P-1Ƀx tA -x t tlphX#hn#S.>|1ɉx =.u:pl)ыt)PxjjxPohX#SSXWV3VBN WBE/RM XE=@u$/t t7tut g ]UVS=\-u='/t =.u$t/..u ujjj5.RP*V PT/u =\-u>5'/H.'/1҉H.u 4YX5'/H.e[^]UU]飪UWVSt eYƉׅt‰//H.=5/u0t;5//}jjjG 1H.5/ld2t8e[^_]UWVSVEj)ơ/u/ǁt#tj11u|%/Su5/á/ƒ// t?x1 rjhY#FY[t j0j1ZtՅtVk1V(Xe[^_]USTá/$N   tw #5/jCP7tW6%I/f5/S5/5/ߟ1/?E4/؋]a//PSy<+u C< u.tPHJ Z;u 1.Se.X5/jPCP9=.S0X]q;!t/tPI XS5/Y=.ui/uh.Y#h#ȀXZMh.Y#P=.u>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉/YYu/ ыuUS]t CPX]UPGPEEUWVS@/<.@.e=/t1//1///=5/t[=.tj3_/t x@j荭//苝Yu*P:t!u5.BZujǴ_='/t*p:t!ku5.AYuj蔴Z1'/=H/un1H/=/tjhY#訣[1/:at h#耣Xt?uhj:Ģ_X WrY.=5/weu:{1/1/&\P菕Zze=5/+ej//t.7iCЃ .jSP_Zdteh///^=/t1ɉ /_=//uy/u_uh/ƒ@+t t;!tA-Ҹu u ‰/@@/3=//  =trSZH?E|a</1EЍEPEPEP/ tD,EĉE-=/u Pw P_ E@Ƀ}}uEЅEPhY#x 15/Y=/S/YuS艒EЍEPhY#6C//Ht!5/h#5/5/s 5/MZt5/Tj1ɸ/&C$tg&*t@tS; u݃=\-u ̾J5h-j+Y =/t)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=/i j1ɺ>%i0S{ aFcx $g&j1ɺ#n /19/}'/1;//|//='/t5/5/LF^_j/19/}'/1;//|莍//j1;//|/1ɉ /='/u+;//}5/5/EXZjj5/1;//|/1/ jjjj5\'/Vjj5\'/v1;//|/1/='/;//}ze1;//|/1/|jj5/1;//|//F='/u5/5/yD_Xjj='/t5/5/TDY^1 /19/}.='/u5/5/DXZjj5.6 /19/}.jj5.7tköUGA5'/1;//|/1/'/5/5/E5'/f//y 1/,d9ѹ|u$du=/t/d1//5/5/G_X//19|,fFhm//19| SGFRP0EB//y15/5/115'/RPFg8EȍEPh&$=.uEtEP1Z9t䡐///'//'/j(Y{j8('/('//1;//|/1/ / ///1;//|/1/s/15/Ѓt+Ѓ$5/ t /1;//|/1/e/1.5/C1FP踳X/b"'//15/'//1='/'//1'/hP#맃=.qj 4-Y# =.M5.6h#Pe u jhZ#5.6Ytjh8Z#XZj -U%@5.ѣjP/19/|/1ɉ /PZ jhZ#45.V1_PrYt VV1jPb1//j1ɺ" =.u) -#uU%j}=.jhZ# @j1ɺZ#;_ ƒ 1?PSmp?Zj1ɺZ#>^ ƒ Sp`?lj1ɺZ#5LY ƒp glSp"j1ɺZ#%RZ/ t u.S}o_/j -U%% j1ɺZ#^/ /19}'/('/ @.‰/ //EƉ9Љ}5/=/E)`//19}'/"'/ @.///T/1ɉ /`/XZ='/t/_UE=`.t@]US]SjšZY19} B]UWVSu}t UE  u ]ZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:=`.HE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt QtV@_u @|$W XZtu h%Vh[&WS}tjSY^y S7 ZPX؍e[^_]UhX#juPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'.<%t.tRFP?Y^CGjCSȃXZutKH݀u=9us8Ft38Ft1 .<%t .tQPS@S?ÃCFe[^_]UWVS]S臡^u1jjjSc/Bu@thVS8 ~ˍ19=`.t)RPZYu FSWk_XSjWƒ ='/u9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=.!8u#P^h"^#PEZYUt^#RU>Ɖ$>YP=kL$QMWd-Pe-PURh+^#MQV$Wx XUV=ZUtRhB^#PnG Sh#PmV- t'iWY>u V  Z S X؍e[^_]UWVS}1ۃ=.u\W=X$SWhJ^#SPKVuPǃ VP>ZYu S Y1W V XZ؍e[^_]UVS]h#S>^Zt(hP#S>ZYth+]#Sz>ZYƉe[^]UVS]SYuVSYZu]e[^]'V!Ze[^]UWVS u='/h.Zj!hZZ#TY_?|uC؉E-uEh#V=_ZEXHtjhN^#s[^Vu~;Ɖ<$t;T$RUAWuURPW V YtsfGftjEPV Ht-WJZKtcu_E18E h+]#~XBEPE8E 0h#~Y^WZ;u Sd X1ۉ؍e[^_]UWVS}u =.j蟒h}^#ZY~1E E^#e[^_]qVWS:E4$:E<$ :UMT$RU}EWVSURP3$W V E@u t]e[^_]e[^_]U|EPu|XY1xE%=@UVS|u='/u1V[t&VH9$P}VPh-\|PV ZYy VhXG1ۃ='/uu!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+= '/u=H.u '/u$Pk/RPWVWVځƉ׃WVʼnZYuu؉}ܡ5/Eut u EU<uu uuqE؋U܉EU9uE}}5/!nEuuP)&ÃEU ~'='/t(} t} uEU' t tؙ)]Ur'   E5/Em tuTi'}Ɖׅ}t(/EtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉU5/ t uΆƉ1ɉ '/E'/Eu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI='/t' t u}tƉECuЉ}E}t ='/tƅRPj # j}]!Su%uuwW='/t&WVuuRPE؋U2='/tH}tBy u5/t t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1=/jjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%= '/uk/9EE}11S '/uEU)juuRPQEURP[^y='/tL,'83 t u, u5/< u@)5/ u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@5/Ey} u#"Å>H /-CMڂRPu à Hu =/~1'/u}E='/u~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ='/t!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU='/tWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5H-=L-4@w Hr5P-=T-e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S='/Ee[^_] pWV9EZYt1E E^#e[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuE<.)HP6WVƉXZutE21ɉ P/ T/E)SjjWV<.HPx<.H9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2='/uts1T/WV]jjWV<.HP e[^_]UWVEU EURP)ƉYXBut1WVYZu$='/t WV XZ5'/WV hM9ȸ}|6Du-5'/(~VRP[ 1ɉM E^#e^_]"XEUEUEPh _#XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjh+_#W^_~}Ɖס<.HP[Y9u9u e^_]d0o\WV <.IuuQjjf *QRPY<.HPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃='/t WVmXZ]u} e[^_]|USZtjhF_#VXZ%q|9} <.IQRPa ]UWVSSEE] wBu@ujhd_#V~ZYwƉ׃uu1E E_#e[^_]VSuWVO9| 5'/RP e[^_]Ê t u@UWVSƉ5x/5l/h_#hSi=wWV)RPMt/SXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPh_#jR_#"j PRM 9u#`#; p/<=t#; p/|:j; p/; p/9 p/ 9 p/҅5-,1 v#u t|\u@r;yj=SZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=t#H`#;8F1< t#uً1V‰8u$#i`# t tu䋅t3RPYZűPx`#Pd(8u‰2ʀ‰w8t1lߋ1MW1t/Ze[^_]Ë/;/~~/ l/ /‰/US/X/p//[]É19-t @uUP?kYt,.t4.t.t$.UWVS/UjS EjS }tUuu YXtP5`/} ljE5d/5d/ 5`/ E`/Ed//XZ1e[^_]UWVSÉ։9/~`/d/< +t[^_]UWVS׉ˋ5l/Vl/Љ[^_]M=H'/tt*ttt t XÃ='/u[USjm5/ZYQ#t:t1ɺNC=/tcc#t1ɺ*C]Uhkc#/PUYZt /"h|c#/P0YZt /c#jh9W`/jh(Wd//hP/hD/h /h,/ h8/1/ZU1}]á//Uh/1/1l/9h/~"`/l/d/1ɉ l/@1//////////// ///hP/ hD/h /~h,/~h8/~1҉/UWVS='/uu uqƉ[X11'/ @'/u='/u u$ZYt  /@;P- T-9U] |%!ʃtM9 H-L-U |  /@='/t /u aP'/9/h1Ҹ WVY[u1ۅtj ]SRPlDSÃ1T'/)9~1Ҹ F19tD5ݺF1Ҹ //e[^_]á'/tP'/='/u T'/DUSh/9l/~$d/<u`/PhP/}XZCԡh/l///]UWVS]u }Eu@0tj$zYEe[^_] =`.tWZ=`.tw/Py_uS[ۃl/~K1S ~YuSW_ZVd/t-fZYul/d/DVe_tWl/uVd^ƒt 0.Vd/teZYt t8.t .t(.Ӊ؍e[^_]UWVSEUMЃt/} u}u=/tG}EPjEU RPu ueu=@'/tV /tM E졀//U#U ;E} „t!؃tEU ///]=/tT1ۉ/1/1k /9{~%8u u1ɺZYGFu1ۃ}tO`/ l/ E1~RjEP{ l/1҅~ d/TRPuuCÃ='/u}u9EEEE55/+5/E;5@.'EPw_/9/uY=/u=/uEU //1=T/~+9=T/~P/81ɺ>GhP/yY19}E81ɋUG衠/9/|1}uEPhP/yXZh/9l/~Չ19h/~=`/   d/<<@B)5l///9/}1ɋh'/ Kݸe[^_]UWVSƉ׃='/tCP [/+/-;@.~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ19/~ /t /)C1[^_]UWVu} ='/uщu} 1^_]^_]nl////á/l///UU1wR5/ZYUS]1w%SZ1uS5/RZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;&9tu&ـuH &uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} /E='/u#=/uS/Zt /1//_SPEZYtIWVM^_t R/xt /ShD/%vWVMZYu5/~ 1/ShD/uhD/k/  /PvhD/Uu/@}/$`//9/}%hP/PuXT/T/=/9=/| l/l/؉ESjEPuU$ t9r)ډhD/t5/ 1=/[^'/t '/uuu} Ul/~7;h/ `/|t d/D0te[^_]uuu} 1ɸJt1tq`/ЉERj]Suƃ `/E9s=)Уl/RjStNjd/l/?4WtV)/~뫣/z}l/`/=`.u/P8rYl/ d/ M9u3_u(t M./t EMMb_uM`/UL_uGMAt?S~tZt /E*l/`/PqSPuE u1ɉ / '/t ='/uuu} U e[^_]g/+/4- /~9|0-)ș);/}s/)WV>%U KYZK=`.tv ='/tT)PoZtu} UK=`.t+SsYtStZu} e[^_]u} MU؍e[^_]e[^_]i UWVS]u }/t4 u t`5/5/1ZYt 1/ ud'/t '/uR=// 5/=/1^//@/1ɉ /4뷃=`.t/ub//ÀuWV1҉"[^Шu%ШtS'n/5/=/Yf%ul /A//90Ph/Ln5/=/[Zth/nWV/ /1ɉ /<//vP/1҉//=`.u]ue[^_]Ã=/~U塰//1҉/]1UWVSQu} EE/tt t5/5/1XZ/tl=l'/tc@.;////l/h'/@.D;/~ Zl'/G=@'/u@.;/~1N= /t/@@.9}Թ ۃ=X.tt =T.u ='/u 11Ҹ *=T.t&}t 1Ҹ 1Ҹ11ҡl/e[^_]TUVS]h/ d/ށ9l/~tu ډ@[^]UEp/E /]USEM =/t)='/tu ~JH1҉ ;/9~/p/h/)Ћd/`/[]/1/UWVSQSMQyq uu RPy^ZYu]ƒt1ۃ tt 5/tI]8/H9U_Ut )]`/@]C뮋 `/t `/teY[^_]UWVSQMQyq 19| RP]ZYu㡤/X`/D_E t$5/u}tjU/Et d\L`/UL/T1;`/r H/E)K`/Uz11҅t `/ىt /eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQ-lPUt!SMQPEgEP E1jRjV)E뜉+E)Ѝe[^_]UVS/1/utFjjP$ t硠/@11ҡl//e[^]UWVS5@.@.jM9Y119=<.~"!уtRP /9}G։5@.19|)e[^_]UVSu Eu=VY@ w>uV-S蚡XZ1jjVsP u뾍e[^]UEo1҃t -]= !/t& !/tUSJZ P+JZ HX[]Ã=/y-U='/u T/1'/jhc#3ZYá/xW@d/UWV1ɉ /5/=/+9Ɖ}jhc#=4/XZe^_]ø/ @= /u1 /!/// /$!/ !/ !/ !/1҉0!/4!/(!/,!/8!/1ɉ -uF"4KhU%'V'h?#z' Ej5YFR&jh"~:t>u R^8_UV輱Xt̋URUBÉ<$8L$QM8*WPURhθ%MQS^ W _usV7YSؾS juujTj;}t&uA&hc#7&*j %% ET/uGX1҉Ue[^_]SUWVS]EEEEuu QZYt jhc#h"SYXujhd#*XZ8IhU%%S%h?#~%oDh$j:jSjj }u}uCPÃtNO@u,E UM;M MM|E UƉ!@tt t OÃuV蛦jj #jSj:DT/j`Re[^_]UWVSu6EU_}u }tcj-Ɖ[u u11j-Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k`!/GPw'k`!/1X&/'t'@&/#tUEEPhd#(YX1ÉUS.w$tXX&/'^.H!/1P!/T!/X!/L!/tP X1L!/D!/Pt jh+_#g<.N . H!/P!/T!/X!/jhP!/-.H!/L!/Y[뉉txux ujh0d#'XZ1]UVS`!/1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP,UEY^u uB2M5.sS CKCtP' Z1C@!/e[^]UEt*xu x u]zB@ @@!/]U Su]jEP>,UEYYut@ . \&/d&/h&/El&/`&/tP{ Z1`&/@!/UWVSPEf=X&/uJ=h&/uA=d&/u8.\&/1d&/h&/'/l&/`&/tP _15`&/{u#j;PsiCs 1ɉKs {SC;.u RWV UPGZUte[^_]UQMt.9Ptjh=d#.%XZP@ UVS]u .1k9d!/u$9p!/u9l!/uPa~#4t P'@5u1҉[^]UU19d!/uǀl!/ǀp!/=u]UWVSu`[1h!/t:P葰PV uEd!/h!/ 1҉h!/YS Xue[^_]Ã=X'/UWVSu hn#uǯ`!/ C Suup&/ue[^_]j }WRPsu s蔾Xh#V1ZYtVWsPhVd#uSUWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=<.E8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtP Y1Cu>/CZe[^_]USE] =.t1E Eed#tS..XNt1ۉ] Ed#u=@-x1ɉM Ed#^S-á.ZtPi XS!P].SO 5.]B=@-y1ɉM Ed#]!.EEPhd#!XZ].-x$Ujh@BRP<.RP?'/USEtzE 8.MU u4@E Qh%R%- }t jhd#}Qh%R }t jhd#k'/-a-y'/EEPhd#>Phe#j ]S虧S=~P|0uD]EPh#e# XZ]á-x$Ujh@BRP@.RP"'/USEtzE 8.MU u4@E Qh#R- }t jhIe#}Qh#R }t jhae#k'/-a-y'/EEPhwe#>Phe#j ]S|S ~P|0uD]EPhe#xXZ]US] }u!jS萏YZt]EPhe#BXZ]US] }u!jSXYZt]EPhe# XZ]UWVSUE t tP]+p&/^w=.t1ۉ] Ee#e[^_]P*PzPMRZYt]e[^_]ݠPƉ׃utS;5'/WVe[^_]USEU tXtugR*س-YYR)áس-Z=ܳ-t tPY XSPMس-YX]]7 س-EEPhf#XZ]US] }uC='/tS3*.Y,&/h%sSsXZE@]?s]UVSE] l'/Eh'/*l'/#tRRJYEEPhh#XZ]UEtHw1E Eh#].]U}u=`'/u]i1]S1]UEu=\'/ K\'/]UEu*=T'/~!EEPhh#T'/XZUEu*=P'/~!EEPhh#P'/XZUEu#=D'/t=.tL8Bu @u]]UUE t#u?-^u2@t+-!-PHEEPh i#N US E1ɉ <'/ 8'/E 8,t)EPh$E P }t jh$i#3<'/E 8,uf@E EPh$E P }tjh¸d#u1]1='/U'/EEPhi#ZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM'/tFPtu)QjP_XA'/ZjPEPH 15'/1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr&/j+UjEEZY];+u$.tP軬 _CP.YSJfh@ fXZEn='/tz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPhj#@EɅu&M}EuPh+j#}XZPhdj#1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u'/9{jQEP C]tSjZYPSת XDe[^_]UWVS ]u }翅u jhj#Cu@t:EEPhj#lusEEPhj#JƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjhj#5t)u9EPjEP }uSjhk# Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjh)k#X Y^jCtF XZtC tT/te[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á'/='/tUShDk#n~P~Y[u '/@-;t CtS C t jjSXZ$ۋ]UM@-t9tBt 9t$1҉]UWVSEE1EE111E@->~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uh}#|YtPZ~-øUS =(/u[h (/gZtL1(/E܉EEEjEPj! E9$5/u5/ۃ`[(/$5/;EMMEEE=(/t=/t=x'/u-=T(/ttPjEP艇 EufE=H.u);P=-9u 5/&Pi^Xʃ=$'/t ƒftըu1(/uu uà 1ɉ (/=H.tx*It 1҉(/(/@(/~+jX!K8h=8#ZE9$5/tt T(/؋]Ujh (/eUQEPwEUUWVS0j u+É4$!|$WVuhfE#WPT؍e[^_]US]S9 ZuSh}#h (/L (/]ÍL$qUWVSQYq AQEU}WRPq12vӉщE؉UM܋EuƉeWuuRPuu؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEPلXZUS-(/t,-(/Sh(/5- 9t T/]UE-]Ã=h(/t 1h(/B$U=-,/r|-P-M1`(/E]UVSP5/t T/E1d(/EPSXZt'u $Ed(/XuJ$VoYC"e[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uMQWVRPqwEUKEЊ}#EUu҅u΃}yC-YSuOqXZeY[^_]aPUVS]1)EM}I}#uyA-NQu pXZe[^]ÍL$qUWVSQ ȋ1I@E1҉UUUEEPЀ wPPwP PwMP9UU~BMjjuuuu}W9jjEЙRPuuW8 ]F8M뎅t1ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPPwP PwLP9UU~AjjuuMSQuV-9jjERPERPV8 E8댃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPPwP PwJP9UU~?jjuuM1SQuV8jjERPE1RPVa7 E8뎃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%!hWVSjubu Z Dh(/e[^_]U4tPw @rP:UXUWVSu} l(/cuWV3XZE e[^_];=t'/uldh(.WVh-T$.\S%g9@. T/e[^_]WUEU E #E#}#]UVS]u Tuu ]e[^]-P1ZE }#E}#؍e[^]\USQtu u>31YZt[=@. T/j ZQujA X؋]UWVS]uE %='/u>t>S$PhPj jjjSPh$9t|Va Xsuojjk 1=4/1҃=. PSW虾 t"W _}u)jh}#[^tP6 ZY>1e[^_]US]tP3Ǚ ZY1]U1}]UWVS|}ue( u ZE E'/x9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWu ƒ1Eun؍[|yu19E E H]9}/3{yMu$#[<:N<%<.uFu!1E1ۡ<.H9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v ҄ V̄ ZY1CCC 5/5/5/ 5/e[^_]Uh4/XUS]4/-t-=4/ujh}#XZ]1=5/5/E]Uh4/'XUVSu] <t1ٸ4/t;pX[^]UWVSEUE|E x@.p+l<.h5'/ duu8EU =0'/t4 <'/ș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1t5/ixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x='/t )ؙ1)=~WVuuuu [Zt}뚃=0'/tEPEP58'/轮t 4/t ] '/t '/u='/t ='/tu='/uSuNPEjEURNESEPuuuN4/(Eu05/ 5/9EM|!ЃtE;5/E5/|lUsjjEPEPR`us3^$`t2EUEUu}9uEbU4/P[uC<ujj]SMQuu54/54/$ EMt%tEUSQuuMM}= '/u(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ /M1ɉ /M)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E//T/}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xu} u} [^}t}EUW1ɉMuu} um} XZu4/tWsS{ Zjj1CCCj @u]e[^_]}{ 4/C4/T/e[^_]U €u1=4/1]UWVS4u}5/ 5/EU5/5/EԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUC5/Eȡ 5/E@u}t0E9ƉU} !u5/5/]9؉ӋM},#u k/׋E܋Uuu  9}%k/]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}k/9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU 4/>MjMQjujuWVY 75/ 5/EUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEK5/ 5/!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEU5/ 5/EԋUأ5/5/]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU15/= '/u]]USj5L-@'YZt4jٸ4/Zt = '/u=5/uW1]U=4/u '/4/4/4/]|UWVSU EEt :DM@RtE34/ s,jh~#E"u jh}#Ht= '/='/= '/1ɉ 5/E]3Ɖ׃u}5'/P"ÉXZe _= '/='/jh6~#_XE+j,^@=5/@1ۉ5/.EPM4/Z@t '/ '/j15/X= '/t ='/U.}Ɖ'/u1Ʌt1<.H'uM@uu5'/cX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; <.| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujj& HP5-P^ZtbShV3 NhP.&P#^Zu @׀8 uSlY~#hf#P#ZYt @׀8 u SelX8t%8,t8 t@Ћ8tH5;/Rx5/PY^t5/t SkZ@x5/P #u|#e[^]U ƅ jP5 =E tPE X+u}f= -t WVh9#WVh# jh;/5 Cƃ5/5/8 u =5/vH@5/e[^]USEjPh9/Hu9/Rh!A#P.<à uVh#8XZ@9/f=-tPhM#PhU#hV6Vhr#S! e[^]Uh:.h#臈j-UWVS}<1ۉ;/;/;/%1u~11Ejh -h0#u u0^=:/uh:.h#jb-t&`'FtrE96/ kU DЉE죸;/뉃a$ĩ&nEtPt=7WwYvhz#Z?957jh"V6x jh"Vx hx"#Vx^Zƅh#jp7h%SxZYkh#SxZYLhx"#SuxY[Åh#뫡7;/7;/Em=;/t h#s7j/RUJYZUt ;/5Rh%h;/; EPjhjjjj57$a;/U P57h݅#R ;/teh#tM;/;/;/=:/1vldZRp3.E)t8HuR}t hQ#KE hc%RUvYZUt;/";/;/;/h*j臂h*j{h*joh*jc 5;/hv#j h:/2h:/u h{#@u h#jh:.(mVXZtKth% h#hx"#& Xt 1N11҃=:/1̸-L-=-1ۉ|-=;/t ,-=;/t5;/9 Yu.t h#j=;/u"5;/ Zt5;/h#j4e[^_]U :/jh@:/c U4hTjEXZu5EZt1 :/=;/u!ujYX= :/h@:/Zu+j X=;/tPu)ZYuUVQP U-Euԃ=;/u h;/hD$P @u ;/%h;/hs&%u @u ;/=;/xj:h]#u lj=;/;/uSh`#!t$=;/u;/=;/u Shx#j辁j:h%u ;/=;/u3;/t;/tR5;/qZY;/;/j:h&uJ t -j:h#&u* t -j:hK#u  t L-j:h#u t1L-j:h]a$u t \-j:hu#u t l-j:h#u t |-j:h_#um t1|-j:hO%uP t ̸-j:hi%u0 t1̸-j:h"u t  -j:h%u t -j:h#u t;/j:h$u t L-=;/u ;/h-=;/u ;/`-;/t Ph"^_;/t PhD"|Y[;/t Ph#&fXZ;/t Ph|%P_Xh;/h%u @u15;/h;/hH#u @u1ۉ;/h;/h=#u @u ;/ ;/t:/x:/t:/tj,SAZYt@;/t:/؍e[^_]US{Ph#h:./Sh#h:./jj"U=;/th;/htji\ j{ D:.y1Uh@:.KZuj=/FVtI)~@#t8u\Q ^@P u f^?봈@=/[^_]UEP^v=/^?<tP@=/=/ =/=/=/]UVSEPh#)XZ@-;t[Ct =-EԀ€Uԃ=;/t̃Ef=L-tMẼeewfEf≠-t %‰USj5/ @;y8u h #E%e[^]we[^]UVSP-EÉ/Aue[^]Uf=\-t=/tPDXjUjh;/5!S 9X<uY8C L{ t VWdZYtAEPuW6 YVC Zu h#(Xc9s ts tC Ke[^_]UWVSƋ?/C!wK?/X?/"8:.H:.y;:.|:.P:. h:.j 'Y[뵋>W,bZÉ?/F<w <tj<t<f~ u=C?/:.H:.y;:.|:.P:.!h:.j!G'Y[6h&$M!XZ|Why#>!?/F ^_tbP<?/v Wh#!>Why#!?/F Y[t'PP?a?/$h&$  =?/"~1?/hA#H'Ze[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@ #t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]hw%S%b^_ug@-; CtcE.ƅUB@tjhxt 5UQM2XY9MU~ 8#QRh %h:.HÃ%#h:.j XZe[^_]UgPPPh}#h:. w$@/t@th @/Xjs UWVSSt Éֺ,&"h}#h&hh#au :u!USPUYZYUu=$@/e[^_]VSh#j UEuh#h&hh#]a@0h‘#g1UEuh#h&hh#'a@0h#11UEuh#h&hh#`@0h#1UMuhx#h&jTh#`11f3A@=uUVSEu ]uh#h&j`uhx#h&jah#p`t0ffPh#fPh̒#fe[^]Åt$1ɀ8u"UJRPRPT 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4`&VZYtdG (uh#Nhz%h%$h:.4`&h#h:.C uh:.j _XFd&EsR@8t54V4@WZT$WVVEPMU1e#sj@HEPr susuh#uh#uh#suh#fuh(#YU$19d&t@ uRh# 4`&h#)XZ}tEPh4#[^h0)uuhT#Y,01e[^_]UWVS]uh#hP&h{uh#hP&hh#?]11{ u.h#hP&hۋ=߶xtgtEWVhPs u s h#n=ts h$#ZY1uh#X䍕uu-WVhPs@ us h=#{럸"=thPs hJ#bxe[^_]UWVSSljUQ3 ^t#u uSuW Ãu Vk% ZHW8u uSVW 9uSuV u V3% XV*% a벉؍e[^_]UWVS@]uh#h@&h8C@uh#h@&h9h#][{ uh#h@&h:߃uh#h@&h;ŋuh#h@&h<몋1 9Ɖ} PQh͔#9|(Ɓ tPQh# 1jjh V = tS h fUtts hj#_X1jjP? 9u 9t-uRh#xyPRh6#u to@u h#qmu h̕#S󥍵Ѷx Զx9t PRh#\)e[^_]Ë :.Q:.y ;:.|< t:.J :.Uh:.PZYU^LPPh#h:.QjF/W|$wUWSˉ1҉F/M]m <=&h}fU fUm]mURp pSQh-0hx#h:.$e[_]g_UWVS]E }܍p(}p4EPSQY^tSh#EeXZe[^_]UWVSP]} CM% CSCt RPW RPh- 1t)L18th-h#d^XcCt2PWZYh-h#dY^}uzPh-YZu΁}ti=F/u\SlUK1҉UtRWeZY@u\K8-tRh-ZY@u"{lth-h# dY^uSh-l XZ }ye[^_]UWVSF/Xt.h-Eh-Epƃ \h-!jjEp\ @Euph&$dc[^xP=(F/t,F/ 0F/t1=$F/ƃ}  =F/h-h̤#h:.AD:.HD:. yh@:.Y@:.P@:.؃ t+@t( D:.y h@:.UZ@:.P@:.Ѓ߃Yt\^jxt6Ph-Y[@u8h-h $^b\u E *Ph-.[Z@uȋE%=t[jhu GPhh-Aà uT 5 F/u"h-h&$a\ ih-S}GPhh-ÃtOGXW\`dt;`dE@hDžl-`dpt`d T`9иdT`Pjj\jjPjYTjwXPjj h# SQj]SV@u h#j-Sh#XZ=5W0FډWVRPzx#=V0tk#RPQ e[^_]Ë :.Q:.y ;:.| t:.J :.Uh:.PXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPV0tvv Rh#Ã=V0=V0tBjj h#v\vXjUR@Uu h#j+RWhT$:à L W0AF`VdEUQRuu#=V0t#RPWQÃV0 V0Et*=V0tU]Ã=V0u=V0tF%=@u FaÉ؍e[^_]W|$wUWVSEUEPYEZuE䭧#EC u=V0tECu}EUE؉U܋=W0} W0ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut({u{ tNV [[^]UWVS(]j@W0W0X=V0uEԃ}Eԃxu x EԋpP=V0tvv s h#=V0F`VdẺUЃ=V0tBjj h# RPj}W@u h#j(WshT$| K W0AEUЉMMuuRPK{#=V0t#RPWQ/EPvEԋxvs$EPhƧ#=V0u7s,hϧ# wshϧ# =V0twsh# F%= u9N % 1RPs4%1RPs0h֧#vdVXN\=V0t3jj h#QRj}W@Ws(hT$4 "{(#=V0t#QRWP=V0tF(V,=V0tF@VDF4V8\V0 V0Et#=V0tNVF=V0u=V0t@u[F%=uEA Eԋ@>e[^_]UWVS]C=V0tS D=V0t=V0tS(SDV0 V0lj?;-(C ;-~:P5W0 ^Zuj&=Y]e[^_]1S -W0W01txux tF@-E-}E}E1҉U}9}~j}1EM9M},=V0tK(KS W0k‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=V0tS D=V0t=V0tS(SDV0 V0Ɖa -69~] [^_]șEș}E31tZ~u~ tIE9| 1=V0tK(KS c9U~U UBGv뢸 [^_]{UWVSP}V0tG X=V0t=V0tG(G\=V071Etn~u~ t]}~9,EEF,;-| 1ɉM =V0tO(OW Ev뎸 Z[^_]UVS RPuV u1%V u#SVPRNPhݨ#h:. D:.yh@:.DXuq@:.P@:.0 t[ D:.yh@:._u@:.P@:. uЃ߃Y=0W0tSDh1" 18tSDhz#5tVSeZYu0|%=@uS/_tSh#SQPVD#ZYu.|%=jjDƃ y D|hS@ ySh&$I4Ve =$W0t18<Eܣ$W0Pv W0_uj31ۉ$W0V@띉8<=(W0tt1ɉ (W0߭8 <=&mٽJfJ fH٭H۝4٭J4Puu<8SDhx#h:.$5$W05 W0VIǃ ~ W5 W0@ 9à ~ X09(-5,-tVh֫#0jOVh#jD ؍e[^]UVS] 5(-Su50-ƃ 9u$-X0~1(-X0tH~Wjjj50-d)RP50- 1(-1t8u 1(-1 8t8EuL8 uh#j(1ɉ (-[^1b8tX8tN8u%{xv$-X0=$-u ChB#_u5,-h#j誚 y,- Shw#0j肛,1Ht u h#jhЬ#jZXZe[^]Ã=W0:=(--UWV-wh#j_XX0t X0X0 yPt 15X0(fEEEPhm50-J xr(-yX05W0ujjj50-+x3jWVRP)WV50-1ɉ X0=(- h1#ha#jXZ1e^_]ÃUWVSPE1҉P1;EE (-X0jjj50-uƉ׋ X0xoEU uW0] W09É}EjRP50-/y% h#0jO(- )}Wt1e[^_]ÍL$qUWVQ1y(-rX0u9Dhŭ#90jjj50-{y( h#0j蛘(- )y11҃=,-~h!#ojRP50-! hF#` (-롣019MQRPWVMU}uthQ#j(-XZUfEEEPhm50-l y)u Vhg#0j託(-(-1eY^_]aUWVS:.=-t:.P2"+5HW0=LW0Xu u1=1=-Oh#WV5050BRPVh#hW޶5050h#hV輶0WVh#hV衶}}t^=$X0tU5|05|0h#hVdVh$X0hЮ#hVH(V$Vj螬 =-ubh$|01WVRPORPVh#hVV5|0h#hPε0h#0000WVRPݥRPVh#hRy5050h#htWW05050h#hV2RWV5|0,-HP10h#hP8}uV5D1hfE#Sƹ%V}$Vj2 }*e[^_]Ã=0-y1|0X0X0UP1 |1t@=X0u7=l1t 01R5D1h(#5016501&=\W0tLhW050-QZYu6W0%=u%=W0u=W0u5TW0-:1\W0X=-w=1t -~ jPYX50-腬 -Z~jURP( 1 |1t.=X0u%501h'$#1l1501M 0-X0 X0u 1|01X0X0=1t,-1 |1t̃=l1t011l1=1ti5D1hX#ZYuS00utjhRP jh5050RPh]#501{j501a1|0ZYUVS Sh41j yhj#0j/ jSj yhh#0j 5W0=$-B 5@W06=1u5D1h#R[XTW0hD-SkZYjh<-SVZYUX0C,-uPShү#h#PSh#h>#ۏ-whh#h?#躏[5D1h#詏h#蟏h۰#蕏h#苏h S褏xhm%SZYu5W0(-5D1h&#>1l1[^|tFu=#0jԇ h|0xZ|01UuZ@th[#0j蓇 US]StZ@uSho#0jf][UWVS|uu V+f_Z@uSt< tNu3p8xPVeZY@tE%=@u1D8؍e[^_]UWV@u 1PHx꡸1P xjƉX)|0Pw8URPh X01P@ uˋEU|0|0RPKYXh X0VZh X0[Yh X0UZjh X0HWZYuE=$X0/u(7uh$X0$h%X0h$X0袕 h:.WVh X0 2:.@th#0j虅 '|0|0|0|0RPlZYH1P(jh41j-T 1e^_]UWVS:@u 1PHx꡸1P xmhxjƉX=1t-5-X[t/h#0jʄ =1tbbyY|1ɉl|0PwMpRPh X01P@ u!pt|0|0RPMY[th X0TZt|0|0|0|0h X0YZu؃=1txPh$X0cY[t1 1tkxPh$X0b[ZuT1=1t/t/t|09EEx|0|/|09EE|0|Wut|09EEx|0h X0RYjh X0T[Zt0h X0_|0|0|0|0RP =$X0/u(5uh$X0$h%X0h$X0迒 t1 p1tgxPh$X0aZYuP=t1t4=p1tt|09EEx|0|+|09EE|0|St|09EEx|01t101J~PWVh X0.Ph$X0G0l1[X<|0t@t=P1uPY=x-t1|0 wlPh X0XZ h X0 Ylu_|0|0|0|0RPXZy h X0;^X=1"=l1011l1=P1uSlh X0Y[y;501|0|0|0|0RPh X0]pPRhh X01P@à =P1hu Rh X0ZXZ=1t=l1t01 1l1u!pt|0|0RPgZY<|0 x5-X1P(jh41jcd]O 1e[^_]UWVS1@t 1t!9t30h#j~]PHx1P x=1u1X t []y!^x1 |1tW5D1hڴ#501jl1 2h X0TZt.|0|0|0|0RP0 ^_Ht#t=1t4h X0ad_y#1P(Ɖf\WVZYyuth X0]^yơ1 |1t"=l1t501h'$#,1l1ZY-u jh41j] e[^_]U=1u y  \y1PHx1]]UWVS Džlh 5L1W~ = w u}/t 5L1h#h4~/t/CFtP5L1j\YZy"L1 Sh&#0j}C|%=@t5L1hM#j| yX i$`=1u )؉h&'n[yDžlh X0}RZth X0%Zt1 1u#h X0$h X0XZY )P1=$X0/$X0PV 9hsh$X0ho#j{tPW[ZYu1=1t:t:t|09x|0W|09|0ut|09x|0jh X02MZYy'jh41j貒7`J$ 1oth X0mXYSPh X0N xסt1 p1u+=1501h$X0r)l1XZ}tPh$X0uZYZu=t1t;=p1tt|09x|0||09|0t|09x|0]|0=1t h X09 h X0"Y+|0 tEt@wpPh X0ZYZ h X0uZh X0"WXjj50p0Ml y80p0ddRh$#0j$zh X0V jh X0oXYy#lPh X0[h X0V Rdlh X0a dy Rh X0 Rh X0@XZlPh X0YX=1x=l1k011ɉ l1Te[^_]US 0 00u 1@0=~~ h~Ph#ÁthPh#jwK0T-5TW0Zx&100 00‰00 Dy밉؋]U 0 0=-u>0t5=~~ h~Ph#thPh #jYw@5TW0XZx%0 0001001 y 0 0T-~0~UWVSX1t hN#jp0=0T-u0yS0+0EU EUT-EEuuuuu})׋E9ƉM}u}WV!ZY+u} 0T- M19}k0U0;0s#50PY_00+ 0RP_Zxk 010T-щ 0}=000EU)001ɉ 0 0o-h#j\uXZ؍e[^_]Ã=P-US=-uh#j%uXZyx1ۉ0015T-5 0ZY~% 00‰0001+P-~C9}Ph#jt Iu뙋]ÃUWVuM 0)ȣ0^_]UWVS$]CDž$$ x$|$x $=1u15xPu ^_y狳!Vh#0jtPuܾZYud%h #0jvtۉ15T-5 0u ƒ  09|Ru -WQQRuk9uUy%Vh4#0js79|$u9x$t hY#j\rZPu tZYyVh#0jsNjE49}u;0th#뗋9}3t)1;x$|$}Ru ye[^_]Ã=0t1US5T-5 0ZY~' 00‰000=u.=1u01$x100X1]ÍL$qUWVSQ Q1ɉMMu u150=0)9}Ή50)څutċ0]؉}܍MQWSRP}Ɖ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u}001970+0щ9|`tt%u؉}9}M؉]܋E0+u}럸eY[^_]aUWVS] ~E0+0 U )څ~'#9~؋50}50)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu CY[uEl*Džl@hh #0jo֋ltE1҉Pd19} 0+ 0 } yjș9Ή}hlpPtPQ50u ƒ2E0x} yE} Gpu5X0=T1 td@9u 0Й).1];x$|$}Rhu  19x=T1t, u&Ed9$thh#jm 1e[^_]UWVSV 0019|1`; 00}h#jAmZY1ۉ00T- 0‰0;E~ 1}}])1u5T-5 0ZY9T-uG00E 0~$50lj=0T-90~?E00 0E)։׉=01Jt[tTA100x,T- 0‰0;E"])X1EEe[^_]Ë09 0s.UWS0)105T-EXe[_]UWVSu] ~;0+05T-Zx 9~‹=0=0)1e[^_]UWVS1;EE }P0+05T-Zx5É9EE }]u 1=0=0)]u 1e[^_]UWVS]x$|$ $=1Pu ŵ_ZyzVh#0jok[0+0~b9}P50u  )019|5T-|^yt7h&#0}94tVhG#ji 1YuxPu 迴ZYySh#0jij;EutSh#֋U Ze[^_]UVS]E xz$usPZyWVhs#0ji$tAP$Yy$%Vh#0ji$. 1$ 1Ze[^]UVS|]s|PVHXYxS=1t1F $M9$$u0;|u(,$U90$u;EuVh#j2h 뻸e[^]US|]EPS,HZYy1=1uOE%=@uEhm%SZYu\SyYy} t Shָ#0jh/SZy501uSh#0jrh̋]UVS]EUdh1ɉlE Upt1x}=-t =-|PSG^ZuZ=-u#EUdhEl=-u$u! PVXZ=d1u ($jd1 - -t[j $P3V%A=-u =-t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSu躮;u h##E18}t}t:11E16SVu{ 9u hA#i11E1ҍCtPR蜎 XY Pz Yuh3#jP[XZ>CPVЉUPEU 0j\̍<+E e[^_]UVSu] }u1NjjjV衭y &ShY#jh$1V0r yShA#0j[e[^]UVS]u x@PQtX=1t*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu r ~ pt1@9uNjt9|$up9x$thp#jY xPu 賤ZYySh#OT$9X$u;t h#jjju y$rSh#0j Zp1$1e[^_]UST1tP1ۉT181XD1um1 D:.yh@:. Yu9@:.P@:.9-uu%1S H1 t뭅u oډӡH1<<1u<1 B<1tϋxyRZV붉H1j5P1hH1蔥T1 ,1]U=1uP1=1tP1=x1t P1@=D1u'h ą H1Yuh#jWXZ1Bt1t9UVSut>uh#j i Xuh #j?WY[FVZH~ 8/u3E ؉C1C=D1uD1@1X@11e[^]á<1t@=1t 41=1u4=1t+UE$u81tjP5T1j US=1t8D11t6{u+uh1#jVVXZ3hn#h:.0| [Ƌ]UWVS]=41u =T1<1541 @u=1u95T1m81Yu @uЋHHQf $&@PURURpp p0]9xjjuuuu81p ph^#jfUph|#h#p jDV Qph#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=1L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPnl y$81pVhȼ#0jTƄ  ǃ$h 81pCPh 81rP5D1hX# t1<1@=e[^_]W|$wUWVS<ÉUMMQEPau}j 9ƉЍM}Qh#Qh#j@STue[^_]g_UWVS\]u=1CEuPhn#Vvx ue[^_]_}W($w{ET$X$(j8$Ej<$Uu#u#PjRj4$Wh#Vw$ w'@$  R%Ph #|$x$h#VwuEPhI%Vw$Pw Sh#u Sh3"VZw Vj 3\ZYV@Xe[^_]UWVST]}T$X$uV($-zSWVh$#Pe[^_]UWVS]u fVfuP进Zt%t0SRjP}WVWCۉu ]e[^_]e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=1!u%U1h-#jLXZ1ø1UWVSSu] E}MM1҉7=\1u)S\1:-uX1 p3.=X1uA \1Q\1u \1X1UWP褃ZYtAU:uC7tMM}E] ue[^_])E] ue[^_]鵞W3hh#(x:u9p3.9}7@p3.W3h#h:.q?e[^_]1UE E EE].W|$wUWVSjEPSۥƉ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uh#P1_DžuBh#jPJY[8zx1҉P= 1uf 11tc߀?t\j,W|[ZÅtj=WiZYuhս#Ej w YUuh#jIV? 1B1e[^_]UWVSQÍEPSd^_uC 1%Ƌ]| tC]Sw Zu11 KDe[^_]Uh:.h#Qja-9t BtU-Uh:.hs#h:.h #h:.h#h:.h# jIaUWVSPuh%SmZYh%S_ZÊEhV(YXu˻Vh#0jeI }t/1e[^_]UWVSlj/E 0*_ZD1t@E D1h#P5[^bD1#\111҉U11ɉM11Ejh`-h#u uKzX$&7!057h#f 0렸1P-덡78-uxu1TW0EjTW0[1QPW0#B13x1$1-=-u#`@}1`11=1u `1d1-c1T57;_11p1a -HPW0%9`171$1Ex9~/pPuy EZYuh#jEj<^EMȋ71P}PW0{$1\11|157,DPW0*#gTW0-XTW0-ITW0-:TW0-+TW0-TW0- -7PW0$11=x-1ɉ 1575CZ411p3.E 4-umu}t 01:.01:.Hw49Uu }uj5 CL-11t HuP11E`h/#jC$hv#P^[_h#SGZYF1`1}tE8MMYEh#WZYE@:.t&h!A#WiEZYuWhy#jC1E1EEYE}tESPy [h#uvZYu`1u)y XEjh#u艦 u@`1t EtSx [EP*)ux XZ1ɉMEHjSu E&EE]}t EtSx [h#W謦ZYt u讂[=1lW5E.j51Ss ^E6~t1C}11ExM}h#S ZYLFLjP[_}u'hv#Pǥ[_u^ h#S訥ZYE@:.ur1҉UE5DžUuzuh#SrZYt ut_=1tSh#{E@u}jPZYy!h!A#SfEY_vS6tj.h#WYZt2jh#W% ujjW_Z*jS1ɉ P-}CTW0t 81h#TW0Zt 8TW0"D1"11jh`-h#u u譈z$̱&1-ă뿃7057h#11x7TW0f1 TPW0#E1@31΀1 7@7tjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh#j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 5D1h#5[_Vh#5h #5hB#5h W5hC#W苚ZYuhK#Wx[= u hm#:5Y덊uh##5ZX<.uuh#5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDh#j2|tHL@t<uDh+#h:.vX WDhA#h:.[Xt@th WD跳0 1e[^_]UWVS]t K΄u hK#R<\u FFu8uShd#j1 Dž~j_ Xuh#j1[^GjQP而 t5hVP薖SVh#ji1 Wg YpV֊t\uF8tFWg Shd#yRZV1u,QWqg h#j0GBGtVuh#jG^ Xuh#j0[^C31CV踒ZC 1ɉKECE C= 1u 11X11e[^]US 11t6Cu+uhC#j/XZ3hn#h:.U [Ƌ]UWVSu 1t$tS=1u S1u=1uSu $uoFPYuhm#j /C_Zt/1s\Ct/1ɉK;W蒑ZC Hǀ?/uC C$l 19tP@uh#j.Y[CSe 1$Z-e[^_]UVSu1ۉ$ 1u,=1u1=1wC |/t[t0CuPFP3  KVPYuɡ1u #$tV^Zt 1$e[^]UWVS]=x-tes{.u{.u Ct: YuSh#j' ʋXj jCS&à "> =11<7t 9t&@ujU Zt p h#b1e[^_]UWVSQ]t:t4=1u3Ujh=:Y 1_ZUuh#j'[^#t.\u{#uCS8 YuShK#j& ʋXj jCS%à 8 =11<7t 9t&@ujT Zt p hs#b1e[^_]UWVSut>u h#j/V.[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh#j% RE@jS Xuh#j%Y[.t;u GM1GtAt+@uVh#%O}tgE8t_W@uuh9#j$Wi[ bGƒWt+G 9OG}VuhU#j$W2[ 1G=1u=11x=11 hx#e[^_]UWVSM=1tPÉֹ=1:t9pt@9u9U}tjAR ZUuh#j$[^1p1ɉH xe[^_]Ã=1u1Ujh U 1YZt1h#j#XZ1UWVS}1$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj5Q YtGGP Zt0 $$$CSEC ECECEC1~SGY Yh#j"XZdUh 3 P $Uu-$CHCwC3X SX [^̍e[^_]UWVSM14$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ30X X]e[^_] X e[^_]UWVSS=1t51ۋ4t#1ɉ v0EW EPW XZuC u͍e[^_]Ã=1UWVjhGOS 1_Zuh#j!Y^CB#=(15,1]-5,1Z@u:VhP#0j! V X1e^_]1Ã=1u1UjhR 1YZt1ht#j XZ1Ã=1u1Ujh=R 1YZt1h#jP XZ1UE$$ $]UWVS(}u=10 $$$EUE 1҉ẺUЋ,$0$1!!ډEԉU؋E9uE9t1!!ډEU 1EE11ɋEUƅt6@ ]9Xu]9t@P @ $$$NEU#E#UЉE܉UEu1Uu1  O $$$ƅE] tYE]1؋U]1 uEjL X1ۉY $$$AQ F AN tX1-t"1111uϡ11M̋]!!9ur9unt`11utLUjOL Zt=UMHUPX N HF $$$EԋU؉,$0$Wh#jh#j1e[^_]Ã=1u1Ujh=O 1YZt1hI#jXZ1Ã=1tDUVS110tjjs sss3[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ 1=1Et#؋M9Hu9p u M9Hu9xt@$uj(J X҉UtMubUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RR XE #Ee[^_]Ie[^_]UWVSEEE EM}1tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3(R S"R XZ1e[^_]1UWVS]}E=`1t,;/t'PS^ZuSh#jT |j$]I Yu#Sh#j2 tXue[^_]Q SZtGFG4W8F VG(W,FVGlFF 1F51e[^_]US1tvC1=d1u{ t s3賴XZ- -tjjssss 3=|-t s3YX3P SP 1XZ놋]UWVSE @~}DE@Eu119}1Ҋ LBuEC}t#]1ۉ]Mэu9s F^BE1uZY[^_]UWVS u=1FhGSPG <9tjww 5-l;Wu;G t 萌h#*SR5-{ 9؍tdh#0j SR| yT$X$G9__W1jF Xjjj5-XkG WxNS5-J{ 9u)T$X$GW1W8蕋h+# 艋hK#0j$ WN Xhj#jZYe[^_]UWVSQ1uh#jXZohu u Eޅt6u_|Y_tcvj E ^t;uGƉYt#u6GZt _E81QVM XWM _h#jN[^0^Su{ZYtSM uF_Zuh#e[^_]UWVSu} 1t=h7V t&3V{ZYuusV7 [֍e[^_]UWVS1ۉ]U]u tu} 1҉EU]t} t} u^ <^4^F (Ku0CEUEU}t9s}u9rKC0E}1 ۉZY[^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=B.ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh#h S5SyEVh#h S5Sy=Vh#h S5SzyVh#h S5SZe[^_]USSˋ t%RQPٕE3J 1U1ɉ EeveRu P訕 ]URPh'#j Ujh豨ø1҃=1t1UMU111<u @=u3} u( A=1t1AH]UVS]} ~;uqjh#PWw u%=-u -hQ#j@ZY1-jjPƺ 9؍e[^]UVSZÅ3h#VwZY[uh#S}wZYt)SVh#jh#h#h#j -vSVh#j1o1e[^]UWVS]u hV_Z@ub- 1{ǃ4$K<vCVh11 | Rh11 Y jjFdP(%($jjFlP8$jjFtP<$$jj F|PdEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1҉$$$$ 2t8,1ǃ$ǃ4$($Qv`ǃ$($ Kt $x$|$ށ1$$$$w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%1҉$$$$1|/uDe[^_]UWVS u$Hwv$&=1t_h#j h=#hb#h#Ń d~ Ph#뮋XcV~Rh#땹1jdRP聐1$$$ u#EƄ/ojj 11#Y[1u9E2jd PEP'ojj 11wE1Ex$|$ƅz ӍynHʃ0Pu uo9uh#9rH@0%1҉$$=1u =1t 11 T$X$W($1jj_Z_8$1jjZYg<$1jjY_{jj _Zud2M1jjhZYuDhSV[_y>jh虡ZYx鋖$  Ѓh#'e[^_]11UWVS}} ?jh#Vqp Åulh#VqY^¡1 1 u1h$#jE XZjjP虻ƺ- 9tPVht#j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPW z/@E K<vM E)Vh11Mȉ Rh11  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)P"yjjFtP<$ Ɔ(8$P PZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2h!A#V`'_Xu$Mt0> PVh%#j[@:.1EPSZYt/G}vEVWh8#jEUt@:.u1 SJAXe[^_]á1t UU RuPi51AAUVS]u F51tRPS tD3j S7ZYu1e[^]US]}t X1|1 1t=l1th:.j 1l1ZY5D1h!"h:.%Su h:.蠝h:.j b  ]USjh_#fY[xEh"PE<1YZt&h!A#S/<1YZt1351?ZSX=1th_#hY#j ]UVS] u}t X1|1 1t=l1th:.j 1ɉ l1XZ5D1h!"h:.$Vuh:.袜~St< Ph$h:.m$h:.j D XZe[^]UIpPhu#h:.=$j 1U#pPh#h:.$jUWVSƋ=81tPh#h:.# =01u ЉˋQtjPՆYZt q8tɍEPs&XZ=41tVh#^Xjs7jsF>%} u#VWPREPh#h:.:#h:.(>D:.HD:.[yh@:.u?Y@:.P@:.؃t- t( D:.y h@:.A?Z@:.P@:.΃1Ylje[^_]UWVSAօu"VP_ZtDžF%=t1jhR @txPtGY[x^9|u,;u(^9u;F u%=tIoW膸+Z<jjjN  ׉NX^\19ȉ}{ 9}Dž 1P 9+{=RZcjjjMG? NX^\19ȉ}{ 9}Dž 1P 9+{dyZjjjLnfNX^\19ȉ}{ 9}Dž 1P 9+{ZjjjKNX^\19ȉ 9}Dž 1We 9PPW +^_jjjK~\vX19}p1҉贴 u݉19} 1QP< 9u#)s[@ @1h&$*ZYu/Xe[^_]UE @E E@E][UVSutYS} u C tC01@01Rs- sk- Se- 01H01 u,1te[^]UVSu01@01`1؃8t VPjZY1u 01u,1t e[^]e[^]UVS`11؋tJ9tFjPZY1uԉe[^]UWVS01@01ƍPxY11ɋ`1tx?tBA'u9t ha# 01u,1th jVS$19}Vphs#p-HQP yP-H Z J GSjXe[^_]UMtA'1`1]UWVSu^Nj7t#vuYY[Åu jWXZ ׻؍e[^_]UShP%JZtaujY1"41tP{ Ã1X؋]UWVSP}U UWRW"ơ01@01$TW舩C1҉S URwC01H01u,1t e[^_]Le[^_]UVSuV[t#sVXZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY118u&S;u0h}#5-qXZ1P1uj=CP*Y_uyjS5_ZDžuSh#5- Shs#&w%-xWP yPl -H YlJ ]@PS3XZKe[^_]UWVS5 1B.DCtVjEPVL11] &8KȉMA&uV)PRh#&tK11C&u)BUPg1NjU1Xu,Ƹ^ À~|tH;= ÊVθ(,)%%#$Ƹ Ƹ^ 1e[^_]U51Ph#UWVSQ5111PIÉ51^=F-t <#uKt;ut$&b1҉jEPSJƉb 8uE8t+b8tM#`& tBUUue[^_]W|$wUWVS ÉUM7Hw$T&q# uu }#!uME5 #tރ uWVuu^ WVuu  MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=1%1  UU6EU=1&t #2E11MQ  mWUEaYutu]ƉӉڍe[^_]g_UWVS(Ɖӡ11EЉUtUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh"j]S; jSuA e[^_]US7=1)u c[]W|$wUWVS4É։MЋ?E1EăH311V]ЉE뭃$" "tCك<E4EȉU̸#=1# wEУ1tV!EȉŰEЃ'wF^1ƒ}'u1EURPh"j}W jW6 EУ1 11V]U]11VWEnY1 M1ۉ]11VWE7҉EȉUX}t # n1t VEȉUU1Ɖ׃ƒ'u1EȉURPh"juV jV51 #닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sá11EUUV01Kw\&8&}GVQ1YYuRPUMY_Kw#&9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ 1AZwSjƉYX=1uRE11MQ  SUEZ  !1e[^_]UWVS}USFƉX=1uQBE11MQ  SUE щX 1e[^_]ÍL$qUWVSQ q}W軝51XjLPZYt5xIu,xNu&1҉Uj PZYUtB@)։51@뽉1 1k1=1t #EЉUWԝEЋUԍeY[^_]aUWVSRE} #_-- 1 1HO;t( 1sx&軞P ωʋ7 1tx BM菞P M҅xJ sH+ -Q舛X51SƉRPh$ e[^_]Ë1Ѕt /tt@11 @1US]u1Z;/uPhm%)ZY@tEPSZY@tҋM9u;Eu3E3U ]UWVS}V蚚VPʵ tS[ 1Y]e[^_] SDXZ8"u뺅u1X0" Ph# e[^_]UVSu= 1uE=-t.1҉-h#oPYZtSΙ 1Xue[^]3e[^]UVSu3t = 11tP Y01@01 111 1jR01H01Zu,1tG = 1t,j51h#j5 1h#jh#m[^1VZF@$1VP-- 1 >/t[5 1>t' 1H 1FxFC蟛XVԀ~/u# 1KhC#VGZYu$-9r :ƅuh 1K;/u>thm%VGZYt 1x/4)X/ XV>t 1H 1FxފFC9-u 1x/C ܚX/= 1uȚ 101@011tP X 115-舗 1j51h#@j5 1h#.01H01u ,1u@e[^]UWVS} u01@01ujYy 01u,1ttj;á01H01Zu,1ttt h# Y0t$=-u =V-t5 1hn#gXZ1ue[^_]UWVS-hƅdhE#葮Yt =l11=P1u 1P1=1tVW=1tVW_X=1tVW8=1twww*1ɉ P1zjwXZ1=P1P1fjw_X=P1tQP1E=1tgWfY(jSW Rh#:h-V EވE1UR脇ZEPՇX1t=-tP1t }tPtje[^_]UWVS} E E܍uV׆51ju\1jY=-tKt>=-u5tUVUt E PuRXZ=l1u V袆X\VZu1P1tje[^_]UWVSWE} _-- 1 1HO;t( 1sx&ևP ωʋ7 1tx BM誇P M҅xJ 莇H+ -Q裄^`1PS|ZY1P1P1e[^_]UVS]h11jshXZ=-l1tKup1Hp1t1l1up1Hp1W1ۉl1MwE5P1=P1; ut-t)E Ps5P1l1ZY[x h15P1e[^]UWVSu=P1=-u1EPiE؉E܋^Yt$hPS.M =l1b[E؋E1҉h1]؅6F1=-P 1PP[h #Qv I-xWPyP-H =_ J=s--xWPYyP-H X J 5-W_jsv E Pvk=P1=-uJl1t:up1Hp1-1ɉ l1Hu p1Hp11҉l1 h1=P1EPpXe[^_]UWVS]uV趂E؉E܋S 1jPs{K[tt=l1uk{t_G1EpWPZYt@1=l1uA=-u81; u{C1u s ]P1ZYt‹띋[1P1V譂Xe[^_]UWVS]} 3EsdX=-{51 1P褠Ph#Stj RU5-UR h#Xu h#X-HyP-H X J 5-(Y01@01u"jS*fEPSRUztUt,uveuu 01u,1tjsKWs$UuR\e1҉P1 RpP1X 01u,1tjtJ=-tA{t;51 1P1Ph#-Ee[^_]e[^_]USD81EE1EEppX=-tlExtc51 1P赞ZYEP($#[EXtj S5- [h#[5-tXjEPZYtlE8141j7XEuKt&:EP$#X5-XԋEtP1j58101@01Eģ81j EppXZ1ɉM 01t5u EpY[01@01E81jX 01t,1t뻡,1txEt"EP$#X5-LZ]UWVS}] 1CCC =-EP~01@01E^@u h#VjWbjWPwu31ɉ 01,1tu6ju(jWuE؉s 01H01Zu,1tpEP ~Xe[^_]UWVSE ,1@H1X1(1$1`H1EP}X1L1E@1ptEXt7u!C1hpPSE 1 sB_tҋ[ŋt1ۉEp ^x|EXtC1sYu|1҉4pjxPS E [븅t4B4닅4P.{_0pt0J0H 䋅010T=-t"=d1u4~0@T40)Љ0=-u 4}fEE( 51 1PAZYP[x1ۅt--HyPd_-H J ~j=W Y[Åt?v{Z-HyPX-H = J={=WAX6 ept@t--HyPX-H J vX6 뼋Ep -tRVPK t vHyPhX-H J 5-_uxsjh&V' u Xԁ}( ``041 Huw)4)400toX4t-X`0QRUR0of}Zf}tJXZ:-{z-uzu apu CSu>E `tfE=1u Ext,AEftfwE=q t=( tgˋE@ft501@01juo][^&8t4&8t*&8 uxPWZY@t &WPiX뀃 h u tCƒv~ 1PSP6hfE#jUWVS]} Cfsftf$ftgSH1$jV$PN P|hJyӅtsh|#`XZ Xth#_t h#YVh&$"XZt h#XVh&$Y^tq01@01sP$P`01H01 u,1th#3,P'h# PVh#{ t--HyP-H *Z J*-HyP-H X J e[^_]UVSu&t"8u%uCVPZYt؍e[^]UVSu &t8uVPSZYuCݍe[^]US,-1ҋ1tHft fux@ |u[]UWVS}01@011t,Pfu9x fu9=,-| P X҉΍^1t 01u,1t e[^_]%e[^_]UWVSuH1XE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVh#qZYUtU~:uBC렡,-U҅y E,- !WE,-Xe[^_]UWVS01@011t!f{usSX XZٍ݉w1t 01u,1t e[^_]e[^_]UWVSutA%<11tCVPZYtdߋ} tX01@01V$=cÉ1fCC VCPe01H01 u,1tB=1؍e[^_]US &tjP)f@SPXZߋ]U01@011 P 01H01Zu,1tUWVS] j/u^_t[EtFxPuZYy 8t} 8ts ffCf1CrƋMH19tMEth#Q賚Y_tM ju_Zt@HftftfuEu6Eu E u=,-yƀx u1E\tE Dž\u =,-yuGYDž5DžXt,-f~tFXDžTDž`juEP` Wa1Zu?/ugX9`Y@Ph#KnZYtuYDžt51h#!nYZuzX9`hxPWYZy.8B84T"E%==1tlEW Lȉ`+-$Q`WU_ju+ƃt fx`tWuh#dQWBcXZ01@01d\ujuY_f~udfF`FDžT BtEt$jTPuh+&5-"f`z01@01d\uju=XZf~udfF~ 01u,1tF FfF CfF fCFCe[^_]UWVS(EE1E11E111Eh#vEZtPE܃bw$&1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEE1: E؈E11tIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5-s^-@h#[EjWVZYtY@ft8*fuu<1P18ufHu("fu}}t̓=,-x tH1fMfMPu̍EPW EfEփ}t f@ E܃}xf}tjWY_t jPlXZ(OE܍e[^_]UVSu 01@01jucË@ZYft&fHu sXfCFC fFC FC 01u,1t e[^]e[^]US ]01@01fEEE-fEu EEPSL01H01 u,1t ]]UjuZYtfxup)kX1UWVS(1E11hT#s_t'ptvtV EѾʋE ct ]tPhX#nt hj#^1ۉ]ԋ 19#cu1#QPh#/uSY&uwjSbXZh#j w tmh#ſXwhn#0_XuY1P1x 8u SP YZthh#h#XX1딡18t-HyP -H YwJ h}ujSXZtGfEGE<H1f}f}U؉UPjEPSEfEEE؃1f}f}t f}f}j/SBZYu^H1}tEM؉MjSEPEPYMIy߅u#t?#Ph#蘾[_uljSv,ZYuuYh$u_Luu0$ Ph L#W %u%h#uh# uh #譽Shn#ZYu h*#舽XEE~Eԍe[^_]UWVSEPY@1+-P X -^_}GE܊_tqtg}tb} C<v8u1:t* t/t<EP4Y[=V-t"E u 1xA gZH}낃= 1uOZ 1-8u(hX#YYug&Pb Z1t p PƸ EPXXuEE %E1F^t\}tÊB& <vC< w 1@1yYH @1 1@1yYH @1AE@uF9utm&t_U9UčvsՉ‹EĈ@ȉƃEM9MMP YPEP EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQLZYx>EE1EE׉E1҉UURMQLYZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=1Uqxvtu@r t@;}u51[xP51sZYy9tt1t9s'@ZxvttE]S@ϡ1;EtP9Uu8/t]C m%%PPX E91t@/Džp>t F1ptJxw@tu@o,1tSYpF/SZt؀x .u o.ux jWtJ tptWu51@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu$1sk^<*P@1@1+-uuuuSuu%@1+-ʉ@1)@ 1uX uuuSuYeuXE)؋1 RhR#u܊N#uNQSHPRhm##u E܃EEPSE)HPRh#ë@W@1+-Pu }tzM]u EMEtZ|wt<1<1׃uY]Qt@뿃uHus독tEe[^_]UWVS]E %E1ɉME tE-1u 1E@1+-E;~uE t u S=XZE 1Es}B~< O$L&:=J{s{u{y{@u{=uz1D1E} t 1@1y;P@1e s 1@1y^;P@11 1@1y8;P@1 t=D1t"@1+-M9~xuH@1 uE uE 11 1@1y:P@1҃}u C< w 1@1y:P@1S 1x@1H @1Us:H @1U߈ ts1E#E PVu R<1p<1<1VvXU 1x@1H @1U9H @1U߈E {~=u}1Eu V[X u1 1x@1H @1Uu9H @1U߈EE RuwZYE @1+-jPHP pމe[^_]UWVSEu ]=&-t1҉D1P <1-@1- 11ɉ ,1 (1P1Sp 1_Zu#u8@1 1@1H 1@1ys8P@1@1+-P}5$1 1Xt¡ 19t PjZY@u?0̭ hd5 15-謓Y[@0蟭 hPh#bՋ¡ 19t&Pj[Z@u0f hPh#5 15-@ZY@u07 h5-o-jj}jj}jj}5 1e[^]UWVS]u+ 1i5rOCSh!#01@0119~Pi@t׃u=uFjRZY@utPY PhH#!9+ 1i5rOCSha#r*JփutBƃ 01u,1t e[^_]?e[^_]US]01@019t P? Z1ƃ1҉ 01u,1t ]ܓ]UWVSTÉUMt&uPh#Sb 6EE"EtM }~EtEtyErMB9tMtEttt t tM IuɋE0u(EE@u[EEEHE\EM9u[5 1)i5rO-+9t# ti-;t Q@Ph#jEPch'#jEPN }WYEtNjE0h#jW%WƃE@|5uh#WsXZƒu*tRh#jW߆]hQ%jW͆Ku =tR{ j WP-E@t$Wƍ|5@)$Wh#- WƉ$EPu_XKyS諄P Y P F~SEP>XZEu EL}tzKyS]P _ P KyS;P|^@P|4M}tVh&W$S荅 iEM0EKySP Y P EEESqEZPe[^_]UVSMt0t"119};ivuC⋉11tJiD} u&ƒu=t uă[^]UWVS utF>%~W,[tW,XY#*Ft~uH<-tB<%t<+u:-#-i 1# 1 1E1MxdtS~J~?Hu(UFPQMVYZMUt UQW"+YZUu뗅uV+ZtjV+ 1 1XJxRt~i90tM΅x29 1~*i 1t"# ##1ۃ} uVP萎؍e[^_]UVSh#K5X= 1tYh#r-HP&-H YwSs1Z8P1xj10Y^u h#BP+ 1i5rO@Ph #) 9DiPh&W$FXZՋJ ;1e[^]UWVSQ111Uh(#-4ZUt%jtptg Ժ;ƍ7H~h,# 1tyt hT#UjPYXUt 1t+ 1i5rO@Phr#t"Ph#XZ1tnHi0i0h#Հ-HQPFY_y/P#X 9~ -x99z 9~ z8 ܉e[^_]Ã= 1u!UjuZYu11á 1u! 1 1Jxu 1øUE=-t@= 1t7uR+ 1i5rO@Phx#5-UWVS= 1t.5 1 1NxtSX1 1 1 1J01B01uh<ViP)Ë 1 1i߉_19~i9uFPM ^ 1 1iƄDŽIu 1 01u$,1tЉt 01@01=N-1ɉfǃ 14؃} ~iE PZ 01u,1t:؍e[^_]UWVSu]= 1u1ɉ 181 1SSrwXZu1 1}=-tpt u I8WjQ^X}u-W5-*ZY@u0! hPh#SjpSjp*}u$Sj^wSjVwtAt8t$=-tSjpSjpSjpuI 1=^ujy{jhg%z thg%h.#?}uke[^_]US]U M=-ut u1uEM E[]鸇UWVS}tE1ɉEPu EPE t!01@01 1E1f&81tt;E܋EEEEi}9r(}i 1M9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉tcu tQ= 1t1=-P;u uEt tEu- 01u2,1t)h"}upuEe[^_]UWVSjjjà ~ jjj=-tQCtN5-F^9t7EP5-nZY@u0` hjPh##1 195 1|btPu= 1u>SKX5E t t&tt M ڋEsF떍e[^_]US1h#h+Zt$ltptZu⻀ۻԻ͡1u t8t Ph&$`^j_YV=-u =V-u@t/jP‰١-1P1@YZuS5-DXZ1]UWVS411ɉMh#*EZt+}nt}put h#裃=1E1Eă}u18Eąt2jjW{ uWh#jWMY^t Wh#@ 1Eȅt}E 15 1 1Nx.}t 9u1҉1ủu؋1MjVE^ZMu u؉}tKE؀u?MjPZYEԅtjM1Wǀ =-uXE؊uẼu؈R1M ƒ}EЃE…tEEËEȉEԡ 1 1U1Mx3t#t uE܉kuñȄ]܅u@1E܍EPjj @u q耉E]܅i\9]t}tLjSPY^Eԋu5}t/1҅tHi4h#juV%{uS#Z}u}Mt7}t1jVW~ #}SXEԍe[^_]UVSuuá01@01ujVjQ 耾t-S5-C}ZY@u0: hPh#u%+ 1i5rO;-t ,jVY[=‰tut čt ujZuVX 01u,1t~؍e[^]UVS= 1th#jPXZu h#Ph&$rsY^9~iPh&W$IsFXZ١-HyPq-H Y J u5-{^Z@u%0貕 hPh#u~01@01SSË01J01XYu,1t}؍e[^]Uh#$X1US] h#$X] 1  1uPUS 1 19|:t%uh#q 1X A1Ë]UWVS fE 1E 1E11}uEE@<}%<a~<w=$t&)y&F<=Pހ<'<\"FEF1FEv t!#< t#E0 wE#< u#փ8t "B+&u11}~ uxFEp"ntj@-t ɉ1:QS@-<}t!~u9SCE\U'$#"# $#1E]CMt]BBuPt}t E"M@EE 1E 1 [^_]UWVS]} = 13v$&$jsZYu h#Xh>%[_jsh#jssh #f[ h%#T^h%#I[Y1벋st7jv3XZ>t h(#X6jsjs u7{t1h#Xh$jshy&1~[(h,#js u h#_h@h#js { t&u h#f^h0#[js T u h#@[h7#h#h;#$XjsZYu h# XhC#js u h#Xhyj%h #s h#jswhB#js hH#Cph#zs t=jvih]#\jv U; uhN#hS#9_vhX#s!h]#s#1#%1`Q#1#1#  #S9tRh#j}WlWVC [w*yh#:Ph#j]SlSvjPiZYhh#hj$NXe[^_]UVS]u t3u h>%XjSZYt{t h>%X[ɍe[^]UVSEX 1=-u=-u25 1ju XZ= 1 D3... 1e[^]UWVS}]5 1t/1}t3=-tޅttVSYX}u-t?Hi@@} t u P XZ؍e[^_]UWVSP]u }Xtu,EjWVSE#0v Phn#>vPWVSe[^_]UWVS]t P 1 =P 1dPXX1u \1 p1`[1\\9P 1~jh&`PΙà u\P 1dP_NP^؀;18t@x/t՘@xPS*.ZYy1EЉEԋ\ 1\u94 1E[ 1u#e1:tt@u= 1h#S(v^_19-T!T-51߉Sh-xWPYyP@g-H X J EЋUԋ\ 1 1\ke[^_]UWVS}WY}E11tb=-u5}t/j5-4jh-Xf-1PaHZ=-u;1u{=-uru=-t`=-tWh#qgXF+t'=-u1҃= 1‰ 1jPyY^1WZ*u@WTXe[^_]UVSU:01@01jR'eY^x jPXZ 01u,1t\rx=f-t01=-t -1ۀ=-t-11jjVj =f-tt-t-e[^]he[^]US]01@01jS[dZYxjP01H01ZYt Sh.#q,1t~qjX]Uu}~E p P:ca1Uuy Zu h#qUu u} ZYu h#rqUVSuVZ@$VPQ؍e[^]UVSEX9-}]ށ}01@01FPb-P-5--01H01Zu,1tip01@015--)- 01u,1t4pe[^]UEuj h#j6a-)--UE--P-P 1P  1P 1]US]01@01-9t-P XC-C-C 1 01u,1t ]bo]UU01@01B 1R~01H01Zu,1toUWVSW -\ k01@01=-5- 1thG9ua-CPW¡--J -+- 1- 1^^t5;8u1H+pp X@MSNjM󤣐--X 01u,1t e[^_]Ine[^_]UE01B01-)- 01u,1t]n]US-- 1-[]US-+ 1-)أ 1-[]UU-)---+U У 1]UWVS,ME 11˅t MPǩZMwDGƋ܃}tE0v h#mFPKE0u _E1t0wLG VdYMVuMMM̋3XZ̋EЍe[^_]UWVSD`111EE h#E_t/}pt}rt}duܡ1EЋ1E뿡1E؃8u h#ljE^tt S`c[Ejh<"nEZYuEP.&EP5-- 1X1EEԉEĿEÉEjMQjE^ HMt EU߉Ӏ\uA}\}u:jQj ^ HuE߉< uO}tj/P_[X9UtltRUu|ZYt%URhP.&{|ZYR}] 1xF $p+-E1!= 1u  1}NE-9r,>Wu{ZYtWhP.&{ZYuuƃ}tjuh<"ki j5-E0Vi EE؋jh&P݅tT}q 1)Otދ 1E؃xu*EJ 1xF6p'ljUh<"E0`ZYUu.J 1xV P+-RE^,u 1j5-E0gh E5-- 11ۉ]*EP EЍe[^_]UWVS1hV$E[t01@01jP01H01ZYu,1ti11rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPha#]Vhq# ]Y[ ȃ0 wF1҉U1ҍpЉvShw#&T1 EGuԃ}t{Sh#Dh01@01SrGXtҁRWEWw 01u,1tgu芴0 PSh#gҁR&Y5-SZZ-@th#[XEEe[^_]UWVS$f11h#QEYt(}St}at}Hu׃Ҿˋ]E &E؃8t@9tE Sh#1Mԅuxt h"fuhD#u^Z|u1ۉ]܉]k] EډӉM܉]FFHЃ w!̋U9и Esuh#ft uh#EX 1RShjKu9UrMˋEÉu &11EPC PxOsCP3h(#gZtWEUE܉U}uM}uGhD#2ZY t Ph%ZXZu ;u EUE܉U1C 1RPuuJRPh>#Y 띃URE@ PNZY@Uuֱ0c| PhD#G}t]u]u ]uuRE@ P[^y荱0| Ph]#dE؀x u_j6d 1*tEUEUuu hv# YY$}O 1SQRPJRPh$X 5-WZ-@th#[XXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPS蛗M 9t#t9uƉׁvSh#Sh#ce[^_]UE0 w @8u1]UVS]1tSVZ1tpVh+%S ¸tVVh#S ¸t<uh"S!w Y^¸t0 vS袁Ze[^]Åt2US-t1:-u-Au-[]È-U-PPR-PXZ=` 1tM=6-uDBPGPV` 1%XY%u#jPh#9a UWVS}] Fh#U_=~%1ۃ<-u,-R-U#RPh#8V%#Cuġ-HyPT-H ^ J 1ۋ-t#c#<-t"RPh&#U Cuh0#:U[1-:-t2-U#t RPhM#-RPhf#uU Cu-HyPS-H YJ vu&hh%W跞^Zu-@uK1-tPW耞ZYuډe[^_]FuWU#Ph?#Y`e[^_]USMU 1-9u ]R@uQU#PhX#`UVS]Ct&st Po XCEe[^]o e[^]UWVSP]1ƍ@uPXtUP0UBX1h1r151=11҉1Ye[^_]UWVS }t151EE519N 1BE-uB<-uzu+t 511ۉ؃EEE@tcu}t11ӃouUE8t E!Pu"Ft51U!RPuSjGY[+U#Phl#W^ru"}th#`Ph#Rjf^SPXZDu)--u~uMe[^_]e[^_]UVS] C}أ1V-1-@uV-jMX18u=1un-=-u*=n-u:j訁^tj蜁Yt - =-u=n-u-=-u --1=-ut :-u-1 -u - - -@uـ=n-uC=1t 1u<@1X1P11jPV1X1XZ=1t6뻋u h#\H 11Pt1111111ۉB9tt 51 1e[^]~U}ujjjjVE01@01jL1Z8tPX 01u ,1u1U[UU0 wj jR Hu111UWVS}uEt ]uQ t9-u Ayu+UB1ۉ1ۿE?5Y]-uyt͉:UtKu5?:u$EEEjEPh#Yà EPh#cQy:u벉뮍Py:xuWڅuU?<:u!EEEjEPh#Yà tEPh#h-Njh#Z^1H9ujRh#LYà 1Ujh#h#/Yà U+E@1?1ɉE11ҋMPh#j URgNhURh#X ÊEEEjURu X( t1E1҉PjXe[^_]UME  h#pYP u1=1u11ɉ 11h1h1RppUVSM1tuA1u1:-uztC1B<-uztBu 1˅tǍr8tuPh #9Yy:u܀y:u.zu 1J 12u Ph#{X51151e[^]UWVSj*1^Qzth2#:8-0E 111j1Yt8zt hC#W8-u @P51P)Xu n19\x9}hU#벍EPYá01@011 1)<}_߉ƋM9sω9s x19r )ЍpkME)9s 151 01u,1tVSo[PY19} hl#01B01)أ11ljNx=1tE7hf ZEy1ۍ1)‰ Lu11 01u,1tU1e[^_]Ë-z8U 1x@ @-J8-z8]ÃxuUSt Pe XK]HÃ8uU1҉P8u]UVSƋXCF~h 1A1Z1f@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P-JHR P UPUSUJtXxv-u~u C $t h@#-B0+B8PCXe[^_]UWVS4-EX=uE8t hH&35-- 1} t u Eu P9!E@EŠt 9u u4--PP GӁt uu ljE)WPk 1H}t 1R\uG 1x\F p\Sà u! 1x F dp 4-> 1xF Dp u"4-@4-==O A94--PP 1xV P-)Rx-X4-M)ȍe[^_]UWVS@} -B ]urV܍Y wVhN#Vhf# 4&h#j"S?FS詍Z؅tWh#}xM4&h#jP FSUWVS]S5-M EZY9-ulP5_H=`19s<wDu 9rMW5\1}] ZYt%\1=`1M܋=\15\1 ##S e[^_]ø#-ztLUS`1tt#u*##41 154-P`1ZY]UE`1jZEODU謳\uH袳 u"4--@8xtjjXEjjh"D _UVS-Xt 1ۉXX8x tjb-1҉P Y1p84-P0 1x 1P 10ƃ)c t,~tŁF $& 4--PP @\ |td;Z=t g u,?&u-@1-@d|u-@Ǯ-@)&t;u,-@ -@ q-@-@r-@_a=t0 u74-@4--B0ztjj`Y-1҉Pjh&Vtà ؍e[^]UWVSSá-@tuy =-,uyGEt7&t,O8uQP)ZYu&^_8Et2jwV2Y_t XS4$PS- Rt -1҉P؍e[^_]UVS-p$ t jj-ubX(x,u{ upVDZuh#P: uBPVg-BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um-B]US]V9tjS]UWVS3t u%j _8XpZʡ-@؍e[^_]UWVSS-@}%11EuCPw C u j X1҉PYt8uj 1~^Xj 1҉VPXFYƉ}t'}ugEwRu D}twu}um-@-@}t_4&t<}t jjG-@#61ۀ4& r؍e[^_]UWVShEӉM-@E1E81E誰E+-]jEPZYtxcTd*"t~L tgF=.H#"$D& Džd't+pЃPЃv;4--Yt藧PЃw tPd@d_ƍ@;w`u hc#<\u<\uhz#ރ?PDžd Džd11\PЃ \w t0)Pw t0Pw t0脣 Ad9ud(=w h#0= 1 á 1HCw6 1?ʀJ R 1CC@wj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1Ywj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1;wj 1?ʀJ w 1CC 1 ?ɀQ vP 1P@ 1 ?{ 1?ʀJ w 1CC 1?ʀJ vH 1H@ 1 ?ȀP vQ 1QA 1?ȀH vJ 1JB 1?ʀB< vA 1AA 1Xh#}€ u 1 e a]tW t)蔣'~ \u聣=uh@#%4--xtjjX븲ŠB& <w 1C 1fxt @ 1C=u 1s\谟k u%4--@8xtjj^GJtujaY>uVZ0VXs;5d 1};5h 1~5h 1}>uIy>u |u &u y1tm&ups1ɉK-djdB(-@(X4-Pj¡-@(Y-u @ 1҉P  躚s-X$-@ 荚-`H,hP S-p9-@ Y (\u: 15 1VXO"D8 .lhjډU 1H\^{t & 1\+-X 1d\@{1#Tþ}Tty&uh B.DYu[tJ}Tu@Td1e1jjhd1 T1Tۘھ &tJ 1xd@d\Xd\ &uJЃ wK 1xd@d\Hd\ƒt:@Ѓ v0t' 1\d\P 1xdX=d6X=d%:t #u&¾Rdh@&HYZ?&d 1H 1tx:C X:xCdXdt\dd9‹\uADdd1 u#}t 1x#C $X#踖1Gfxufxt΀Aw@ ȋ-X2dVNj@f@f@dr@&1҉Pa'uAW|&u1 1\Nj@@B&f@ 1\$ו 1HNj@@"&@f@e[^_]UWVSS-1ۅtXC1-0x tj-1҉P YF8Pv vS‹FP U8tSj-p蘚7jhb&P-HUJ@ B Κ]e[^_]UHu+]UWhPT81ld-`(1\}1󫡨-X1pjEPZYE81(1E-Tjh螙 :jhb&P -B t$Pt=^- hppDžt1ɉxR|T}E-jjtP‹ -pnX-`-dڙZl81\(141u jlDžp#u^j2Džp#X-`-dlXl81\(1pu hpp}UWVS -@1ۉ]}¡- u@$xm@4$Ժ&jj}CjjlCQu;jF Ej@UBjj,UB뻡-xu j F Y1҉V @jaj 3^ -zu jCjUjCjD-@C u-x,u p [u h#Zj诿 -PS @0C>-Yx ubx,u\h%pn^ZuIu¡- up0-pY1҉US@PvjjfHu? 8j@-1҉P P-J0HCBHYvB-@ttjjjtCV-@^Xj蓾 -B0+B8C j -p0EC 5- ~ uh%vmZYt h%CEF-xj ƋE0FEY-xu-x  jj p0‰EEU表-@^Zu UBE밡-xt jj@0Fj:F -@Yt-Pv jj u -@FEM1҉@{j jC1҉SY^tNjjX=V-tt3j"-@X&}t-@uWf^_VjjJ¡- u@$x@1ɉutt;tj aXZÉs؍e[^_]UWVSP} uE E1E1}-X- u+p0ƉxXtӡ-p^[뼋H up$E0FEE럋]K9u}} uwj- 4-H4^SZYuh+#Ssj/vp= t hJ# -4-+A8FF-1x4M@u} u jj\1E1҉j 1ɉHEFE F -@0F[e[^_]UWVSS-@1tu=V-tt h\#LGܡ-@nAuWj 腺1BUjnËUBpXYUjU$C^Ut1ɉ ֡-@tj")pZƉe[^_]UU-1ɉHHPtjjX-1҉P t/Ht3-@jy-Ytrrho#*-1U11ҋE]DUU Et 9Pt]UMt1tPt9JuB]US]jθSCU PUPUP X]UWVSEP[y h#9*u;5-~5-ExWfZ=w PWVI `jjjr uNujjsjjsjjsjjs$jj sSEpujtuEe[^_]1=p1UWVS}u ~}th@VWZà VWlZY}t9u9t:WTX19t-yu0R@ PVWhC#S-SVWh]#)9-}-؍e[^_]UWVS]{tN7Gu p1} t} t&Wxjw PR+GxPYWV8 Z1Ce[^_]USt101@01uSwt1S8 01H01 u,1t ]']UVSt1t/}u jS$ZYstFxPX6͍e[^]UWVSu] -9}5-9~-9t7SjjSV+9t=t8VW> PShy#'؍e[^_]US - A - ~.CPjj  x9-}-POX͹ؙ } l1]UVSul1 ~;d 1|p5l1j Và x9-}-9t0tVXYwN9d 1~>}u}1ɺ<ƒu,EEptVl_9h 1}Vh#0sssru>h1UPjS @Uuh03 PSh#> !9t'VjS{ @uQh02 PSh #}!ju܋MZh(#rXe[^_]UVS]u M1P1<&t#KyS PMX P\&<uFtPh#S+ S4\&VZYt vVuQShC#MSh<#EF y)KyS] P-Y P-Ph#S Sv XZۍe[^]UVS]f01u!u 1u01tX=1uOTuZ1tO18tCt>11@1=-tu01uO ,1Bf0[^]US]SYt ]]鋵hq%S- YZtS&Zu]US]x#t%SZuSh#j h11]UVS]} tKyS P ^(P ?u3Sh?#q ZY?tH!VmPh&$S  uKvyS~ P XɋP 뽍e[^]US01@011t8t P ( 1҉Y1u11 01u,1t ]]Ë1u1t9u=1u 1UWVS]u =1u1t8t= 1…teu`tM t$tAW؃u>=-3=-u,=1u#=n-t=-u1uYEPjSb @}t tD1:=-tt!Sv=-<uu9ujPS`ZY@t^u1u jSZY1E܉EEEK>v c DjEPjz e[^_]UWVS] }uh-%s0T^_t}sh|$V TZYuhx# j5- xh#VS^_Eur1tF01@011Pu% 1ɉ 1[t jVXZ 01u,1tF@u111Eq}sh"$VQSY_th&"V@S_Zt CE1#~puM} CEh-%E0RZYƅFMEu}}(th1ۍF~u1u6u h}#XV?Ph!% C ~ h?#oX1ۉ@ut h?#WX111tB18u6u h#-_VPh!%C ~ h?#[1F@ut h?#Y1ۋ1t718t+h#1PE SlPh#-C@u91tLu==1tE0Zu)E0>-u~u1}tE1 111ECh#RXECu\1t1Phn#Y[E PaÃEX?vEph'#5-6 h#1Zu h# 1P XSCPh# zCuui01@01t VX1t1P" Y41t jSJXZ 01,1EO111Ee[^_]UWVSuu 11ǻ1tB8t;01@01W-1P01H01ZYu,1t1uu e[^_]e[^_]UVS]u 1u VSQYX1<vjS[XZuƃ1e[^]áP1=1u t8u1UWVS11ɉ 11u@@u 1e[^_]1҉1=1u‹1t1}W15P1S!jP+S@ d1t }wWk15P1Xe?1uHuUS]91t$jj1jj(jj1]US\1ɉM=1u'=1t1t EEP111P11tjEP[Zu Eģ81jEPhZYt01@01jEPLY[uO8Eģ81=1uы1tǀ;tH11jSXZ몍Eģ81bjcwX] Cvv1ɉMMMMEPjmXZjSXYX1EEEEK>v U[ DjEPj 7SPXZ51YU1E1YUWVSh&P ZYj'V_Zu <)ș19e[^_]á01@01-t,UP 1--Z 01u ,1t 01u,1tW UWVS]~;1Wu u\ ~ )Dž~E u F ~) Z8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu1CfKS u>01@01s>C CC01H01^uV,1tMV Ffu9s01@016CPRC S)S01H01ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9-u]e[^]e[^]U5-uXZU5-u~XZUPuu EPo E u hA# uPJup UEPu u UE Pu5- UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'V_Ztt~tnhl#V_dZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h&VZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9-u]e[^_]se[^_]U5-uXZUh-Ih-?XZU8ruPhq#Ph#UWVSSEPE X85-- 1j=RU ZYj=SZYU))9~߉Ӊ 1I 1<=t$t xFU蘙p UCɅxUzU] Ue[^_]>UE1@u,1+1Rpp h#jh11UWVSu} ]t t9u t1141&Ft9t&!@t)[^_]UWVSS11ɋ 1tZuA=u܍P訕EY1 1t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#S_ZYSRBZ9u;Sh&$j'SY^ƅu+Sh%XZ/<'uh#sXuS)Ph#o e[^]UWVS]} sSt"CtS҉XuEs1Et Wh~d$Y_}t5uh~d$XZ$-Jy R[ -z9 _F>=u y:Cu}th)j#FPZY-HyP-H X J e[^_]UWVS=1u1 h;1Y11 1tJG} tE t8tEt.19P511%1XZ11tfzuh\ jjh@&1zuHhq jj h&BR.uh\ jjhP&h4#P|3ZY¸H&t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&P>_7;";f xuWSP[^1WS踭ZYuNf$&)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!]舺]t9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$Ծ&SVV1Y[SVF1_ZYSV91[^SV(1ZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PVV^_xPS?ZY04]E9uc9u_E98PV^_uWxPSZYuD04MU9u9uE98f9]PV親^_t1oxPS菪ZYu鋅|9u;xu͋3E 3U $~t08u9ut1u u# 9uM98Mt#y޸$#uPhy# ECSW YZ@u';"}*#RPhI% E}t jW[ XZMuUVS@# 11 11W59t j=SKYZt hSXZ Ph#j@]SjSh#j h-h<"(j hT=$h#Ʋƒ %u#j Ph#mj,h#h#\j hT=$h#K$e[^]U=41t 1 1 1R- 1141<1 1=t1t jY-----tP.1-ZUj1ɉ P1~>R-1 1-Zxt@~j01@01jXZ11uƀ1@@u 01u,1tj UEt]UVS]u tVs XZe[^]UVS]u &$&Vs [u CEe[^]s 7&VDF4$VsJVs Vs[Vs Gs%VDF[ ]VsVs C[XZD[*uFEEhF#VY[EEE8.u(px*u EhF#V_ZEEu uh#EffEƋE@xWBtG,%A[A< $L&CCA<2hIEܡ1tPq^u$ǣ1YE܋E܊@<<~8Hw0$&b~<'tz<\tv<"trflnhrdt`v\ru B.DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС 1tP>Z1 11tP'X11$11ɺF E5$1FP£1XLx׉2Es}t"tRSuuh 10RutRSuh 1Ruh 1 @ 1 1j Ek5 1h&$`11t11҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPub_XMƉUйjEV}t uWVuP(hWVStWVSWVN1th؉EM܀"t'uEЉUmЊM<'1҉EP10B}С1P1UY^MmЃ=1t^}ѹLE}mt(t <$SuPX <$u t <$SP( <$]EЃ}t%tPP$Suu LPP$rt PP$SeWW$u%}Nu 1Buh#C[^E@EEf}f815--fBYt*fBh #jK1}9tǃ8뼡1h#XPeY[^_]aUE E EE]UWVS}0uh j jh&MQpÅu$Mh j jh@&QPÃHxu Vh##Eh:.h# Ea6Wh#h:.2vWh$#h:.F (twu1h$&SY_ujhO&V^ &t"VP_Zu&f81<&uhP11҉zY[th?#裕vVh#脕 f81hcX$S_Z1ɉ>ÉhR"V_Zu h]"VZYu6hb"VY_u Vh#Ȕ e891h#S*_ZDžum>jP11҉(Y[th#QXZ <91G}Ɖ듍Wh#Sk9 HuEt9d1s(h#d1fj91Y[fj91uƅh$S6^Zujh81h,%SZYujh81^ h#SY^uAjW11҉_Z91Ph5#SY^u.jW11҉_Z 91hC#SZY^u.jW11҉t_ZL91hT#SY^u.jW11҉5_Z 91h"SY^u.jW11҉_Z91Thd#SZYthr#SY^u.jW11҉_Z~91h#SMY^u2hW11҉d_Z<f(91h"S Y^u2hW11҉!_Zf*91~h#SY^u2hW11҉_Zf,91;h#SY^u.hW11҉_Zuwf.91h#SEY^u*jW11҉__Zu;091h#S ZYu9jW11҉$Y_tVSh!#u491wPw{tSh# F;d1rSh#~!jSh#ԏ‰d3181f‹x9181hf#VH_ZƉ>uh'#<Y[@&;twWZt ucPVW5h uT-@&Ë91WmYƀ>thf#V躬_ZƉ>1&tB.DPt7hP11҉,ZYt$h?#U[_ Dž"!y v5Vh#hD#1ɉƇ8181$@&p91|91|9181W8116C-fCp91|91|9181te@81t>16C‹|9181h81Ze[^_]UWVSP1۾@&<@&tCtg1}jSEPH ths#:Y1@E h jSP<1E4ϭFZ9uuOXe[^_]UEU M= -tMU E]F]USÃ=81=81u1҉Dt%Ph81XZ0 u=81t =81t0 ux=81u=81u7j荜h81hedAS/ tHh81hrdAS u/h#j=h81hedAP y h#jE]USQ81WEVd91WEVfh91h81:fh91X=81=81u2h81hfdS y8t8t#rE=81u2EPhmdS? y h#:Z$-h=  X=81t1&h81hgdS y#W]UWVEu 81t 81e^_]Uh81hmd5$- UEU 19s f3P]UERPZYUS]EPu Y h@:.hS‰ƒt$t< tj S8ZYt1]US@-tsPh $ 讏 `E E'$]U"=x:1u"PhF$P: Hu9Y[u uVh $YI][<1M9Y<}Ph $9Y[1jPT t5h1uh:.=t:1~E1]9^~ t)t;FtF5h1Wuh:.+FGVh $舕XZe[^_]USBHBy;B| X RQ?XZ]UWVSQ]u uh'"S˘F fw4&h"Ph."S褘 FPjh8"S萘FPjhD"S Sh&XZFXt ShQ"Y_FXt Sh\"~XZFXt Sha"kY_Sj }v(hj"S v,h|"S v0h"Sv8h"Sv4h"S$vu8t/jG} tu Sh $ Sh&_X뿃} tu /Ph $ 벍/Ph&[^띋$t $PLYP?Z}t E1_jPS2 y hw#FX7ƒu*t=tRs$u hfE#m e[^_]UE(@1E @1]á(@1á$@1UE Puh:."h:.j pj~UWVS]L8ށu= @1t5(@1h!"*YX=;1t"= @1u5(@1h $1;1XZuu ZYyWwPh$ۇ t7= @1t.j X= @1tKP5(@1h $複j}e[^_]UE Puj' UE Puj UE Puh UE Pujjh}UWVSt1ۉ$@1Ph%_D^_y h $YKhVu(} }t Ƅ1ۍPWDYZyWh- $NXZ]%=`uz 9u;u$@1Whh <1 à uWh= $뜍xPSC^_yS끋%= ShW $e= u0t,WhVE à t ߻Whu $+W_Y#0hVk à uh <1h&$BXZ멉؍e[^_]UEP0ZtPRPh $ u uh $hh;1;1U塄;1tjXj US5j0h&jDz ;1jjI ]USj蒟jjjj]UWVSÉ֋x CPww wwփt=@@1~j ;X@@1e[^_]UWVS1=4@18@14@11,@10@1,@11 Dž蛾u/h $h $h[^Dž SUYu8Åu@3hV&j ǃ uVh&$0XZPXEtVh $诃 Eu {u{wu"Wh $h:.  DžQCC jhPjV Ãt'$Phzd@Sd @uSz [WYYD B.9rDYt)PH,@1t4KRWQS u <tPȉjq W$q C1ɉK C C1{;0@1C0@1<@1XZ{ t%VwYZuVh $fXZ?jMq Vp Gp G p GG1CG8{Dž*Ed@DžT,@1Eu<@1} u:E 5j 藀Ytsh$bs _Xtvh!%L6M 9~=,@1 1ۋ9}IU: tE 9}?C9Ft16uPh$eXZPWZy5,@1ы1Ҩuԉ ^ EtPs ssh($~ȃƒt.t&Ps sshA$h:.ԃDž StPVS t"18@1C8@1 ssS 1ɉN@@1H@@1~ X <@19;<@1,@1?uǃ tuU E 9|q4@1#:tV$he$Ph$h:.蚂4@1t`?#;t%#Ps ssh$h:.eͅjsVsUE u T )9 _ TU e[^_]UWVS]fU ffCffBCffBfCffBs s+TY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssXSY^} GWssBSY^GWs$s /SY^G W$CDȉGDs,s(SY^G(W,C@ȉG@s4s0RYYG0W4CHȉGHsf}3EE܋Eؙ}E)9EE у}uUuG=B1=B1 }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AExB11}fG18f@@XZtA 15B1xB1C,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=xB19E9UʋMou{5xB1C,)֋C,C,)s$S(;h$SNjCSMEAE@ufFZ[tA 1B1Ee[^_]UWVSu^8C@Pvu uu uhPu uB1 )P@1ɉ5TC1NP t1҉ 91CtCS OtNCSWVP +QCSLCS >WVUP +CS yP @1t|u!<|uxuxx u xv8|^u |txTC1=B1XT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp xB1TC1H0|Ãx} xB1x5xB1f-sTC1B0C9sjh-VR5xB1 C =B1t@Y @[ JPdh t19}#8@#BLlp>Ãxjh-pQPh)$j=B1t h=$iYhI$OZtWC jjTC1@0 RPJ P^_DTC1@0Ɖ =B1tL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|21B1 ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jjTC1@4 RPjjWVv f-xB1Hɉf- f-f-f-f-E-=B1tE-]E]C WV XZ=B1t CpSt C(T1ҋ TC1I4 xtWV`([^11tjupEN xB1f-UJ TC1@4B9s$Ujh-QMmNM xB1 UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_#f@t|#PhP$$\=B1t+=B1tC CC C u#hZ$hdYhi$ڰZu1B11nu t3f@^_`@1d@1jj ¡,-ƅDž Dž1 B1X[tBBp tBBtPR^_t`@1d@1hs$Ӄ[=B1t/5(-jjjj`@1d@1uh$蘯Yu5,-RPjjt0C1=B1toh$bb5`@1=d@1ut(jjX@[ZHfAWV$1`@1d@1XZ=B1tj [_`@1d@1ut!jjRP!`@1d@1uu h$RPof%[^f=@h$sh$臮ZY5`@1=d@15(-jjjj`@1d@1utRP5,-jjEhjj5d@15`@1YƅDžm WV}@@PP WVaf@5d@15`@15d@15`@16^_8th$x1ɉ B1[B1B1tCjj RP0D u{C9s#Qjj RPA N0ӍS19r)#u 5d@15`@1iu"h$蠀h?#5`1B1XZ$fH^_f@t !5d@15`@1hC#fu8!t%hC#5d@15`@15d@15`@1#@Z[@fAs5d@15`@1gf@5d@15`@1h;$$u thR$bX =B1j lWXeY[^_]aUWVS}u w wN@fEEZY9ucB1t=B1t =B1tj jjjw wuB1jhe$W[ w wNYXG d@19O u,-;`@1tOf%|#f=@u#Rhk$d~w wE)Puhy$:W=B1us=B1tRyNj ;Vh$~XZ=B1t2h$]_=B1tfE)fCe[^_]q h$ݩZHt1ɉ B1x밍e[^_]UWSáTC1p8ѻSYu1ۅt$ TC1q0RPkáTC1H01{ ؍e[_]Ƀ=B1tf‰Ã=B1tÃ=B1tUWRPU,Y_}UWVS,u} }B1B19]KM])9ȉЋUTC1H8UUE9|"A!!EUM]9]}=B1tuI!QWVh$bUTC1MȉẺMuuWV2D EMEЉUԉE؉U܁\TtCЋU!CEUԉE؉U܋CEU܉EUEUEUE9ƉUCEU܋]9؉Ћ]ظ=B1tduuWVh$T TC1EƉ׃\TtAЋ]!A׋ARPuuh$=TZEȋUEUԋ]9؉Ћ]ظ};=B1tuuWVh$$STC1uuh=$S$럍e[^_]ÍL$qUWVSQ8QEU}9Es9=B1B1Esuuhb$y@1@1TC1sx1u؉}܉Ɖ׃uЉ}ԋ}9}Ћ}}sEU9E}(\1ҍMQRPuu: EЉUԋEUEUċ}ϋUEȉUḾTtXZPh$>Y^=B1tdPh!">^_=B1tCSCS rRPh$> =B1tC(CA1RPngZYE E$e[^_]h>e[^_]UWVSS]u }s stEZYOu6f%|#f=@u#RVhI%!es s_=B1t h$DYh$ZH=B1u؃hB1lB1{@tjjjjsHsDs s Su[^_=B1t @1@ A1 }s sZYe[^_]1B1e[^_]UWVu} WVuuuh$"dj F<WV$t uB<v Rh$be^_]ÍL$qUWVSQ81yAELC1EЅutWVTZY8t 1u؉}1ۉ]̋E;B1EB1suuEZY8t EU͋E9B1uE9B1TC11ҍMQRWuu'# EĉEEC1Eȋ19]E s 9sjVKYXu!Rh$bXZ1E؉ESEpW$*Eȋ 9s@t EpOXEC1x0uu EY[ TC1EƉׁ\TtAЋU!ASA RPhC1薔5C1TC1}󤡤B1=B1ttt5TC1u5C1 EЁxU tU tuh)$aXZ=B1thC1C1_EЍxU uEЋX\áTC11RPuu # EH TC1ELHh R5$R* =B1FSQhR$1* =DC1t4hg$*DC1Xtssh$* j )X=HLY4DEUE9ƉU}4Ѓ1B1뾍U1Eg 1pB1tB1hB1lB1ETC1];X,W}}1Euu TC1U׉e^_\Ttq֋}!qSI SQhC1To5C1TC1}󤡤B1=B1ttt5TC1u5C1脜 =B1tE@x TC1E1E=`B1t7TC1p,kEd1E;SVuPhs$h:.1=`B1=B1=B1ExU t1U u E#uh$;[^ExU uۋ}G\M]ȃ}tgu EUHu}u}11ۉΉ!!u6u2EU}9}u܋}9}uԋEUEU}uE|C1ËE}uu 1ɉK<}%?}u}9t uuuEZuuh$:j 1}MECEUEUtxu}9r WV[X M89xu9tuËEUtx5D1=D1 D1D1TC11҉EUtxEUtxt1x1 E9EEEEe9׾r 1)ӉΉߋ|C1E]3u us&C1|1҉TYm9}u9utc%?u9tWVh$;9jnSu#YXu Suh$9uEsE)Éٍ1EPE 1B1e[^_]UWVSEP@EUE@ E}juu艻 tD1t`}9xuPu9puHEuuh?$Ep p D1qyEpxu}qy D19@C1u @C1u덋=D198tEUMK؍e[^_]UWVSTU1EE~ DC1D1111ETC1H,9M=`B1t5kEd1M6SMQuPh$h:.1ۉ`B11ɉMTC1U;9soWVtXZt`u} B1tCCpB1tEtCCttEWVkZY8tEPSZYuE_Ee[^_]UEU @,+B,]Ƀ=B1tf‰Ã=B1tÃ=B1tUWRPY_}UWVS Ep8=B1t 1Q=B1tt1;B1B1slj}1RPj@F[_DžEx48x0.Fhm%P%QZY"}O_ u9ttFPh$s4Y_R$Pn`ZFfSPV whD$>`_tr<Fo)efFYPVWtGfSPVXE@0P4p pihfH DžU;B0B4wr r@Y[=B1ƅhhC#Pek B1 B1ufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFhC#PMZYucA1A =B1 ~h$Ep pFh$^H1B1EHX P@uuȉh$SQRPVFD9c$>tFPh*$y1_Xr$P][tguE@0P4=B1t hQ$YP1҉P FfPhc$#]_u@@ uE@0P4=B1t hQ$_[H1ɉH F>ufWV C+fFPVSfWVuDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uh`$ ~ .u)hp$Ep p֝1>h$[EH0P4 19B1B1s h$=B1tuHu<~t6h$1RPEp p蔜=B1uHt%~u븉Fh$&[[H1f1RPcXY,t#B<v^uM;A0A4o h$1RPEp pЛh$ZW1ɉ B1?M;A0A4t!=B1=B1$$R1RPEp pPh$ZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0Ph$Ph$-=B1t h$ Xh$XYU;B0B4}R AAQ=B1tTVC9tHh$1RPEp p™CFh$~XHt 1҉B1 DžfKPRh$>+u Dž 1 e[^_]UWVS\jj`_ZP$&h$+h$W[^u 1ɉ B1}hjjjj8hD$+h$W_Zt5jjhjjjjآu h)$X*1ۉB1hr$SW^urjhej\h[$+h$,WZYuh$W_>jj%[^@%@3fs Pht$)=B1tjjY_fXZh j5$C154C11ƅDž 54C1$C19T=`B1tD+4C1=$C1k#)WSPh$h:.1`B1C$w0h$ss xB1A 1C$h$ xB1QC SRPRPhW^ xB1C$1҃=B1tQRPWh0$h$a)QRPWh0$h$b)=B1t h$_ xB1C$D1C$=B1t/ss CNjC$1~YY=B1u$GW 萷h$TZHt1B1GWڍ@1=B1@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=B1u4C1_54C11ɉ B19s؋{$@1=B1@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =B1th$SQRPOhC#vvvv 蜓fOWh$SQRPh$Pu 1B1,v vOYf@fOFVFV RPhC#vv 訒4C1$C149s$;ww Y1҉WWY_8u؋=4C19s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=B1tUWVSX$C14C1D4C19=`B1tA=$C1))Kkd"VWSPh!$h:.1ۉ`B1ss WZY{u { <{u{t t&5B1tC=B1t8=B1t/u*CS 9RPWf@1C SCSut+RPWW¡dB1Y_:u9|Css菰FXZ95dB1|)js s賜Y=hC$E"hi$YN /ss^1ƅs{Dž  B1^_tBBptBBtVRPZYu hj$x!_Pss觛tQDži ssvVPtUf@Y[5d@15`@1UfHXZ4e[^_]UWVS EP@EULC1ETC1RVuu EEƉׁ\TtCЋU!CQC RPhC1R5C1TC1}󤡤B1=B1ttt5TC1u5C1 ExU t U tuh$ [^1}E@ EE}juu跢 pEUЃ1EUB10M;DC1Ӆt3}9{u}9{trzs{DC1Rz Y!}tdExU uEp`ơTC1RPuuJ E؉U܉Ѓ1EU܉M؃3pB1tB1Ex@t+jjTC1@4 ؙRPEpHpDp p` TC1Ez89x t2}t,E@$ EL@ EEUMW}tu}toTC1E{89x u^E@EL@jRPEpp+ K` tPuSzch 5TC15 $rXZ=B1thC1GC1X=B1t =@D1uB1 B1 B1d TC1AhdlߋplƉ߁\TtAЋt!AƃdAId t1RP5[^5TC1BLЉ@D =B1uh$ [Huqh{($臿Y=B1th 5TC15hSP5|C15B1ƃ hC1lC1pC1|C1=LBALt[=B1h+$`h$tY_jjjjjSW;=|C1fGWW:fGC1CJtejPh/+$ =B1uh $ Zu9hM${X=B1tC=|C1fGW9fGC1_fCff=v]hd+$Y=B1uh+$Zu8h+$X=B1tfC=|C1fGW{9fGC1_fCffuih+$AY=B1uh$5ZuDh{($襶_=B1tjjjjjS:=|C1fGW9fGC1f{f9}zD3<:uu6G뭉EuaEe[^_]UWVS}]O,uh3$h&h` ؙt,h(4$h&ha h2$蚸U Msu)u؍e[^_]UWVS}]O,uh3$h&hq ؙt7h(4$h&hs h2$ UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}K1t5B1WVSh>4$lSWVu5B101e[^_]UWVS] u}K1t5B1WVSho4$lSWVu5B11e[^_]US= C1t h4$|?j5K1{[Zt!h4$Ghr$[ZYujjb5K1xX1ۡK19XL~$K1t@Pp0h4$l Cҋ]áK1t%Ux,tP*Y5K11K1ZËK11t z,tUu uuuRUWVu} WVZY=B1t@X@d=B1t1s&TC1f`u131 ȍe^_]UWVSB1tH K1 K1TC1!`t'Rh!5$ۑhr$ "j`atuhlpx1RhW5$脑hr$蘽 th<5$TC1 ǀdƀah P5U 9}׋ut߀Su)~u8$1҉E܉UE$ƋE4Bu~u EC$EP57聵 ZYoEUS1e[^_]USU] Ӄ9tBJ13`&[]UWVS E 1҉U9Et]Uf j eT UWVSu }jWVuSuh9$un[^jh"P Sp1Cs SZYp9t%EXWVh9$P5CKPKTʋMЉh1$lPsLsHQphu2}EtsLsHh9$PRpZY‹E;SXt+tsLsHh9$u~p hYH~&u 9$t9$WVPh :$uDu tjSPjjWVu Vu tjpPl1RPsLsHu uNt 1҉ll;CPs㋕lSTp‰Љh@hr(z,+r z$E~BRh&$htQDWVhr$r tQh:$u*,hjRjWVr$r u FlWPl1S~fX1e[^_]UWVS É։jQRPiEuh9$S[^EfUt)tWVhK:$SufY111҉UMU슌 tu@ tiE}u҅tou\uXHtjjhg:$S~jjhr:$SjujjjjjS iytWVh:$S~WVh:$SjujjjWVS_E ,EEEEEPHME@ uWVh:$S~0E1ɉM܉EuuuuRERh:$S EԋMQуt;t6juj1RPEURPS uiMPB1;VF|~$u~,u;VV | F)8tZu#[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ|l|t2@|jmURj$O8QUR|P[tijWR uYjuWUu"@uuZYjuPUu@v0shV=$u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0hf=$S 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uhp=$SZY<$E܉E1EuuWV2 utuWVh=$SLEPuuuu]0 Ɖ׋EUutuuuh=$뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^h9%57K _X1td1SщU&MMYZMt/UBuSh=$u h9%j8K XZ뫋&&  Vۉe[^_]US1 &&uh >$}D`u܋]UWVS ]} Wh#Sn 1&&EԉU#E#Uut7#;t%#WPSW&SEԋU!E!U`u}u}t;uuh>$juVB#;t%#WPS谣WVS訣؍e[^_]UWVS]u tEU E Uuuh">$SY[ SZu E@P9sPVh1>$SۍFEPS Y__EtVhP>$SZ 뭋EU҉EU#G0#W4 E UG0W4S2Z@tuSZYEU#A0#Q4 E UA0Q4S_@NVhl>$S+ Ee[^_]USP] ;u:j EP57 U:u1҅u57hZ"u Ћ]UEUitstau+u Pb uPZYU @Rh>$PU UE t*u 574ZYt57h>$u US] ;u#57Y1҅uh>$uXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h>$PY[E1eRPN $RPn[Z@8Zu%S573ZYQh>$P ֋]UWVSu }jj h#WVj]S8 yEWVuh ?$o@}t Sh$[@ZYj s?Xe[^_]UWVSQ]M tu E𿥴"E𿵦"Qh?$SN'M $jOXZM uWh0?$S> 9jVQjjuuSU 1ɅuWhO?$SVS‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_Zthj?$6jSY^ujjjjSTEU}u&}u h?$S[XZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt h?$PP @9E}}EUuu h?$'EUjjjS@ $uMY_u h?$jPjuujjS8 uVQh@$S p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS,2_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS1ZY@UB߃}uujSr@jp juuuuS u h2@$b @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9p3.tE `&1҉Ue[^] ,(hYA$&$hdA$;$1RP,(* RPhuA$ hA$"BjS\ uhA$ BXrX CRPhA$V;s,s(hA$s4s0hA$$C8Ph#hxV-VhA$;sPh B$; 1e[^]UU E$E8E U]UWVSYXuWh7$V @:.hEEZuh>$Vo^_bShjPq:ƒC @tWh5B$VF 8@:.t ES;XYUEj uN_ZuM^@:.tUSW[LEPVZYPEPV @'Et M 9 p3.uPho EPVh&jWuQM e[^_]UWVƉj(jHZYt*0xUM PH 1҉PPUP1ɉHH H$e^_]Åt!USÃx$t p LZSLX]UWVS$u}Et>QEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^hB$PWE UEԉU؋E9EE]}5Eu"WVuu uuuuhB$P8(1 AU1]1 u`U3U ]3] uPt3}ut(EuMWVuu h4C$PMEAE A E$A$tMu}t=B$}w } &B$w&QRhPC$uy<1ۉYMuWVE Uà  E C E$C$E;EMu7E;E u/ACKtX EYEUQ#E9Eu0E9Eu(ACKtXYE܋U)AQ qMԋE U+EURPEU?E t]s{ px EUMԉQE܋U)AQ A}G{YK_Gtx)E}䉸hlC$uEXZ؍e[^_]ÍL$qUWVSQ8EAQE؉U܋A QEUqy19WVuu" ut-E؋UWVRP_$ ΉE؉UMWVuu}" ut-EUWVRP$ ΉEUMEEă}Eăx}PEЉU1M9ˉËMY}u}tE9E؋E܋]DE؋U^9E؋U܉EU}XWVuu! EU}u}t6EЋUEȉUWVRP! Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}u}tE9EȋE̋]9uȋE}uH}uB19}FEPWVuu ыU}ut#ΉEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@^1EċEčeY[^_]aÍL$qUWVSQȋ]yIX P@E؉U܋w yh}C$uhC$u0XZ~thC$GW EUN^ }u}u O_ uuSQM؉] M؋])9]u 9M@E9؋U}SQuuhC$uO_ ȉ+EUEUVFV +EUFV FGFtxM]M]SQM]uu ҋM]ut&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U# M]uhlC$ut tN-}uA1h 1h] RXYS}uMQhF$S jHJ8QRUPUr 1B$E1r(z,ꀃEE}S^_@tPSn^@tFUȁ¾1uuuRauS@uhF$S'ZY1EEe[^_]UWVSSÉЋt񾥴""""Ujq Pq qu uSU uWhG$S &PSZY@uWh1G$VWhMG$S1e[^_]UWVSÉu uRP@ }}t}ME䥴"E쵦" UMEE䵦"E쥴"@ Ur $Ep PFVEPF V$EPFHVL1Fv VFE0S@uuhlG$S] uuhG$S1e[^_]UWVS]} tE &1ue[^_]SEUjS thG$SjSrjSd jSVjSH u uhG$SY[z uhG$݅t)I }9y$uu9q tuPh%H$SM 븅t*t u5Xu}+rz WV tjj _Z@ultjSY^+uu tjjr_Z@u)jjjjSuu h8$jjjStƃu h8$1fdžUjuu썆PjVjjjjjSC0PSY^@uh8$S;hXH$SSXZ1e[^_]UWVS4u ] 1E6#hH$uVU tPSu @u95p3.th&jZYjh" Sue[^_]UWV &}^_]UWVSH]u }1ɉM܉MMMMMMEhH$WVeT Eԃ @t=}buEPSXZ׃}qtuԍEPEPEPSv@uE95p3.th&jE1;EE}1SuMu_t xuPt9pu 9uU@uuuuuS-ẺUЃ}u }E܋UEĉUȋE؉ES\ZEHEPSEjh &PuuhP>$S g$1RPuu EUSXt E;AtIhH$S_Xqy 1U9ЋU}`9u\9uuW}u}t,1U9ЋU}=MuuWVx ҋMu#u}t 1uh I$SXY[uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,SZ@tJu`p(x,S@t$uűMq1uh.I$S>Eԍe[^_]UWVSH]u }(,EUEhI$WVQ t(qtsu&jsEPjjS@uzE95p3.th&j_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuhI$SZ$1RP,(W Ɖ׃uԉ}؋M9ȉЋU}WVuuhI$SqjSEY^tPE܉U}u}t hI$Eċ@ EjS_Zu h[<$pjSY^u hI$Rx G EG$EjSg jSY tu hJ$SXZE9Eu"E9Eu}u h/J$S_X1E̋p GPGTEE܉EME9s3Mjh &V MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuhTJ$EԋU+EU9E| hJ$.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u hJ$S}Y^ U܋MHE܋U+EUЉQ}u hJ$S=XZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uhJ$S @ r $󤋃p PF V$1~PF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@Eu}UԋEhK$S[^MffuSZY@h/K$Íe[^_]UWVS]1uuuuu11hMK$uu YL btENtoat%itClh&Y1EPSZ&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9p3.uEU t th&jZYWVRPuS1e[^_]UWVS Eu} jj h#RPj]S  yEWVuhK$s}t Sh$_ZYj wXe[^_]UWVStƉP)Zt 9St[RhK$VX ,{ RhK$$1s3щ¸K$$1s sщ¸_A$Wh&$hV (Wh#htS{ SV[uhhO&Vx SVhK$bGPh#hS: Sh%M$C$jmSj$G8PShxM$!hM$G0W4uuhK$X1RPhPwPsލe[^_]UWVSˋM} $&EK$u t hK$Xh8$wX  ׋󫋃Vh L$$_8Sh#htS ShL$hL$E)L$>E7L$2{u;t hK$YhEL$C KZ1҉9u9BuEiL$hOL$:_tjmWj$8S1tttSh#ShYL$hWWhL$ZYwh8$XucuZEK$E E]L$e[^_]e[^_]ȺK$uRPhM{%m #e[^_]Ë :.Q:.y ;:.| t:.J :.Uh:.PXZUWVSxh|% hL$hZ;$x hL$hL$\xà DžpL$DžpL$s3x pys sx p\ CtPhL$)K Cs31F { Wh&$hP Wh#htVVP(WuhhO&Ps PhL$XZ{h L1h#hVfVhL$oVhM$d h/M$Wjj h#CK x$$RPjV CK x$$RPhv" jmVj$G8P跺VhWM$hM$G0W4u[uWhK$5X[tVhL$~GPh#hVVVh&$ZZYeRPhPPh'#+K Cs31H C tYC 8P)s t󫋆Rh#hVVhM$e[^_]UWVS}u 1ۉ]]]1hM$uVB tYl`~Wa wO$&ut6xu>ƒ뽃븍EPW EPW[ZY@u떃95p3.th@&jY[ujW^Zu hM$lY؃tډE;EE}1WMuZt xuPt9pu 9uU@܋Ut -h|% hL$`hZ;$ hL$KhL$W1ƃ EL$EL$v6 uv v u FtLPhM$XZ e [N Fv6 ?vXZq h'#Y1e[^_]UWVSD] }1 &}EN$uhN$uu @ tfitJTt,Lt u V. [TPh:#V5B tCPh[R$VB tCPhfR$VB tCPhsR$VA tCPh$&VA tCPhR$VA gCPhR$VA LCPhR$VA 1CPhR$VqA C PhR$VVA C PhR$V;A CPhR$V A uG DžVWb ZYuhR$[^%Buh8$AWhR$G uS Ph#6$S> tSh*S$ 輪 p Dž@$A 9Yo Åu Ykuh2S$hD&hhN$P; tVh#htWVWh$&SC tFPh#hW/WhR$SB bv$v h|%SB Fv,v(h$SA *v4v0hG#SA jmWj$F8P諩u$Sd _ZWh$S-B uh?S$E hIS$X [`E  Y h#MD t9h"XZu&h7$S.:.VSrR_X:.tV ^SZ1ɉ Xe[^_]UWVS]} U#1,hiS$R$W1  @$t&Ftiu57Dž,9=p3.tE x&1ۉ]e[^_](,$($jSZYt,uhmS$*jSpZYujSbZYt,uhG$S蹪 1ɉHh#VBYZu^S$V: ZuhS$hOR$ Ω Y^uhR$륋$1QRP{ uhS$SB  1 h*S$ | XZthR$Vi ZYtjhPA{ u$hS$SV  4Ph#6$V=5 F41$1$8PhR$Vv> TP8;Y^!1RW($ $( ,10$(+hIS$ ! _ZOh?S$P ZY4P _u"jh &R4 umV@ Y8Ph$&WW= dR8ZYdt8hS$S 1ۉ,DPh|%W2 LPh$W2 g,9DH0|;LPhT$S荧1Vi $@P , uhT$SsXZ:jjjf-Bu @u hGT$1$ 9sP,Q ;$u9FjRPQ-Bu @u hmT$-h_T$r$,y ;$uF9$sh8$ ޥ _X h%R Y^P ƹ,hR$R葥 PB Z X+tPhN$Wm1 t,0Ph:#W2 ,0Ph[R$W1 ,0PhfR$W1 ,0PhsR$W1 a,0Ph$&W1 =,0PhR$Wh1 ,0PhR$WD1 ,0PhR$W 1 ,0PhR$W51 ,0PhR$W1 ,u/(~ǁ#,$ ,0PhR$W0 ,0PhR$W0  ,fǀUjjj)Bu@uhT$S譣$,L ;$u ^u&H$,ȍt _Y4t 1󫍽@Wh$&V7 tuhR$SԢR@ZYu(WhR$V7 tˍEP@~ZYt@hS$S脢 fEPh|%V}/ tEPh$Vg/ mEPhG#VM/ SWh$V'7 tj$EP@貟 sV0ZYu+C xu"t s srEYXj Zu,Xe[^_]UWV։P Zt hV$jV@ jWMQE 0Xe^_]UWVSuE @80ƅ77Ph$#VO t 7u>HVH ,Z3V _t hV$0x jWh}(聫 Ttg81ƅ9}(@󥍅8PhV$jPSx0PhV$jPuVx VShW$j-? S[t hf$jA? T˅tdS zuW$(,s'/ZY(u1$zu%B TSh%V! u ]=)0xP0hPTXY_ShSW$VA! u =)0|P0pPTXXZShZW$V u <+TX0@dy! ȋ0Gdj0P0 j0,P0 1e[^_]UWVSƉ`d$1jvSv tj+<uh&hU$jV= Sh'iPO @u hW$j8= `#te[^_]UE]ZUE]IUWSD<1 󫍝hDžDžxDž DžDžDž $Dž(,Dž0@4Dž8DžLi@DžPW$DžTiDžXW$Dž\!iDž`W$$󫍅Pu u e[_]UWVƍU1Eȃ^_]À=L1UWVSàL16C jjhWRP[thh#WH WhW$CV_Zt%п )׃ tv9t1Wh"Y^CtJCjjhVQPƆthh#VsG VhU$IXZGuCPhW$1Y^CtJCjjhVRP^thh#V G VhW$XZC1RPhW$hSShLV$e[^_]UWVSVu$_uh&hV$j9 ƍEP'[t hf$j9 juV>Nj] t>sV)ZYu+C xu"t s s>YXj ;ZuXe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u h,&hU$u+^uh,&hV$j8 sP3Es WsEhu %u t.Pg Eh$u E tZuE EYLEPh#u }Chs@PuA @qh X$u~ XZt V؝ YhX$u` XZt Q躝 XMEPh#u E Mu {hE EEEM؍CU`EPu u @Muh,&hX$fEftft5fu6t2C t Wh-X$j$7 }tC(UhMX$C0ut3hiX$j6 t C0sHtS4KL9sщ}t:s@shu us@s`u @u;4w581t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\hX$s8sXue @u s\h&$te[^_]UWVSPux Zu1du 虌 _tLV Yt4W EWu ȍ tPMQS uS謶 [1V躻 ZtSH X؍e[^_]UPEPhB$u" ƒ 1tEUWVSu\Ph%X$V t\Mfnj4Zu\VXtd$1jRVVhiS"@tt}f1RPh%X$u ! 1e[^_]US]uu S? @t ]]1]UWVSu u [^u Z3P2 Y9Es=3?V< Ƌ}M)1Ze[^_]UWVSu u見 [^u 2P˙ Y;Er2?Vՙ Ƌ}M)1Ze[^_]UEPh`#u ƒ Eu2UWVS8uEPhX$V{ uh|%hP&hhX$+hX$V׊ _ZtP3 ƹ}[E]ShiV4}ĉjSN PhX$u 8 ƃ S Yt:EUu؅y1ӉM]! EjEP XZuVhX$u ي V蒳 He[^_]UWVS1Rhiu54 @t|j7RPhX$hSހ>tVhY$VU t j7RPhX$hS;tSh%Y$S \ e[^_]UWVS]hX$S9 Y^tVPk Zth5Y$h@&jVhX$ *Vq ƍUܹRhiS<3@u hWY$j1 e[^_]UWh%1󫍅hPhiR2 t|}UWVS\PhY$u uh|%h&h0hY$f)dShiu2 tT\`ty1׉\`! ftShiu>2 @؍e[^_]UVSuV|ZtÍEPhg$V) uh|%hl&hhY$(uS#1^Xu hY$j0 CPS ZYu hl&hY$Ph X$u uhl&hY$j/ S1e[^]UVSSu] EPSV @uh&hX$j/ hZ$V ZYuh&h&hhY$' X$Eu$PRS] He[^]UVSSu] EPSV @uhL&hX$j/ Eu h3X$j. hX$VX ZYuh&hL&hhY$J'PhX$S܆ He[^]UWVS}h!b$W [^uU-P) pY@vhZ$VZu h4Z$jb. VPh!b$W@u hMZ$j. xtdPhiW/ thdZ$뮉`SX`e[^_]UWVS}h_$WC ZYu,rPg pV=YXuhqZ$DVSh_$WK@u hZ$jg- 1҉Uu]EPhiW#/ @u hZ$jf- S<X1e[^_]USÉЉʅu #th#QuRPShZ$]UWVSu1j+Vhxi P @uhZ$ UЉUPRXۋUu hZ$j, U]Vhxi W  @uhZ$ڋE9E~E19u~tj [YWh&$.FXZj @S<jBUVSPuVZt"ÍEPu V @u Sh[$j#, @PUWVS$ƉUЉh^$PO [ZtP諑 ƹY1@]Shvi Vs-j Sʏ Ph^$u贃 à Vj HZe[^_]UWVS(uEPh [$VK uh|%h&hfhY$#MԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EP XZtVh^$u V谫 He[^_]UVSuV[thu %V ZYuh&h,&hhY$"PN ^fx PSr+ZYu hY$jf* P<X1e[^]US]EPh&[$S u (&juS-,ƒ 1Buh&h&$AXZ]Uh/[$<1US]dPh%S uh|%h&hhY$"d|lPhiS8+ @u hf[$@X1]US]dPh%S- uh|%h|&hhY$!d|lPhiS* @u ht[$@X1]U1EEpPhiu* t hdZ$j( 1UhZ$u ZYuh&h\&hhY$!Ph X$u 蔀 HɃ0 v+BwBÍBwBU ']UWU1ERhiu) @u hZ$j( 1}W|$wUWSÉЄtGjj h#QPj]S S z#th#PSh[$d hO!#¸%#@Xe[_]g_UWVS${ uh&h[$jb' jLh-)_Z#t[$jmh- ZY¸[$u#WPSh[$h:.g=h-t VW?Xjmh-ZY¸[$u#SSSSSPShZ\$h:.$V菧 jUEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-YZt $=CЃ v؃߃Av n$h-Z>uQ$ -1]UE1҃tL1]UUp-t H9t@]UWVS41ۉ]܉]E䀖DR1EԅƉ@R1EPjxZY@u h]$EU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=@R1}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EP[@u hf$jk$ }‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEPY Y[=DR1tSZusuAjEPjCwZY@UEM9u]9uE9E-9ŰMh##j># UWVSÉHP]ZtP_D 1D1V!LY@u h8&hU$&RPHSƃ uh8&h]$j" R1RPh]$hWWVhz^$q jVWWhiL@u Wh^$9t Ph^$&XZjVWҽWh~iLP@tt Ph^$Y_j pHZ@uh8&h^$uu =`-j:RPh^$hW]?tWh?_$nW| j:h^$hW?tWhQ_$(W~| tHSW?YXjVW購Dž@WhiLuh^_$XZjS9#jVTW\Džd1hlWhiL @t|h)Xu hr_$l@1dWhiL{ @@u h_$@lh_$@R =L1t%͡"w&Rh_$Y_HS XZ=L1u0=L1u'DjHSDP jV`V-VL1-{k?PL@uEd$=L1t]$Pj} h&%_$ KR1BXuthe$%#Xuth͡"%#Xuth_$%#XutRPh_$v h&%_$JKR1_uthe$%#^uth͡"%#Yuth_$%#Zj 5X-XSV65p-tjHSVv e[^_]UWVS]S^t EPu S @u Wh[$j u q Sr Yq Etuh@&h`$j; EPEZt hf$jI u1EVtRUW= ZYU}tRUu ZYURhB$SN tFE=MR1tFtj=LR1tFu[=IR1tFtL=JR1uE=L1u+!Hu)}tj `Xh:.vZY U6"=L1tj -XS u ujUWVS,ÉUPb^uhV$@hc$Sfs ZYucU̹ Rh8i(S @u8t hc$j jhc$u9 uhL'h&c$j Eܣ`R1`R1u VhCc$j^ e[^_]UVS։P跧VSPhUc$j8 UWVS]U hmc$Sr ^_uh%h`'h2hwc$‹`R1ށ؃E u %ERU葀 NjUR讀 WPFtDPEVZYUu s#9ERE ËE É`R1X1e[^_]UVSP]U Chc$Sq ZYu WP S VP訋Ãt7EPS5`R1AƣXR1S1FuE#U`R1e[^]UVSP]U hd$S9q ZYuh%h@'hhwc$+PR Sr VP Ãt7EPS5`R1裨ƣ\R1S[1FuE#U`R1e[^]UWVSS]U h\&%Sp ^_uh%h4'hhwc$Ƌ`R1%EV~ V~ WP[ƃt1Pu蔧ZYuc$EM É`R11e[^_]UU EkEPhc$uf uh|%h$'hhwc$`R1%у uсE ȣ`R11Uh:.hc$XZUWVS]h\&%Seo ^_u3hd$STo ZYu"hc$SCo ^_uhmc$S2o ZYtP`R1 \R1XR1!‰`R1d$1󫉕tVh7iS; @u hd$j~ e[^_]US] uPh&$E tPwYt Ph+d$XZEP詤YtPSh % 9%܋Et Ph4d$XZ]UWVSuV%[u hV$/VYu1P{4Z@u h'hU$p 81jS8P8Ph8i(4y@`%1󫍅`PhiV @uh'hAd$j2 tWphQd$X'Ht#8tuP9u Q=XVh[d$XuShbd$J_XjP2Y^u h "j \8Ph8i(4 @uhc$H诡Phvd$h>%HH9Tt$h߼$h>%Tj)j P4Z,H%(hQd$'_1ҋ0t`@'xtO(9u 09t4#HɋL #t%#QPh %/ ,딅u hO&^j ,YjmZti 119X~M%9u>uWcPhd$ hd$hd$4j F뫃 u]e[^_]e[^_]UWVSӉϋuuh 0h Zt2tVWPk u3S 1ɉ [u1V> ZV5  Xe[^_]UVSu]}t jG~ NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPuhBpWv Y_u F ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP#Ɖ׉‰ 9иr E8t8"uo;sC| C 9s} "WV0 Y^u x 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPF X1e[_]UWVSÉUMU1}E;E t[ztMUj8^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1ۉ@}u T'E@u E@ u*PE 0g ZYu6PE 0g ^_u獅LPh`#E 0 u 10 L0t 1󫃽0 00_0nu[[Hh9%HP(H,ZYu Dž,t$&EXtj/VQ[_ÅtC`1DžT0XDž\@PTP,V.ǃu@xuPq bTt/0u#xPVռZYHufDžtt,Ttt q T]1Dž,tN(j DPS*,D (t8t1ҁ,v  "1҉(VX(0tDž,1ۍh$S_Zu?Dž1ɉDžDžDžDžjShFh$ u ؉8 B.DytRx:uL҃0jWVh9%Pt;9u8tMhOh$j$ jRVjP\ƒu;t 1҉Ŕ@|Phi8uƒ 1Bu hoh$j e[^_]UVS0]juVhm$Sg@u h'hh$V~+ Zu Vhh$jk Uf@fEލEPhiS% @u hh$jh 1e[^]Uh:.hh$XZUWVS] }1EPh8i(S @t&E1r r r1ʹ|󫍕[!RhiS @[< v Phei$jd hi$>[P\P <fDžLVhiS @t%fNthi$=L1t hi$ٟXfDžLVhiS @t%fNthi$=L1t hi$號XfDžL VhiSu @t0Nf=) Phi$e_X=L1t hi$NYfDžLIVhiS* @t0Nf=) Phi$XZ=L1t hi$X|1󫍅|Phi8S @t}u(j $PhiS@Ghi$裞EEEEĉEEEԉEEEEE|Phi8SO@uh /$MXr}uMu u uuBEH~HEB.DJtx:t~&jPh>h$ uWhi$^_1Dy h>h$̝Y Pt`XZGj,ŜXhi$藝Y4t8hi$}XZ hc#oXj 舜_PhiSF @PhiS* @jh'P[ u ftePhj$[^Vf"fPN& Phj$ǜ ft Phj$謜ZYj ěXe[^_]U81EE1҉UUUUUUUUEPhi8uO @u hoh$j 1UWU1Rhiu @u hh$jY 1}UVS]EPh%m$S uh|%h'hNhg$uVhiS @u h!j$j 1e[^]UWVSSÉ׉Ph&$菛S)Í6 9})j<苚X)ЉU~&Ph((#LGZYUJuj>]e[^_]j-NXUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh3j$6XE1e[^_]UPEPh>j$u uh|%h'hhg$MME\UPEPhi$u uh|%h'hhg$MEUVSjjj"@_ y hGj$m\1ɺuBhPSG y haj$4ZuufiuS1 Xe[^]UPEPhi$uD uh|%h'hAhg$.MIE=@u hpj$j 1UPEPhn%u uh|%h'h4hg$M E@u hj$jF 1UWVSƍt1fDžfDžRhiV y hlk$j h'v 1l)ƍJ(R!R _9l}l' Džl hk$hޛ%hk$hk$h,k$hh$hk$llhk$(pp(dp@!Pd!pP YR1t R1ER1tI@tc@tC@tP@ tS@@tB@yA@pXx@`1ҋpv9}pL9}B\pfP@u uw%k pfx p@tp d#!= = w-g 1u=w_f?v-k 11u?1p%:=$v1"- 1p1p P hR1SW`\VPPllhk$p@"Xp@!dǃ0X*w'Owt4tov2tW0 Z=L1OGPySPhk$hk$5=L1j$uj$WZdPh&$XZ`Q#d9s ΃#yg$VRPhF#C9%Ȁ=L1XGPGPGPhl$hl$苔G1d_19d&j>^=L1GPhk$RKStRTRPhl$RPh"l$  F뗀=L1GPh)l$Y[Gd<G=PuZh4l$h&$跓XZ=L1WGPh9l$虓GPh>l$膓_ f`Wֹj$d5t-\PQh %=K "\`f\TddTj$tHj$Ptj$Ptdg$Pt"PQh %贒K "봊`\d<"\TL=PuEGu:hQl$h&$T^X=L1GPGPhVl$1 t#=L1dl$hQl$h&$Y[=L1GPhol$ՑXZ1t D ҃L dd`#dtj$VRP`Q4'h}l$vCu_hl$h&$V^X=L1GPh9l$8GPh>l$%wW ÉTӹj$\t-dPQh %N "dϋ\fd`T T`j$tHj$tj$tdg$t"PQh %`K "d\kT`PhEl$ZY=L1)w '$'j$Xk$txj$un]k$gj$`j$Yj$Rk$Kk$Dk$=k$6'k$/1k$(6k$!?k$Hk$Ok$ j$ck$OG)Xsj Wpp)hXh'"e[^_]UpPhiu ulhl$0Xl$Eu hl$j EwE11 -USE UUXt=EEEE1҃UjURPK 뺋]UE Puj US]SɩPhFm$j觨 SR1PR1~ UuUE Puj覩蚩je UE Puj脩x Ã=R1tMUEE EjjEPEPjEP&ƒEBuhWm$XÃUSP jh( ' jSɃ uSh|m$6jPkZ@uShm$j]UWVSd@u~Q1}=R1tC&;Et7EE jEPjjjV`@uuShm$O 1ۉ]]]]]E}W]SjdVSj[hrÃjhm$ ZYum$m$1uuuujEPj苁 E"1}jhn$h# EPh$%R h$%h`n$ji jpu6hn$r[jjjޏ jWjjVj\1ɉ -jEPj詏 ud8tghn$Z(9uV,Phn$jWj6jVj, oU EҀu+=t$hn$DjSځ = -m = -tjWjjVj -RÄ = LEEEEEP Xe[^_]UVS]E pt&I>v I![^]USQjj]Sjjh -̢thD#uR1Zu h "j- jjSPjh -莢u‹ER1]USJPho$h:.<h:.ho$`Shp$h:. jUE E ]UWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9t ''  9$t ' p '11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t '/ $ 9L$t ' p '11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ] ' $09tu ' Ep '11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t ' $9L$t ' p '11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ] ' $9tu ' Ep '11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ] ' $9tu ' Ep '11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ] ' $9tu ' Ep '11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t '9T$ 'uwy|$y|$L$ ˋL$ ˉ$4$19t '9L$tq$$9T$tq$ p '11 [^_]UhX jjh@-uT|1҅tPUWVS jEP; Eu_X1E9}2uSPZYt!SPZY tG1EEe[^_]UVSQË0tRVhr$EPiuV舘ERrZe[^]UWVSQ1:nuzouPrX1҉Uh9%P荊 ZYt98nuxouSPmZYu}SP[ZYuE1VEe[^_]URPPPhr$h:.DjyUWVSÉ} u,PQ , ZY u Qhr$1t VqXt*hk"WNZY1u"su4h%,P=^_uE"~u M }jP ZYt1ih$Kjhr$W  uU jZP,P t% 9|\ 뭋QRS uS1 S1u17hr$Wj Vhr$躁Eta#Et#Et"Et6% 'u0P,PX ZY@tjj@p^_,t#jhr$S uhr$VeY[0Z"tShr$Shz$hVx0 ,Dž@h9%,P7YXZ9 PW5pNjXZڄtVB L<-u.1j=V0Y^t$S@] $S4Q ,t1|=S1t}t=S1u}uD]hr$xY19~4h!%^GXZj s~Y=S1tc$P3 Z@u hd#X1et t6hkA#_X t XP=S1tj}t0$9v j2v j(% @u hr$_-,W3h#%h,R&}P,R Y8tV,Rh $ ;u/8uWVWhs$zj t %[PY}u, Ex](;u jj  WS$t ~)t}u2h:.,PBXZj P$s ~j,Pu @uhw#X,Ѓu ƀt&qttP讘PVhfE#aH}S1 S10SVoT Y_@uVhs$XZ e[^_]UWVSj Ph!s$P|;11to 'tZ$ 't =S1t>( 'F%#u߼$QPh %{ !ǃ 끍G#th#F%#u߼$WRPh4s${tG%#u߼$PhIs$b{p t 0h&$ h#7{XZF=S1KtSp%#u߼$QRPhWs${=S1h%#h&$zsds`sTsPhis$zslshs\sXhs$z0=S1~chSjjhk"ju.t%j S腏^_tShs$Oz hy&׀Y?#t$Ph&$&zXZe[^_]US] 1t-tPu\ZYuS11=S1]UWVSEt48nuxou S1P>X1uh#X1Y,u@B uPB_uh "S芍[^ljxj,SrZYt X1e[^_]UPhu$h:.|jFoUWVS]!11҉tE1ɉ7p3.111plhv$u u+ 0r=dhWlSh0" ,@uSVh"jp n@t(RPh 'hSWtS|j!lUSP]jEPScU :9uySu h"j ]US]SZeZt@ h$#SZY]US]S,jZt@ h30%SsZY]USP]jEPSU 9t :uy Sh"jE ]UVS]u VS. YZu Sh|"jF ;/t"Sh"YXZu E"e[^]Ye[^]U_Ph"h:.SxjjUWVS EEu EE}]EEE1҉7p3.h"Vuפ t4ouBjWh'57Xu h"jw PHXY붋p3.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh}%> ,@uLt"t"~0 Z"t"PSh"jl jyiUVS]u VSS YZu Sh|"jk ;/t"Sh"WXZu E"e[^]We[^]UPhVv$h:.xvjiUWVS]E1҉#11ɉd111lhhv$u u HuLf$M,9tQG.C|g$`'UC| C|C|C|57CpXDžlL57CtXDžh.57CxX57Xjuh '57Uu h"j PUX57nYDždC|p3.P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPW-YZ@u Wh.$j ltECphtECtNtE%CxdupVVP[@$XZK|ǃe[^_]UWVS SVdPhWu u&hWdShr% ,@uSVh"j f@tKRPh'hSnShv$o0jeUSP]jEPSU :9uySu h"jV ]US]S^Zt@ h$#SZY]US]ScZt@ h30%SsZY]USP]jEPSUU 9t :uy Sh"j ]UVS]u VS YZu Sh|"j ;/t"Sh"DSXZu E"e[^]-Se[^]Uh w$jd Uֽh&w$h7w$hTw$hw$hw$Phw$h:.q j=dUVSQÉj EPS} U:uVSh x$j e[^]UWVSuEE@t"S1 1VFe[^_]P2_u h#jͿ VP ZYujc]e[^_]醁UWVSQ]E10u1-hix$u u蚝 2F$`'=T1tT1뷃=T1uT1c뛁K뒺a7C8K t T1hK\cPD7jC@K@2K&g7@Pc s4K I7C(KK@KEPuh`'57HPƃu h"j! Et T1tctKtK@tK t=T1T1 s=T1tT1c@tKt1҉,-sc sKsC  sC sh$#V(NT1Y_Eth˘%VNC$KXZEth-x$VMC KY_Eth3x$VMC$KXZEthXZu E"e[^]>e[^]UWVS]fU ffCffBCffBfCffBs s/Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss.Y^} GWss.Y^GWs$s .Y^G W$CDȉGDs,s(.Y^G(W,C@ȉG@s4s0u.YYG0W4CHȉGHs+YY8<D@+YY@DHȉHLȉLPȉPTȉTXȉX\ȉ\e[^]UWVS ]} ȉKɉOCȉGC ȉG CffGfCffGCȉGCȉGCȉGC ȉG C$ȉG$C(ȉG(C,ȉG,C0ȉG01T4ʉT4@uE\TtyLup1TTʉTT 3M1ҋMfQfMffVBu@ uhPPAȉ MCTȉEGTCXȉEGXC\ȉG\C`ȉG`CdȉGdshΉwhClȉGlCpȉGpCtȉGtCxȉGx.)YYMU tEȉEEȉEθ3M9$| ɉ @1\TtGU 4U9~ ʉ@EP1ɋE9~f4Kff4HAe[^_]U11ҋM ʃ=u‰]UWVSU ]u:LABLt ߉։U fCS_fCU ȉBȉCB ȉC fBffCf9Juftf=vfCD'Y^1e[^_]UWVS]u u$}u}u EPźXV薑_=v1LABLCEȉC ffCRVCPfuu'Y^S~fCe[^_]UEU 19s f3P]UERPZYW|$wUWVS,EӋWEUGW E؉U܋wO1҉j EPS4EЉUԋU t8zt Suh"]$' t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh"jס 1ɋuЋ} t1M蚠8"t$M tM9uM9t Suh4"맋E9ƉU}7=Y1tuuWVSuhU" 4uuWVSuhU"?9u؋E}<=Y1tuuWVSuh"3uuWVSuh"j e[^_]g_UVSZ=Y1tPh|$h:.ER h|$Ph|$h:.+Rh:.h"LXZ=Y1t'ttshm#h:.Q jjD=Y1u UPXDUWV=L-uHH׉=tY1t&ɉ HffJ=L-u f@ffB^_]UWVSƉ˃=Y1t/=Y1t 1}oQY1xY1Pu < RסY1ΉRPSu5Y1I 9t Q0hPWVh $@Mj"iCe[^_]ÅtUWRPO#Y_}Ã=Y1UWVSƉˡY1=Y1tQuxY1P^; M׉ΉRPSu5Y1,H 9t 訝05hPWVhF$Lj$Be[^_]Ã=Y12W|$wUWVS#Å=Y1uY1BB4Y1Y1 Y1 ;Y1Y1ؙ=Y1;|*9Y1_1)։ؙ5Y1pؙQ Y 'JtRz!9t !9t ҋ1҉ؙ=Y1Q ;Xe[^_]g_W|$wUWVS4EU؉M܋ Y1A Id t15Y1/X=tY1tY15Y1PPW Y1xU thm$ZQXY1H xU t@\U؋M܉M؃=tY1tY15Y1PP Y1A Id t15Y1Y1Y1JH,1_9M؋}ruuh$I Y1\Eȋ1ҍMQRPuu0 Ɖ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuu3 K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05Y1#5Y1Fx1҉$Puu1 tY1Y1\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu%ClÅt]SuOXZ1EtttpSY_DpTtF u1E+Y_Fu @ߋu%CPY1H05Y1EЋUXe[^_]g_UWVSQEӾ=dY1t1}=L-tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='Sh$h:.ZJ ]W|$wUWVSC s(H1`Y1t ǃ^F=Y1s0Kd t1RP߭ڍ@=&VV$h$( Y1 ؙy8PۅI4=&WW$q,h։$( Y1A0= @ Y1Y1=Y1u\Tu k‰Y1jjjhjRj£Y1 Y1uY19uh$.j&11=Y1LY1Y19|RPh+$' Y1Y15Y1 Y1h'[t?  Lș)Ou뺸=dY1t?jj5hY1S=Y1Sb Y1uPؙV jVuؙ=Y1VYY1Y1Xlj=tY1t PRCXZY1xY1\=Y1DžhC$,X=Y1~݋ Y1A,XƉ׋ǁ\TtA!AƃAId t1RPhK$jji$f:.ftRhht@PU DžPu ftY1=Y1tu 11=Y11w,1Y1;x,t h:.C Y11҉牅8^9؉<}Ë\TtAЋ!AAA)uhy4D1ҁTtqփq9Ћ|ho$N*(u^Y11=Y15Y1FU F )É^=Y1$~O`^p=L-u*VtGx9sЉFx^fFxG,H9ufVNfFFTVXЉF\KN`ȃ$~:=dY1uFh$\^lO`؉Fd9sh$(%[5Y1=Y1F t/)؋É1ɉ~U uF\Y1H xU u@\€ 5Y1N J~U uv`G`YY1$~%Y1Bl5Y1F=Y1=L-~&_89rOd1VT~U uVTP~U t FX1~JOd1111f# Y1A8P!tm)D4A8)Љ9s?~U tv`у >5Y1F$B1ҋ9r)=Y1O`艅FW897~U uv`G`aY1$~%Y1Bl5Y1F=Y1=L-Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5Y1F$뵋Y1$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹Y1BY1;Y1u^=tY1tY1s4PPF Y1@Y1Y1Z4Jd15Y1Y1Y1Y1H41[Y1Z0 } Y1؋5Y1=tY1t5Y1Y1P5Y1 Y1X05Y1ދvxx Y1\t4Tu^%FlL%CPO붡Y1Y1𙋝ڋËƉ߁TtAЋ!AƃAId t1JY1Y\Tt=Y1Ys8Y1){0ƉK`Cx1񉅰69s)9sY1 %Cl뀡Y1Y19rߋ Y1A01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==Y1j.X܋ Y1ߋƉ߁\TtAЋ!AƃA׋Id t1#t>%WVRh܊$9|]=Y1DY1P,t,=Y1t hC#X1j X1x~j X=Y1tj;_u=Y1th$v5Y104=L-0FF4+=_w h$ji Y1X󥋅`1=tY1tR5Y1K[^Y1=Y1t ǃ\8 5Y1x\󪡤Y1RP* SY=tY1tY1Y1r4PPG Y1X4HdLH t15Y1Y1Z;Y1sE=tY1tY1r4PP Y1@Y1Y1Z4Jd15Y1aX5Y15Y1Y1@4P5Y1eY[^_]aÃUWVSu]tVyi _uVh"j!h `1ɉPhd@u G tGRhedAu E @u!f8tuh"~XZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(hiD%Ⱦ ƹ ߋSh"V$J CPhN"VL C Ph "VL CPh"VK CPh2"VK CC,$C,PhE"VK C0PhZ"VK tP X}!uhzd@u D @RhedAu D @uuhi"jhf 4}1󫍅PuL^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEPhr 1e[^_]UVS4]jhPjSuIjPjVSVn u؋E ʉʋMQ؍e[^]UVS]u VSƻ YZu Sh|"jd ;/t"Sh"VXZu E"e[^]?e[^]ÅtUWRPY_}UWVSuuuu É֋EU)jj`RP Nju 1ۃ`9}1EPl@hFVk`EUȃM ~MAhQlCȍe[^_]UWVSP]UpEM1^F}tF^ECS}tffCCCCC 1 :}u: 1҉C(S,C8CY1uˉ8كsh0 'h$jY  pd1 Xd11V Dd1yVpd1fH XZes pd1f@ L^1T^1؍e[^_]UWVSj8PfE |d1Exd15 Z1FZYtVh$Z1C!؉t ShԌ$j9Y Z19s QSh$whVh,$j Y v hVhV$9t SVh$ס- =-f uft Wh$u$@(X^1 \^15Dd1(Hd1FPd1Td1أLd1Ë$x)É(Xd1 dd11T^1x(1ۡZ1Z19׃}SQRPh$jW ( t(<)؉D81$1Z1 s i9s1Ë1XI tȉt \)‰9sAÉ(11$ D01ȋ$Z1(5D^1@^1$\d1`d11 hd1-ƻd1H^1=`^1=d^1 h^11l^18 tDž111 p^1t^1x^1S|^1 ^1^1N1ɉ ^1^1^1^1^1wf^1| f^1^1 f-f^1,PDS ^_,t h%$Sh^1 Z1_Xt&SkC^v h=$jSh^1b ^1@b11ۉ_1 _1=`d1=^1^1  `^15Dd1D^1+T^11 v1ҍY؃1SQRPM D19s)Ë$HB‹)9s؅u ^1f_1 Z1W £pd1Y u hU$ 111 9$5`^15T^1^1t ^1t:t`d1tt^1t _1Ɖpd14Npd1Lpd1t5pd1֋$H9u) `^1)ȋfF pd1A  h^1u fApd1BfBG L^1P^1= Z1~y(Ɖ5Z1S5Z15Z1()й1PVuhw$c`^1 5h^1P Z1P$h$9`d1@Dd1d2jjjhjPj£d2u h$ d21=$Z1up5Z1=Z19| WVh$R Z1m 'XSt1޸ = Z1 DžCh$X= Z1~$H`^1T^11RPhK$jjf:.ft0Rhht@PA/ DžPu2ft Z1=$Z1tu 111$1( (9$h:.X=^1t^1t(@^1(f^1(`^11T^1 d2Dd1 \d15pd15d2)֋( `^1T^1ȋ Xd115Z11Sr_Dd1 d11\d1H9(u^`^1D^1+T^1()ȍX9sd1@)‰эd11ۋ(9s ƃd1C(9sكd1C׋(pd18 Xd11hd1 nh^1d11Dd1)Ѱ^(t9pd1D8 Xd11hd1 Dd11d1[1T1d1@ u뢡pd1| Xd11hd1 Dd1FY;5hd1s"1;=dd1s-d1G= Z1'(=^1t^1t(3~==$Z13 j.u Z܋(`^1T^11ҹ# t>%RPQh܊$  9[= Z1B(\d1t,=$Z1t hC#X1j X1 ( ~j X=$Z18=^1^1u ^1'-/-V1fDžTfV8\`d flfDžnDd11 ׉ؙωʃv^1uh8 'h1$uXU| 11EETEuh8 'h$/ Xd1Dd1S_uh8 'h$S([t `d11h8 'hߏ$9s>1ɉ C Xd1 1( Xd1CX_1=Dd1$`d19$9rPh8 'h$vT^1D 1;\d1si^1tЉtF$9rh8 'hS$`^1‹ ȋ( Xd1GB돋$9(1҉G䋅$9s1 UVS11 1ɉ e2\-h:.! h:. e2Lf2i<XZe[^_]W|$wUWSøthg3h$.XZ5f2h$5f2h$ h3t Ph2$_Xf2t?f29} hC$[()<=&MMEuQQ$hf$ j f2Z0|h3h3EEhf2sH~-`f2]PP$I `=&RR$Spf2QQ$SEWW$S h-PP$Shy$<|h3f2f2"]f24f2Ezu=&ٞzu=&=f2\$=f2$h$ie[_]g_1Ujj|7XZ1=f2PVU=`-u =f2ujh u17f2ZY9f2~f2|h3ueUSáe2e2xFأe2e24f2=&w=&r\-y1]X]W|$wUWVS=g2f2ffBg2@f2=Pf29=Df2u ;Lf2g2]f>g21Ej]Sjj5hh3D| yh$[jh(h3jjhg2Bf>g2f24fpjhHh3jVP5lh3\ Ã9t:y h@$OYSVhg3hG$Zh:.Z1`-f2% f2 h3f2@f24f2Lf2(f2=,f2u(=(f2uf2Lf2Lf2Lf2(f2=v.}fE fEm]mE(f2,f2=&5xf2=|f2f2]u}fE fEm]mE0f2 (f2,f2EΉ߃ɚ;~ʚ;Eހ}0f2 (f2,f2Lf2(f2B=&؉(f2,f2(f2,f2 0f2ى 0f2ɚ;~(f2,f2ʚ; 0f2f2rW xf2|f2 (f2,f2 (f2,f2f20f20f2=ɚ;~ (f2,f2-ʚ;0f2|h3t 1|h3te[^_]g_UWVS<ÉUM|h3tUUEčs}uyMăA}9}fE؍t E;f2uJ1@f2Df2u5}t4|h3u+?EPuha$L Ѝe[^_]W|$wUWVSEU܉M7C]|h3MQURuht$t h$XWh$|h3Y_t,sE `=&RR$Ph$=}h3y"uC:.e[^_]g_e[^_]g_USU$&=p3u#1SPh3$h:.jPUWVSƉP%¡s3_tEtPh$E s39U|} Vh$j3 su4 1C@C1t )уȋKAPEFCCp1}~CpMуt[}D;19Ue[^_]USӃ s31҅w =w"=wj=w:=w R=wA=v=w.=w "tft uȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPst PVh$ Sg PVh$BhPSj~PVh$SgPCPVh$h:.RXe[^]Ãt"¸G$7t-$tUR"Zø:$USљRPQhSh:.S(0] :.yUh:.j (XZá:.P:. UWVSDuh:.e[^_]ÉÉh^$$'a_E1ҿ!Es,s }uCEtHH1ɉ B u1ۋtЅ}t2}uK]1ʉj.ht3EPj:]1ʉur VPh&$j.ht3ht3h!%XZT5s3VPh!%C 0=s36UWVS$@<tPhk$Y[ C&'tRh!"Ph$j^_Ph$ZXZCH<$"'h#C Ph$.C`%' Sssh$C! %'<t$'<t&'CTS C ACPh؟$CZYPfwk$"'h$h$X1Zh$h$h$h"s_3h$a^!h$OY Ph$<XZ뢍A9sh#$ 6EEEEEEEԍsEԈEӊEՈEҊEֈEEUMfsfhw.ffQRPEPEPEPh0$jfuVuVuVuVuVuVuVuVQRPEPEPEPhS$V$* X=s3tuhb$~[_}H1E92=s3tC҅U% Es3t Sy9=s3C{PS5s3 u)87t))Phw$ 9~Ph$蓽ZY=s3u=s3t GaSx5s3jRU Ph$}CxUtHH5s3RB Ph$Jhzj% VNX1e[^_]UEt Phȡ$ڼXZ'hD''Phܡ$h:.jUWVSDE։ϋEEs3us30-E s3t<t"t(E}u+E@E'E@EE@E@ E@EX0-UZhh%VZYu=Et'}s3u1ɉ[cEXt""}uV"Z [^1ۃ}uj/V[k ZYÅtUԹ1}EEE}WRht$&VǦ t-1EԅۍUt/WRht$&V褦 1ۅtVh$t/Exuxt Vh$jE( p}P juy }~tCUj1}^Exux uxuxu xE@E< u2]Ĺ1jEPEP聓 ¸r&EE耉E 1}E@1}11FQЀ w0 QwWMQw7u&w$#']@ }@11 @]M9ru)u}1ۉj/VZYÅurEEPV Y[Vyh XVYVMZHuNp @0u }u=s3uVx Yt- Vg ZtMUCUe[^_]/;}u =s3BEXSh Z{ X ?}u MUs1t$& s3Uf1E e[^_]US-tuPZYtC]UPu*fxu#@Ph$hh@v3@v3 Htu DPy\ P^Z ZU}uE u  'h$h$RRh%PPh$ UEt#t#"$,$tPh2$$$Rh#fXZUVS$''E׉Íu 9stMtJ@ShH$%XZe[^]UVSh%}tJE t1@jjEPà tj.0Y^ƅth@u3@P)YZuUuRYf ZhPh@v30 @v3e[^]UUE Pjjhh@v3PRo thhK%h@v3  @v3UVSE UZ1t@ȅt  )ˉ t Eu7t3jSZYt%uh%hPh@v3/ VRhY$hh@v3lmVPRhV$hh@v3CDσVQPRhS$hh@v3VSQPRhP$hh@v3 @v3e[^]UWVS$u} 5E ~y111119FtM |1t 1} L7tMw tLxw tHuGC@u?6ttxtu#  @@1u "5ω5KtB uhh%h@v3[^vth_$賳YEPjjhVPPm t hK%V蘳XZSVh8%hh@v36@v3e[^_]UVSMQ@t3QAt3يۊ`''BZ`''XÃ@.)օ~=.u3uC@t3[^]UWVS uE Eԃ=4-tL1ۉ4-hh@u3ԓ_Zu(j.h@u3ZYth@Ph@u3, @u3uhhh%h@v3, F<tX<t<u^EԉE FEe[^_]G]ع1}ʉfEu jSF ^_uSZY6e[^_]VPFPhq$hh@v3@v3e[^_]US]U MC<t,<t<u/MU ]]yMU ]]q؋]YS(PCPhy$hh@v34@v3]UWVS(uE MMԋ]U~u'ẺUЍ}عjuVB _XUЅҋEtt SVZY SPV" }yE E&$e[^_]tEEԉE E#e[^_]EEԉEE E"e[^_]UWVSXEEE EEEEEEE"1EEEE1EjjuVjj]Syh$Et}tSyM9)sxEt  Cy;8-t8-PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth#h#h$:.H:.$yh:.j XZ:.P:. }e[^_]e[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һ$~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(USPh$h:.Sh$h:.Sh$h:.y$Sh&$h:.fShE$h:.VSh`$h:.F$Shs$h:.3Sh$h:.#Sh$h:.$j蟽UVSƃ=Dw3udPS贀^Zy Sh&$,밋l%=`ƋTw3t:h3$RP~ZY h$PRcZYu\t_X/rtXRPh$RPhۨ$h:.A\`tRPh$m RPh $h:.Dž`t0P _tPhH$ZYDž`9t S"X`tjtj jUWVS TPjhPjTU11ۉ`d`Ph|dV @ h;lu\1ɉXSi9dsW` XZuh"\PkY_t X\X;lrt\h"h %hWzEPt@w3t8WPhZ$tWPh$} lSZh`PhedAV 1ۅ9usCaPTh"h>%hW豾EPt@w3.t-oWPhZ$tVWPh$贿 CiV! Xe[^_]UWVSV1}jj}Wjh('` uTEEP&jjWPh('6 t Sf[!h>%S ZYtQh>%je[^_]ÍL$qUWVSQhqAdA EAEAEjjj! h$S Y1iPlEZuh "Suj j! E y h$j E9tSPhʪ$4 tCtQt_}uEPEP _XE#t[OEE#_A$:E$"$@E$"E$Ɖ"ES6YE܃}ƒ}E ˆotRExurWZ9EsEh$h$h"h"Suh $uh$h$EE1EЉEԉEȉẺEM}dtEh9xE@EE@EEEEEEEou E]u]ű]u]usM] }EݝxEݝpEؙRPSQ蔫 Puuuh+$胼u؉Ep݅xܵp =&PP$E])ؙ WVRP? PEU WVRP% Ph6$jj h#SQj}W胳 @u h#xjj h#EU RPj]SP @tjj h#EM)ș RPjuV$ @tWuuuhO$莻Ep݅xܵp =&WW$VShY$e,mE}MЋ] }tajj h#SQj]S蚲 @jj h#EȋU RPjuVm @VShp$ۺ MЉ]ԋu؉uEȋU WVRP覩 PWVMЋ]SQ蓩 Ph$}"Mȋ] }jj h#SQj]Sб @Ijj h#EЋU RPjuV裱 @jj h#EȋU+EU RPj}Wp @WVSh$ݹM]u؉uEȋU+EU WVRP袨 PuEЋU WVRP腨 PuWVM]SQo Phƫ$gW}MMȋ] }m]m]jj h#SQj]S蘰 @jj h#EЋU RPjuVk @jj h#EȋU+EU RPj}W8 @Eu =&QQ$WVSuh$uh$|M]u؉Eu =&RR$EȋU+EU WVRPK PEЋU WVRP1 PWVM]SQ Puh$uh$ $u#XeY[^_]aU|Ph;$h:.pjUWVSljU΃={3u'jh{3 {3ZYuh$ [{3Xi {3}u-WUPZYUujtdWUPZYUu=tRhhw3Aƒ w3uPh&$j1 K c1e[^_]UVSƻ@-tPVZYt"Vh$5pH49G4MC St8tPRh$|x Rh$lxZYuj 3h@?4o C$?4 ?4 e[^]UjSX=DH4t%pH4fPftjh?#P" jh|3胋 UWVS=G45G4ÉDžu¿$RWh¬$5pH4C5pH43PhPh@:.$y'1=P3ShӬ$5pH4B.fDHfn,f?trfauHG4Sh$5pH4裸 (fptfqt#1҉G45pH4h$Y[C1P3Sh&$5pH4W &SSh$5pH4:e[^_]Ã=P3tO=DH4tFUVS5G4G4G41ɉ G41U5G4G4u1҉P3[^]1P3UЛ3j5Z=G4ujăXG4tG4j詃jh|3h UWVStEUtj1]ut=tB.TS!@u$EE%@ B.t B.fBuӃ}tgh`G4[ƋE]tC1ۊtG4t8u9s&H`G4 CuݍHȋ])=~ E봉EE} Uй 1u1`C4tltf$t\uDS8uOCDC<0~2S8u0x tF8tutt 8FtC1DЋEǸ`?4:[tL\t$HWыu)@,-x$uvXB.DZtep0u&E@GOu)~ˍYσ ttD9])ف~mP<,<]B<\t<$uj2B.DstX0u"Et@GOu)~ɍAσ ttD9t])ف~Oȋu)=ZJ ]]\tBJuztBX5B.D^tS@0uU tZBGO])ف~LӍJσ t4tT9t(])ف~Wы})ׁ@E8uhuP EE 5pH4h$EZYFbEe[^_]USEU uM跠>%@-pH4tRQh %P(#PhU$9G4ZY2t!h@?4h$5pH4޲1G4 B]X]UVS]u9 ?4t}5@H4E G4u1@H4@-8t 9XtSh $j @u=@>4th@>4Ph$p Ph$pZYu ?45@H4e[^]U}u荟G4]ø<$]U}uhG4]ø&%]lU}uCG4]øC$]GU}th>4hI$5pH4萱 G4U}th>4hj$5pH4\ G4U}t趞h?4h$5pH4( G4UWVSEuEE PPu \Ht 1}6h®$E PEP& uhͮ$E PEP t}E p_E څuP$8at$=G4t$1Ʌt1Ƀ=G41=G4ƍQV1M Z^9Yu19ARPSWS G4e[^_]UWVS0 EuKG4Huhٮ$E PEP tP3h(,jU^_jh|3! ZYu=G4E 9E ;u"1ۉP3jju à u=G4tՃ=P3tԉڋƅtō5G45G4 G4yZY9u1Ƀ=G4κ$=G4t$VPSR较E =P3c=DH4VG4G41ҋtP3G4(=G4t=G4=P3u"C9]j[^1=P3E ƅtˋE 5G45G41ZYU 9u1҃=G4‰ֺ$=G4t$VPQRǂ=P3f=DH4Y5G4G41ҋE tP35G4( 14RjhE 4 u uE 40h$d^_=G4=P3E [Dž5G45G41ɋQZY9u1҃=G4‰׺$=G4t$WPQR蔁=P3u5=DH4t,=G4G41ҋE tP3=G42P Xe[^_]UWVSEuEE PPuu`Ht 1}6hͮ$E PEPB uh®$E PEP' t}E xp+tYuG41St&1ۃ=G41҃=G41Ƀ=G4111ɍSRtXZ}==4u5pH4h$T [^닍xPSdZY}uIy,b8tSh- $[^1ɉ PH4 TH4OPH4TH46u2jE pܻZZutL9¸}9U 9zu19ZVPuWSh1$·1҉PH4TH41ptȺXpe[^_]U=TH4uP%=PH4t6$Pju uU=TH4u"=PH4t6$Pju uUWVSEu+G4:Huh9$E PEP tP31=PH4=TH4thF$E 0ZYu*==4u5pH4h$p [^Džth(,jp^_jh|3z XYE t ;u&1ۉP3j5G4u 蝶à uK=G4tу=P3th94S2ZYuShM$5pH4虨 멉ڋE ƅt5G45G4 G4YXtt9xPWaYZuPH4TH4 Wh- $ XZ9u1=G4ƃ=TH4u"=PH4t6$jVPSWh1$I1ۉPH4TH4=P3=DH4G4G41ҋE tP3G4pj7XZ1ɉ P3e[^_]UWVS u }t h!A#v蠧ZYuvhr$5pH4 zj hI$W > =TH4u"=PH4t!6$tVWjVjjhRSSySrX G4e[^_]U帥"}uc#]U}u ߓh$h$h$5pH4I1G4UWVSE]uu1҅‰uTpuCE xh"WܺZYu u0Hhc#W迺ZYu1t/c#B u븥"PVh$5pH4諥e[^_]Uh$hG4u uIG4U}uG4=@H4tpH4E Eï$]w ]Uh$hG4u uG4UVSE] u1=G4G4u{"yt csh"V谹ZYtBhc#V蟹ZYu 1G44V軻^sh$5pH4蘤 맣G4G4노c#Ph'$5pH4l =G4t5G4h=$5pH4J 5pH4hd$j G4Y[t1҉lH4G4e[^]UhS$h@H4u uG4Uh`$hG4u uG4Uhv$hlH4u uG4=lH4t1G4Uh$hG4u uMG4UVSE] u ސ1=G4bu.sh"VZYuBhc#VZYt1s54^hsh{3{ G4{3 뷣G4G4t$t:u5pH4h$ 1G4ZY454:u#c#t"SRQh˰$5pH4膢G4G4e[^]Uh$hG4u uG4Uh$hG4u uG4UVSE] u 茏uHsh"VԶYZtBhc#VöYZt6VZy+sh$5pH4š 1=G4G4L3t "c#L3PQh-$5pH4t1=G4G4e[^]UEt~輎G4HuhG$E PEP膾 tЋE ph$t_YZu9=G4uJ=@H4t5pH4hX$ XZE ph$6_ZYu4>454154USUE G4u 3Pt ]pYt`Pf Z@u Sh$;pH4=94th94h$P01ɉ G4 Ph$K XZ]]铰]UEuhG4=Huhͮ$E PEP5 tӋE phٱ$#^ZYu 4>4USSEu G4Huh9$E PEPּ tP3h(,jE[Xjh|3p XYE tE ;u1ɉ P3jju լà uu=P3tڋetShٱ$Q][Zu 4>4=P3u=DH4tG4G41ҋE tP3G4tujKXZ1ɉ P3]UEuG4}Ht}6h$E PEP觻 uh$E PEP茻 t}E ph$t\ZYu!E ph$]\ZYu 4>4UWVS}M 1ME1=DH4t5G4G41ҋE ¡P3t@P35G4ujPZY1ۉP3EM9t EPXe[^_]UWVS}u ȇ.jj|ƉXZS CYujjҔh#( à u$%j/S* _ZڅtPhRWU =G4t65pH4S pH4HQPY^y Pj Y^ J }~j5G4h^#WSf  jWSf Sh`$G4j~Pl Z9uWjZYFu hs$X1ۉG4e[^_]UWVSPEEumG4Hh$E PEP7 EwɋE ph$W_X}h$ ^u ]E XSh$VS41 uY}h$ Yu ]E X ShȲ$VS1 tA5pH4hв$@ XZ<u}u"E X ShȲ$WVS1 G4e[^_]UG4}t#=54t =54u#n=54upH4E E߲$ h54h$5pH4b1G4 UG4}t鴄=94u#pH4=94uE E$D h94h$5pH41G4 UEt~SG4{Huh0$E PEP tӋE phj$UYZu9=G4u<=@H4t5pH4h?$ XZE phi$TZYu 4>4UEt~趃G4{Huh0$E PEP胳 tӋE ph$qTYZu9=G4u<=@H4t5pH4hq$ XZE ph$3TZYu 4>4UWVSu huS 9}1hE4S F 9~hh>%S GSh&$SY[Hu j1NZ4>4e[^_]UEu蒂G4/Huh$E PEP_ tu uh#- UEuFG4/Huh$E PEP tu uhҳ$ UEuG4[Ht}6hs#E PEP迱 uhͮ$E PEP褱 t}E pphس$R USEu聁G48@H4@H4Hu h$KRYE ph$8RXZ@H4]USEPv$G48@H4@H4Hu h$QYE ph $QXZ@H4]USEuˀG48@H4@H4Hu h$QYE ph$QXZ@H4]UE} tumG4=G4th&$AQXžU} t}u1G4Ã=G4t jjXZj^Y=G4t jjuXZj UjjjUWSREEuG4=uE Xh+$Z Xu]ShȲ${PS1 e[_]UVSEu\0HuY[e[^]Uh$hG4u uG4Uh$hG4u uG4UVS]u u}G4lu%1G45pH4h$! G4G4ZYBG4@G4G4jvhtG4C u `G4jvh`G4# e[^]USEu)1ɉ G45pH4h$ G4G4[Xu|G4~}~hĴ$E PEP萬 uG4G4j 5G4胠[ZÃ=G4tC; tG4j SbZYh5G4h`C4F C; thSh`?4- ]USEu&1=G4G4G4"t {E Xh"S(ZYu G4hc#S ZYu1G41ۉG4*h@s%SZYuG4G4uc#c#=G4t"PRh˴$5pH4ƍG4G4]U$=@H4u1Ph>4u uSG41>4U $=@H4u1Ph >4u uG41>4UVS]u VSXZu ]e[^]Uh$hG4u uG4Uh,$hG4u uG4UWVS ]} a}t~Qwhw%V茡ZYtJhI$V{ZYtBh]$VjY^uEtFw聣ZyyEE̓uw NX1ɿ11jjEjjՆEEuue5$>4 >4Wu 5,>4(>4}t =@H4t0 (>4,>4c#t"QRPh;$5pH4詋EtA뗃}t =@H4t0 >4$>4c#t"QRPhw$5pH4bujuj 1e[^_]Uju uJG4 U}uxG4_h$jIZu2=G4uC=@H4t5pH4h$ YXh$3IZu4>454154USPE] uxG4==4upH4E E$hu@j EPsk xM9tsh$5pH42 PH4TH4PH4TH4 pH4uuM E$]) RPh!$Q]US}uIwG4!@H4@H4hQ$H@H4X]USEuw=@3u5pH4hV$ XZH~}~h$E PEP賦 u밃=G4t5pH4h$_ Y[j E pk@33P @3 u  33kPk3B 3k 3D:.H3tzD:.y h@:.Zu!5pH4h̶$(@:.P@:.< u$@3k9 3uP{{uPKoC닡@:.P@:.8 t D:.yh@:.衤Y t@) D:.yh@:.膤Z @:.P@:.8 u5pH4h$@3k31G4]UWVEu AuhHuhͮ$E PEP tjE pȗƉXZutWVE ph$5pH4t9G4e^_]UEu tsHuhͮ$E PEP腤 tjE p:EUYYBu@t)EPZnPPE ph#$5pH4؆M;MUG4UEU u tG4]Hu E)$]DBE E.$]DUS] h"jSu1tssh6$5pH4F]UWVSVEus.Huh®$E PEPt t݋E p聮[u G4zh@$yYt8uՀ"RUÉ4$~|<$0WURP% Wh>%S WVS (S: 1G4SV e[^_]UWVSEurG4Huhͮ$E PEP菢 th@$2yYt8uՀ"SǍ@$u|GWS@Pf =G4PH4TH4EU@H41@H4G4PH4TH4jjh6$M qVh1$b=G4EUPH4TH4@H4(VZe[^_]UWVS]u t q>hg$WZYt.h%WZYthn$WY[t뷻v ZtpH4u6hv$R tH3tD35D35H3h$R贃1G4e[^_]UWVSPU} uRUwZUuUE $pH4Ee[^_]cË@t Pݓ1ɉKXW-CZ=@H4ttP3hӷ$5pH4$e[^_]USEU G4t tt<]ep-t8Cu#PRj h$5pH4Âjrr 1G4]UVSu G4}t e[^]ovyvXuvh$5pH4Z,Ct PԒ1҉SY3h$5pH431G4 e[^]US}uoG4B==4upH4E E$] @H4@H4h1$6@@H4X]USEU Hv oG4V==4upH4E E6$] @H4@H4Hu hc$?Yrhh$?XZ@H4]USMU AvnG4_==4upH4E Ep$]1 @H4@H4BuPh$E?XZrPh$3? @H4]UWVS @Eu} tnG4AHh$E PEPޝ tЋ5@3} 19~j k3PwR t*Cu%wh$5pH41G4 h@h3P 1ؿk3X 9XrB.DP@tC3<$t<\CFC B.K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP54)PE 4V E 43߿iu6CDžؿ9}~)54)PE 4V^ E 4蓻ƃF;p\30mXu 5pH4h4$u!5pH4hI$ G4^X~ t=G4u 5pH4hu$΃=@H4t:5pH4h3j pH4HQPYYy Pj mYX J j 6R \3P5X3V =G4t3~t-pH4HQPy;P| J PjXZh@Ph3 oX3E\3E 9XCؿt G9}ce[^_]USËt P輍1XCt P認1ɉKXCt P藍1CZ]USdЛ3jrwX=DH4t>Ph$jd]Sw~!pH4fJftPSR(n jh@~3N USdjwX=DH4t>vPh$jd]Sw~!pH4fJftPSRm jh@~3'N UWVSÉ֋:j:W裍YZuWh+$S :WP<YZtj%WpYZtWh4$SW\F u FfP HuFf=tPh$S诤 h#S衤XZe[^_]UWVSQljUR>[Ë7 <wsBSuRU u8Uӊu <wrs C <v1e[^_]UWVSË@t P{1s_stV衷Y1Ct PR1CZe[^_]UWVSljӋuy8E8 u@EPh?$[XZ H< ws 1e[^_]Å8UWVSH%Pty=B.UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu hX$j jh$W uW1ɉK fCPjh$W\ uWC fCjh$W6 u WC _t36蚛v萛Cv腛CF C FfC (Wuh$Y Ei$:j/RUω^ZEUu R 8)ЉUHQM覚ƋMQURP { uEuCYj@VxZYt_{ u1҉8>4Mq@P跚j:EpE t@P藚MAYE@yE@tj>[urVj]RUYZEtH:UttWuVh$)PERV,bMV}u WuVhƺ$fEPx:t1j:V蔈YZtP>t3tJj EPRUO U:tM9u HvWuRh$W?fC*C tt54t54t#RfCZ{u%{ t%PFCX1e[^_]USZKJy ;J| t Y RPxxXZ]UWVS\fDž1jh$PV _1Dž1jP"$AZY@t(t 8tt 8uSh$bV7(8j;P ZYƅh$P軉Y_t>h!$V誉_Zt4h)$V虉ZYuh1$U_SVh^$Shj@P t%1ۉ8>4@P;^j:踅ZYt+@PXDž11Dž8ta8tVj/P [^9u*u+pjh%S ts11ۃu t*G41ɉtf1҉uPt ;th~$SpZY1ɉt >th~$VpYZ8>4=G4tjjXZ8>4衾hPR u11ɉG41҉G4QPG4G4YZuu*"#Hu9 uPh$R Ou Pj貿Pj胿_Xu1t ;t1j/SZYDžtG9hh&R 14>4Pj=4>4u,;u=G4uh:.h$$ ^_W4t3hSS) hh%S hVS $hhI$R 1ۉ=54 tSG41ɉ G4t hhF$ hhJ$R Pj(G4G54uj/V [ZtP1ɉt PjPjXZG4-cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh@~3? ZYu P"$Y[@S豐^蟐<$苐Zffu/t+;h$S<ZY h$*t?u+$u =54uh$QNWY,,54t <,j/P _Zt@,P谏Z P蝏Y54 t 8uh9$c1=PH4=TH4XH4\H4DžtDžx=54t0 tRP%ZYuPH4TH4O8H4x$,h!A#P蔖^_44u ,H4P*t$PY[u/txXH4\H45PH4=TH4ut84Pƕ1҉$WVP)y,Ph$_XO=@H4u=D3D3,Ph$5pH4j PH4TH4 pH4uu5pH4j O[^RPh$QjhSh@}3/ =4@}34u&4hT$ Zt6Pha$Ve = 4ļ$t$PR?_Xh$h$hr$V&1u4޼$t%#t7=@H4tWh$5pH4a Ch$變 t2=@H4tWh$5pH4a CVh$x u<4h#P`Y[4P^@u6hп$1$[=@H4t5pH4h$F XZj[X<415-b`h$ -Xj r^_u 1DžDžl@`j lRPB lt B.DB@tU` [DžDžDžDžDžDž1DžDžDžDžDžDž1ɉ1 DžDž11]\dd$tej `Pd? XH4\H4`8\P -!Zpv$4ƅ#d8*u@zj pVP5? cp8-T@dj VP> -9Ћp8/Pdx*u,j pPR> pd8=TH4=PH4h$-$tXH ׉dRp^_oDžh8HVRcIYtx><$td*F$tN<$othY$$>X$Ou jh$@$!td$ ƅu$utPlXVI_^t:\-,r)=TH4'=PH4h$t;u h$x~3Px~3~ h3$@H41u>u$PڋWY^'ShS$5pH4t[ ƅu+  Shf$5pH4B[ ҃thx$Y<XZ h$H<X (DžDžDžDž\kXu tSHkY:k_uRh$DžDžDžDžDžDž 954u h#P_Zu Dž8:.\ 8|uQjj TZY h"@PzF [^88u @Ph`$Dž08<PH4TH4u!t9Nj}5uPuGXH4 \H4!΃9=@H4B5pH4h$V ^_+u t=XH4=\H49u 9t Ph$9 hP% h"P YY[88u Ph7$=Dž0h(j-S[^hhjS_ZD3h$h)'hh$I;$}3t2 }3tPhYD3=~$}3PyzZ }31`H4dH4G4@tPj~R^_DžjR[4P5$}35 }3 u h4$Ϥ1ɉjP5 }3@ƃ }39u hV$薤8"ty-舤" }3R)Phi$ż  u @;u‰Њ Bt th#P聕_Zt h{$=,>4u ,>4șu$}31jPY[؉|tL𙋍|9Ή| ||=G4F|19=$}3|19||Nj4PWj5 }3,ǃu4PZ1`H4dH4|)ډ|8 }3@DžftSF u|tڃ#u)uË9 Ph=#=lH4pH49`H4dH4|#QG4RoXb)f=,>4tYjP[_++y @B19|@B)RY맋c[1u9V4P5$}35 }3F uj@N$$h#5 }3b_Zt h$4|ft=G4u4P}^tch$%Q=lH4uڋ `H4dH419}NjG49|pH4 뤋pH4#[#jN8$mY0=xu tjS#XZtx1ɉ08R18 $P{ _Z@u*tP9$re$h$5pH4MR 1;`H4dH4|XH4 \H4y )jFXPH4TH4`H4dH49؉|1=`H4=dH41@u @u"PjLY[㋅Pj wLXZ@tPj^L^_@tPjELY[4t4P|@t P6E Z0t8t08RX ;54t t Pa1 X,t,PIa1,XtP*a1_$t$P a1ɉ$[(t.(P`1(Zpe[^_]UWVSÉjh$P jh$Sg tsh$SZYDžt$jh$S@ tS)Wh$jH uh$C_u?F t u8t,jh$S uVj11҉JZYe[^_]É؍e[^_]EUS1EEjhH4 ZYt-=G4uEE@EjjY[hijI[Xhj IXZEE;EEj:M 4U`ZYtw1ۉx~3=8>4u 8>4EU 1oE54t%h#SLZYt;|tS_1ɉ 54[E~E@EE@E\=G4uE]ËE@tjj+XZUWVS$} j h\$uV蘩 uE1ۉ]]upÉEP赊D4uj=G4t/t uu5=4h$5pH4kD pH4B.DptkG4 DУG4u#G4v=u dutB.DpuTu@)t+ t&_3s4@du (uu-ut1G4uE9@@H45u$ >4upH4 5pH4^Xx u@uhPh3^ =G4uԛ3t R^t&G49tt1t1ۉT3j<j)=j==G4t ujNY3!ȅ!Ѓ„tt jZ3!ȅ!Ѓ„tt jX0e[^_]UVSu=ț3uh$"G4[11ۉ3hj<ÍE PV5ț3[5ț3h#f 5ț3#\T3 h&$V^ZPƋ3Y!ȅ„t tjYSj;XZe[^]UWVSDžXG4X303jj3Pě3 yh $'X`L3tjXRjhP 3<t <=>4=>45@H4=G4u @H4h$VÉ5@H4X~St6=G4t-G4-wD5pH4h2$ >4^_9h3hn#5pH4? =G4u}H>4hY$[=G4M= >4=>45@H4=G4u @H4h${É5@H4Y~It,=G4t#G4-w:5pH4h2$ XZ/h3hn#5pH4> =G4uD>4h$_=G4=G4t 5ě3/5pH4h^$uڀ=3u5pH4hu$i [^1;$h$S|ZYu1lG4-w 5pH4h2$븍RpRRRPh$h`3K t5pH4h$n:u:u:uҿ33󥋅pff3j3Ph35ě3r[y/ě3=G4P1 Xě31G4m=3h3j5ě3?^ZYy h/$覢_3=G4<<3<3P3P3P3P3P3Ph_$Ã=G4i)=G41ۉG4303=G4t f3ě3tP/ Xjj3Pě3 y"h $謡_G4=G4u#jXRjhPw @uh$$3Ph35ě3 yh$?^L3tjXPjh5ě3 Džh31󫍅hPR5ě3: @ h$됃=>4D=>42= >4+=>4<u\t3<u1j j WhStPtPB 5@H4=G4u @H4WS\hO$É5@H4~5t=G4t>4_h3hn#5pH4 : =G4u Zu<if3RPj3P3P 3P 3P 3P 3P 3P3P3P3P3P3P3P3P3P3Pjjhv$ÃX1t G4<uADžXjXPjj5ě3 5ě3, ě314G4$ w=t5pH4h$olpRPRRRPhs$h`3 $h$SwZYG4$ j3<lpRPdPRRRP`P\Phj$h`3a , R\x`kd^31f3 Ћ Ћ ȣ3lp ff393C<vlpRPdPPPPPPPPPPPPPPPPS`P\PhF$h`3 \t5pH4h$.\` d31f33@ulp ff3jh3h3O x5pH4h$$m=5pH4h$r5pH4h$be[^_]UWVSD}ě3=G4tWPrjjP( ƃ cPj5ě3( @Hě3EfEjEP芴M]ġ4LZ\\uOuh&$^_뽡H3hM$h)'h7h]$n;3t23tPq7YH3=~3PKIZ3j!_l@ujj m!Y^l=G4t=lH4t =\H4y G41ۡ ?48\fxt \PTfyt T@S5$>453 3 uu h#ËXZQs8 `H4dH4P ta\`RPPG @\@ @`H4dH4TXRPFPY^@u|u\`RPj "G @uc[pt95`H4dH4|ȋpH4#5pH4@_ptG4pt륅u!J\@ @u`H4dH4pt9 `H4dH4|pH4 T@ @t0pH4#qXu h#XZ\@ @t"q`Ihx$XGj%XdtdTR^1T\P>1ɉ\ $[zhPjXZDžh=T3u G4cě3xP Xě3\t\PV>^1\jf[G41;`H4dH4}jYh@u l@u"hPjXZ㋅lPj ^_ě3xP [ě3du \u)TtꋅdTRY؋\P=XHlH41҉PH4TH4`H4dH4e[^_]UWVS1ۉ,4(0G4PT8H4$15`H45dH4LXH4\H4lH4 G4h1$u`_ZDDu =G4uVu=@H4t}t}u&E 8-u}tuh$5pH4! 뺋E Ph+$5pH4! ɋDtE uPu} 1ɉ8Dž<Dž@1=G4uDHjh3 _Zt=T3tzj^h(jXZhCjY[<}tWE jP Y[E j/Pȱ _Z n8tNn8 tDE Ph$`[^G4 E h#PC_^_E 8|utU %9t m%tE jPe Y^t/x=G4t m8 uW@m8 u"E hPk _ZyE Ph$P=G4t 뽃=G4tE PYE .D ?4uJutY jjlXZ$?49u&ju/^_XH4\H4G4ujPlY[=ujh3 $_ZSDu}u/mPH4TH4utRPh$t vˋE8t8PuhI%P HTh!A#=^00uuh&$Y[ȃ}E h#PU]_ZuDž(:.15lH45G4E 8|uXjj !_Z@E h"@P Y[((u E @Ph`$A15lH45G4Dž8=E uPmY[((uE Ph7$褃XZDž8(fzt (@xRPB^_@tE%=t1ۉlH4G4D3h$h)'hBh]$d;3t23tP-YD3=~3P?Z3j'X=G4t=lH4t =\H4yG4$1$ ?4DtBPH4TH4ut/(f{t (IjRPQmI5,>43 3(fxt (P0ft 0@$VS u0i8 u`H4dH4h$ȁ^ڃD =TH4u =PH4(jjjP@11y4E Ph$hY[,RP=[Zt׃ t;5PH4TH4(|jjjP?yv뚃 $`H4dH404RP<XZ th(,RPj < @tv(@ @uju04RP:<^_tA gL@L Hu (,RPS^< @um$uwPT95`H4dH4pH4#5pH425YPTG4ډPT롃`H4dH4#PT95`H4dH4|pH4 H0@ @tNpH4#*g4g8 u`H4dH4 h$=Y݋(@ @tf,E Ph=#XZjJX8t8(R^1(0P31ɉ0 $[Lu`H4dH4y3dLPh$5pH4 5pH4h$e XZ뾋D(uu=G4uj# _苅8=ju)[^X\Bu@j`S豗^_X\lp1tE SP%w ZY@XPs$+‹E $Ph$5pH4`jh3~ ZYt$G41;`H4dH4}4jE Y*hjh^_=T30PH[벋<@u @@u" UVSƻ-tVP&ZYt1ۉ؍e[^]U塠P4u"o#u h$j` P4u $PhhL4*L4U塀L4u"$ku h0$j_ L4u#PhhH4D*H4UWVSS1}tS11ɉM1-t4U C:Kut0Bu+U9uE ։Eƃ}Z[^_]UWVS]u t>hڹ$WFOZYEue[^_]2ø#=G4tR$PhZ$5pH42 -t$=G4t~ tP2PS2 S%%YE ]e[^_]\ QMZƒMuQWh$5pH4KSu QWh$ދ}u#Uj PMQ k MMEPjUR rPj h$5pH4`릍e[^_]á3 `3!t$uCP4tJu6P4G4%P4P3-8!u-UVS t t @P4tJt P41&P4G4 tGtBB@"u\uXu@!@B؀"@tՈBut B1`33u/P4tHt P41P41G4[^]US33`331ɉ P4\31ۉX1X3P5\30XZtX3@ڋ]UVS =DH4t2pH4SPZ 0^Z8tPh~d$5pH4t  5pH4a(jh@h3h@:.)y}uB5pH4h$t.=DH4t pH4Hy Pj bY[ J z=X3?\30ZÃu 5pH4h4$+u 5pH4hI$x t =G4u5pH4hu$Y [^1ɉ G4j 3uVg \30P5X3S =G4t3{t-pH4HQPy;P| J Pj~XZ{ Zqhijhj e[^]UEt]1]US]u h$jRZ SZu Sh $j:Z @]U=-u  -pH4fPftP Z9-ÍL$qUWVSQ0@H4 lH4 XjP莊+ P4P4Z^+P4y @BL=&ڽ߭ݕ `H4dH48H419}l؞vK߭ٽf f٭߽٭؉Ή߅u#t 11h#RPSQh=$hP:ٽf f݅٭۝٭Q~DQh#u#RPhP$)PPÃt Ph(#)PPÃ<RPhZ$)PPT؉19}t  @~4H+'%y)DžkddʉӉف1 Q%1 RPhe$)PPS8`H4dH419݅XH4\H45PH4=TH49Z)߭߭ٽf f٭۝٭׉hy$)PP"à t!Vh(#)PPÃ<RPh$)PPË+P4P4P49}9}&h$)PV[à h?#)PP.؃ upH4fJftPVRg eY[^_]aUS0S1;`H4dH4}6=DH4t%pH4fPftjh?#P jXR]UWVEE왉U1E}ujEPje e^_]U0E E1EԉE؉E܉EEEPEPusQƒ xEÍL$qUWVSQ@@u5jhP44P4P4PH4TH4P4P4XZjPPH4TH4`H4dH4+P4P4_XP49}Z)Å~:ùdh#)Sh`*'Ph$)P=Pǃ119ʉst  @~4H+'SQh$)P=PZ+P4P4+ P4y @BL=&ڽ߭ `H4dH419ظw ȉ߭l=&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4H+'%Ƹd PSQh$)PPáXH4\H419‹`H4dH4)ލ 19‹݅99}h $VQà +PH4TH4߭߭ٽf f٭۝٭?~~h$rtPh(#VQ:Ãh<%VQ'à <ЙRPh$)PPÃuh?#)PPà pH4fPftSVP eY[^_]aUSJjiJX]áDQ4@ `t1USDQ4HyPYu1ZJ ƒ,uɍPv"u|P4DQ4HyPSZuJ"\u%DQ4HyP ZuJCCDQ4uh@$ YP4P4DQ4HyPZu ZJ ,„t@Pv8\u"DQ4HyPYu JCCDQ4uq-=P4thP4P:ZYuC ߸ ]UWVSQƉUhP4P[_tHj.V& [_1ۅt6uPkZYÅu#)WhP4VY u1ۀP41ۉ؍e[^_]À=3tUWVSh!A#h3DQ4^_u"H8th3hY$`Y[1$hSM_ZyƅEj.S] [^pu Džp#1btH uuzG uҋp=4uSpEƅt1;4 3*%u_3uGE uhP4} hP4P8ZYtE th$P8[_tBDQ4fPfttRPZYx|?thi$ h$w$xAE85hP4>}X DQ4fPfttRPn[_x"|?thi$H h$> E8hP4}z=G4t5DQ4PYt u DQ4Hy t u5pH4h$Jɋ@3u5pH4hV$Xk33 3DQ4HyPZu@JB.DB@uGG9u u@3u3 33=DQ4HyPDYuJkPk3B 3k 33DQ4HyPZuJ< u6@3k39 3u@@3 {u@@3KZChP4hD$b _XDQ4@tR[5pH4h`$4D XZ5DQ4Y 5pH4h$ۍe[^_]1US]B.uh$S ZYu=4DB@tCjhc$ST u =4Uh$SJ ZYu =48h%S- ZYu =4h$S ZYu >4]USZKJy ;J|< t Y RPDZY]UWVS@H4=G4u @H4hQ$,^tIh$h3O ZYƺ9¸} 3.uh3Vh$5pH4njh$h3S 5G4tjhq$h3S uSt =4 =41$?4j h<$h@?4P t\h@?4h$5pH4 Bt 1=41=4t*j h$h32 u5pH4h$A ^_=4=4=4=4=4>4ԛ3(h1$躲Y1u<=4u 1҉=4@u=41ԛ3@H4e[^_]Uț3tPX1ț3G4=4=4=8>4u18>4ě31>4>454tP9Y1҉54=G4u1@3UЛ3jX=DH4t%pH4fPftjh?#P jhH48 UVS]@0jX=G4tfț3t-fPftjP 5ț3 1ț3 ě3x jP 5ě3 ě3 1G4jX=G4t>ț3t-fPftjPp 5ț3U 1ț3 1ɉ G41G4j芾PZt Sh$j@ ?0e[^]UWVS ]uG4=P3t =G4u$u 1ۉU4U4Pu+U4tÍCU4C1ɉ U4U4h5>4W M /thh%WM hh6$WM WryWhD$WXZ1qP) =@H4Xأ@H4G4lH41G4lH4} t1=G4PX"t!jjRPPh$5P%֡G4-cvt3} t1=G4P豼X=@H4G4lH4h!A#SU4SqU4 uuhi$l ^i$PhhQ4 u5U4 1ۉU4j hQ4pZYuQ4e[^_]UVSQQMq@H4=G4u @H4==4ut95pH4h$< Ph$YZuBj h3^Zuj UR@P M te5B.DN@tVu=G4u==4u1ɉ =4t=G4u5pH4h3*< pH4 XZz@H4eY[^]UWVSQ4MY=@H4}=G4}=G4u @H4==4u}5pH4h$; fPh$Ԭ^_j h3ZYtj.h3^_th3*Y3uKjh$V, u7Vh$5pH4f320h3h+$5pH43 }1V*ZtVh>$5pH4 EPhV$Vg tEEP_uu G4u\]@H4gu=G4u==4u1ɉ =4t+=G4u"5pH4h3R: pH4 XZE@H4EG4eY[^_]Uuhc$j2h`Q4uu h}$jF; `Q4UWVSP}u jjGh#j9Wh$Vf ƒu&Wh$Vf ƒ uWh$Vf ƒ USjEe[^_]Uhh94 ZYu94UVS545@H4G4=G4u @H4h#YZuQj h3_ZYt?8t:x"u41Ɋt t"u P"u @54A@Ɓ54545@H4G4e[^]UWVSu huSF SB hm%P *u]WS诐 YZuSh$PXZ19/uV'É$VW( uڊ/ e[^_]UWVS}GE119ut4r'Z9sFSUhH49r1uÍD1EkE1Eu9uE1E9]tzMt5pH4RUh7 YXU;wrpH4 4t (>4,>4$>4tK >4/,>4t(>49~)У,>4$>4t  >49~)У$>4 Ph$j7 UPEB.DJt`j URPSM tFtyu= B.fTQfkt fgt"ftfbfmt yUSP]=D3uSEEPhD3hhS*y @uhE$ZD3 D3 =~ D3=H3uXEEPhH3hhSx @u he$j6 H3 H3 =~ H3jhH3hhS_x @u5H3h$GMYXjhD3hhS0x @u5D3h$MXZ]UWVS11} _]}ϊu;E ;ME]]]t>t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=G4u E#$=54uM=G4MtE54E}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL湅#=G4t =4u#}mډ)Ӌu N ty.uup9swBL帅#=G4t54)؋u ^ tA9sHBLE H9cS%"M I9OS%49sSڋMA[^_]ÃUWS$]؍U1EEEEPSht$&u- ƒ1uu諯 Xe[_]UWVSu] }VuS u1N tu$t$fN lSZHˀ; uLUJ9uD D:.y h@:.?Y@:.H @:. t@u҅t$ff t1҉e[^_]UVSQuh3J[ápH4?vPh$/ juh$PXCƃ3 1҉UUR@)R3Ph@:.yh$uh"$5pH4 jqX319\3 U e[^]UWVSD]} SMj j VhRuWd| t&hh"R = j h"V< 54tzW9Vt vuvvSh @uT.8jjjhSvv{ thh"S< j.8Sh3$FY[4jjSn ƃ u(PPhg$hF$FPjS0 @uPPhs$fDž=jPT_+‹Y_+y@Biy1fDžRjP uY,8u=+[^_]US] hT=$SYZ¸t,ht$&ShYZt;uEuh$ICXZ]US]SZu Sh$j, ]U耭 u h$j+ US] Su ZY@u Sh$j+ ]UEu h=$j+ P̝Zu hc$j+ UWVShuE ]E1҉UUUt PEXt SE_=8>4tIEt P"1ɉM[h$nEEZt P1EXh$PGE[_EPEPEPVy$G453 ZEU3pH4t\RVh$P1ɉMEPjP]Sh@:.}yhy@#uh"$5pH4G41 Vh$P Sj=G4tVRUCÉ4$9|<$WURP6 WhOt$S7 WVS7 E(tPX]Rh$蓙^_}u-h$@ Yu]SES1XZuh$FËuV1 uq}u-h$ _u]SESZ1[^E8uh$豻 YPhȲ$՘ËuV"1 uŋEtPhȲ$裘_Zuu54G4^uxG4 5@39~Lk3Phɝ$ZYu0h@h$h3V5 \305X3YCh54154Et P1EX]tS?_1Et P1ɉM[]tSZ1EtPXe[^_]UEuG4=G4t%5=4h$5pH4G4fHhD$E PEP7 UBw G4t 54u 54u)E @tG4t:u h$j' PRPE pZY=G4t"=@H4t5G4h$5pH4= G4j h&%h@?43 $?4 ?4j h$$h>4|3 >4j h.$h>4a3 `>4$j hV"h?4C3 >4j h &h@>4(3 <>4=G4tjjE p UWVS0u=G4uue[^_]=]ȹ 1SjhV u}uVh$Y Ss 1E0ESY XZEče[^_]UWVS,EPu EPA Uȃ u2$ ỦEЋE0ufEjEPVuC,'!8#usZYCEЉC{uMEЉC 1{UԺufU؃=?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuVo t VP^P5(h45 h4hT$j F9p4sp4e[^_]UWVS1ɉ /t,$Xtt+i9~d\@1ɉÅu5(h45 h4hj$k1Ҁ8IuC1tOFH@>uj RPo F 5(h45 h4h$j ؍e[^_]UWVS ÉUE9C#u~nu 0h4th4@ p4p45th4_1,Ph4= h4u8#uxnu 0h4M 1M I tPh4 h4t]Ut @uKf Ph4-tPh41ɉ xh4=p49G p4 h4t1BJM pЍe[^_]U@h4@ t=|h4t/=p4t;HyPYuԋJ 5@h4P? XZ1UWVS|u=@h4uQp48u==|h4t h]$jB @h4@:.(h4~$: $,'p49p4rp4kP5p4p4XZ=p4k 5p41hp415p4{u5tE8t6&1:"u#C؍e[^]USPyYt@Ut‹EBu Sh$j ]UWVSÉk<`-AfEE19E~6Q@94:u9E~֍~@k%QuRK,CuFS}u0Kx9tF( Fat~UCuBEsD})EKʋEC _9~M{fufSf9} z)f{)MS9|M9~fK)y1fsf9|MS9~/E9}(CPuyRuFYXCuE9}ys(ulXZ1C9uf{th0$uQs *Cujjsg uCuS)Ps0se[^_]UE @]UE @]UE @]UE 1҉P]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE 1҉]UE 1҉]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]"U1`q4jA1U1`q4jA1UE uU]U4 -1]U4 1]U4 1]U4 1]U4 1]U4 1]U41]U4p1]U4U1]U4:1]U41]Uh袧41Uh茧41U`4 1]U4 1]U4e1]U,4q1]U4l1]US] 4)thkj<XZ*ƀxj3P?jj354Y]UWVS ]u t/{u)P.vP= t6vWKC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>PjC ZtsPVs 1C sfs1CZY]UWVS`-1AfEE1}9}FQF @tf~uߋ}9}֍~@ksCf;ssfF +tdgC,t{uu S_XC0tu SY^{hC E{CE܋Cut 1EEuECutiPEZt[8tVU1ɉMj RU5xYZNMUt)9M}MԍPuRLZEM9}MtFE1ɉ u1uE$CЃEЅy 9}NjC fsfufu EfC  ,q4M)U)9~(f~CDuEԋ}))y1E+E)fC M΋U9|C@tSf)zuu5,q4WuCPC Ph$"EU)E)9~fS }}E}t'E܉E;USBu2ZuEC9E|P^9E}EEM4(q49~*u5(q4uuh$h:.ejW}u)MUʋM9})EK u,q4}))ȿuWVEQBPCu3NuuWuuuC Ph$$h:.wd$jWjPo蒜ZYthshsCtuuWVC }POC 'dC tOP507gPXZ?S{B99fSs C9|)BfSU sV_#@$.'2=.=9=R@Kщȃ$.'C*h:.jH Y^\sF "HSB ufCf;CfCs$uh:.jG 507N6507+6jjWP4NEtbu507N5,7/V ƃ11Et9}} < uEF5,7rxhf$jj5,7+Vjj5,7$jj5,7`5,715,7Y=5B.DBxqz>tKdtF<-u(=t5=t,-v3=Rt=Su%t!+=,q4S>t,q4|@h:.jAF XZVVaCfS K)y1fK)y1fC\{f}}S׍ MQ9UK fMU)y1s9~fSUʋMM9ULfKsvXxut fCfCjz `~x~Ja (EC99C@ 'fS?u ? =St=V Yvt1ҡB.DPIh:.jD V oesuC Zt sPL_Xs \Y t8F t!u S_Zt Cs~ft^F uMsvuC ^tsPKs 1ɉK s[s 1C q4XZu W_XF suC Yt sP3KXZs>[XCt2PBo1s_$uCD0tP#oC1҉T0YEC9E|ӋC4tu S_Xs 1ɉKC ^tTP 1C ZFuuZu 5,7_teE9s$[ Xe[^_]UU q4U fP]UU1x9$q4~ q4]UWVSP.5$q49B  MP5 q4jY_Mu11 q46$q4 q44ujh=~%5Tq4+uZ5Tq4B,E5Tq4J,E5Tq4,M)HE1ɉMEЃEM)ȃFE9u ؋M)ȉE}xE91EF9~؉‹M)ʋM9~)ȉE؋M)ȋM9~PEMPuu5Tq4E5Tq4+}th"uu5Tq4-EU)Pu5Tq4h5Tq49y5Tq4X tM u 11ۉ1't!7u/ B.au~()PEP~EPUBKqEH9h:.j>< ZYyQWMT9DP@tOUT:DP@uO)PEPEPA)) !~딉 u.1ۃ}uuuL u脓Ã~9PB.DP2UȋE 0)PQM̍~EPXAM̋UȈCi}t/j E؋M)Pu5Tq4L1@q4 .t.t)94q4r!DPt Zt;8q4s  . .؋]U5Tq4j1@q4UhX#莰 YtPc Zt h%T Ygjhn}YZ hZjXUWVS$1ɉM܍}14j5j袆[_ ]߉j jPM =4u:S<ZxEPj w_X}`jhz[^14L`\lj4PgZY~>jh8j4Pfyjh_X=49SE^ujhY[SZu41$Hu_k4Ph&$jXjc4)t]SU^/}EEjPUY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEP.e_1;}s7klE@0 t(Pdt!ztHhr2p8p4jG19t4EPZYvGVX_}kSlY^u`S[Ohj]jYju8j]SZYu'lڋS踕Sjj^ڌEP蹚Xe[^_]UWVShPV) hhe%V hVW $hh%Wԣ Vu1EWZt/SSSSSSSSSSSh#h4jj.Y[ WVXZ뷍e[^_]UVShPVy hhe%VI hVSW $hh%S$ SBt VSXZe[^]UWVS}11u܉54jj7_ZyjVPHI e]4$*u u^)uYjhbY[,u>tPZt4$PX4$SX^_ES9bSZYS^]_e%e%S^507fjj5,7訍5,7y[5,7nfEPj  }tChj_jZj u,jSZYue%e%Ј贒SʗXe[^_]UWVS}11Eܣ4jjfZY=wjSPyG xpuࡀ4*u$tPV_XEV[[u4EPj ZY}t!hj`jju ޑVXe[^_]UWVS1HH;E E8u EH1LEL0< t tLEL8PWY$}1ۉ889E S.Z9$PuSW O]1<%rA <%t)B.< u"DB@C8Cuj PPSp P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uB.DP@tC8u$C<54Y'= 4t#,0VPhd#h %j[# 0VPhMf%h:.>j11]UVSƉ5,7Tj5,7O!5,7P`hPjj IhqPh\PjjVh&$A ahm%CPjD_5,7@jPSR)R5,7&$uh:.hrf%Њ j,0jPC@uZYt'5,7>wPSv5,7PSjjS褅Sz^؍e[^]UWVSӉVj{bVj(P$P@  D4hD4hpt$yi =.h.hbt(Ti ud=.u[jh&j. h.hf@$!i=.t"1҉.h.hbt(h .4tP#WX@4tPWXt %1D4]f%f%u j/ j/ jjhg%. jj蕞 a$/ 󥁍 Pj(譸 (4t#u hf%PJ;54V14@4t#u hn#P;5@4U1@4h&3y^_uhf%syZYu s Xe s h4XEt28t(P1 _tSPhf%S S3 3hf%: j肆41ۉD481󫋍$88EDž1 $tWDž1ɉ CE81jj Pc+ 9AX8󥋅 ,014,PjjXPh+ c 8uE 1hv%ٞ _=4t m0PPhf%548hVS+ ~IƄuSPV$5* ud#Xh#3 ^t@ ?uz4tPWR 54S 8uE wh#P ZYt f W00X Cxf% 󥡄4xt SP{7XZSj ƒt=$'+ (+ 4^_tP$R[1ɉ 4( ƒuhKu $=t th%M Z1e[^_]UShhjh,jjjjj jjh .h4y.h:.h#g%讃 4Y[t Ph#g%蘃 XZj(jP0Sv ]UWVSEPuhS0}u=xPSY^tE 1҉Nh!A#SM6YXu;h!A#SZ" XZ1u+4tSh`1'hBg%P5띺tVRp=ËE Xw1ppWr Zpt\B9rOw wtSEE 1҉Y>lRpSQBËE YXۋplt 3F늅t 3}uWOW% Xu#4tRh`1'hYg%P4e[^_]N< UWVS0u 1EEEPVEP6 ] 1EԉE܅ukVhlg%E܍t0SE)Ph"V7 hg%S) ƒE؀8'uE؋E؀x*h>%u'3 ^_]EԊk<'uMCj'SfE^_E؃}u SpY؉E؋Eԍ4Vu@E_ZRShg%jM j 벋E؍J9d<%u<@Q)IB*B6j/Vd ZYDžtVVs EXuЅt GE/}!uo_HEu M܋}ԍYtqUĀx .tx uuWp uˋU;2tEԋEԍRUu@EZYUWVE)Phg%E܍DPk5 y;2tVCXuf XtE܋M1ۉ+}Whht@j_ f}ufEf}ufEPEt|e s+,7EjP5,7rz5,7CS6Et55,70Hj5,75,7S,7EEKEfmEURuuUjh@:.l ]u uAE@ uEÉESESXZ9,7thPjj,7t-9ut h?#_5uY 9th?P[XZRtE@tEEug9,7tSjPx t h?#\_hPKRD:.HD:.ZYy h@:.L@:.ZRjWG [_ SLL9,7tS[}ter+5,7HF5,7j5,7Quy@Y]܃Ct Pe@ZuZ@Xt EtVV"e[^_]UVShV[ZuYtPEj.VAZYÅuhVh y4 'hVh y4ъ hCSh z4 e[^]UWVS֍y9sjʅta}t7E t/t,B.DHuUQMum@ZYMUtC)؃~Qhg%PS)F1E ؍e[^_]UWVSƉUMjjjà @t5$1UVjh {4V VuS[S7" ؍e[^_]USPh {4hg%EPjh?#u0 [Xh?#j0 ZYttjhg%Sk u؃hg%S ZYuhg%S ZYujhg%Sk t؊t t@hShr4 u >X]UVSh y4/j$ z4!j$h y4hq4Ɉ = z4tR)~y4.u y4Ph z4AZYt+hhm%hq4b hh z4hq4N q4e[^]UWVSd1ɺ!iu$xtx诽 jPhy4 1ɺ%iu$xtxy jPhx4 jjjà < 1jh {4V誇 Vh8i(SXS ugL8P;hPhv4m d$8PXt*hVhv4" hShv4 9%Íe[^_]ÍL$qUWVSQ-T`q4LChh%(Pj y,4t Ph5h%qx [^h:.hXh%`x jhF3Ƌ(Y1ۋ(?RXgZX9hRD%W YZPWV蒫 hRD%W |B.PDžX@.XtIQDPg$HDQVzh uHPDAu&XhViP躅 C iƄV:(:_Xujrjn[^TDž$Hjj$V(Whph% g @u"Dž$ jjVWhh%f @u/ ;Tshh%jPZYt,뱸 ;x|s:hh%jPY^u(hdZt`q4DžLh jS>5P^_u54[DžL9 P‰f@ @ 9uhujjjjjjjjjSPjuH41ɉXTDžhjthPH;h uHiP8XZ{ `q4hiPh {4舃 jhg%h {4et(jhg%h {4e g%g%1DžPhh%j@$V"jjPpPVd $@t puh4x1'h {4h %h->jbt8DžpjpPjj$Szd @tShh%]^_1@1ۉX= {4su%=!{4lu"{4B.DPX(Ph% ZYu7h$Pve^_Džu\DžTX/1jv$X󫍽p!1󪍍pi[@u 1ɉ$Nhhh%U_Zthhu4hu4j=u4thht4ht4hhP%hi%,&ÃtϽPhi%j[h-i%S[h1i%S[h.i%S[$hLi%S[hu4hWi%S[=t4tht4hci%S[ hni%S[Y^h~i%S{[hi%Sp[S?hi%j^[h {4hi%he(h {4hi%h$SS4.hh%hv4~c_Zhi%hv4ec[^hi%hv4LcZYh6g$hv43c^_hx"#hv4cY[h>%hv4c_Z=v4hv4h {4hj%jxtnh {4hj%$Pj~ $-^$^4[hhv4hv4j~hg%hv4qbv41s4hhj%qSZYt/h"__t h {4hj%hj%ht1i s4hj%\Pj ~h\hw4~ \3j hw4n4 th k%\Pj ~h\h45~ \.3j h44 t=4t s4hk%\Sj( ~h\h z4} \2^= z4u8hl%Sj ~h\h z4} \2[j h z4v3ZYt= z4t s4hh y4%^_u = y4u s4,hP$S} hh y4h y4jx`hh z4h z4jwJ,PS`Y[t%s4Tujhy4hy4jyXtjhx4hx4jz_hy4~@ Z=x4u=w jhl%"P?w jhl%-wjhl%hx4>| jhx4hx4j{hhw4hw4j}ms4u:1ۉllPjI^Xluhh4h4j|*w4XDžDw4u DžD6g$x4=x4u6g$x4=x4u6g$y4=y4u6g$v4=v4ug%4=4u6g$DVSQRh {4Ph y4h z4h#h,w4u6g$x4=x4u6g$y4=y4u6g$v4=v4ug%4=4u6g$VSQRh {4Ph y4h z4h#h^(jjj h%x P Yr4Rh&$h( heZZ?HP2/hl%jtj9`q4_V=4h"hl%Y^u>=4th54Pok hvh:.PWk jhl%j\TpV VVPhm%h m%S9T = z4th z4h=m%ST =4th4hHm%ST hi%jSj8Sl8=y4"Xhx4hy4h {4hWm%jhwm%hs4 hhs4hs4jjFj jh<u`hm%$Sw hs4S< dh>%dP _Zt 8tV [^^jj`RPW HTuB=x4t hx4hy4h {4hm%jhy4h {4hm%j= y4th y4Y$h y4 ZYTuY=w4t&hm%hhw4hm%hwhphn%h[ TT`q4j6`q4LXXLeY[^_]aUU#wh1']UWVS] }Vh:^%&ZZYuu ƅ?jh1n%@:jjf@Mjh8n%ZY9t x/t/@?/uGjh8n%MXYR4$SRPh@n%hue[^_]UWVSƉˍPh:^% YZY#uMn%t#VQPSS4t4PVSWhQn%hie[^_]U`4E]UUS]SUZй4؋]4USPEEPj耱EZYt=44=4/u4萱SPh#%hh@4x1]US]=`q4ujXE]EPj EZYtt4$44=4/u4SPh#%hh44=4/u4ݰSPh#%hh41]U Mh +$V3M=v4thv4hn%VM hi%jMYXs4Ltd迮SPhn%jL=v4thv4hx4hy4hn%VLhx4hy4hn%VLhi%jLXZhP%hn%YX@Pho%jdLh.i%SYLh1i%SNLh.i%SCL$= z4th z4h o%S'L hy4h8o%SL = z4t%Vj h8pVj  t$hh=~%Vzj h Vij VJY‹E@9hC#DPC XZVh&$Ep e[^_]UVS]u {t5F fC ][^]G[^]UVSÉ1ɺ}%%ujVɹh#Sh A#e[^]UWVS\ƉUM1ۉ]1E9tXE 1;Y sHFE1U9t; u;Zt(@URSQMPL Mt EԃUCGjuEZYu 1ۉ]EjuEZYtMEEE}E9E1ۋE;X skFE1EE9EtE‹E;u;ZtAE߉MEURSuPL MtEuE_E@ EC덃shjjhjhj_ZExN1jSEpLe S}WS}Wttg`PR][^tEPPR跟ZYtU6V8t,V8u"E@t$RP]^_uh}%EPGY[tEXt p$l(h,`d04t:$VS\_Zt'EPV4Php%hSEpFjhp%jY[@YRhp%hp%SDVhp%WDWhp%Sݮ$WPh}DSb6Su?Phq%8‹ t ?tPh q%P貭_Zu[h q%P萭ZYtލRh$&PC tjj h#04,,RPj$W SCB. tHLDJ@tSPWVh*q%hFPU  |41󫍝DžƅDž |4DžDžShQVZ   |4f=tfyfV|4f=NE1f=FX!ʉ׃11ɊV|4W|4t 'w4$@'w'$@'wt$@(u$@| uu1Ƅ$jj h#04,,RPjSU $PSVh8q%hFPo4J1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VLX j!?jAm.jUjj h#04,,RPj#W (S?PWVhDq%hFP Ljj h#04,,RPj$S SVh֑$hFP 0E@8@ue[^_]UVSPjjuVjjh2'@tbu XtSjjVSjh2'm@u SY2h>%S ZYt PuU ^Zu S[ h>%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEw1h>s%wf Y[uF h%w A[ZÅt#h,2'6AZYG辟t똀\t @BJu Xt@w44$t)tVP҉[Xt4$1҉94PSD@YZtXP,40Sƒt/t#VRЉXZuTRY8puo$uVP҉XZtً$HjjjjhSQRPx jjjjhSQRPx ۍh%S h4PS\ h"P h4PP\ W(R<^pT`~a9fhGPS4\ hwVP\ ;h%S hwS\ h"S hwS[ (uYhSq%V hV[ hwSZ Ph9%S軐 à ƅG1ɋÅth"S=ZYu!Ph9%jk à uhZ $S=ZYth#Sq=ZYthR$S`=ZYths%SO=ZYth"S>=ZYtt hhWq% hh9%VZ hSVZ ƅGw PV謙à wh&$jj9k؍e[^_]UE1҉UMU ].UEEMU ]UWVSQ]} E10$hmj6Su E\q%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVSE 1ɉ1D󫍕D1҃=45,7^h@:.7 5,7#=4 GuujjRAXZ1Ҁt,DžfDžDžDž=v Dž1ۉ11119tD5fDŽ5DŽ5H5=fDŽ=DŽ=BC8[ty1t1DŽZfDŽDŽDŽBt1DŽXfDŽDŽDŽBhjjjjjjjjjRPj轜Ã4uDžRuh&$j@DžPS(tuiu5hjjjjjjjjjPj1ƃ4t@DžPV轑ZY^Hy VXSڜ_u?t6hޤhPh. U 4.DžM=4yu4Dž&1ۉ49i8511ɉ9=4t9i854t(~SW7YZ[ڋ44ƀy1҉LPTXjSPS hCP4"PS jSh4S 54,, 0$4(804DH$u"u $1҉DHQ,RPFP$4()n,, 0$4(804DHu u $D1H$ 4HpuDH9jj h#RPjV jj h#4$P@ RPjP_ 48t$4VHDPhq%RO 4$p~ơ4$0hRRVP4Pjj:5Dž1ɉ$Pj躍^_u654h_1Z7$P1$Xu@P4P54 Pz^4$HXDH-1ۉ,048DHƂ(48<=454\44Ytu 4h£4a1X@_yuƆy$tP,40Wg$͋e[^_]UMw1vB ]UWVSDž1ɉ4*)PhKr%hS }%#t+hf)/ZShUr%h豾 ju藟h%֋4Ph%hS- h%Sh r%ҍǃ(h%ShrjlE0p111R ZYtsE;klEX{41 Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQhI%hǃ&YcLu۝XZ=4CLSSRVǃSRjj\0jj!6?$1'v=IC`,tPhnr%hV Vhtr%P| C`,tPhr%hV CXtPhr%jW WVC\tPhr%jWg WVzST"t9%tT=$VPhr%P CH@}%r%CX,tS\tPhr%hV Vhr%P Vx%#r%hr%P^ _Xr%)r%hr%P< Y^r%1r%hr%P XZr%;r%hq%{Tuq%PP ^_r%Br%:13}%r%$tt1=161e[^_]UWVS 4*PƅhJs%>h"h $;蠆PhOs%j$=4t"4XzSPhhs%54N u6h艚4Yt Phs%[; XZjj3_Xhs%WQ$4Y[1D)SP-B^ZmPdR P,V dRhs%W#TPVAL$TH\@H1ɉD@9DtUh"ZEZURuh4PVSuh y%j¸$KEu j$uZY대>tVS蹢 Và E)ËE9th6y%h2'h hMy%>Ee[^_]UWVS EUϋMMjW$Y[tK1MU9t FRlSVPNƃtPEVAXZ]e[^_]0e[^_]USj$uZYtD1ۉ]XEPjhjjj EPSU Vt;M rj$S뱋]UEPM UJXUEPM UjXUWVS Ɖ1uP$kƅ:Phy%W, tPkYy%t~y%Phy%kXZy%ty%Ph4Ơ Vj&4W Hv|=`q4uj{^1.Dž.Džjhhm% kPj(Vu1h4h.V #=.u3h.h:^%<ZY#uMn%=.t#VWRhy%h谉WS裟 =`q4uj膒XDžjhhm%3jVj'U(=`4+=4=4hz%V V h4Vh#%S* Vh4h`4hz%jڈ$WSh%jVh%j讈V WS蚞 Y^DžVj)TXZS=4tZ=,4tQ=4tHhz%VF V h4Vh#%S) Vh4h,4h.z%2;e[^_]USڸxtjS ZYuShHz%jʇ ]US18tjSY ZYuShUz%j芇 ]USSJ=tsg1EEPj%SEZYtt`Huȃul"hm%hX t&j hm%hYXKuhmz%jTXZ1]Ã= 4uiU 4"K4z%<4z%-4]P$4ؔ%4r"4]USE] tP:gYSjR{fXZ 4E]UWVS18Z1Dž@DžDDž<jjklCx4uFtWXF 9sklS9z4uB4@s XCEe[^_]UVSjhPjuet)uu P @u0S0Z1 SXe[^]UWS] 1Sh|duw t#S;S t%iSR3ZYt3@X1e[_]Uu hzd@u)UVSujhPjV苨t(ju jPV)S6y 01e[^]Uu hedAuUU EHJ Ju BM+KQsPR` u&y s2Nu {tfa EfxNA t @fFFf9ߍe[^_]UWVS] u@(D=$4u jP$4XklhNA0 y841RPq1lWƉ׋lAdP9QhslhPPlRWVh}%Ep腨EXfC u>`4ufC ;^Q8tWRPQL }E8`4u.XfC uVhD 0 tfC txPT41҉`dRPTP2HL|]d`SQX\lppX\uX\lt4PTd`SQ裎X\tj2 t j3ZNXtj4uu赗Y_FhD8L`}Du/E t)E8u! 4uhM 4ZE}`thMXGFhD0 thMYG@PtэL)QWNht18RЃSZT49sL}uFEt8u:Spl\XLHh}%Ep$f#`tEt8u#PEPP4PSRRpl\XLHh}%EpY8e[^_]UWVSXu} ]=X4hLT4PZY9X4}X4hsLP4PZY9X4}X4hOLL4PZY9X4}X4h+LH4PZY9X4}X4hLD4PwZY9X4}X4jGK@4PVZY9X4}X4jHK<4P5ZY9X4}X4jIK84PZY9X4}X4jJK44PZY9X4}X4h_K04PZY9X4}X4h;K,4PZY9X4}X4hK(4PZY9X4}X41ҋ;Q$s+k UA(0JPUZY9X4U}X4BʃX4F@ t_u {4 H J2NE#UsEUt({t h#5X4h~%v t85441RPs$s *RP5L4S4C8u%uh u hI_hPR>Y[P5T45441RPss軉RP5P4.54C S$CS 41SQRP苉RP5H45X4h"~%vP %;u1C( P/IP5D4;u!SH1BLPIP5@43;uSH1BLPHP5<4l`u'CHpX5045X4h0~%v; `uCHp\5,4ρLCHP`u&hoHP5(45X4h~%vOEERh&jP h5HURjPcà P5(45X4h~%v蘠SFcfx5845X4h9~%vfCH@Hth@~%vMXZCH@HthG~%v5Y_CH@HthP~%vXZCH@HthW~%vY_CH@Hthc~%vXZCH@H thk~%v՟Y_CH@H@ths~%v轟XZCH@HE x~%FEe[^_]镟KuCHP5445X4h~%-+{jPMQKQWsPRdk B(0F}WP5X4h~%v*0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4WJ8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhI SPXZ1e[^]UWVSu jFHP}W jWWjjjjj IB.E܃,11ۉt}DW@uu@tA~Ht҈Uth#SZYUu GFH`L+/tG/jSFHPjSW FHHL1e[^_]UVS u vDh&j ]Sv j SSjjjjhH0SFDVHB`1e[^]UWVS jj%G[^8hLDC 5<h9DCC5<h%DC C,5< E1҃t^tZ 5'tOE4F 5<}Ou/UDEjh3}EZYUMB"t}$vuhCF 5<X}$th~%h3'hh~%:jjjjh;hjj jjj%SjM+:ƃ4xu P/V ;See[^_]UWVSQE @4tt3t.t)=t" u E x8uu u\XZjj 襣^_x 1҉j45'UG =UBXYu؍{sheBhYBChLBC h?BǃLjjjjh=hjjjjj SjM8ƃDxu P.V9S/1e[^_]UWVS] B({119tuklKI0΃@jj h#BJJbRPj!W jj h#CKJbRPj'P 8uth9AjPPVk E@ tPAjPPV( #u h@Xp@0@'QWMQVRPpjjA)4,jB@SPh֑$j -P[ 4jC}@SPh֑$j :P9 40j-X@SPh֑$j GP jD<@h,@ YÃsT4uZ£P4Tٰ-LƄT 19~-@Vh~%jPh4脏 j.?h4P5P45T4GP:P-Ph~%hh`46 Dhm%DXe[^_]UWVS] 4$DV跲Y_(V胵0(C<@8jPڟ@ x 189}gG u CP@@<2<9s SklLT<R+A<Q@+QP$@ 09ȉЋ(}fF돋<@} Ehujjh@jjjAjjj8@h4E4URP*u5@4}j8H轞<_Zj 褚$^DPRH04EZ1ɉ(,~!klSLQA<Q@(,1@8048;HHD88`VpWRLV7uVP 9jj,(40EU+04RPjPPQ,PTEUjVP @V PRLk@8< 󥋽 x08x4@u}u} 40WVNz)׉(,8E@@PEp譝_Xs$Ep@f E@fx@CklPsiZYVCU<8kl4@0E@)Ћ@)P880PzCUk@l( 9s)klPVP~z 180(󪋅<18@98tNH0N8HV@8 QPWRL B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhDh7?jj7jjjjF,ƃ4PVH"V-E)PB89B4<PZufLW WPF8PP8 WRPQLP $A )9Uth8%h3'hlh~%jEjjh@heOhrjJjjjuPh`4"C(4ys$1ɉK$[1\E<M@C,Ss(,XZ{, 3CE11}}9}tLk}l{G0u:8t4GLt.MUGh%P轾ZYUMuBy GD tO@E묅u}u4V%_ti[Jtyp*Nj0*WPjhp*Nj0*WPjh<VUYu(VGZuujV^_ƃu1s$跏1C$s(K"C(ZY1e[^_]US]t*h%S赽ZYtj/S ZYt xu]UWVS]u}Ht1҉t1E U EU3'E|4=Tu=8 =T=T=4Xh4 WtLWlEURPh h 4uu= <W91EuPE!UMjhw%h#47 MUtt#+=b4)uUMjh"hr47 MUuQ 4 u ƀ 4HFur4tt s4g4= 8t4=T; 4u4; 41; 4u; 4utt4Uh`4-É$h`4UR6 UuӊtZuVh&$hԁ%dSbe[^_]UWS0]}ȹ 1E1EEE =4ujjS)@ jP4E܍EPjS@e[_]UWVSM 14f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh%j]UWVS4}=4PklUVE 0m`ZYE UlVSClP=11CC,C0CLCPCT 4$p( u1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC hf#VOO ZYSߌ$S  t hV1 uE<=uV苌Ƅ<$SVhy%hPJ 1ajXu5WSh%4 tYWSh%PeO 54Uj<4tSh%P:O 54*jSh&$hw%蘀 1e[^_]UWVS]u Cp}SYu 9% :%B4tWh҂%PN 54iWh%h%VS1e[^_]UWVS}u E2%E2E%1E4ÅujEPYX9uG@<5hRĉZuG@<KtG@;1e[^_]U1`q4jC"Zt%61UWVS]u 1j "Yt5DžPj[XZuC@<=4uh.%jYXh4h4h 41h 4hV%hzh 4hg%hv%}~h%hXtWh%h< jhMőC@;XZ1e[^_]UEJ]U(EPE 4P1]UVSU E0pVSPhك%EpPe[^]UVSu] hqj軇ZYt,h%hoZYFu @8@V1e[^]UVSu] FPjFph%htF@V1e[^]Uhh%h UWVS\]D1t=u41ɉ 4h5xjP!N gSbZX@.1ۃt"tu舀4d.)Ⱥ4tP[[_th%hȺ4js Ph%hȺ4jWȺ4x.nthN%Rj) $}vWPho%Rj=4t$R$Rh%WJ W̆<$ZYv .8..="FtPVZt F9F:Ch4h4h 4. 1@.Ct@t!1C F z~uʃ507Xjjj5,7m5,7>_5,73jhKjjhhQj&jFjjjPjÃLPSS e[^_]UWVSQƉh҄%)h"PH uA=4th҄%Ph%54dH h҄%Ph% /OuPh%Ph2%b _XVh[%S!H Sb]th҄%h%Sj h҄%Ph%Sjh҄%_P4ZYtuVh%PG 54bujh"V蔅 VXX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝu1ɉM] u]u]܉uu9u]{ u ;}}w1] 1ۉMԉ]M]x(Ã}t*M 1]1 uM ]M]U9uU9u {;u U| 9u܋U} U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á 4"UWVSXE؉UȉM]E EUE} }}$}}؋wu}9UM}։lj]19؋]| E1ۉ];EE}LuuWV/ut4EUuuWV.);uE}u}]؋EUCSE܉U1ɉM̋EUEUE9ƉM ]9]E؋P@MAQEUEM])M]EE1҉UЋM9M+}EԀx EEԋ@1҉MM]]1Éً]1Ӊ]ˋM 9u]9ƉE9Ɖ]E9E܋Eu};EEEUuuWVq-);uE}u}E9ƉM1EEO)]9؉ӋM}EUEЃEE9EE]|Eȉ0xUMPH EE̋EU׸;EEu}uuWV,);uEu}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UVSQMAQuRPRPjjjjO IuEU11ҍeY[^]UE]US]sh%ji ]]}RUWVS]} j/W ZYƃth)PCDPW ƒuMV`~Dr9s6t'19ty u9t@e[^_]Uju EDPsSUEvPEDPu 诜 UWVS]=(4u ,)(4K$9C |b5(49s sW}jjjjRPRP t39r,1tu{(u t @9|1e[^_]UWVSU}119y u 9;] u}t uz(tt}h~t[nЃu"9uǂǂ1J Z$1ɉƀJ C@]tÅ%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS41ۃ<7't,jS3FFXZw6'C "uʍe[^]Ã=4uUX4]øX4UWVS Uu}E EE9E saE11ۋMy u9t 9] tC9] r;@EM9|ۃ}tMa}w}uWrV 0}t.1HR}t PRh %PRh%WVU9 R}t PRhv%PRhv%ԍe[^_]US]uh%hp6'hh%smNX]]`NUWVSÃ=4un419t/@ "u 4$419tp4x(9uB1[^_]UWVSu =(4u %(4E1҉U19~\UE]FPv(,uutu Ex(u}t!C;(4GUfˉ}FFN(1tF$1Ft 8tjPkMP kMƄF uF }th{UXEEe[^_]UE>U U]UWVS]u=4u1҉U1ҋM9bx u 8D;U +}ߋE싃E苃E}t }u{(u1+FV C S$FFlN(1tF$1F,MPFtk9t jPRx F tV"}uM9MuǃǃFt$9thM%h(6'hdh%詁F t'uBK 9M sM 9rE1e[^_]US]=4u!w k 4"1; 4s k4$4C([]US]=4uS1w5'E[]UWVSSÉU=4uv!v= 4 $41k 4B9tp4;u(}u1BRQFZYt$4 4k44B 4V 1Sh&jRUS4 F hst~ SPh%jW34 F'F(UV,~0F((e[^_]UWVSPu]=4u1E1M9z u :;E  1}1ɉKC1C CkEt CCEC S(‰C$EPC,}u uK9Su;u tK }u0~(t*u!K @N 9M sM 9rE1Z[^_]U1ҋE ]USR] j EPui U:tt htX1 k]UWVS0]{Tuh%h@6'h{Xuh%h@6'hh% ~{\uhʆ%h@6'h߃{`uh%h@6'hȃ{duh%h@6'h뱋CjCDPV& u h%V XZ{4uD1ttʋ5B.DNuT4@׀{4ujhf"C4PfH ؊LD tB:u JNt Ph %W, h"WN6 ƃiWh2%jlPhA%VlsXs\s`he%Vk,Psdh|%VksTh%Vk19aW 47'PwP7Ph%VqkG P u"OQPW RPh%VDkH9~h%h?#VkZYZhi%jkVOPPVh%hχ%jÃ(V˵Xe[^_]UWVS@E PẺUЋE @EE @ EE @EE @EȋE p@ E1ɉMMMMUjjuujjjjE u}zhM]EUEԉU؋EP@9ȉ|YtTtOM܉]}ىΉ߃SQWV)׉M܋]))EU؉EԋU؉E܉UU9UEU} EE܋EEE̋UЉEU9M̋E}M]ċEԋUڋM̋]M]9ȉ} +EUĉE܉U=(4u (4E1҉U19~W}]Exv(*uutu Ex(ut} tƃEC ƃ1EC fǃ؍e[^_]US]{Tuh%hX6'jg{Xuh%hX6'jhh%\s{\uhʆ%hX6'ji{`uh%hX6'jj΃{duh%hX6'jk뺉CKUU U@8P1RPPjhQ]1UWVSPEE=04u111ҋt]}u=6'u B8t88 Ӌ9(7' Puuu jju҃t-Ӄ띉uh6'uuu jju(7'e[^_]UWVS] ߋuE;Utf1Myt]J8{ sStWVPщC u5EuV2P4CZuEPDCuEjP4CXe[^_]UWVSo46'94k049ju2_11 8't;Gu܅tT5,4P3204^t7;t @'{t F'{t 41҉SR:Ye[^_]US1ۡ04;,4stCP:X]UE p 1]UE @<1]UWVS]} O4u Cf` 2@XtQRЉSfB ^^uփfB f{ufC4CEs1EU9U~*Ex ufP ufP E΋OfVJt Ѓ9tЃfFJ1;p$s4Vw4RP`EG8CfH ʃ}ufP FÍe[^_]UE @1]UE 1҉P1]UE @1]UE @1]UE @1]UEPE ]US]E UuhHPR0Yu hZ@EE &$CE]+UWVSu} ]=4@14j4P=dZY94}4j4PdZY94}4h4PcZY94}4hd4PcZY94}4h@4PcZY94}4h4PcZY94}4h4PhcZY94}41ҋ;Q$s1k A(0P5cZY94}4Bƃ4C89[)ljhWKQs4PRdk B(0VWP54h~%v)0$$8'S#tBP545441RPss RP54[5441RPss RP54454C SCS 41SQRPRP5454h"~%v)5C8u 4C u4P5454h~%v(e[^_]UWVSPEC 9E rh#j hL$Ep(Ru SPL t t@8u54uh4Yƅƅ@Pt QRu SЃ541PWVpRPWVXRPh%Ep'ƅ11;xhQWu SPTtTtKwCPT`Z9s Ƅ @Ƅ5 )PP5P~ @ DtGsPh&$Ep' e[^_]UWVSE 0@ #t PHXp;Nj00SWPvjhb 5441RPvvRPh(~%j}W 5441RPv$v RPh(~%j]S FPTX0hPRjP_PS2h%h`4 h`4^Ë=4$NWPh %j^W  4Lh#LRPh %j|R 0hP|RWh)%hh4 1;x`4L@ HH0PHPhL$jMQc hMQh4} $NLw ƃ`4 CB1 LH9sLNw-@GLZhh;%h4:} hh`4h4&} hm%6e[^_]UWVS ÉUSP\E{ [Gu]jS,EZY1KȍJ9t9sfAAFurfB `4fB }uBqfBB B #B1B1BB ufB*B,0E)x9th@%hL8'hyht%f1ۋEEe[^_]UVSQÉ54 0U4CEfC[e[^]UWVS} P,pjVr+YX19sD @jjjhjhjjj j VSj:ƃ4t WPֶG=XZVSo/e[^_]UWVS} SDV=ZYu1#G @Pw+ZYtW JO GЉ41x 4ȍUĹ ]{ u0SPH,0^}1ɉ<@EWjR<;*XZL1<9}D @>hujjhjjjAjjjRVhE4URP腵uV".}51Dž<Dž@;us<`RVSPL t$hl`d<@FjHO)4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DPU1]1EEPVJXZ}y1Q1҉Tu1Hùxt%| q1@ 4SG0|GEE;xrB;Us E11ۃ}t E;]sP7/C_P`YV54NXZ}e[^_]UWVS0EDž}uEl,4jSZYt jSy^_uY13jSR_Zu[^ƅ1;,404} tE 9duE(u)tURYu0;$s{ЉuE, EDEHʋ9Ɖ}fjj h# WVjWhpƃ 3WVPh%Vx V Nj8ƅ3ܶP\ Nj8XZЉ8@ Vw؉1=uRhnFjj h#EDUH,,RPjWE$hoRjPHVKG$=GY/GL9  $}VP VGpf $V $SF[f Vs WFÃ9r$h%h88'hht%PuZ1hjjjjjjjjjPӫÃ4tPSi^X19s 419t4@Y؅ttWZ tS&Xe[^_]UWVSljfDžv/ƅujhm%Y^yhhm%S1d z躠t&豠8t觠WPh#%hS hWSc =Džp!j/SL _Zt.xv9tH9s8/tQ"k YyߍxPW9YZ%=pu=U>hQW_ iƄ/u%谟QPh %hS $hQSb =@uWWj ZuhWPb =hSױ Y_1Ҁ;/u 1Ҁ{‰hSCp<$CZlhЃpDl=w4uhh%Sb =whWSb =v S?VT= _y SV0YSV.= ZVSX1e[^_]USÍEPS迿YZy1]EtjSXZxj `PS t SYS`Z=vf u]UWVSEUPE ^ƃ}t11ɉMV7\ Zt{fx vX jhɉ%SRC uSuh#%EP @u h3#j 3Et}tESWuh%jcu{[zV8 XEEe[^_]Ujh*IjQ UWVS h)%411tY+ڸ2%xuڸ=%tu#WS XZuWSY^1yah=%hPS_ WSQ1u hC%蛜PShM%jdShY%j4:hSнh8%ShPP@_ WPu'hc%SӛPPhM%jhl%hPS^ Sh%jtPhl%hv%juh*%S^hPW^ h%SAPWhM%je,h%S%hPWg^ h%SPWhM%j2,h*%SPh%jMhKs%SϚPh%j*h%hPW] h%S薚PWhM%j(h)%ΚhPW] h*%S\yth%S= Ph%j_ h%shPWZ] h%Sp14!.Ph#%hW ttpWhM%jC utjh+bFXZte[^_]UE4fP]USE@k 8't!8'ShWE 0-C4 ]UWVS$h.ƍPhW@j-@1jh%_ZRhW@P;- 1ڹ8'1!tT9u Dž0AVP>ZYu=4B G jjjjhjjjjjj!ShÃ4tj"PS觗SXe[^_]U辗4tPPRRRh%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ41RPSQ[RPhK$j]S ]С4Eԃ7x6P URjP91ɋu ;Nsklu ^c0AO0}u}u ]u]uutu9]}UEG0uW+EUu FV}t ]U]EUWE `1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A fB}lj`:'fG G5GG G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{~S(xE+C$PR蔖XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP2YZuk{8ueEC8EC4FV SVCt~8uklHCBVPDXHXXe[^_]US]5,785,7-YX{$ujCPC$XZC($h4jjhwh7hRjFj jjPs$h 4yC(4ys$1҉S$Y1-C,SP]os(zs$C(1C$C,]UWVSuV[t$V"Yt&jPQ: S uue[^_]}hjXZ1e[^_]UWVS4$)t uiVu`j(PjRƃu1O4jjHDjjPÃt͡4$3t j4PLSЉƃu11P;^ s-URSVPL tEuEt 8uPC΋4@u <@TXuuDHTX=4pjj h#,1ۉHL,ËHRPjXPJjj h#jhj^W,8jj h#jh0jdS pfH 0T4DP&$WXRHQDjP p H0SWXWHRP4Pjj'm(hm%0lppltDžxDž|}1 EPt!EfEEzEDžPf@ @ @f@@@ f@*@,PW=,4v~(u@0f@:@<BhujjjjjjjjjREPhuÃ4t#Pu@,ztPS6kS|v|Cwc 4LPdhTXlpF(t|lQdQP҃ fVYexM|AEAEA Q119~.u2FN<uF EuPEXZC΅juɋEtY_1}z 9u}Wڹ[fB EB h;jjujjj(jjjuSjsjƃ4uP`VXkSEEEe[^_]hj XZe[^_]UVSuE ]wi$<'hDs A[4hE2[%W& hRW ,9u|h"nhPW hh=~%W S0pz t7z(t1hh>%W hRW ,9uWh&$v [[$h#:[ h$0[h%&[h&[h'[h([ h)nSPh%ve[^_]UWVS ƉӋ}ɉt,hmQPShθ%hS耽 tWSh%V)6jj h#EU  RPjW WSh%V,e[^_]UWVSEkE <EXp8V$D='|thxuhhlYP"Sh%pn8P@xu!h#PѢ XZ+jjjjhQWRЃ tQWRPLt tt 8thhIl_詵‹ Y^tASRPh%%hSٻ @jى$P҉t5hh߼$W hRW hhy&W $@j1S"@1uDHM] 1ɍe[^_]];ƅsh%W#- S0pƃ 1z t%Q ,9utns$h&R, hjRjPNj@js,s(}(WYh Yj‹@Rjj1ɍG;sh0%W , { uh2j‹@Rjj12K t-h3i‹@Rjjv@j  ;{@u-hCxiZEE &$@Ee[^_]s%Q 89u1118 8tsuÅtHC4S8RP)RPhL%hSз @Sjj(KhKs1;CC}7C Ph%hW~ @jss1ɉe[^_]UWS]1C1CCl@YdRhV% S;) e[_]UWS]*1C(C,C0dRh_%S( e[_]UWVSu] = ".u-hujjjjjj jjjjh".j] ".4f~F$d='S5 ".S[^jSSjjjjhQj 1l{(C(R {,C,S{0C0T1ɉ Ph#jS jSSjjjjVAj0S2 ZxS' X됍e[^_]UWVS$u] E=!.u-hujjjjjj jjjjh!.j\!.4f~ F$|='1ɉ (4 (4S5!.QXZ1EPj QE^_xC$h*jЍsC,:sC--sC. sC/s C 01ɉ Ph#j]S觴 jSSjjjjWi0S ZVS XHe[^_]UWVS(É։5441RPEp0芤RPh%jUR- jEPURjjjjSh4E1EЃ8ju uWVUREP<Ã19}MˋEʋ}We[^_]UWVSUE fz iR$=' jPPjjjjhcg 4,1P<1RPd 1҃x,‰P,11҃x0‰P04jPPjjjjheg ͍xT@TfxX@Xgtx\@\hg1҃x`‰P`땍xd@diLxh@hj?Plҁ~ @lbPlZ1҃xp‰PpI1ɉHH'h4_ Wtjj__h5ku241RP 蘟RPhK$jEP; h6&tjjI_Yh7u)tjj_ZPh&$jEPޮ h8t"u h#jEP詮 h9t"u$h#jEPt h:bt"u(h#jEPB h;0t"u,h#jEP h<2^VP 4Ph ~%s詶e[^_]UWVSX1ɉt @@$44t=$txuP1$Xytƃyjhf%:_X=444|uÐ Dž8144ktƒ8C1;8 8/T0 RPh#%hWɬ 541҅t4҉uFWPPZYu Ɔyȅ4ƀy1LPTXƀ);444ǀ,ǀ<jWP hW4"Pk =4u/41҉4h4aljY t^4tByu/49u4ы9u􋐀뺃:54'xk<ǹ1󫋅PB LsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB L$CsC C8RPL u;x ruكtЋQ__k<y׹󫋅PB LCsC C8ci1fD @9s=4t1(>'󥍍P{_<>'󥍝PًH^=4t_Dž DžDž841҉P>'󥍅PًY=4t1d>'󥍍PXX31B :T3B OI$4y @HfFe[^_]UU J E] =42UWVS11ɉ44PYZN4418t=suB89J4ƅƅ{@144k8|<teD@Phn%jPv44Ph%hvhh%R[ h44PRB F8y44D(~&Ph%hW軥 hWV 44D,~&Ph%hW舥 hWV 44D0~&Ph%hWU hWV P44؃PVh%hru1Dž8844kt1;8 8tuÃuT44B1L'Sj0ZY1Sjh4jsjhhAb+! MhT4jsjhJhE.0 VSXh84jsjh *h]* &h4ssjh)hW-e[^]UWVS]}11=4t}jh"CP ufK04|tF9Lu@‰4p'1҉GrEPj!-'us4h$VuC<h'$VYZuC<h8$VYZuC<h/$V^ZuC<1s4h$VZYuC<=ЉC4t5xt$h`3jY^tjjXZǃ=$4؍e[^_]U=4tuh%jPR UVSuu1r$ugjjjVcyÃtjjHDjjFPt$4KS;DH} DHe[^]UEx8th#h>'hm h$%@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$蒛袧$zuubPCsYtWWPZtNjE@ u WVX_XWPV tjVSnE@ t VPZYVXjjS;ƃx$4 e[^_]UWVSuXYƍ}Ĺ 1uVZt틞$S_xt,jjjSǃtSYt$SPHLPd 1Z} w#jM >'RjP8x u0h#h>'h h$%>R1t4Q,1t9E t @11tt:[]UVSQMp@19|h%h?'hhf%(9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s8SrY;C K$}'ujjjjRPRP Ɖe[^]Ã=@4uUhnXUS]=@4u1;@4s k<84[]Ã=@4uU@4]á@4UWVSSÃ=@4ut=;t6@458419t$USF P藭ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h%RQZYuj ju}C,S0h%V)Y_uj ju}C4S8h%V_Zu0j(uY^ƅj)P_ZFh%VZYuEh%V蠬Y_u j(uh%V腬_Zuj`u@S1 Oh%VaY^u>h%#EPB XZt(B'>ttVP.YZuG C<e[^_]USPQRh)%EPj6~-h?#upEjh?'Pt2u}[1Ehf#EPB XY:tjME+[h?#joEZYuuH}X]UWVS1jhPjEpiqÍPhd@S @SS;`EP,[1Dž Džƅ ƅ tpÃuMtGutЃ ) u DžuЃ A댋Ex@uP@4tPhL%P ƅEpPhS%j6\E@@Ep0Et(pv0v,hd%j6V{1ɉH0X,H{09L;C,P{89T;C4 PCP5L ^_;s@\PVuZY{%뺉M̉UЍUE,URىGZtGE @ uE@ F4V8})G W$E/E@,t9tVSr:e[^_]UWVSM E@,1҅tj9t BuF thuHus09wtIhjmY^u<}t 4}19t롃;S,u)6lj󥃣E0jMZu뫋MQ{89y u;S4t EP @+C4S8M)A Q$UMe[^_]UWVSu}N t-^,11;E t9st@ڋut%1KuF,tF0jSZu SpXN C4S8F V$e[^_]US]{ tjjSR u]UWVS\E Eu thȔ%h@'h=4uhӔ%h@'hhf%蘦uhܔ%jP*  44uh%Pj(jDjTkXZh?#aXZ1ɉƅ11h?#ja^Zƅ1hf#P3 XZ>tރuVtjYj jVm uj jVRmTuj jV1m u7thh>%P hVP޹  sh)L$VZYuDG8PW<G4h7L$V袛ZYu)+hL$VhZYu)j h @'V_ thjhh^Xۋu0lY19ȋWl[j`RC@Pt C,S0C4S8 u+t)CQ RPWYZuƅu_, G 1%E u G1ɉOOO_O _$UWG@jhRjP XƋG,ÅtjP4tKRPPs0s,Vt'8t"Po PXZ@8u ǃC4S8)G W$q1ɉSh|dV iR>bZuujYSh|dV茆 u܋1;s̋tpH,9H0u0;u"H49H8u;t밉jSPԴ BrVMZ1e[^_]U覝1=4t =4]UWVSE8}fHfMfMfXf]f]X]߈]X ]P Uf@fEExstExlK1MjQkC'RU U؍Muu ru Fu1MjQkC'RU U؍MuZu ru觳 uPEPEPEPEPEPEPSEPEPEPWhN$u uR 8 Fz밍e[^_]UWVSu] t>u1}ZEPEPEPEPEPEPEPEPEPEPEPhN$V4 uAEyƒt ƒu&UUSCEC EC fEfC1J1VkC'U͕ZYUu$C'}EECEfCGue[^_]UWVS@utcC'CPCPC PC PC PC PC PCPCPCP3hN$j@}WQ 8ssWփ E'ue[^_]UWVSEUM܋}EEۋM );} GEE1EEƒ< ‹E䋀,uF;E9r+F9s,t }P;U u)9sE䋘0 }t%0tt13t]ƒt<tՋ,E39Et:ƒ}u9r&39s#P;U sxU9sډ)9sу@uEE}t(}tE8}tE܉1 )1[^_]USMU Zyu t tR9Qr[]UWVSHXH X$1ۉX p0uu]9]E}u1ɉMUtj}t}tуtat\@ uуt=t8v1]9]t UrH X$9} 1҉P P$ )H X$EE}u}0]Q[^_]ú=tUwB=tGwH w8RXs.'-v=uUWVSUM119}uP0uQjVRjGуtux`ڃuV]0]}tT1ɉ]Ut4u9}u*uu}7SjQWuPEЃuGAuFA1e[^_]UU 1tEMh]UEUU!U ]USMEX؃< uʄt E0‰[]UE1҉U˓U ]U EEEEEEEP6U EjUWVSÉЉʋuˀ{u,C { K?H} K.C { K?H} K KI1ۋ}_ik?19Ή[^_]UWVS u]}1u܉]EP U Zu tXH%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EMȍEPEPEPUE_E @/EЙ]u)։]u]uEEMԍEPEPEPUE @Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋEԉMϋUeƉωؙMʋEE)׋EU t2 t,EPWVuuc2EE}u u}tE}}4E؋EؙRPuu :EU4DH~1ERPWV9uuRP9EE]ÉUӉыUe9E1MȍEPEPEPEi @tKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9[YeY[^_]aUE]ÍL$qUWVSQ1A1҉U1҉EUF0E؉E1Ɋ t,}uÃt$<t ,}u9]t@u0Eu1M]ƒ< RWvWڋEy11AtE1ҍeY[^_]aUWVS,M$](u,}01EEEEEE1U9ЋU| E1E܋EE19M}M9Eyu1EEU ẺUЋEH9M}GE;E]UE0juQu@M]E@E1;EE }Vű}΃Mu uWV:5);uE M}uu)9s ])] 1҉U111*1҉19]]܃}MM 1yAQ Eù19Ee[^_]UVSEP$9p |$1jjjjSQSQjURP),1҉Ѝe[^]UVS]U M1k N( u4؄tfEB 19EtJ @u,1u.R E@M,9du 1dd[^]UEUUUUUUEUUURŤU UEUUE1҉UP0UURAU }UEUUEUUP0UURU LUE1]UVS]MU2U k V(u؄t=&ukE U1uQЃ<![^]UEUUE1҉UUURyU UWVSÉ΃8t2$41jVRA $Rh{dЀ3^ujhPjRE@ue[^_]UEP0RPfUWVS]E EC0E1xp@u4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@t 逌}WuS yуtu G{0Ea;hhZYohS*ZYa }U׍e[^_]UWVSEX01҉U1Eߊt]t}ttR<tNwtw A,<vxP6W/=u7sE@,9uQVP37 &=t1skE P3 e[^_]UVSuE =D4uhD4X>y D4CFU,U9u D4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU PQ 1]UVSUEu Nt+t6uXE@VvpSQFD.4t(vtvPSٚ e[^]USR] =L4u0j EPu ƒ =w uE8tt hCX1kD44u]U U1vEEUEP~U E_ZÅt*UVS14OFZuS OXe[^]UWVSQu>xp19|h%hDF'hxh%[]9|@89@|ue[^_]UWVS0uU=4]ډ@E =~Mȉ\1ɉ`}ډ1@8;FF| FP1RP|~ tlURjVPL tYEċUȉḾ1ۅuBu>dž9|Ӄ!!ut9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E }uthȔ%h4F'hh%hhjlH^_F'u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP,'@ǃEPu^_t!ẺEЉEԉEȉC1҉؍e[^_]US]=L4u]1Ҹ;L4s)=w9t kD@4B1=w kD4[]Ã= 5u ^, 5UWVSƉ $41󫋅 EU RPVh%h4P5 E jhPjV7xShydP g @u V/.X1V$.jSu蹕 e[^_]UWVSlu] E EE$EEPSV EPډXE8t%E8hՕ%hE'h h%À1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}u }t#1A}tPh%%uPuk "}tPh%PhQr%uu3 ؍e[^_]UWVSHÉ1jhPjS5J1Dž11҉1ɉډ1ۉ؉!!ׁuO1 RPh/=fU?XqWVS{/9u)9u!V!ʍ4󥉅SGX99;ƒ<<„t <uh0101ff=Uuf=u#(,D1ɉKu1󫋽{w%RXuX tHtt7tqiEt,EPFPVC,1RP4P P~ 돋t6t%C,dDž $t tx9,sbthjo@^Zt31ۉ Dž1ɉ1҉Jx 'Xu&1󫋅fǀUe[^_]US0E }uthȔ%h F'hh%zhj?XZE u CEUY~11ɉKKCSǃ?ǃjh>RPj@ECǃ1҉oK0SUE Z@u SWCX1d3{ uUC$9K }DURjSPL t1Mt*419t @D=u=u S뙉؋]UWVSUMtQ0t),0Ut,]))111҉XZ[^_]UWVS}UM] A<t <t11É1uvB? ڈ49'fDžU1 WV)Ӊ1!!ډuAWVhP$x30 14^uPv$ƙ9uK9uCH!؍S#ƃS~<Y9k9_'X؍e[^_]UWVS]Euh,%h F'h .1uEE}lj1Ʌuh%h F'hh%xrs{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{419tBDu3{u}s{ u}u}u}v}t 4M1;})ωxMH PC u h"kE UP XZ܍e[^_]UWVSE }Ĺ HUMx}}t}1҉H41ۅuh@%hE'hh% q9tCDuu}EW%}}1uuuuE1} u}w2t tu'}\JM1ɉMr1u}}}E}u}0}}u}t7}u }|ڀtu(}E}u }E}9}}u1UMUMUM}9}}u P @|UEUEUE9E}}}pEbE`Mt:EUu9֋}|}9֋}}ً0‰EU,Ɖt1xtx}9ЋU99uE|{}EE,EujSUr }4u9P7u 4XZm1hjN3E_Z EfǀUƀEEl1ɉpplxt!}9}u|H1+EUẺUЋ,E,EEujuUs }t'4}9ttP6u 4XZE0qEHEUȃƉplRP)׉E9Ɖ}ME,uȋU)Ћu}ƃu}|U9E}}EU+EUẺUЋEEEUEĉUȍEujuUx }t'4u9ttP5u 4^_E9uh0u_E,9EE}KhjC1ZYuEb4}uu,fǀUƀ0Ë0}00UMыE`M]}v*}}u }t}iuM9ʹu}UUpx u}EEMEjR}wR‹E@vM1ҋu9Ћ}_EEE1}$tuVME]1uCu}ƃuuWVb )׉u}9]EM} EUEUE1ҋM]M]9ȉ} +EUẺUЋE\EUEĉUȋE}EuuW< }t2EED4u9ttP3u }D4ZYEu0h7jjP2,1}?t;_u}E@Eu1EE1}EE1Vt_}9ti@уtuH}0t;1Ɋ_]ttt}t9}t#@AuՋ0U9u1e[^_]UWVSP]E EuEE}t:C,u)C0E1҉UĉUȉỦUЍMċUPX{,4}u1( 1}jjjj1RP1ҋ};}ERPjEPS,tE5EUEĉUȋEUẺUjuVSUEaUċMȋű}Ѓ uEYUċMȋű}Ѐ}u.h6'sWVQRUMs(7'C,UMtX(C,u 9}8SjWVQRs,7'C,tPC,e[^_]UWVS}Ĺ uE0xE0EEH419t@D=u€t E1ɉM1Mtكtu‹]9] uEE@uȃwE9t}h=E]1ECƃuuWV )9މ}u}1E1҉EtqE9E E˃tuSE`tF1EM t}tȃ<ttE9E tw̋E0h#jP]S0 jPSSj S8 ƍ@[=wʡ4EHDEU}~ E1ɉMRWuuSVRP މؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]4480hX{%h}WuVEPS$xuuuhX{%hWVEPS>tuuuSЃS\e[^_]Ujj 'aj j P USgbP%S$#PShӗ%h:.K j U=(".u u (".(55fPftPmZ9(".UWVEE왉U1E}ujEPjv e^_]U0E E1EԉE؉E܉EEEPEPuaƒ xEÍL$qUWVSQ@@u5jhD55返 855D5555 55055455XZjP舔 55 555555+855<55_X@559}9055455s7855󥋅0554551=$55uhkjjE.t!jjjP =$55uihA#PY 55Y[tPh&$hP x555519߭yP=&ݝ݅ <=&߭ٽf f٭۝٭y1d~dVh$)P=P6 Nj 55~-55t POZ)Å~:ùdh#)ShH'Ph$)P=P ǃ119ʉst  @~4I'SQh$)P=Pr +D55H55+ L55y @BL=&ڽ߭ 555519ظw ȉ߭l=&s9ٽf f٭߽٭=ٽf f٭߽٭1 9ljst ȉݝ4I'%Ƹd PSQh$)PP á555519‹5555)ލ 19‹݅99}h $VQ à +55 55߭߭ٽf f٭۝٭?~~h$rtPh(#VQR Ãh<%VQ? à <ЙRPh$)PP Ãuh?#)PP à (55fPftSVP$ eY[^_]aUS[j[X]UWVSPu ]Ett v9s[71;uuߋuE9s$;ut:GFFPhħ%jW- ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=B.DWtDOt uxu[1!tjjEPpx  FCE덉뉉؍e[^_]UWVSujuYZYt&Vu PW9uZ7؍e[^_]UVSu hu à @tuuSvS؍e[^]U|EPu~ ZYtM EUQ1UWVSEE 0Vj S( DžuVjSr( ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v UD&0Ep V<Yw{t)1 E@ȉC,ub Ex txj(Zu h4L'3XYǃ,f@S(P1.1;,s$k(рyus1(D@1u e[^_]UWVSSƉM׋ttZ9t<{ t6 1ɅuufujuP t[뷃 S Vh%2 e[^_]UVSËHt2L~tHHHZR1ɉL^Pt2T~tPHPZR1ɉT^`t2d~t`H`ZRj1dXt/tVfG,X11҉Yt/tV-G,X 1Xt/tVF,X 1Xht/ltVF,lYh 1hZe[^]UVSNjjjVnD@PjV%l8@t@4%1҅ut 4%1҅ut 8t48SVlXZe[^]US]E ftPhDK'h%0 jP t(@t =IhDK'/YE u1҉U E](ShjP#@uE DK'E%]i/]US]E ftPh0K'h%W/ j|P t@yHv|y cH7`xv | xYZt>1҉Sh%j"@u;E 0K'E%].h0K'.XE E]d']UVSĀptQPhhxVԟ@u hL'8.XV Sh%- e[^]USË4%1҅uau]h%SXZ{PtS 1Ytk%1҅utSLt %Ju#PSXZ]UWVSÉ׸r#u2$%+1u%PSzS_jSZCt PSXZe[^_]UWVSÉ֋8 Ph3%,1ɺhXZu+%VSSjjN%1ɉK 4%1҃uuj%XZe[^_]UWVSUM8ttY@@0tM~ tBEU  1ۅut1҉FXZ[^_]USËltu;RSlZYt&hvRpPaPhJ%+]Ãx tpUSË%1҅u:u6S]% Y u=uSnZ S.YuS\X]US]SϘYuj$XZIpQpcvPhR%+j#Shjdj#]UVS]E ftPhK'h%* |)RxPS uhK'*X;|t xD8t|xh:.&H 1tf :.yh:.j S Y^:.P:. Shj @uDE K'E%e[^])jXZu Ee[^]y"e[^]UVSjhg%qZYuhg%h4#-)[^"VP.XZY@u Vhh%)ZYSXe[^]UWVSMy t %1 EU}u%1҅ut6`u,QM3Y}Mtu1ۉ1@EU}u#%1҅uZ`LQ.X}t u 8 ى%1҅u1` 1e[^_]UWVSM48%`uu %t%ti utSYt %@utS6-Zt %`ut[1҅u%u! u@uM1ɉȍe[^_]US]'%P'jjUjjU4]UWVSQ]4Ɓ@1utg%@1҅u\uXt0t(VwZ%t4J' Vhp%&NvSq_%t4J'ht%%[^8th%&j( Shgj4Ɓ1uguc%@1҅utTS,1ɉMjEP,H@u hdL'%Z,ǃ,Xe[^_]UVSuh##%48ӁYt:tt{ u h+%SkYX[j+XZe[^] @48ue[^]-UWVSD]u Ctt,PCQPhj@EPt@uhLL'$E_E{ VEPW3bƒuVWh%:$ st#Ej@VCxPL VWh%?$UCxU3`UXYu"D@RWP_׍e[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3=_UM  {Mut';xu;0tQhϚ%n#11҉Y^{ tFEU   t3"Z@uhK'3#Xe[^_]UWV։ϋD@WVXZe^_]UWVSu%1҅ut V%ZuF Ph%z"Y[Ӂ u% 1҅VGEj EPju^ ]PSh%"M1҉-1;,sYk(jQMu| Mt5j EPjQPMAPuh%! MQC럋 V4Z@uF Ph3%![X ~ u#V3%1YutVdX~ tV#[ӁtK~ uEӁEuEuEuV蝢ZY@uF PhB% !Y[t ~ uV<Ztue[^_]We[^_]UWVS(]} uS#ES|Ẻ{Ls$S# { }u }s uJS0Yt?VhR% S SdSj3poE m%]e[^_]@Vh%h %S*11҉fs$t jjSa" S.#Z@u,98t hL'X1}E A]e[^_]"}{ tC uPh%Ph%(Y^{PtRStCQEЍ}ԉƉщUS&CtZU9uPEPu葥 t{ t11҉s{ t411ɉh#SSFS8]e[^_]e[^_]US]C Pt$ZYts$sLP ]] UWVS];1{Ly)tC$tjjS 14%1҅ututEC$u?tSp!Y@u hK'ZjjAS @u hK'X]e[^_]US]][].UWVS׉΋;M EU K 9}!E4UQMK(YZMUtBu }{ t~EUhƛ%SYjjMtuuSD tSޟZSOSX+9t'C jjMS [e[^_]UWVSP] 48%@1҅utjZE1t6HjEP, @hK'h%!_tm@hW%h %h%@t+XRDLtzhқ%hۛ%h%I Ehқ%h%h%& 1Eh%h%h% 1u1h%h%h%t C[h$%h2%h%<@uuh:%Yhjjj^ TPhB%EP55u>P554%1҅uu u_P55XZe[^_]USS]E uPhXK'h%R jEP, uhXK'jYuZ8t$hXK'hw%j,,ǃ, _w$jPhXK'h%ju6M8tu h%YuESQXZ]US]E U{ u)C щ‰{ t][]t[]UWVS ]]} utSEtXZu 82w{ tC Ph̜%K%p^_CStP }tQSS[1pEPjEPu] EuhK'WYASuMXZu1~ WEt YXt3{ tC Ph%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh%$11ɉddY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu^ ؍e[^_]UWVS]DžPPhhs @uhK'h%1XZh%%Y^1hP?F1׃ u Vhg%AXZu/87t/8 tt Vhg%^_\XPSǃuhK'[ttlHp VWZYu VjS ϋFVt=PVF PtZYt%Vh0jj 7u7W1FtPV2VP~ t11ɉ#Vh#WtSPtSttPSP e[^_]US]E ftPhhK'h% S虡Z@uD%.87u ]].8 t.8Vt-8tEhK']]UWVSD]} uMMtFMPVZYt3Mv/-7S UE K'EfE#e[^_]EC(f9t { tQPC Ph|%f{(K>:Mu#M}tyEPVC*P0 Mt_{ tEj<}WQC*P9K PQMh%Yjt S*ȉe[^_]UWVS0EEE EȋEEԋEEЋh%S_ZuEE %+h%SY^u,Eȋ@0SZ@E] EȉEe[^_]uh%S^_E܅h%SzY[u EȃHg1E9}E4OZ\FSX}1ҋE9}?EЋ UQMƉ$MQu9 K)Eƍ@E UB 뺋E@Wh %W1p3.E 1E111E܉EEPhO'h5%uuttktA(NtR4tU6uE뾃UuM@밃ptxtn 뙃M듁M늁M끾wEkp3.E%@1҅uE䁈4@EԉE1}11uE䋀t0tR~ tGߍV }9}~E4RUZYGUu9]uuVj-v EvjEPEp 1 uoE䋀t0tL~ t-ߍV E4RU>ZYGUt}9}9]tvuVuu @uE䁠41E䁠4E@t{)E܋Uu9]u)}u#U܋MEtNf}fC(ffGfJuj? ȋuFZK>s*S>+Ee[^_]UWVSu} lh%hPV@à t1=whlh%hh% <&8th%h&$_ XZh}h[u hL'> huPY1l>uZG Ph% tXZt{>u[C Ph4% _Xhh[% YhuPWhQhnRPhnR: =nwHƄn ƄoPRhh%V舆@u-hL'h%, XZhtjWhà ppe[^_]áT55tUT55PT55UX55]UE@]UWVS]u }uh%h\M'hG}t}uh٦%h\M'hHh%tu $:t 9ptUC tHtJKHjYYu<tBCXCpf@up MH1҉PfxCM1e[^_]UEM uh%hHM'hh%u $t 9Jt#BH@MUWVSM Ep}y1yy9s)}_+Yyutʚ;1Ƀ}t}[^_]UWVS$Ǎ]Sj+x EPGPSfEUЋG uʚ;)U܃tHPU1ɉM؋]9ڋ]]s 1҉P1 ])ډPX )9s tJPMىH 봃ue[^_]UWVSU} uh%h4M'huh%h4M'hh%<}ʚ;vh%h4M'h܉É΋P t9zuM9Ju JuK$݋S(tJtHK,JjYtcUUrEB zEBEBC t&H9r 9ux 9}sHJP1C$BS$1e[^_]UWVS]U Eu}xx xʚ;vy![^_]É}u M[^_]USEU M]]]] 1ۉ][]nUVS]u E1MMMM i@BU[^]4UWVSUuuh%hM'h|h%B 1ۅtI} t} 9xu5}9xu-t9pu$xtyz$x18z,xB,C볉؍e[^_]UEuh%hM'hh% U PH@LUEuh%hM'hh%@L11UEuh%hL'hh%U P0UP4UP8UP<1UWVS(]}1EE@uh%hL'hYh%L1҉ỦUЉUԉU1;s4s,C0 I>v m DFu EPj @u11EEEE1;s4sjEPC04 @tF1e[^_]USjPj[ZtÍ@Pjs ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tP>E t9VuFt9t,NtJKNt PKXV^Xs@Q1s@sDCMYC t6HtJKHP!ڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]UWVS ]uCh%hL'hh%T55t,T55HT55X55C8tsƍ@wFtq;CLGtJfPft9Ѓttt tft PwW XZN`?8NzCHe[^_]USuuh:. F h:.j ʲ @ttC؋]UWVS }] u=d&.tG VShP^ ts PS5d&. ^`&.1s0~x~ @tVSh:.h`".*1a&.tVSWK e[^_]UEPu u# UVS=uu hV SPVhfE#u$e[^]UEPu u UE Puj UE Puj UE Puj] UE Puje UE Puj1 UE Puj9 UE Puj UE Puj ád&.UEd&.@t]]UShPu\ tÃ~ t,h&.Ph&$N1h&. ؋]á`&.UU`&.@uPJXa&.u9USM hjh`".h:.Q`&.ۃ  sjSP }t V]US]tBS&SSS ,jSlSL3:$]]]US]S~Z@u:jhj蠋  @tjhj膋  @؋]US]t$P覽ǃ tP舽ǃX]]~~UEE], UWVSu] E`d$1jF PdW$ Whi t>t Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t&zLu1t]UWVS\u~>u Vv7EEEE1]Mu^ EMQUE UJHOuԊEEjPS蝹PF Ph %F>PSVD}(u V*N>׉e[^_]USEtS,jSV[ ]UE t E] ]USEtSSG[XZ]UVSEu Ʋ9t t !ʉ11@u1[^]UWVS}] ?jWS" s jWV|" wmj:Vl ZYDžt?EPjhjjj jGP C8 }tUC8jVCP" B. DJu <:tFu}Wjhjjj EPV_ C0E t/it.u#Wjhjjj j@P, C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP{ZYt[u{1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjjURWPVsu ju(C*WtE84%@1 u/t%SrZ@uhɧ%SO qSnC@SCvfCDCCHSu @t CPCHC pSuCL1s@CX_Xƅ2e[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[ ؃4[^_]~ UWVSƋ tC1ۅu)u%O Ƅ  1ۅut1ۅutӃuӃ u %1ۅuu[^_]UWVSljQ.} ZuhO'RÉEh%#EP\ ZYtfP| XuhO'S[_LUj@PV? UuhO'SsURj q7SQXe[^_]UWVSljӅt΀9u113j/Q ZY…tH@EEPjj jjj juv }t uhէ%-t SPZYuUUWV˷ ZYUuVh%0ZYtB/1t7!Xe[^_]UWVSÉUQ YE>"ux"MFGVj趬XZt7t9}s7VS耬ZY1}u>t tCEM9tHM9MsuN\?~Vnt>0bt!# tt:xtBrt#   C  E B.MNMߋUDJt!U߈U~MDyu~~U}EjjEPG$  tE1ҊM΃0wGMLBu}t?jjEP$ t.S=~ttCEE}u$@t9E,1}XFe[^_]Åu À t t @ u1Ått u@ t1UVSQÉ֍EPjjjjjjR }uȉjDZ~~1CtCHuCЍe[^]UWVSE։M؋ERx EYuhO'j=uK _ZEu VhO'h%u1?E}uJ [E܋EE1CEE8j=W ZY)9EuuuWM uʃ}t'Vx ^tOWE[uXuFW É4$ EBU$W.ZYUMuhO'u[} DED1u3Vqw _XjCPu>: uhO'yVY[41҉TMe[^_]UWVS]s {X1;s s WF,Xs1s s{$X1;s(s WF,Ys$1C(C$Ze[^_]UWVS,ljU؋E1=b$$M'E*@1$} $t uh%$;@".tPXjM 11rXu 1#u1ۉhO'6Y#VQZtjM !^@t;thg%S ZYw#So1ۉ^c#@PYO#} 1# U -#} u#jM ZuhO'hE%t.u hR%u%" "} t% jM _u ho%1 a"} C"H"<;"u pt <P[^""} !h#u / ZYudž!EPjjjjjju  }!u h}%!} !EPjhjjjju  F }v!u h%]!} K!8M!jh%u u/E܋HL@ư`ijh%u p u/E܋PTư$E܋@DFNPpMju PWSuRUSu=ju MQWSu܋URSuju VWSu܋URSD u hè%+ }  8 jh%u u2E܋HL E؍`ojh%u ; u2E܋PTE؍'E܋@DNF0E؍FpMju PWSuRU~Rju MQWSu܋UR\Rju uWSu M 1'1} tjE 8tbj/P Y[Džt@j/P _ZDžtM @t/O1!t1ۉ/ } EPjjjjjju  }u h֨% )jM EYu h%  T } luh%} Uj,u V _ZDžtxu u h %89E u=E H j[u h|P#Q 1ۅut%Ɔ EPjhjjjju : , }t h:%ZO )ǍEPQM芪 ZYHMu-> 7: U艔) jY  T } E <4t E x4u  E 86tx6u @E @E 묃} zEPjjjjjju  }cu hn%} 8=LHM *L} j,u _Zt u  P $Uj[Uu h%RP; 1ɉW藼}}} u Ƈhkhj%u ZYu ƇhLh%u v [^u Ƈh-h8$u W ZYu Ƈhu jy[^Pl裸ZYuhO'iXlu P>p^_} u Ɔ 1hx"#u Y[u Ɔ |h^&u _Zu Ɔ  ]h%u Y[th%u t _Zu Ɔ +u h%} t% jM n[u h%1   ~o} Q8Sjh%u u/E܋HL ư@ijh%u v u/E܋PTư$E܋@DFN0PMju PWSuRUJ?ju MQWSu܋URJj} <8>jh%u u8E؋HE܋L @ư`xjh%u X u8E؋PE܋Tư*E؋@E܋DNF0^PpMju PWuuRUIju MQWuu؋URlIju SWuu؋URKIju VWuu؋U} j=u ݸ ZYu hɩ% @Ej h%u 5 ud}u11҃uM6Sj h%u u}u<1ۉ$jh%u u0}u 1ɉM1jh$%u F tFjh%u 0 t0jh%u  tjh%u  }u(jP%U XZTEÅu h,% @E؋M܍UE@u WM1ҍE@t WY#X3EPRU1EPU܍BP1EPU܍B8P1WURP)%$1ɋU jhF%u }u(jP$U ^_MM1ҍE@yW"[h1ɉMEPRU!1EPU܍BP1EPU܍B8P1WURPY$$1ɋU 9jhO%u - tjhY%u  uB}EPjjjjDjju薺 }duh^%Kj hm%u }uߋE j/u _ZDžtGSuj HuNt>EPjhjjjjW }u Guhz%ƆtGuh%!11Ƀ}U jUEM j/u A ZYuEjPO& PJM JM UEM j/u 轳 [_uEj P%  J M J M b} DITPM 6T*߃  % Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ2Ɓ&E DžtGEM 1?j@P $  JM E } u} 8jh%u uHLHjh%u uPT@Dju ƐVWQRP7A 8u h% }  $ɯu ` $ZY hO'm}  4%1҅utu h %9FU m@u u h٪%N K < - ! @   uh%F EEӋ4%1҅utu} t h%\ڀE Lt @Z} t6j/u Y [_DžtGEU N@uu h2%/ 1,E؊EE19MtIk(P} u*t,]f9Xu#U8uU8PuU8Pu U8P AjE@P(  (,P,k4EfF} FEt'EEFEFEFF}t uF1~FH j/W7 ZYÅtCuWjH HtWh%1~_X f~ EPjjxjjjjSF } Shz%QF[^  }    @EԍD1HEԍL PEԍTXEԍ\E؋E1҉E1ɉ} u^ }t EX]ԃ E؃}  hC%}  EX$]ԍX(]؅uhi%}tlE ƅu u h% EPjjjjjju 譱 }t u h%j FVE tMh%1E̋E ƅtFj:u . [_t8URjhjjjj@P3EЃ 1ɉM܃}t)h%j=u [_E1҉UЅt@Ehݿ$u ZYu'E uhҫ%qp3hQ%u [_1ulE Itčph%u 诮ZYu. 5E uh%qphN$u nY[u&E uh %뽍ph$"u 5[Zu&E uh"%넍ph%u ZYu πsh %u ޭY[u @Uh#u [Zu Qh:%u 袭ZYu hO!#u 脭Y[t1h%u q[Zu hӴ%u SZYuhڴ%u 8Y[uh%u [Zuh%u ZYu|h%u Y[u ah%u ̬[Zu@Fh:#u 豬ZYu (h-%u 蓬Y[u $h&%u u[Zu hA %u WZYu @h%u 9Y[u @h2%u [Zu h̴%u ZYuwhc%u Y[u\h?%u ǫ[Zu[hH%u 謫ZYu@hE#u 葫Y[ t u h8%}tu hI%uXZ1E s!t@uhf%NXs"}uh%1[uu h%urBsthQ$SZYtSV Xu 1E؋Eȋ]ԋ }t&1ҋE9tE9S{IB,j,E@PQT uhO'V]ԉ]؋J k,1CC C$C(Ẻ{EЉCs }t"u _S׋u܉)1S׋E}t5E-}t }pEfE\} >h% `<"- } u 聀^udu h׬%@d} E aDžt @khx%u Y[M܉]t&hr%u [Zthe%u s ZYu E܋U  E܋U%h(%u < Y[uGu h%Åt @Í0PWj Ht h%|h/&S _Zth.%S ZY@yj[B 3}  jM _u h8%> @} EPjjjjjju Ҩ }u h?%} tyEPjjjjjju 蔨 }tfu hX%P} tBEPjjjjjju ] }t/u hr%WPT[uh%ZY@1 S Xe[^_]UWVSEu} EEEE1ۉE싀O'tM܉UVP ZYUMtCnuFE샸O'uu u E##EEEEE} O'EEe[^_]E8uu Eè%e[^_]e[^_]UWVS }]u1p3.} t[%`EU%Vb e[^_]US]uhϱ%hW'hdhm%P c]TUWVSuuhϱ%hW'huhm% ƘjjV(à t PVY^hZu hW'赵X $1؍e[^_]UEU uh&hW'huha%hW'hhm%~ PTUVVuuha%hV'hhm%T 6YtVPEXZEuUEuh&hV'hhm% PTu EnPPXZUWVSE] uhϱ%h$W'h<9uh]%h$W'h>hm% jjSǃ t:jWSƃ }tG9Et G99EuWSW* e[^_]US]t"jjSb tu S@T06 ]US] UHSuZY9tS+ X1ۉ؋]UE PTuhr%hV'hhm% 2PuUWVSSljӉMBTx t41҅utSWYXu'S$ZtCP^1t<CT9FTuwFt ;CtulSVZYu_FttCttC8PF8PZYt>CPFPZYu+֋CT@$uFx9Cxu񺎱%%}u.&ٸt[Ftr0tCtt&SjK6XYBuc 8t h%>XVj%6ZY@u 8t h%XSj6ZY@th 8th%X1tEVWV Ee[^_]UWVSP}tDjjSƃ t)jVSE 9~TuVSXVo uӍe[^_]UVS E uh&hV'hPTuhr%hV'hhm%S 2uhñ%hV'h߃}uFƈPV|XZt1SVuh۱%j uVx ى1Se[^]UWVS8uhXW']ShxW'EPhxW'}Wu WV8$thV'h%w_X14SV萞ZYujEPjEPe[^_]SVRZYt1xjjS`à jSEPGECT x t8jSYtC8PsT!<_Z@u h%豯YS;U t2C9t ;E !SEP_Z CTESPNjC|ZYtwG|tEuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWuW g /1z'1zuz uzu 1z1U幀U E]UWVSu] }uhy%hW'h{uhY%hW'h|h.%莽 Fu#<u;FuFPh$WSaq @u612WSPFDPgÃVWSPFP Ã؍e[^_]UWVS}] uha%hW'huhm%hW'hh.% GS8t)R78s<t<t1&vvRS Q/ e[^_]UWVS(uuh#%hW'hFE<t<FVU1QF1 G!)JO9tx9 dB@t8tM9r1=8}1ɿ}tAut]@}9s8 /`1ۀ=x55uU}ع1E׈Ex55S}W<WV-thy%hW'h'h.%, x551ۉ؍e[^_]UVS]C<t<tF /g S'؉U Y=x55t15x55S>Z;E th%hW'hnh.%薺 x55Ǎe[^]UEU uh#%hW'huh&hW'hh.%K fPUWVEu uh#%hW'huh&hW'hh.% fe^_]USX'tPh%o XZ]UWVSD1}]Sc[Z@j0S\1uuuu}WS\1;5L's/L'H>v 諿  DF1;5xL's/|L'H>v r  DFWS/\K 1҉u uSjE0EP_ƃ S&[YEt  0e[^_]UVSuEPu V uVjbV ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh%h|X'hC؀xth%h|X'hhͲ% u1W9s*jCPU` tًUGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`P]XZ `S`U X4%@1҅ut _t^Fh#Yu%Ph.%S @!1 Ph6%S @uWhB%S @ydhlh=%W YZu@ltDžplxDjVYZuGDžphL%Wĭ YZW贫 Z|6hT%W蝭 ZYuDžph%W} ZYh#Wh ZYh %WS ZYhm%W> ZYyh"W) ZYdh%W ZYOh+%W ZYpDžp Džp_t@F Pha%SU @pX'tPhn%S. @7@t pOdTX+%u#Qhz%S @hVLO&t E$Ju%Ph%S @9vHh%S @!FPPh%Sr @v$h%SZ @V舨Ph%S>@~Pt?vtFQPhhtRE@ttRhƳ%S @~xuF4%@1҅ 1hXW'tPtXY#FxPhг%S @u(z u RuARPXQTtP@ZYT9Pth۳%Sk ZY@jjtPƒ ttqTjjP T9u-BTT Ph&$Syk @T`jR뛉Th>%h&$SNk @Tu4jPSjP @h+%Wک ZYu>dTX1҅u+%#h=%W苩 ZYh%Wv ZYh#Wa ZYh"WL ZYh %W7 ZYthm%W& Y_twpuhehxOpu VZ;pul/lxDpjV}Y_#+%#Ph%S @Wh%S @VvtZ%u6u_%u*Ph%S @umt:u%u @t>(W&tY%uPh%S @u'h%S}_Z@pu^hh@hq PVh%ST@d%O@ugpll@LlqPPVh%SY#@\puPhtfh@tYhqPVhK%SS@dK%pu,VhK%S蚭 @1d u{puDt׃8tVYtËlpHpDVhK%S}"럃ptpuVS_ZPh&$S @tXd 0uSC StY^u hpX'/Z#_tFP`P u,hpX'X_Džp.؍e[^_]UVSË2\tPSKd e[^]UWVSQ} utu@GL %t #Ht"}tE1@ۅt 1ۃu4t&xt HHt}tEP@uCWZt!CE}tL%EE@t]jWb[^t WYuu"Ep}tT%Eƃuًt 8u1W Zt^}t8EÃuˉ؍e[^_]UVS]u tPހ~t9蓲 :jh0%S uSh Sġ \ZY9rh:. X1e[^]UWVSEE} u |UGƃuh\X'蝘Y[jh5%W茢 uu Ee[^_]E1҉UWPE Ph:%ԗEPƃuuhPX'hfE# jEPVd @u S 8thPX'hs#ܗ1ɉM^_Euƒut%[ ^Ct hG%[ YCt hܿ$[ ZCt hP%[ X nE:.e[^]5z UVSM] X\19t 9t&B,hl19t 9tB,1[^]UWVSu} S2Z@uh%h%h[%WVY `PPSh%h%ha%WVY u.P9r)ǍGPCP$ZYtۍP9r:)e[^_]UWVS EP EE[tF  >SPȜ ZY} -];уM I+ѻ}h%#EP2 ZY;tjh%S胛 ujh%Sl uu1;}1u1;} uJum螪 [EPjjjjjjSs }tG,9uSv 跛 ZYEPjjjjjjSs }u9G,nFu2m d!umX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9 1E؉EErE,@x VuQ9uuި "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms n 7뎉ߋM_.MIE)M܋E9,}v0 M}}t ;]tC }uUUt;]tC } t}E[^_]UWVSu EEE}1ۋE9EeEEHes2Y'Y'Gesy4EuyB.DBtes B.DB@t) E\t-x)B.DBte/t Mצ M\u/t#w軦 7f\\t0v\0G0G0OttNGCt*tesUEu EZY[^_]UWVSÉ׉U7(ƍPS踔YZ@Wh&$SeX @}uSj=3= _Z@u$p hG#S/X @u@ s=Vu hV wXPj sVu Sn> Y s Vu Ss=ҁ u V( t.Vu PhV@Vh&$SshT=$SZYsC1D0t<0u FuM  )sSP; Y_@u|u } 9K;} u@tPh&Sj ; ^Z@u3tPh#SV @G루tffPh&t&ffPh#SZV @c t Ph&@tPh#S$V t%7Ph&$SV @sWj.VWjt tcVh&$SU @tQ?tGuUWVC*P. U[҃VSo_Zu VSo[^tRXZR軏YtPtˉrVSA_Zu VS貎ZYtX跛 /1 訛 ؍e[^_]UWVS,E̋A tӉ΀ytup x1}ԍVx}W}ԉ}Z@$1FCt}ЉF tCUfCF t&EȀxu xtK|@Ft C8UF t CXUF0CxFftPEt虈_ZF tU tUȋECTt14~t z h@p%EtCTZYuՃe[^_]UWVS8XCtP>YS_[1ZtEe[^]B[e[^]UWVSUu ]8Z>t F1Dž@jB UPP٥fDž ˉhPhiUpv UJ>r*hPhipv ,؍e[^_]UVS1ƅ@ CtDžC8P.^CP~ƋƒYu9Zu)CT@fCXP_u tt uC| t Cxt(1ɉ,uCTƅƅfDž1󫋅@p׉މ;tHH t2fDž f󥃅 ZupV耆XZtHHt'CstHHt0fDž f󥃅  t'CXsXtHH)fPR6 @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP4Y@OHuWTY1CPW+QXZ$jjVSjLPX@u# 8 넋H؉@D@9DDx9@sڐ DD9@r׉F u]dEuGuXu hb'wX?$RuhnPmpPC(PSZ뼋F1,1t zuB01$t$uG4h1 jSV蔖fDžx,|Vhi@(g @u6> 8t4 81thb'h%nY^<< 4R0R,RSjP(e$4󥍽hr󥃽$t$j4PSƃ u6x 8tn 81thb'hŶ%mXZ31 "4u5uSU ^_u1C YuCtP *ZSFX1ۉ؍e[^_]UWVS(]c{u'ss s(@ S1sSC ЉEԍENjuEEEE؋E܋uЃ9CrHuԋEƋM9MsMM̉MV3ZY{MԅUЉu}ԋEԉC} E܋}؍D8CC;Cr 1CCK%Ѝe[^_]UEEE EEPhgBua UWVS`fy(u}d'󥾀c'Xҍ4uV@c'DžLDžPDžPhBSa ;ȁ .Xc'DžLDžPjRS e[^_]UVS ]E fy(u/UEfEq*ufI.fMffEк11҉EUEEEEjEPs%e[^]US]s's %DXZ]]DUE@u(1ҋEp@th~B Ep ` ZY@UWVSM}]utDw 菀 .E C[UU +29s_ "1.1U 1ۉ19t9u} A,[^_]UWVSSÉ1҅tލ<}})v ~tCf…t‰Z[^_]UWVSEӁcSct V1E E1}}1EEEtHe{l}܍}u܋U9NQUt9Mu& Ee{,}܍{l믍~}~MNM9Mr}ʀ}t}4u NɀMU;Uf}}tcuU9s;1t)ЉuRT>ZY}艇} u E苀MNjuu؉uUU} t] u3tMNjuE苀E}u } Ee[^_]USSӉʍMQM QMZYt }u1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]USSӉʍMQM QMZYt}uȉ1҉Ћ]USS\t rXs\1C\ ]USS`t RXs`Y#C` ]US]$S<>XZ]]E@UWVSRË1utOC><vGD&BTtt_9t;t1zT9yTu)1uuUo U밋@븀{>v P Shi%b e[^_]UWVSÉ։h,j:ZYt:PǀcScufǀ,1e[^_]UWVS@ÉRiY@u Ph%aXZ.Gw*hH Ph%a th, Pj9_Xt@dtVWv<u?(9x u1Wt cScuGhu @G @(GH>A<wOw*󤋅% 1҅ut&x utmtdf@ tStJSjrjPSU9Ѻrf‹fP@TȋG,D8ǀcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃf@6Vt4L7Pu"uJƃv9nC,m@1ɉ;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃qf9 ffC tHGY u<)9(CM A 󤋽 \ tC)9C= A󤋽 \wr sb@WuM tB)9iC< A 󤋵 \ttWH4%1҅u/u+@t@Zu)؃fPhPIƃ tjt jVC_ZP)9}QC t  CfCtKSVY^>t/t+Vb Z@)9  CKttdt[%1҅ut)@^u)؃ftC t@)9rhC A 󤋽 \S)‰)=+wD@1,w,)Ѝ4? Phҷ%+X4 hAe[^_]UVS~\jhpPF\ uFq 8u!5l&.h%WY[ Shd'hfE#tW 1Sh@jpK@uhd'h%?WXZ1e[^]UWVSMuh%hd'hh%'j Ӌ}S OuO 0u싐1utXt Ctw qjSPC u3BC C^PP S@BSjuME"ZY@u 3~BCXSjuME^_@u C CS j3uMEZYtC Sj:uME^_t1ɉKSj;uME_Zt1sSj6uMEZYt1Ce[^_]UWVSu/h4j-ËXZ1C`CH%1CPsijhV%1҃utV0s^_ p11 % 1Y t/@P( ^ A %1҅u1utfpFPg( Y?V @ QP lpS@>p@P' Z W(P O>w*󤋅Ɓ1uTuP%1҅ut3 t)hRR@PP Ph3%>@>u1DhRP*PP PhI%RhLd'RXe[^_]UWVS$Ɖ1iu1h]%7RfN:.Xfth$SPGà 1GiPV Rht%Qh$SP6~Ãuk 8t8iW VhfE#,R!w h@d' Vh%R 1d4@1u$u j5SWY^@uƅS%Zu h@d'QX랍lj󤋅e[^_]UWVSS]Sj8_Zt,]t#8tCP%Zulj1e[^_]UWVS$ϋEE Eh%R[ ZYu}WƅPY $$Xۋuhtd'PYuQVhRSV-<@t-PhP% XZuEtd'e[^_]=P1ۍj6j4@uƅx,w #j@,Ph@hW0u蜬WPh#腬WPh#SVh%[N$v#td'%u)1PWVhʸ% N(PWSVh%M ]e[^_][+UWVS] d'tPh# XZE1E;s31;Et k, 9t@v 6h׸% PV|G,1;uts 3h׸% PSVF,܍e[^_]UWVSEvpE E] P1}tEu SPh8%u @tBE^PPh!%u @t E9sT;] us< v!g Juj ZY@u؍CT9Ubf "ujJ ZY@te[^_]UWVSuE ]xKt t4SWhS"@u{Sh&$VO XtKf S7ީPh&$V @tuuVj ZYVj ZY@u@ue 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hHMЋ@E؋E E@_tE@oE'EPjyMЋU؋E X^XtE#,EPhMЋU؋E .Y[E߸%E4u1҉UMUu X1E1tENjM U)уȉEU~@uCtEPS萣EPCP胣EPC8PvSu  EE9w< v d #ЍzD9E7c "E@Tt 1ɉMEPj!MЋU؋E XZt؋]u1E9EFEtu ƔXu EEU9t M;At;A u1EEIʸy,%=t%=t 1tȉE@uGtEPW'EPGPEPG8P Wu趕 ]E@PEPjMЋU؋E Y^E41҉UU9u 譓XEEPW胡EPGPvEPG8PiWu ]뤋EԋE؉U%1҅u7u3E @hu$űE Ph% HEԁ Ee[^_]UWVS$]ƅj4uM^_@uƅExux uExl!WPu h%u7@u1juMqZY@t+W3ƉP蝤Pu h%uڡ@tV)3Pu h*%u贡@yjuMZY@t,E#pV6Pu h<%us@ 3 PPu hQ%uA@ut Ex,u@GhElPhhV4Vu hi%u$@ut 1;j@E,Ph@hVVu hx%u蟠$@uc;s WF,X鋃@1;Ds WF,Xh1;ls WʿF,X鋀13;⋍T9Pu{@D19t ;t_B,RPMUXZtPG Phܹ%@nwjG Ph%@F0 V8u0E1Em p=&}fE fEm}mEЉF8D9r@E1Em p=&}fE fEm}mEЉF8PG Ph%k@ V4F0u0E1Em 8=&}fE fEm}mEЉF4E9V8s@E1Em 8=&}fE fEm}mEЉF4PG PhV%? ^0>u-Vdt&F$;BuFhuPSPG Ph%^?v$̜SPG Ph%p?E苐84EЉU%1҅ut*FH=%h=%W蕦jEY8~HuJFt.Fhu(VJ9Hu~<t>t FH%FH%>u FH%FHº%~0uF8F4eWhWv4jE6Whv8jE6(Whv0jE6v8v4G PhȺ%+>$~@u\EEЉU%1҅uY[^hEtGW4ZueE苐84EUt]h%=jE6 >vHW7juW#*tFdFhӉe[^_]g__e[^_]g_UWVS EEE EEt uujjE5ZEE싀ƃ1ut{%1҅upul ! CiPE0wu@ t@{t:{<t4s$ߙPE Ph%_EHT9%u e'rt E:tQVC Ph?%:1uEPLt @v@}GLihh ES2>ZYEE1}m5`=&EHT9%u e'zt E:tVV$QWC Ph\%=:MElE@eEEE@ht 1ɉMExdtj$PS& tڋE@$Et͋E@4%1҅uu h&SY^Sjj01҉UuX}tSuuj@0e[^_]g_UE]UWVS ]ESjj0Ghu/E$t#tShPj/E1u}}{ u}tEHPWh»%6!9%u%QWh%6 ]e[^_]UVSuF Ph%6s b1C CCL ue[^]UAE]UVS]tVwLShWj.v$xPC Ph(%5 1FL]e[^]낍e[^]UE]=UWVS]{ WhA%5F0+F8PWhe%5ShAjA.1F @tEi@Eu PhR%0EPj-E1pLp d E1x xE܋ƃ1 utEe[^_]Ɓ1EP E}GG @EjEPuUJ cSc}܋]ԉu؉t t@tQDcScXEp$pEE@@[xYE@ cSctP@ E1p p_!E܋EԉU؁E@ uEEe[^_]cScuE܋% 1҅u΅uʋE;E1{L%1҅ut%u 1^uE Ph%-ZYE䋀ƃ1%1҅ut/s$賊PE Ph}%U-EEe[^_]E䃸C cScs$YPE Ph%,E1C<wPh*PBP uhx  XTTu ~P1ҋPX#\ًP9 tW9r7>Ph Phk%s TX#\PˋP9 / 9r̍oj5`hUZY@u ƅoATX\th Ph%(Y[ oX< uBHvW`Vh%W`Vh3% duW`VhO%%uW`Vh_%d1҉PLDžPPPTDpt;jP`h:Y[tW`Vhq%PPuDžPXT@6@t:tj6`h[Z@uW`Vh}%W`Vh%`hKƃ tPh Ph%&V:d8 h4%1҅u.u*h%hdiPh0ڠhhdpPjh;d@Pud@Pi<wPC*PEP4 u%C PF Ph¿%KuMUd[뚍e[^_]UWVS8EE] }uP8Yt99s&}E EE d'E%e[^_]b)WPS" nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉʵfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMЍE eUfҋESftuyPE Ph% (fEfu)T3EPE+Xe[^_]UWVS$}E ^\ftPhd'h% cCubh$RSU u#>t=G Phd'hfE#EW*sPRWt^\ue[^_]UWVSE 0xjPu( uEdd'e[^_]ËOwvwPw Sh!%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhd'h% t @`jVP u hd'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuV4Xt,sss Stttt:uj@苃t$P ǃ tPǃY%1Ze[^]W|$wUWVS }7tu PdYF><vu#%1҅uuF(fu  Ӂt1ۅu uuE0e[^_]g_h{ ÉE1Em5`=&RR$F PhD%VhSjt(e[^_]g_UVS]Shj|t~ht j3.fXZe[^]UWVS E} w]~tuE9{dfG PuF Phh%`VE1҉Pdh$%VV *!GuE@ @;Gu}PPsPF Ph%%1҃ut V[AV%1YuمtӨtW1~E84%u!uG]9C$uSh{dChTE胸,1ۅutEVZ1҅uEpE@]CO W؃~]CX{F$E}uEUҊM]脄tI_E@Ѐ8t HD)у@v - M@X@E}uE@H%j6cEpHVp{e[^_]UU1t )]UWUBv|- 0E 1ɉJI} ډу¸)Ј1_]UE1҅t3Ⱥy(t%=t1҉]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVSdEtE}?Ex 'Eu1E@$ hXW'EPLjju OÃ{E8uǀxhtxduh%he'h*h %R$ hXW'uVuLE@dZYx tWu[Xu1RK|EPdB#B E}WS}iE@d@ EWCPgiC9SV]jjEEPN jjEPNE }E8P\d_uqE0@Z^D$NjuuPZC| SEPq\juEPTNEuEPZY@E@$tvtguvZX1uuVSOhVCPEhE@dEPC8P/hE@dEPCXPh SEP[_Xu[jj}WMà SWNsxC|ZY uC|E@dEPCXPgSu K9tSYS-WX떀{tjSu 1Mà uhSb_tߍC8EPb^ujju Lƃ t9tEuVdZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E1u}}G$tN}u>}Ghu5j}Ghu5jLZt tSpPx]UVSu8jjÉ^Xu hf'UY1[1҉SCC ؍e[^]UVS]Cdƃ CdC`tChPC Ph% uGuAC PhR%zY^KtPd sҀ(t hL%QgXZe[^]US]u:jYt'1҉@ǃǃǃ1҉Ћ]USPE]UURPDRptPQRP>RP*RuM UuU]UWS]U v_ 119t@u1 Gf'[_]UWVSUyv  u1΃y tËAdr@t$tt @$u@hp%DX؋UÅtF PSXFP}WWCPXFd@t Kth}( u} WC8PWY_C9@VCXPWXZ؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PVJXZ?ˍe[^_]UWVSQEp1҃t<t19sAM1ɻ BAt }ut1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}]Cfw EHfvA f9]u1Ʌtd@w 1 w w w ?w xIÉEU)ЉE9} "uu}u1EEftff@~jVC@PJ ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjS'ƒ ujjS]m ]UWVS} uEtCt=u{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVS} 1EEEE3CdEu u%StVMQS2uCE䋀%u=tuuStPMQSjC@PE0 tK9Ht ESXESut URP'ZYSXu e[^_]UWVS} Et0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UVSEt0t.ttju CPPy t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j]Zuhe'$YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZoECCdUSǃt_{ u Pu uƃ C S@t@sdKQPuR[@u s{ u @t{ u j.EPC K{@u RURY^@s@{ 1UĊ  L @uj.EPC@Pj_ tOSRPh8%j.ChPh jC@Pu+ tP`S`Cdt  K`(Cdhe' SXZ1ۉ؍e[^_]UWVS$EEE EEU}uM M؋M$M܋M(MԅuEtLRPEY[8E(uZEЋEt2jWC@Pv uE܉C`}tp}ʃ}jVWu{Px{@u 1C$C {4s(E܉C`1E@CEX}CPt Nju }(CdE܀t CdtS` ttSX{@t4E4uSu!uSuu}uLSYMCAPu<{*Vhhf'Wr tVh`f'Wr u   r VvEU1Ejj@EPSƃ@$@ 1ɉM䋃%1҅ut6EPSFPF PF@P@u VE䉆F F@FFDf{(uXC><u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV^ VFHtVoD eFHE8V@?jG@PRUq UuG`t7%1҅uuV 1ZiEGhPG Ph%>V oj.FhPRj 1E@F0EpjVt8;Cdt,q PjCPPCP@SF PtjR$če[^_]UWVSEtt?u[0tFdЩu1҉t Pu /Y_6ҋEt^tTCƅtDGPEPn8WRVSE} Eȅ@)@. us Vh%FY_xu_jxZuhf'Xxh\jPx@uhf'h%F_XjEPS @u hf'!Y|@P|WSh<>jj Vh%XZe[^_]UWVSPUB UPh%xUXYu-jjαËU_XuEf'e[^_]~U3CUB>^t @H KUQjsZYtUJ>t/@}wFH r*NjM;rC 1CUe[^_]&W|$wUWVS ue[^_]g_h< ƉE1Em5`=&RR$C Ph3% Sh)@Vj(e[^_]g_UU t,t9PuƀRhFjj&UUу1t.w 1#tRh,g'hk% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`P EF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS81ۉ]]]E1u1EEE9CEׄCdt\URSTRP譖 t t0u5CPE Ph%+1ɉKd EEt9sEsxF URV4RP; t tlVdtRNh%tu %QPF Ph%Vj_@u 81t 8t h g'Z1F$F fdEt9sE6NEtXMPF$Pv苕 t t1F0PC Ph%V tPVujSTRPEċCPEЋCL }ffMM9Ms% KMɉMMԃщu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u(}uƃEȃ}v1ɺ>]4tuh$CWjE}t?E Ph%EEZjE0"hT%u:e[^_]UUt&t9PutƀU]a]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S^ u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EɮEP1ZYtU9pu 1ɺ]GEttu4@t$P詑ǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj?E _X1EE 9CEuh%j uV螗 CPVh%u* @uosXsTVh%u*@tuuVh%u*@tCtPVh%uw*@tC`PC`^E#tE^%"t #Au}$# tM##@t+A$#y#uRWVQuVh+%u) @&sdVh?%u)@ C1C;s WAIF,Z拀H1C;Ls WIF,XCPECLE}EfE9EsT SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhG8PB PEPu2E UU)U0sx1t8Fd%u'~ t!GFhPWEPhN%ui(@6ċ?e[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09XuƀلtKj3n%Y^u=t hT%S4XZe[^]UWVS} 71ۉj|]úi'Jt f9tUWVSEU MftEv0f9s 1&f9u}tMf9) [^_]UWVSEu} tRU w 'fɋ] ] +39s "1?fҋu1҉]19tu692uA,t[^_]UWVS8Eċ}ċ]ȅt Ⱥ_кgMQj uP҉ƃuEfǀ< GfEfwEă Ph%膹Y[f>ff}fuEfǀ< 1҉1ЉЃEu.Ef}w i'Ph%j ]S# 1:BUP XۋUuhh'XߋMDغuf}f9<t >tuă PVh%R蕷SEf]f< 18f}uVh/%}ȃl}(Y[Eċ4%1҅utjXZE΍e[^_]UWVSSƋ1;,k(Kfu{u#{u{ u {u{t]fuCUhPCPVUt1ǀ Kf1ɉHG[e[^_]UWVShEw E@EEEE@|tXdÀuXdBEAE1ɉMM}Ef9UrZ9]s#& E PhL%¶XZu<}])Ӊ]ff}ftftfu f9s# E Ph`%Y_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSPY< UtLF΅uE4%@1҅u/u+j EPjEPGsPE Phx%;f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPruSVPE Ph%D(b1ủuEEPM1ҋEPE[tE-Eƀ>f}uEȅEEEPjuWƃiUЍ M))Ufw# E Ph%谴ZY%EܹEȉEUʉU9s* uuE Ph%QEX|ۍEtjPS׷ u`jhPuhǀEfEĉ{(u 1ECECdu%Cd{4u EC$U9S tKdS t};sC t u9FhsFhE}{}uuE Ph%6 Tf}t21u~`}W9rF`E̅t}OdMQ9rGdE}uE؉EEe[^_]UWVSljUMu w@ Ph*% 1҉u1ɋUYt E1ɉKhKdK`ǃu uVj XZƃ>VuMUZYuC;u}tG PhE%G[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[], 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύG=DQK wWF(1RPQhf%~(WQh%j EPjSuuAtBf}u;8ύG=DQK wWF,1RPQh%蠰~,WQh% e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@%}tQuЋE؃ Ph%ub18ujjE؋謨EPjx$@g'8u ǃ8%EPj s@s<Qtf}uʁXsXS`1CdChǃF8u ǃ8%8u ǃ8%8u ǃ8%8u ǃ8 %{`tps|t8Fdu.S`F !AtH9sFhPE؃ Ph% 16ċC`tPE؃ Ph7%1CdC` u9t.E1Em 8=&}fEހ fEm}mދEȉC`{duEt:E1Em =&}fEހ fEm}mދEȉCd ǃ8`%}Eǃ;uCTt>}t8sLъCDCLCHCPCFd rFV t#tFhPF Ph% 1F$upFhPF Phi% Vd s"1F$F VjjF蝤-NtHN rV裰XVBYHC`;}؍w u PVh%MuVh%,KdSh tRQPVh%u跪)uVh%u蠪 RVhe%u茪jE0XZ}uA}t;WVh%sHsDhWE0% @u Wh %7^_E؋^|tFCdҀ t ujC@Ps tKd Cd uًE؃ Ph%sw8uE0 E؋041ۅu2u.}؋1ۅut$%1҅uuj\Y[XZ렍e[^_]g_W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@%# C4xH H-%+ t %VQW PR, PhA%$1 SҋCt>,u1siS0,G$u u iSS0S ti;S0sS0udR/ Yd{u1ɋS0)`=& ڽ 1$߭ ٽ2f2 f0٭0߽ ٭2 Љ ,茪Z{ 1߭5`=&u +t #u¹>%ݝC4HH H¸8%݅u-%+t %WW$VQ RP, Phg%#,{t 1s,薩Y6Pjs8s4Wf6t虿 ,TVjSXZGu 1a8RPVvljփ 9иr781kddȃ9ƾsff+tST1󫋅,@EUUE E)E.E d}TjEP:c @u, Phh'h% C@Cto ?9sS0S9su,S$t%,R jŜP, Ph%d e[^_]g_U库uE]U庤uE]U庵uE]UuE]UuE]UuE]UuE]UE vyu]zU,vE]i twUWVS 1tx 4 u1ۋM9s3ru2u\tffW׋uUuƅtfC [^_]1UWVS@D@H@4tPH1҉P4YH8 w$Xg'ƅ< dƅ<;+  ƅ< Bƅ<ƅ<0ƅ<ƅ<D 4u:ƅ<D8%1҅ut,Dž41DhP  14H,X@(fDž11,,9(DPDT19tk,<>98tB9rIpr@uDtDu f,,ht1(4tj(\ZYDu" t\1(fDžD,0% 1҅ut#j@wPB$t @pt1$Dx@1ƋH8G 5bu`(uHX<@D&v P Phi%՜ HP4BbCD_Zu hg'Y#Nj󤋅CH_1҉tjhj|PtP6-sD/j1CDCH| e[^_]UWVS] E1E;s31;Et k,9 t@v 6h%U PV=G,1;uts 3h%tU PSF,܍e[^_]UE@|tPd(t1]USEu1X|tuu SC u؋]UVSEt0t-uvX|tuu S u1ۉ؍e[^]1UWVS} G@4j.DVCPjv 4wVh% ~}tE@<"jWu茙< u hh'G8@Pj48Ƌ<% 1҃utj%X$C P< Ph~%8 <<t{4u< Ph%XZO88 ttu< Ph%̋<0jj48"#<01,0,;(⋍(ttHuƅ0eDP< PhG%]Ph\%> YX؃t w t u F19tAE9uuUM7Ph&Y> XZUM΃^Ѝe[^_]Uh:.h`%jO4 :5:5t9W|$wUWVS(:51B:515x&.% :7fZ7 s f,:5/sf,:5 s/f,:5f95f.:58:5T:7 erI(:5 :5ff,:5f.:5=95tijEP Eȣ0:5Eȣ4:5ZYF):5,:5(:5 :5:5 0:54:5f0:51ۉ&.&.p95L:795U1E(:5uEࣜ9595jh955(:7*2à x9u h%该 XSV5$:5h5%B< Z7Hujh&.jB1 959595=95u=95u9595955|&.=&.u؉}mrq&.E؉ 9595 9595E9595=ɚ;~ 9595-ʚ;959595$=&we[^_]g_UWVS4ƉU)'hW%#; Y>F h[%AFfVRVRPWSPhu%: j.]SFPjG] uj.h"SÙ Sh%: j.SFPj] uj.h"S蓙 SAF^(ZU)ڃ<,wJ<w1tR<CSPSPh%<+h%"<:tI<%"( Y ShJ%( XZ geTP\w닅T@P9TX\H9s&$ B.DQt%RP' CYXʻ\J9H4sb4Ph#h %Q' 4H9scTH\SHZuhj$' [0:utSSg YƄ4\n1Z7:h߼$& T@Z<t <uh#%hX(&& XDž8)T@Hʃ8tHj,x% XHT@uRhS%yRhf%Rhu%%& YXtj,9% h|%& XZ)P\uj,% h%% _XRT@9@8j,$ VT@Ph%% Z7P!PWha$~% T <x2<w><tG<T@8Ph1%P $i'<rT@<w*$j'h%Bh%;h%4h$-hܙ$&Ph %,T@t <uh7$hJ%C+^ Ph`%$ Y[THFh}%{$ T@Z<t%w uh%<uh%h%J$ _h%Ph%5$ [^T@8Ph%$ THjh%h%h)%h8%hH%h%hV%}hk%sh%ih%/*j.STPj F uj.h"S舂 Sh%^# j.STPjE uj.h"SR Sh%h%# h%## T@f8fZYfw2$(j'h%h%h%h%h#%h%zuh%nh(%h2%" S1ɋHQ t Sh$h?%&uj.VSjD hI%6" [hS%&" h%#" T@fHfZYfw-$1e[^_]UPEPhhb7h f7uƒ1uEUWVS} uLu7uuW1ɋU à =f7u u1Ɖ>1e[^_]UPEPhhb7h f7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ MؙF#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rסf7EСf7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSU} u]R2I $URjWI $WjV I $Vj$SH ZE] Ee[^_]UVS@ÉjjjQjRPJ tNtL9tHVP ZY@u::Y j@]S0:iW h?#ShU%P&.=_f7t/ 1e[^]UWVSSÃ=f7tO1t f7<!j ơf7!f7)Y9sRUf7Z9Uu)@uÅu,f7!1ɉ1ƅtÉ5lf7hf71e[^_]USX?lf79hf7rlf7Élf7 4t1[]À=\f7UVSh#h#h#hz%&.h#h?#hv"h%&.&. "=]f7tM#%=^f7t%P%=_f7ta%QRPh%Ӌ5&.z$=Xf7tt%W$=Yf7te%`B#=Zf7tt"w%=[f7tR &SQRP֋5&.]ڡf7h#h?#Ph%֋5&. ڸh#h?#Ph%֋5&.ڡf7mh#h?#Ph%֋5&. ڡf7Fh#h?#Ph%֋5&.ڡf7"h#h#Ph%֋5&. ڡ&.h#h$Ph%h#h#h#h%&. e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVS f7f7f7k(0.hm'@PNw1ۉ^,f7~0XY1ۡf7E9s6U1hm'GPwKGU!C(XYk(|0f7EM9sCU1hm'GPvf7E؋M)@f7GUC(XYk(|0EMf79U1hm'GPmvf7Ef7EEM)ȍHf7GUWC(YXR h#h#h'%P&.=_f7t+ `f70e[^_]UVS`f7;f7s4>uDC[^]á`f7uÀ=f74UWVSS DžDžDžjjPhf7jP-@u f7 f7Pf71 @Hf71t3tShPhL%W t!Ƅ9h]%jXu ƅ t5Tf7u _f7FtB<97$k'_f7]f7]f7^f7^f7볡&. f7Q9}H &.@&.\f7\f7w&.iH&. f7Q9P@&.E&.7H&. f7Q9@&.[f7[f7Zf7Zf7Yf7Yf7Xf7Xf7ƅP hI#Rhl%P&.G:Q =\f7t h: Y=&.&.9}&.׸Éf7 f7 f7r5f7f7f7)I f7ࣸf7Pf7tPf7 &.f7Bf7 f7Љ裤f74裠f7#5f7t@f7)‰f7=[f7t*1҉j Ph " hm'hf7qjSf7f7f7hm'hpf7q11df7f7lã`f7u&f7 1tf71e[^_]1À=f7u1ádf7u df7UWVS@É;f7;f7j~¡f7_9u739u0PaY;f7u;f7)f7f7jVS` 19Z;P f7PPhpf7q=f7XZVS Y_@u:N j@}W0^M h?#WhU%P&.=_f7tH% 95f7u"tX f7PPhpf7qXZe[^_]UWVSEЉʋf7!Ë f7)){ MA L>D=]f7tMjRP_ M95f7sxu@)lj|| >;f7Fs"J| u| | DT>| T 9Ss$EExSWrED CSWp;sss{uISC PrXZ=]f7uE@,t f7EX,f7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC f7‰ى[^_]UWVS¡f7!9t> f7)su܋tu 9t)D @!u܋D UEPhf7Zn@ZYe[^_]UWVSQӋf7!‹ f7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS Eܡf7Ћu!9`x }؋ f7)‰Wt^f7]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w m'wm'"1wl'1;SsS |C@C;Fu ;u1ɉHt SFP,pXZNZH9t9sxt PFPmY_SVmXZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPhf7JlPhf7o=^f7t KZ{ SC df7df7e[^_]UWVS9f7tf79kjjhpf7nǃ t؋_ jWhpf7nEWhpf7 odf7=df7;f7r;f7rw1ɉÅuj}먋 f71ÅuP=f7@u1jNjf7!‰)[9tPlf7Y9uō3f7t]EPhpf7^kXZt>G 9r7 39s0jWhpf7mEWhpf7-ndf7=df7}뾉؍e[^_]UWVSÉU f7EC1t}9xts@Ƌuzơf7EF}}1U9s1k`;${'t @u-$ {' {' sjtt5 0@p00uHP@$u1S$0t9(s5 *\p0믋H@9(s(0띍e[^_]UU%%;\(sB.]UU:%;(s44.]øUS] uSh:._ h"S虯t4 0Ph$h:. h:.j [XZE:.]^ UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt 3 )wu PEPà Et i3 1]UWVS ‹@E졐B.E11 =E}9s%9]D{t}tk Y DFɅt}uzuB f7Bf7 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEPÃxuUSˋ@ ى[]ÃxuPf7@f79Ps=UVSÉjRp{g u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD Pu C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$'sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj=@.t9s?MjC,@Ps(c Mu e[^_]C(S,z{,f P{<tgFB.0=@.u9sB.0=@.u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E '.HuVQM! t uMQ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCCf7f7f7'8[u"x.u.K9r !f3r9s:.u z]u{uCf7Cf7[^]èu'B B.fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uCf7Cf7{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4݀' ZYuCC u1]UUE ft҉U|']1]UWVSSɾ=@.t9rC,E5B.=B.113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjhP%V u 1ɺjhW%V u1ɺ,S j@B@Pr 4^ u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uCf7Cf7f7<-t<]u{uCf7Cf7f7CE؋ B.Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ=@.u˸jE@$E@PEp $\ u fMA Q$JuN$f8-P9x]x-t A -f9k=@.vNf9~;{uC f7Cf7ff9UPF΃=@.uމEa~{uC f7Cf71E7* UFup>-uF3-U;Cr{uC P8]u f7Cf7{Ex8tC @tEHfE1@.u9}~Ju9sE8}3G8GEx<t4t fEfu-GB.8EuޡB.8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF B.f tNt B. t< B.ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCCf7f7GƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC f7Cf7{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JB.DJt%9~{uC f7Cf7PU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uCf7Cf7<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $P'^[m\p{|;{r{uCf7Cf7S B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)uf7Cf7 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCCf7f7Gu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM B.Dyu},t{uC Cf7f7@}t{uC f7Cf7?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJB.DJt%9~{uC f7Cf7PaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPB.DPt 1e[^_]UWVS} UҀcE tEp9J) W ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEu.Džh1V1DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 B.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNB.DJ_bB.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXB.DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ B.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qERGPx u )MuMA}dM)ыU9uG PVjx @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ B.Qu?f_t9f}fMQҋ B.Qu f}_zftQ B.WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgB.OJf_ f}_Zf_ 8u_CfCU B.DQuf}_f}u2ы B.DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 B.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNB.DJ_bB.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYB.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ B.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVzh @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRUjb UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f B.DAu;f_t5f}E B.DAu f}_fEzftOB.DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡB.DHf_ uB.Dpf}_Ɖ 8uaCf7E B.DAuf}_f}u4 B.DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRU_ U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRU>[ UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG B.AuE B.DAuf}_f}u4 B.DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRUX U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 B.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNB.DJ_bB.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYB.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ B.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVP @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=@.lt1ۉ]tMEAEW YE}M9MP F,EF4EtpF8EtfFu}D$ Ġ[^_]Ëhld<D$EgD$<$D$#D$<$ D$EgD$<$D$fD$<$D$EgD$<$D$0D$<$zd9M`D$D$t<$A`u!phD$EgD$<$'UWVS l} uttEECgEEEED$E$OQ…PEt⋅D$ ~D$D$$m &.&.&V9sNuE@D$ D$D$$l Pf.&.&V9sNu;&N9sVu GgN&.&.&N9sVuR ZGgN&.&.&N9sVu;rEGgNf.&V9sFuEx6fgUT$ D$D$$]Zf.&.&.&V9sNu;t94GgN.&N9sVuGgN&.&.&N9sVu{Ex̑ @>ውVGgN.t&.&V9sFu鋽Džȉ&.&.&N9sVu#1og^gD$D$D$D$ D$L$M $.&.&N9sVuD$D$ L$D$ D$D$E$;ҋȉ.&.&N9sVu鋽BD$BD$BD$D$ $D$D$ $f Ȅ.t&N9sVuAD$D$hAD$D$ mAD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ dD$D$ $e AD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $d B D$(B D$$BD$ BD$BD$BD$BD$D$ @D$D$ $Vd snit&.&.&.&N9sVuȥl.t&.&N9sVuKga.t&.&N9sVu{i.t&.&N9sVu;Qu.t&.&N9sVuv.&N9sVuv.&N9sVu{EDžDžDž[golg~@D$ D$D$ $b .&N9sVu@D$ D$D$ $a N.&.&N9sVu;A D$A D$AD$ gD$D$ $` .t&.&.&.&N9sVuD$ D$D$ $j` 1v.&.&N9sVuUE@D$ wgD$D$$_ EDžDžDžDž DžU1})` UWVSt IU11 DrEEEEEEEEEH>U DEED$ED$$UU}ĉ|$T$E$ ƃtdE$X ƃt'D$ED$$HU1҃ډ踰 MD$|$E$蛯 藰 M荰 8D$ED$$Tk 8t[^_]Z UWVSP Z Dž/devDž/XtyDžyXXD$g$Ut-ƍD$D$FtH4$0 4$OVD$D$ D$D$p$N@Džgp0ƅpD$D$<$TƅtFL$D$<$XuD$<$Xtg$BUnC蜮 P [^_]聮 8u)΃wΉ<$VuD$D$<$S`TEE ut|$E$AUt#ED$D$ $EtED$D$gt $ 1P [^_]پDžUVS ED$ED$ E D$ED$E$tKBB ƃt?uE$SE$:[^]ËEUE$sS[^]þUVS jL L; D$D$$w t@ $q ǃ L$RǃLƃ 1 [^]K 0ǃ L$RǃLƃ t 0ǃ ${RǃLƃ ߫ UWVS< TuD$/4$o D$@4$'Qƃ%D$T$$PV 4$QƄ=D$D$D$D$ D$D$ D$$蟅 tVuw: ul<[^_]À uMQ Ɖt$)XD$ gD$D$4$=X =x ? ` UVS_ u 3D$/4$2n "Lt$ $K  D$D$L$t cD$ D$D$L$ !Ѓ2 D$D$L$軙1[^]_LRD$D$%@4$NLD$t$ $ 脧 Ɖt$)XD$ gD$D$4$pV =諨 ?G$`S tƃ Qw 8#u͉4$ƃ Z J 0_> 0UE$]UWVS$1 æE@ E։υU };EE EU D$T$ $""""D$"""@9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""?]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""?UM]9ȋEE9EE },EU D$T$ $D$>9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""\>9BMϋEE}19}E UM T$L$ $D$>]u9M΋E eƉi`T$L$ $D$=9MϋEEƉ]u덁݉a)u}T$L$ $D$+=UM]9ȋEM""""9""")Ɖm݉]u UWVSH aD$T$|$|$D$$[> D$$H*)R)L$L$ |$M $> tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8 u}܉EԉŰB.ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}ŒB.UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$]] E܍ g D$EЉ$] u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍ g t#D$D$EЉ$]諏 uKE܍,g t+D$EЉ$]4 u}g]܍#D$EЉ$ t2,g t%D$EЉ$]֏ u uE܍L]̉ލg tD$EЉ$]蒏 uruЉ4$]{ T:sE܍LD$EЉ$]Q 2u݀}u<E]DCt.E܍D$EЉ$] u1ۋEЉ tC.uu#ỦD$EЉ$]迎 Uus5uD$EЉ$]舎 tu#GW ]ԉSG UWVS ÁƋ'<'wwEVN)щȉMEED$$v\t_FMȉFD$F$Q\t:F]؉F>FDF 1[^_]ÿ'E {UWVS5 D$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$`lLD$@|$X\$LD$\D$`M|$Txq|$X\$LtL$T=qwT$`9l@-D$@tT$T=qw L$`9l@tL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$XLFD$\D$`t$\lPT$Lk)ЋT$P ‹QD$dT$hD$t ] 1uUT$$]8tFuɿ [^_]UWVS} t: >t M1uU T$$7tFu̿[^_]UWVS Ëpt:l>t M1uU T$$37tFu̿[^_]UWVS 诱 $E $ ƋE%EEEgUuUT$$$…plU>t M1uUT$$w6t1FűuUEEu54$1E [^_]ËUt }1]uЋu9t!$U] D$UT$4$ E0E렃}tE1҉UWVSw u Ex}u 4t+D$4$5uE)E@ [^_]Ë t 1[^_]Ét$(RD$$nUWVS bE D$E$Pm D$ED$4$NjE8tB|m 8"tn€4 uOt$ E D$urD$$҉[^_]:m 8"u썇v«4뱋 t[^_]ÍvҋE D$arD$$mUVS euF$/F $/4$/[^]UWVS$贮 )}E 1t u$1'E[<$ E܋MAnD$4$*EMA  EU P8E܍EgMUT$${!ƅ>nED$=4$/ HE } M D$4$3uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE j t(E܉$5.E$*.EE$[^_]Ét$(RD$$k $-ffffffUWVS8ά Cuj D$rD$4${uD$:4$. DžD$D$4$H{hF$Y $$D$$D$D$|$ D$D$DR4$}1$p$6D$D$|$ D$D$4$*1J|$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $H  $2D$$Y |$$ƅOD$E D$ ED$D$$$D$E$tPT$$}$&+$+g 8[^_]À>/uEt$D$<$St'D$<$D Sg 8E D$t$E$u}뎋E D$cD$E$vuE D$D$D$ ED$D$LR$.BE D$t$E$urf E D$rD$E$tDž1D$ rD$E D$E$? Dž1ktf E D$rD$E$ot1;$ 5f t$ 'D$E D$E$ <$ 1rD$E$xD$/4$se E D$D$E$sDžDžve E D$mW`e E D$mWUS(X ͱEEED$D$ED$ ED$D$E$,x E([]øUS( aEE>ED$D$ED$ ED$D$E$?,x E([]øUS(耦 D$ D$$?D$D$D$D$D$ D$D$D$D$ $+x D$([]øUS ED$D$ ED$ED$r$Sx E[]øfffffffUS裥 E$ U膥 U\t \]ÍO\]UWVSP ů}|$E D$E$2q9s [^_]b ?|$ t$D$$\[^_]UWVSߤ T}|$E D$E$q9s [^_]b ?|$ t$HD$$\[^_]US p E$ t []ÉErT$$\EUS * ßE D$E$ t []ÉErT$$\EUVSܣ Qu4$tt[^]ÅtEt$rT$$\EUWVS苣 u} |$4$ t[^_]ÅttE|$ t$T$$\EUVS+ àu t$E$ t[^]ÅtEt$sT$$\EUWVSӢ H}|$E D$E$ u[^_]É` 0|$ E D$D$$\[^_]UVSh ݬuE D$4$8 t[^]ÉEt$"sT$$\E[^]US ÆED$E D$E$uE3sT$$\E[]US辡 3ED$E D$E$uE3sT$$\E[]UWVS$i ޫD$ D$EUD$T$EUD$ T$E D$D$E$9 Ɖ׋D$ u $[^_]^ L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]UWVS$觠 D$ D$EUD$T$EUD$ T$E D$D$E$'Ɖ׋D$ u $[^_](^ L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]U `U!TRፀL]Íq]Í]Í]Í]Í"]Í9]ÍS]Í]ÍB]Í]Í]Í]Í]Í4]ÍS]Í/]Í T]Í ]Í]Í0]Í]ÍF]Í<]Í+]Í%]Íb]Í]Í+]Í"]Í]Í]Íс]Í]Í']ffffffffffffffffffffffffffffUWVSq ƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS\- E}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ  ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s U D$/4$ϑtLrtP‰T$|$t$)D$ lsD$ED$E$1$[^_]Åt xruS뵀>ruGt$|$ D$ED$E$X뺉}UE$[^_]e{M UWVS~ D$ED$$t{NjE88/tbD$/4$轐…tL)JBU=wsG|wdD$}|$M$] Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVSs }UtlƍxD$4$u tD%=`u'-$U ytĄ[^_]K O1Ą[^_]K 1UWVS̍ A}U)tlƍxD$4$η tD%= u''$U tĄ[^_]t}EE u[^_][^_]UWVS4K ,78ủt$E$ϣE D$t$<$4[^_]UWVS wEE},70E D$ED$4$=t}EE u[^_]p[^_]UWVS4蝄 uED$E D$4$Q=t%}̉|$E$ ED$|$4$ 4[^_]UWVS4> ó,70E D$ED$4$<t%}̉|$E$觢ED$|$4$4[^_]UVS ۃ PEM thP8t P807@:t1 [^]ÁP8,D$D$7@<$)OH8붸 [^]UEt @:]ø]UVS 0 å7t^d2.@:.T$XT$$p4$7tE$/207$$,7 [^]Í$SXu뎍vs$q$fUWVS(聂 }tG{E{EOEEME EM<$bƃ t tu#E([^_]ËE1([^_]ËUGD$ D$GD$<$CE9E9G?@UB. DqEEmUT$D$<$4:E;E :E+m}EE;E tu}MMD$ GD$GD$<$vhD$ GD$GD$<$UhMAE9O~D$GD$<$9iGU9ut$GD$<$^9u7D$ D$GD$<$gD$ ut$D$<$gt$GD$<$9E;E v}D$ ED$GD$<$}gEHU9_E9G5MzUG;U D$ u4UT$D$<$gED$GD$<$P8E E&OL$D$<$f}D$ FD$FD$4$fFD$FD$4$7}tE9} uD$ FD$FD$4$lfFD$FD$4$77D$ UT$D$<$3fG3L$MGD$<$d7MD$ L$M܋GD$<$eM{D$ UT$D$<$eGU D$E D$E$]U ~ D$UT$,7$^]UWVS } Pu}ED$E D$4$6tE} u [^_] [^_]UMU E~tEU M]]UWVS R} LJu,78E D$ED$<$5tEu } [^_]~ [^_]U | jE ,7~"tD$ED$$9]ËEUWVS| }EEuED$E D$<$T5t'~#tuEE }[^_]E[^_]UWVS:| ïEEu,78E D$ED$<$4t)~%ftuEE }[^_]VE[^_]UWVS0{ 9E}GDEE0798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$]fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]cMEE9G~0W,10[^_]Ã]1^E:<$]~1Uy $,7$]UVSy $7p t4$ u N8@[^]ø[^]UVSDy ùut4$ u N8@[^]ø[^]US$y }E UD$ D$D$D$T$T$ D$D$E$$[]US$x $E UD$ D$D$D$T$T$ D$D$E$ $[]fUWVSNx Â} uUM=tUG$iUrl7tUF$U5l7tBU$3Ul7,048<@DHLPEtE@$l7  $(EtE@$l7TX\`dhlptxE tE @$_}l7|UUUUUUUUEE$tE$@$^l7U UUUUU U$U(Uċ,EȋE(tE(@$b?l7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉdT|t ʉt ʉ`|Mt ʉt ʉ\UUt%  XŰE@|E@hDž$ */ E@,p1҉,MI, qfL>9<ffNv tv$uMI,4vD> qxf~g$JO HG 9u͋9 <>f|>y_u$F,HfD99f|9y.NDfHD$F|$NuĴ[^_]Éщ$E@,R|)ƍTxDlx9qf+fG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YMQ, rfVAtωp$0V PF 9u͋tp9l9h\T$xy DžxEP$ty DžtEL$y DžEԉH$y Dž4$]y Džx|Ƌ)΋)ȉpl9^p9dE@,H1҉tvf~94>ff~~ t‰ljv$Nu}O, I4F uf~0r$z4W PG 9u͋9 Ƌ9l9|)ȉ9~ht|Ƌ)΋)ȉpNj9p9 E@,H1҉lht}f~94>ff~~ t‰ljv$Vu}O, 9I4F uf~k${ W PG 9u͋9lhwDž?lxE@,@xMT6MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bǃ| <ǃ ^ǃ vǃ #ǃP :ǃd 'ǃh #ǃl #ǃp #ǃ -ǃ -ǃ _ǃ |ǃ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$,T$ D$D$E$o1.t&.&.& Tp=u[^_]USH SM1&.&Tp =u[]UWVS,YH R EƍME$+FF(9u݋uD$$8Cuxu'D$$$3T$$ǃ !ǃx +ǃ !ǃ| ,ǃ !ǃ -ǃ !ǃ .ǃT %ǃ 0ǃ %ǃL `ǃ %ǃP aǃ ǃd fǃ ǃh gǃ %ǃl hǃ< &ǃp iǃd %ǃt jǃ %ǃx kǃ %ǃ| lǃ %ǃ mǃ <%ǃ nǃ| %ǃ qǃ, #ǃ oǃ #ǃ sǃ %ǃ tǃ $%ǃ uǃD 4%ǃ vǃl ,%ǃ wǃ %ǃ xǃ ǃ ~ǃT #ǃ pǃ #ǃ rǃ d"ǃ yǃ e"ǃ zǃ ǃ {ǃ4 `"ǃ |ǃ\ ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$,L$ D$T$$%Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^ $v $#T $: $'y $#g $#U $#C< $-1| $-, $_ $| $o $pT $r $y $z ${ $|}4 $}k\ UUSB L ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0B ÆLEU܉M$772EE4E fEE$Hƒ=4M4%y 4 44fǃ EDPfvM䋑f8;@E fWf^fqf$MdU܅7Q)ʉ$ 2E$N‹E@ @M M4 'UfB 49}} 4% 44;4tf 7f1҉Ѓ0[^_]ËE44%y 4f y4D$ D$D$$1 4449)‹4L$ T$U؋MȉD$E$!4;4U}dž4…f 4xp4fǃ 3E$>0t3E$=E0U,)4fǃ E܅U0tE@ U؋4 E44B%y 44D$ D$E‰T$E$~v4%y 4 494114M%y 4;4)fǃ Mԋ4D$ T$U؋ED$E$ӿU؋M~4y 4 49411x4Wy 4 4947ff @}AEE܅U$-E$‹E@ N@FM MtUB.jE@ U؋4  UfB 9 4,fǃ !E܅{7Q)NUm~ 4}} 4Hx6 44m4%x4뿃ߋ 4}} 4%y  449}fG Ef` @:.D$ D$!D$l$ؽ $ĝU: EEfǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSXS: Du$7MV8у$33`2.EEt<7 E)V8N<t=%G*tE11zE}uAX[^_]Ãt $*tًE$ƼE@EF@u,78E D$ED$<$utu } [^_]* [^_]USr5 ?E$[]ffffffUWVS A5 ö?Ɖ$r $ϭ…t"ׄtN<$tȃuЃ [^_]ÀF$ڶ Ut p@뮃$<UVS4 !?ƍ D$4$ ~sD$4$ 4$ 11t)0tGB<1;NVt~΅u׀>u|F[usVmt2t00uVFtJeNVu1UWVS043 é=Uu :uH2tU$1YUF@fu2ML$ MD$T$<$#2M EPJ(N$JN 3s$1D$D$$ FTs$zD$D$$ FXV  ~$797NT7 72P3PB0zp12džp2E싂E苂TEtU܉Udžp2ELɉMEEEUtwD$Eԉ$UiE܋U؉$ Mԉ $E܅IH 1$誱t2džx2EE-EED$E$ u džx2EPED$E$k u x2t|$E$J u x2dž|2UtE)dž|2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(EU܋ED$<$ UEU܋ED$<$f Uu p2MU܋ED$<$8 Up22@@,EF@fL$ D$ZD$<$2XE1ydžt2džx2Edžx2;Et ED$E$^ u dž|2EtD$E$: u |2|$E$ |2LMFEidžt2džx2dž|2Mdžp2EEdžt2džx2dž|2E@tg|$E$ uTx2dž|2EJt|$E$ u x2dž|2dž|2E8ENdžt2džx2dž|2ExOAOU , 6$7D$E$]US+ X6E7H$ 7H 7HT 7HX 7Hl 872 p2 t2 x2 |2 2$4P[]UD+ 5M$7tJX71]ø]fffffffffffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS `* 4}ƉDHfx 4 [^_]Ëf=tyfDN4f>tX$]褢TP.t&ffB9uǀFF [^_]ËEFf\Nu]ED$$]AMME$ ]UMtZf@f@@ f@@f@@]\]X ]]9Eu]$躭$]@:.D$ D$D$$ȫ $贋]$a$藋UWVS t( 2Ɖ׉M$ ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS' I2Eu^.&9t)fxf8u@$9u׋~1$]q9> $]Y4$Q[^_]UWVS Xt&.&9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS& 1}fǃ $'P.&ffB9uǀ2ǃ ǃ ǃ R2@tL$" =w4D$T$$N2!9u[^_]Í$P$膈US i% /E E$7t+2UT$$U(E []ø []U% /UM ~*$7t2t _1]É1]UWVS $ 2/$7te3339}}<31 [^_]à D$$'‹3t333뱸빋3L$PT$$ 33]\33u-U # b.E$7t%2UT$$1ɋUE]ø]U# .M$7tJT71]ø]UWVSg# -}<$ƃuOG @tI& 8u?$73t-7D$7$Htǀ3[^_]UWVS " ]-EU$72E  EE$3= %y   fǃ LNfu f9q fmffjMUU$) E$mE@ @ME@ M  %y   LNf   yt鋓  9f y [^_]ËE$Ot3E$8=DEMR [^_]ÃUfB   9|  <  9f [^_]Ë %y  ; fǃ Eu-E$E@ @aσufF 7Q)=  Ef` [^_]ÿ@:.D$ D$ D$ $蝢 $艂UWVSf )u$7MqV8у$2c33`2.M MEt<7E%F8V<t|‹F ó EHEP,UD$U T$PT$ PT$UT$$WB[]ÐUS X $73t`3$貇[]1[]UWVS   udž243@fu|$$N t%F@f|$$- 43`3<3h3@3l3D3p3H3t3L3x3P3|3T33X33\3383d3Fl83Fm4322<32D32H32L32P32T3222@3%2fdž2432<32D32H32L32P32222324832@3%g2`33@fuT$D$$* [^_]dž3771 [^_]ø|$$ UVS È$7$LtHl7 Pm71[^]UVS  =$73ug<7@7ǀ2233t9@fuT$D$$ [^]V1 [^]UVS * ß$73ug<7@7ǀ23tE`33@fuT$D$$s [^]1 [^]UVS  $73uc<73tW2u<23@fuT$D$$ [^]Í21 [^]UVS j]C=w"Dt,7XLJ3}9t:ǂ3EEEEEEL D$}܉|$$B ǃh ED$$U d ǃl  US Ð l t[]ÍD$$ d ǃl []US B l u[]Ëd D$$躽 ǃl []US$ h t$[]ÍEEEEEEL D$ED$$ ǃh $[]US$   h $[]ÍED$D$$躾 L 9Eth $[]D$L D$$耾 1UWVS4  $73;3@fT$$( l h y07B$,oD$D$ HQT$PT$@$詧7@|U,E؉D$D$ $cUԋ@t A:zUԋ}؉|$D$$+|$D$Uԋ@X$ @$軋 D$ D$D$@$ǀ343@fuT$D$$4[^_]7@|,M"E܉D$D$$x L 9Eh 07R뒸d D$$d ǃl h |14[^_],MvUԋM؉L$D$8$Uԋ@YD$L D$$謻 CUWVS, # EEEE uԉt$}|$$`EEEED$|$$`D$$a$73tD$t$$W`,[^_] ^$73tUS 5$73u-3@fuT$$f []øUS h $73@fuT$D$$ []US Î$743@fuT$$ɒ []>US BE U7RtI|t7“,T$D$$A$7ǀ3@$ 1 []Ëxt“,T$D$$$7ǀ3@$蚇 뵸 []UWVS  yE$72tQun7@@tt\ǂ2“,T$D$$`@$ [^_]7@t ǂ2뮿 [^_]7@tǂ2{U+ $72$]ffffffffUS]E  }t J;}R ;~[]ÃUWVS 0}tG8 u^@u[^_]ÍtG~W,EO(G\p;}@ ;~9Uu׋u멉<$G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U091[^_]É봸USEt=H~6X,1".&.&.&9t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًU-9u1[^_]øUWVS}] UG9)9i4utU}t]G,E] Eu pW(9|_9}W(p 9 _9} E E;E 1[^_]É듋uW,G(D$OL$$D9UED$ PT$D$$]UWVS}G~EW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]ta{tZO~[w,1 t&9tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]ffffffffUWVSn ЍR4ր33V,U39VG8 L4U;W81҅ZE1EEEEẺEUMD>EED$D$ E3@@D$UT$M $mV,UD>Mȉ$xUV,E3EEE;4ML$ T$D$E$7ED>$exEENjE94~-D>D$E$5dEE94ӋUЁĄ[^_]Ã4$ D$t$ ED$D$<$‰ЁĄ[^_]ËED$ T$D$E$ED2Mt$ D$BD$$D$M2$P‰ЁĄ[^_]úsUWVS8 |ƉEЉU̍R4Eԋ4}8<$ ƀ?EEE4E؍EE'E$vM9Er;UU)ր?Et)E؉D$ t$|$E܉$tEy8[^_]Ë}ԋGu܍WMtFȉ׋uԋ6tftE‹u)uƋ@tQuEt}|$D$ $U} UEЀ4SŨ8[^_] EԍPMtыujuE)ƋEԍPCt$D$ $U} U)u}E)9s뷋E9r7EԍP9UtU?$9Uu~X24H90t…#ȋH90utJ$`2UWVS lj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$,UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS Ɖ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u;u?uGt7@@8tf@1[^_]Ãf@t4$t4$미[^_]USU MU ,7t%t X@t @@f%f1[]ø[]U U,7M u]_]U VU,7M u]]UVS (E ,72Uu0ÁE% úډ1[^]ø[^]USU U,7M u8tHX2H@H@[[8u1[] ʉP@[]U o,7U]SU Q,7U]UVS .,70tFFX2@Ttf@4$4$7@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]i]UEU Mu]5]USEUu2U Á ӺEڋE 1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]aUVS qutFFX2@Ttf@4$+4$7@@8tf@U 1[^] 7PT1 t t t@t̀t(t t8t ttLt 1 F7PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS 'u4$ D$t$,7$H [^]UVS u u 4$襃 D$t$E$ [^]UWVS < ñuE ,7:x<ut&.&9t<uЉD$t$<$ [^_]É4$! UWVS E},70E D$ED$4$|t<$݂ D$|$4$K [^_]UWVS v u}ED$E D$4$'t<$舂 D$|$4$ [^_]UWVS! Ö}u,7E D$ED$$UǍt/Ux0u 9t<uƉt$|$$ [^_]ÉU<$ ƋUt$|$$W UWVS }uED$E D$E$6tAxEut&.&9t<uƉt$|$E$ [^_]É<$N UVS su Ex8u9t<uЉD$t$E$| [^]É4$ ffffffUWVSH }EUċEG,4@4E@U {}X E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$藼uH[^_]à zE1H[^_]É$V'EEFEȅE@$VEyEGM+M9E O(U @9~F t$vhF E@ffO@EE %WHUUȁ ‰ЋM ȉFEfFE@EȃvA}$cJMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$gG UMȋE@A%GGfGfwu}G9uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$HjMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$B%UčJ‰Uĉy19uĉ)UBHFBLfFMEy19E0B,4v4BDfFt$B|U$du 4M$SE u E;GTuO,u u6uč @4PA!EE;GTG8 <$<$2 EE EOT9E M MO(ʋH98OU9U+GHFGLfFfFUO9{UGDt$G|$jcu2 ȅM cUuUȋu6O, 4I49~X}uEFDfG|$F|$bFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 @78u E<$GG8 <$gEuĉ׉EċE MO(@9/(E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM EG8 3E RW9)ʍBE <$9ENG8 <$n[tUWVS E8uE0E,EP@,Dt@ 1H4 ¯,7t"7Rt`@øU mEt97R8ttH@]Ëu]U Et#7Rt`@]ø]c ,7t=PX2R(tt H@Ëuø ,7t @@øUEt:PX2R(ttH@]Ëu]UEt@@]ø]ÐUWVSq uF8 4$lj4$ED$FPD$4$|D$4$cUT$|$4$|07;0t 1[^_]$ z78uFָ[^_]U 3UM ,7tx;H}9~ PPHT1]ø] ,7tUHPU PTE 1]øUWVSH ýu} F8 u 1[^_]É4$E4$ED$FPD$4${߉|$4$*ML$UT$4${0790u$ y78uFx[^_]U UT$,7$]UEU Mtx9H~9~ PPHT1]ø]UEtHPU PTE1]ø] 7@t 1 U7@t 1UWVS( EUE u79}t079zH}z}JP9krT9`N)9c\]u܍D;9u׋WE1MfFM9yA,U[4ADEFFfFt$A|M$]Uu([^_]؉9BT9H)9)Ɖu9EMAIB[ωރtftEEE}9B,}4!}#zuŋJ)9q)؉E9E]u=[BI߉΃sEtftzmEm9FB,M4!]؋#zu띉ϋMG9 u9|-׋GD$ D$t$<$]C9w~׉BtU$]U$]1)J)9A:0UM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]OSucE9EuM܉r9M׋GD$ D$t$<$] 9uuE:fS 4fU< UT$,7$m]ÐUWVSE89tp@EOE)w~TEP,G(UW,΋M4}.&.&y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS$û 8}GDE0798 GH%EWUG,E40UutWUыpG9UfFE9svffEF%M ȉFt$G|$cPu¸$[^_]ËOU9~VUEEGGED01E_GD$ ED$ED$<$<$ӿ1$[^_]EUw ,7$]fUSZ E]  *t&tʬ A ʰ 1[]øUVSu^(~^F,11҃} <.&.&D,~9u[^]Ð.&9tD,y)9u[^]1ɉ[^]UWVS0苹 EH,7E  E17EMED$D$D$D$ D$L$ME$t#UB UUB(ҋM~CMM L$$Vt=9 ~#tyمjE)c)Mǃ 10[^_]UWVS }W$G(E1Uv.&9w(~hD,tO L$y؉D$D0$uED,yD$UЉD$D0$P tD,E9w(E[^_]EyUWVS躷 /}G(~"1D0$־D0$$9w([^_]UWVSy u 1~M1$v.&.&.&9t% 9° uDŽ 9uۉ[^_]ffffffUWVS f]ƉE׉UM$FM ]EPt MA +B A(EEuFF]^]^FT4$] 1ۋN]uF,MzF@1ɉU܉fGU9VUGfGFD$]8G |$F|$=Ku [^_]ËEED$E@,$]z3tыuF,U)D$F0$]O3tF0V]K +J K( <K,[+ZR,UʉUf.&.&rprpP 9MuԋEqU܋zUED$<$]ZLUBEE9F~EP1 [^_]ËVE}ǍD$uF4$]J2ÅF4F0V, M܉ً]Ӊ]ut&.&.&.&HXXXX @x9UuҋEo];90G EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVSM ƽE]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$E0791[^_]C:}7079(79,79S9M 9u M S E789E9EE)Dž#E(7tS} x }x$}u UM su 9+E78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U wE~M ~$79B$t ]1]ËE 9B ]UWVS 轰 2UE $7Ex$9}i07P H4 9uogH$p <19} KCJp(7P H4 9u91H$p <19}  &D$E$u),7P H< 9H$p <19} E}x$} x 7}:7} :2u $vt@:u$vuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )8)UWVS軮 0E$7ǂ3~aM ~Z;B$t_M L$$D$07$t [^_]ËE D$$o$1[^_]ËJ 9M uUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS蕭 }M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$F|$4$D$<$̵1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8t @P81]Ã⿉P81]ffffffffffffffffffUWVS - E} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]/CFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HMJ$x9MtH}9űMQ ztQuut duH8 uX8J$UWVS( ]EUMia$d#ƅIǀǀǀE܉$*#EF,D$E$ 'ljF0EF4EFXFF]^EF^ F$EFE F F8F8~xfHf@fuEfx~OE@uFE@#h2u  7:tx}$K t$KutE1[^_]f~E@tfx~݋E@u$7{uGm뱅t}$K u%D$07$G}$J QiUEPT$ PT$P T$P$11^]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]z뭉U델[^_]UWVSՑ J07@@Mt7J y ,ED$D$7@$,]A@Ă7#A@t2ED$D$@$\B@Ȃ7#B@~ED$D$@T$\A@̂7#A@7t $E[^_]uX~t7,ETt,D$D$BL$-\`@7,EfED$D$@L$[`@77[^_]7,EUWVS XuEӉ΋}$EP, 9u;u t5 D$E D$ |$t$$]K6[^_]èuUWVSĀc ܙE$7Eԋ3 ]07]JxV HJHUE@8@u B8@U B@ ]Ɠ,t$D$7E@@D$ZEԋ@@H D$u4$]蕗f8E@PhtzEԋs]sE878 S,11.&.&.&ȋ ˃9|u 9> Eԋs/E@ Eԋsu EH| P,CEfEE}ǜ7}]qM I, 9quV2xH uV p92fEuu؋sU;z)R,M<} :MMUQыP,UMUhyEE EuFD]䉃 FH fǃ  ED$F|$#"iFLf FHEċEԋM؅~E@,}D8uF,}8E̋@E;F\E̋@ EЅI}9|GEЋCEE@,]] R]܋]̋[UЍ.&A@uUEPrLuȅ]URu 72@ x]9]ΉMEu FuE܉D$4$]u (]ԋHP}|$E؉$E[E؉C{9}(UEH}ȅt}9}E}89^y1ۋE<9|"E@EčPE9E9U܉bƋUԋSuE܋U9}|:}EcUċE܉D$4$]UCEԋ}U9{tSEM9Hb{E79UR zsC}]9]EԋEP:xE@EH u;F}F(9~E 3tEu;Cw|MȉE3Fu)F)Ǎ)ƅ~ED$4$]utʋMȉ}yEE@@LEEԋHE@8ZZE8tE]D9FEP]9ډUMUȉ$]6 EMЉÉ؉؍][ )؋])9EUr8^y1ۋE<9U܉[^_]ËE7E}G}WX@#h2t $0],D$D$Eȉ$SEԋ}uW PEw P,u2 R4UE9x]DFfFt$D U$!UDfF4E9u]䍃sD$ WD$D$r$ $> E@ xkE}G}WX@#h2Et @@D$$];[E(7EE@9SD$$]EԋCB[EEEE܋E;E^]9]#}E܉D$4$]$FNj]ԋSuEƋE9~@9M9CSD$$EEԋKiSKD$B$EEԋCCEfED$D$E$]JEԋCEYEԋsSE@9 EPSP$#]7Eԋ@$a ؃[^_]Ëx}HJHw1 ;G}7ƋW,tGD$BU$]UB;G|ɋELME@8k 79FEЋEP z@tP N][]̅  MċEËM)ˉ]D$\$ ]؉\$D$$]o*U܉M2D$E)ȉD$ u؉t$EȉD$4$]-*EE@ ẺD$$]tƓ,t$D$$N1ҋEeE܋E@vE}E;xEԋuFECFCEԋXE7E@PhE@E$]SK}GD$G$Y3]OEԋE`8@@$]Z$$ ]9E(7E̋QY,E1ލ4}R,z9~uLIR~1ME܉]9uT$U<$]MUuՋE܉EűQpY,ЃE u؋E<}܋4;aUR,:z9~_y}R~}419uT$U<$]UuՋu؋E̋Y,QB}9~E@@%E9u~_})E1U܉M0E؋@D%EU׍FUM9ƋPB%M9uU}}E)Dž]9E̋EًU)E9EEE}ӉʋuEEȋE}EЉ]uċ]9]MEȉE܋ZE@,u܋xB,p1҉]M؉M9}L$M4$]DuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9E@uԋsEEzE̋Y,E܋4mEpuE܋]؋}̋q,"XQ9M$mE@8MEԋPuFD$FE܃$M&:U܉\EK]CD$C$ESPSPM؋E̋EuЉ9}9}}z}ӋBM!EuȉuȉM}ӋB9E܋u9~EEBDu9  tT  #FfFEBLfF9t!BDt$B|$]Hu E̋sE; [?1ɍ  UL$D$ <$]U€w֍V)ƉL$D$<$]mljEЋE̋@  EȉEu9~uE})E؋u])؃EEH,E9w]]]E})uu]9}u܉1}9| u9}9}9}E؅,9E܋u9pwE䍐  E̋@=vm EĉEE܋Hىωָ tftEĀEā =wEဃ)ȋ}܋OωփtftE܋uЉpE̋BD$ D$ED$$]AE؉uE\U܉uk|nd`t$D$$]EDd]Ɠ,t$D$$Ed ~Mċ]CED$D$ E؉D$\$$]w U܉M:D$E)ȉD$ u؉t$EȉD$4$]5 EE@/],L$MD$$DU܉tE܋M؉L$D$E@$DBE}̋R, }9}uE]E@,E]EE9E|EH,EE}؅'E@}ԋsE؋}9Ef r uv'E܋HE̋@1Et$qt$ $] W9}u܋]䍓  T$UċE܋@$ U(fv[1ɋE䍸  E䋀 EEpu@E܋}ȋE)NjE@X0ppuChG}uNű;JHED$ut$$]gƓ,t$D$$eBD$D$ D$M܉L$M $Ht$D$M@@p$BD$D$ ED$D$$M@l|$$ft$1|$$AE̋@D$D$}@@0$]ft$D$$|AD$D$ D$D$E$^t$D$@@p$5AD$E܉D$ ED$D$$tuv`D$1D$ ED$E܉D$E$]1Ɠ,U؉t$D$E@$]~@U؃9u1҉Ut$D$E@H$]E@U9uyD$1ۉ\$ ED$E܉D$E$]|$E@$eƓ,t$D$$?E)ED$D$ D$D$E$]E@|$$dt$D$$m?D$E܉D$ ED$D$E؉$]1Hz }p D$1D$ ED$E܉D$E$] 1Ɠ,U؉t$D$E@H$]>U؃9u 1E@Ut$D$$]>U9u HH_ppu;t#t}uNű;JXLJED$ED$$]bƓ,t$D$$=D$D$ D$M܉L$M $t$D$M@@p$=D$D$ ED$D$$aM@}؉|$$]ED$D$ D$E܉D$E$]E@t ]̋ ;qtE؉D$$]RaƓ,t$D$$(<D$D$ ED$D$EЉ$]E@E؉D$$`“,T$D$$;D$E܉D$ ED$D$E$]SEƓ,Ủt$D$E@$]H;Ũut fhEƓ,t$D$E@$]:u0L% E̋u;p EƓ,Ủt$D$E@L$]:Ũu^D$D$ ED$E܉D$E$]g|$E@I!t$D$E@L$]:uUWVSKn Ǹx]$719X‰PtFC:uk11ɋCD$ CD$C D$C$rtB[^_]]C9u07 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]Urm w,7$]UWVSWm wu] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$u>vF9u+07 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSl wut$W$vu[^]UWVSel v}GDE0798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$&tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$XtD$D$<$$1EU(k u,7$]ffffffffffUEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSj uU} w ty1 f.&t6~RutF$Yu1[^_]ÉU$t8U F@RuDžtÉv$ uG 멃UEU  HJHfJHfJU @ E]UVSi 'tutv$u[^]UWVS i sMq~X1Q,zQ~>1҉EM׋q tMv$BuME9xԋEM9A [^_]ffffffffUS] t[UӋE+v.&.&.&.&.& ȉt %1ȃ9u[]ËE[]UWVS]} 1115.t&.&.&.&.&.&.& ȉt %1ȃu1&.&.&Lȉt %1ȃuڋK tBu1ҍ.&4Ɓt %1uۋIuċu9 [^_]1[^_]USdg qE t$D$l $}x) 1[]É$91[]øUWVS4g }qU܉   E苃 E7E@E@pE؅7EE싳 tRyF%y }93}Ѕy}Ћ})щ})9uM)9IBljы U)y<93}}Ѕ}}A7L9+~ EЅD$D$E$m1ǃ  EE1ҋ u}u7E8 ; |~)EЋEHAE̅q}؃E9|9;T$D$Ẻ$0E@p ǃ ; QuJl @7lT$D$$i0 E8uuE@@l8 } ; MJ Alu  D$ <$l…y )Љ m t}艻 u䉳 4[^_]ËE17EEU苳 u}4y yFȉE7E8@7)}ЋEHAE̅ ; }tM؃99R D$ l $J) ǃ  ; y E 9Ul Ǎ"t$D$$\. ; ~a x E@@xu XD$<$y)  ;  ? t$D$E@$-  ;  uԀ> u)ʃ7El EԍEișǍry )ƋE9E@M؉L$D$$,  EE89~1$ & _$U ;  07uR,r@E؍l E0   } [9 EP, 4v4~}}܅uE@}؉|$D$$+  y}9D$D$E؉$+ǃ ǃ UN;H@uRFuLf~-$^ D$ D$F $V fI E@$ =   tD$ Eԉ$9…y )Љ 늋@lT$D$$v*  E9 ȉljM$ gf t'D$ Eԉ$y) $ Aǃ  D$ l $.y) ! E)ȃ9E@D$D$$F) 9 l Ǎ"t$D$$ ) ; ~b E@@xuƋ t2D$<$Oy) $ 4$됉Ƌ  t*D$ l $y) $  E1UWVS o\ fE苃 7M19|    9 7E79 9@7E,E)$ Eu ǃ E98.@@ltˋM t‹UT$D$$J'뵉  PBh9}d T$t$$ LƅtDE; t4$x U ,D$D$4$&uU1    [^_]Ë @7Eu@@h9ME4M䉋 E;0 GE  7p >u~x@7UƓ,t$D$$%mtGUt @@tut$D$$%@@lu$ mu ǃ 7E 9P))Ή  $ 둋 xǃ UhY cU U U  U 11]U,Y cU U U  U E1]ffffffffffffffUWVSX Fc%$72(7E07]19u9uVF,E1҉MEF~`CH1U.&.&9F~59uuS9~S 9}͉9FˋU9VMIS[^_]Ë]S~Cs, 9tɅ~UMڋXCӉu.t&.&.&.&΁9u9uu9u_FW a7BH8~NHD~GBlthtËuu拐tt 1V Ra7@ xUWVS$V ,aƉEY7EBH8ˁ=u 7}@D-=}7LJ $7Y\A`fAdBt%],D$D$ $!EBt8],D$D$ $!07p2!P@EBlhzǁl2ǁh2BxT2@@Tth2t h2t h2t h2 t h2 @t h2@t h2t h2E[A\sfǁrǁt5Wfǁ~ǁ;fǁǁfǁǁfǁǁfǁǁ|fǁǁt[tfǁǁ~>Rr&.&ff@f@@ 9uǁp"ǁt"~@p"p".&.&.&ff@@9u}싇 %ȋtp"xt"LJ LJ 2(7E07E ItiE9tE9tE싘 ZHB~&zr,EEz9uuMD$$]R[MIu1$[^_]ø7ˋtiǁl2w}UM܋HQf.&% ؉9u9ut͋UMD 7놋tǁl2]tOǁl2[UWVSQ €[EM ]fMf]f_7;7Nftv 7969+$7l2tot"уt>]f9p"t"]fp"]fr"1[^_]Ét"ufp"ufr"ft|WfffufEftoEft\fYfEN}f9r"at"yfufEffEfEfEfEfEu%UVS|O YEM ]f$7;B`N4f1Dfl2t1[^]ft_/ftMfufft2#ftEfuffuffufffff끸yUWVSN YEM MMUUf$76;F\<@<UfrftMfv7? tV2vtCL$҉T$ UT$D$4$>“,T$D$$1[^_]øUM AXEfx?$7;B\}1@rU f tUf vEf1]ø]oM W$7ǀtǀx7 t% ǂp"ǂt" u1U勀 %1]UWVSL dW}M $7l2t^ftfvǀx7 t) fp"fr"ǂt" uI1[^_]fPfftifuft_Bfthfj` %=1[^_]fuf/%뛻늻K BV$7h2UVS K !V$7l2tt f@d [^]7Rt,D$D$$ Ђ7M!A@f@d [^]UWVS'K ÜU t07} 3x@tOu f$7f9pdt6l2t307fpdQ@E % ЉA@[^_]΍N} f_f|S07UL$2@l$,;,L$D$$UUULf`L$2@h΍N} ff|07UL$2@$:,L$D$$nUUULfL$2@t$J:,L$D$$ UU07$UM fxGU07$fUM fH uS$7f@dUWVSH SSU$7pFFy ;F|# tH4$ [^_]Ét$$\UWVSyH RUu FFy ;F|# tH4$ [^_]Ét$$UWVSH ÑR$7x|$E$iƉ<$l [^_]UWVSG OR} |$E$/Ɖ<$2 [^_]UWVSG RU,7tX } xQH9M IX9}Bxp,9!39M t' u pP1[^_]Ë#39M uك׸[^_]UWVSEM UtY xSpu9|Ip9~BXx,9!4>9Ut'PH1[^_]Ë4&4>9Uuك׸[^_]UWVS UztzB EBE wGGtXNjEB_ ])؉ƋEBWU)Љ xыOM9NjO9}_W,9~ ! U9u뗃 [^_]ffffffffffUWVS@E fPE}E E EE E @$]ÅGE؋E @ uWUXts E7E_E))9~ىL$ED$<$]؃@[^_]à u:G1@[^_]ûkEGy1Gڸ@[^_]ËG,M؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9rTU).&.&.&.&.&AFAFA F AF9sڋUB E H %BfZE @E܃vKMȉ]ĉ}}$]tM \_ XG 9uuϋMȋ]ċ}EԃUt3uމr}ߐ)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]{L<$OH<$]7E9GTG8 <$]h~E D$<$], MԋUЉE E9-]ȉMĉ:BD|$B|U$]|UBHGfG9}s*w tUv$]IuUG 뜋]ȉMĉUB LUT$,7$]UWVS A ^Lu}ED$E D$4$t} u [^_] [^_]UWVS A Lu,78E D$ED$<$Atu } [^_]X [^_]fffffUWVS|-A KEMu ME $]GEMqM$]}EEÉEMAEȋQUċE @U zދ]7]t_ @ U$ ]ÅyEEę)EEĉEċuMqQ)փE9yUċAEȋE uEE7EEkEĉEE U rUUEσ tu[ $ ]yEEę)E]É]EE E  uFE EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9wU@t)G$fE9rFUv.&.&.&GFGFG F GF9sڋEȋUUċuV}ỦUUĉUUȉUUUu΋^,EEEF@ED$ED$ED$ ED$ED$4$]v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(6 jAEUM؋ufUވM݋U 1ɋU EEԋ}B.Et$$UEx}P$u܀G$R Ut}EMU E‹E Et~MލAf qCWЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wCWDž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS4 F?UE t\J;A t];tUZ {$u_Z[pۋtC R(D$ ƅt$D$$b1[^]ûu11U64 >  D$ ED$E D$E$1]U3 e>  D$ D$D$E$1]fffffffUWVS3 >ÉU:GEG<\<^ЍtB.z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PB. Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVS+ 67t t~9t $Q EED$D$E $!uI tG@t  ¤7  @x [^]É댋E[^]É @uUWVS(* J5UEtBEE7u4$ UT$ D$D$4$bM踵N)‰)_EีNe)‹E)_Egҍ)lmUD$4$F ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$ UuG([^_]1([^_]ËH pm([^_]UWVS(z) 3UEtBEE7Eu4$ UT$ D$D$4$}kLЍB),_E܉eЍBE),_E>)<;LlD$4$ ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$ MuՋGy([^_]Ë;Pl@x([^_]UWVS(( Î2UEtBEE7E܋{u4$ UT$ D$D$4$裴}-?L) RЍ)ЍXGEeE)  IȍE) GE*SRЍ)<;_D$4$h E܋;_AQ tUy$E܉uv.&9t(~suED$$ uދF E܃9u؋E܅tЉ)43LlD$E$ jEOMEuu4$ UĉT$ D$D$u4$TuĹ-?L) @)ЍXFUeȋE) @E)4FU։*SRЍ)43_D$E$ }tux}cur}ulGEEt}fOMrBEER3pm$AE'u땋3Pl$B3_$pCk}t EE$ UWVS f*E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىUi Uƍp@Hπwx9}몋E D뛉U) UUWVS9 ƞ)084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0xt,8C,{0K44y0q 1[^_]Ë0 8a$08 t@0@4$0ɕ8G,tG0ƅ`%0B. 1Dž$Dž(Dža`,4:~Jwɋ0nʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0oV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0oው,4O&4PD]Em PUT$,0 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$0yF8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0,Å8X,4H0@44,-0 1s0 ,40 ,1!4e0 1,40 14c,0_ 14,,09 ,&GwҋTq1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]U U|]UWVS c}u >}0D$$^+D$t$$`‹U$4UtUuE2$ƅ_EE[^_]Ë}ut$ D$$M$E2@ x tbMut$sD$$EQ D$$$ Ex tUE9ED$D$ht@E$o tEftUft IA(Q|uEt E1s$t!D$D$$=RB(~$\tD$D$$ RB끍H D$$}l D$$_t$sD$$EsD$$/UVS! ÖEtD$ E D$ED$E$ƋEt$0[^]ffffUWVS 6ƉEωD$$ tB4$ո ƀ?u1)9tXzzt"D$|<$m …uۉ<$蟸 9t 1[^_]Ét$ED$<$6 [^_]ÉUt$ED$<$5 Uu[^_]UWVS$ juEUt E<t] $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%]܆]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]8ljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$mUu$pEE܃@[^_]ËMAOMփ_EtfEtǤ${pE܉$ppEP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$oEp@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMxn 11EMIuE4$hnE܃@[^_]px11Eu؉4$;nѨu2u>Mt$IEUw r}fm밍t$ E0UUWVS UJEtB9swt$U$7jUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$dU[EfUWVS uVzF9sHtT|$$5it8~VM f FHNMLF [^_]Ëu1[^_]É<$cUWVST ED$,E$6 D$|$]a: xD$|4$]l HM4$] =M t<$͗ = E$]贗 =n D$$P]fÉE@ t$$Ut E t E D$,E$*E, EEEB.EȋEE u<.tk)ύ)ȍD$4$ t [^_]U #E=w ]1]UWVS u4$谉 UT$ D$D$4$5i}-?L) RЍ)ЍGEeE)  IȍE) GE*S)ύɍD$4$ t [^_]fffUWVS4 ufF(}ȉ|$$Rq t4[^_]É<$PM1".&.&.&t9lufV(4[^_]UWVS Éu  7fV E¤7 4$&V(EfD$FD$ $U蜦=UwDE |)ʉM싆t7T$UD$E$[U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$7[^_]ËUыU|UVS ?utgF$ZF$ZF$ZF $ZF$$ZF,$Z4${Z9 t 1[^]ǃ F  @: « @tÍ'ffffffffffffffUWVS flj$U D$$ Et$UT$U$:9UuED$$ 術 1[^_]ÉUED$$ 聓 $<UD$<UD UWVSd Ë 9EEEEƍEE> tqE9D$t$U$:Utˋ$ <$;UDŽa 8Euu>vt1< tHv0FFU$;$;UDŽUWVS<r  9U1ҍ Ӭt"u Džguԉ@!&.&O@6ƒ:uƅ/nFu$W>$8<( .Ɖ$9D$v9t$t$ D$D$o4$x@E+<[^_]rD$@|$/$r:tW.&P:uVpƅ끋1$a8Ɖ$p;Ɖ$?8D$-8$!8D$/;$8D$7賢$苣趢$8u$ƅD$/4$/tY1ɉL$T$/T$T$ |$D$4$t$uD$$h1҉T$T$ |$D$4$u빉ouIUWVS u}D$:4$T t!D$cT$$ t|$E D$4$5 [^_]ËU t考 [^_]UVS  ÒuD$:4$T t!D$cT$$d tE D$4$q [^]U 6Ewt ]1]ì]UWVSh} Eu 9M9}xUED$ uD$D$@U$U<UƒE9~ЉEΉ )t$|$ʉUM$3MUӉϋʉU$4uD$4UDM !}|$t$$~3uU+u h[^_]ËEUWVS` ÈEM 97upUMED$ uD$D$@U$UF;UD$$ 衊 EED$ML$ED$i1;EUT$$ u>i %!`ut$L$$'1U+uW`[^_]+ U$_3ED$P3UED跌 CUWVS` *EU 97t$\pwbtNT$E UD$ T$uD$D$@T$$T$9T$Mt>$uT$ U MT$L$$jk L$\+u`[^_]ø{UWVS bExw|Mt_ƃtAƍU$1ED$1UED [^_]Ãu$1Ɖ [^_]UWVSpF dz}EU 9u]]p3MmLm8@E Eߺ81tEI}E )|$t$ʉUM$]~/MUЉ΋ʉU$]0}D$r0UD܉ !\$T$$]h ]U+p[^_]ê0f%CD$D$ ]D$D$@}<$ 7mo8뎉f>~%E~LSC9u1Yf7k]  ]uUS ^EPw*Ӑt諈 -[]ÃӬu$'2[]US EPw*ӐtV -[]ÃӬuU T$$ ` []UVS 7 ìuD$:4$L t!D$cT$$~x tE D$4$ [^] - [^]UVS 4uD$:4$K t!D$cT$$x tE D$D$4$, [^]ËE D$D$4$ [^]US 9 îEMPw*Ӑt - []ÃӬuL$U T$$, []US KUBwÐt1[]Ãìu$^ []UVS uD$:4$vJ t!D$cT$$v tE D$4$ [^] - [^]ffffffffffffffffffUWVS  fuE1ҋE, xtGEljу1Uvt 2uU@u [^_]UWVSĀt }E| 9xƋEl p,A E,1 E|1E]E,I Eƒx  EB A ǁE9uʋE%u  ͭ EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËU, 1ۍU, @tBEtʍЉʍI$ wu1묋},A E@1ۍE,1 EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }C\uE,^@]l1҃DD  u̓E9uE,- :*.&@t$E,Du۸@u܋}, Ƈ, l}8,T 8, 0u}̫, ]  ]EC M[ }~Et M  ЋU 1ҋMDŽ  DŽ  r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹Elt a1v`,tEUEEt @Eǀl -]UWVS`B ³uE EM 9ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE,- EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEE E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ, ]3, ]3, ]3, 3,! 3," 3,# ]3,$ 1EEԋ,% ]3,& ]3,' ]3,( 3,) 3,* 3,+ ]3,, 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u, u3, u1E䋼,% u3,& E1ljE3, 3,' 3, 3,( 3,! 3,) 3," 3,* 3,# 3,+ 3,$ E3,, }m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1, E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEE UWVSPm EЋ}] ] 9EƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍu]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝ  }}̪̍?tLD$ D$\$$.t&Ҁ09u$?uE]Ј  E؃  }E̪ủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝ ]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍuN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍ$ ${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]/UWVS蝷 E 9EEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]UWVS, E؋U 9E]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSD9 U uU 9‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$: @D$$  @D $9sӉ t׉D$@BD$ <$L$  $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$譻D$$葻(D$$P4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$vtD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*|UWVS `Eu 9E1D$D$,I $iDžDž4$8$u vt$4$Ɖ$i^ DžD$$8vu[x=uUT$$l D$$: DžDžDž DžDžEg|$4$-pt5tmuIT$$x'멍T$$ye뇋$01U+Ĭ[^_]ÍT$$.x+t$u$^ uDž't$u$k^ DžOD$$ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$t*D$ 27D$D$p$$1.[4$NZ |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$D$D$p$)$&D$uD$@:.$7(UVS蛫 uv$H‰)Ѓ[^]øh`UWVS4U εÉED$uut$u 4$Y u3D$ ED$$EE8$E $]豳h`)‰UE E h`9t$u+E E܋E$]W NjED$ut$u t$u܉t$ uD$D$bLK E$,K t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃uD$D$b}<$WU^D$O O ȉD$$EPU9uD$]>K ?K  ,K ȉD$$dEPU@D$D$4$E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVSc Ȯ9ЍPH USM HvH?aЈ>Df`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂK $2?ƂK aDK ƄK $,T$ vT$D$$7H4$tI `D$HD$T$14U+[^_]Íxƅ?n)nOPEȉHTDUWVSI þu(}  9E14$UH $?$u 1H t $t9u틽)x  @4$$D$(|$4$ D$vD$4$T$|$4$}<$T$D$(L$<$T$T$<$$D$(L$<$v|$0, $}$lj~T$,D$4$&Dž0Dž4Dž8Dž<$D$#,D$<$u։fǃL $1ƃL $ D$D$L $ dD$xvD$ B$et$,$m1<$ʉ)Ѹ%I$))Љ)‰ ;$D$(D$<$ ɋoD$,D$<$|$,$:L lL D$06 < ȉD$$lL lL D$17 = ȉD$$lL lL D$28 > ȉD$$TlL lL D$39 ? ȉD$$lL lL D$4: 5 ȉD$$lL lL D$;T$$lL PlL @D$D$,$(E+[^_]D$,D$<$ ɋ$D$(D$<$l|$,$y$D$(D$<$6p D$D$<$ ;$D$(D$<$[ D$D$<$ &(D$<$$Dž0Dž4Dž8Dž<Dž Dž Dž+ffffffUWVS芔 MMUu 9ƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$ͯD$@|$<$0E D$D$<$|$$,<$耯D$@t$<$D$t$<$ϯ|$4$E+[^_]Éu4$ UT$L$4$qt$4$膱Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TfffffffffffUWVSQ ƚutJD$ED$4$NjE9t58u0M 8"tE 81[^_]ÃuE M UVS MEU ]~<ÍLt&.&.&.&у? H9u[^]UVS臏 EU ]~Íу? H9u[^]fffUWVS81 æƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$et8[^_]É<$uEĉ|$4$2Eă8[^_]U茎 Et'tu-E t:%v]ËE t#v]ËM t v]1]Íu]Íu]Íu]UWVS Ïu} 4$uw[^_][^_]UWVSdҍ Gu}$}(E($ZEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$<<$ UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$5UtE(D$}<$ E0D$E,$ <$E jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSV ˓u4$u1҉[^][^]UVS Óu4$u[^][^]UVS Xu4$Zu[^]}[^]UWVS览 }u <$…uL}wPU>…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSX ÐM $C5 ƉEE$ljE4$ƉEE EEEED$ML$}<$/t.1EM $M $4$EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS詆 }u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVS2 ç}u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVS貅 '}u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úU< ­E##+ፂ-v]Í#]Ít ]Í ]ÍDv]Íw]Íw]Íw]Íw]ÍH ]Íx ]Í ]Íw]Í ]Í ]Í0 ]ÍP ]ÍXv]Íkv]Ív]Ív]Ív]Ív]Ív]Ív]Íw]Íw]Í0w]ÍGw]Í`w]Íyw]Íw]Í ]Íw]Í x]Íx]Í.x]UWVS WEwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu$0 tffUS / U T$D$U$ []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVS ju Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG U~ UM ̲tt M U],]UWVS4T~ ͈MU 9ËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&D̲ɋtxD$$̲ҋtFD$4$2Z ̲tt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$e؍ŬUWVS 3| E}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$]' [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0{ Ë}wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;Hu̲tD$$]E+u <[^_]ËUEU Mt t]%]UWVSXOv ĀuU 9E1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS X cu} FEFED$E$?$ug$E D$EUT$<$ u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=uztUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$t? [^_]øUWVSXV 0a}EE 9UE1D$E$ƋẺ$E]} Kf$OME Eĉ4$ U9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$XUĉT$ D$D$u҉uȉ4$i4$ ‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$qi4$i 9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$h4$ ‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$_h4$W ‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉf賁UMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVSP [Ѝ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$,$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSLB MuE 9U1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFT#rUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVS?? Ilj(UE u 9, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(mUWVSd< gGML$U T$ 9D$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$E$!2.8t!\$E$wuD$u ]w]]D$ET$$]]UVS8=3 ò=EEET$ T$(2.=w ,؅ك\$0!D$0e[^]؃xD$D$L\$0D$$ /D$0؃&~fxD$D$ \$0D$$R D$0ZD$cM xD$\$0D$$ D$0 D$c xD$؅; ك\$0D$$D$0D$c yD$؞ك\$0D$$RD$0ZD$cyD$س\$0TD$$D$0 D$c yD$\$0D$$D$0D$cxD$\$0 D$$kD$0sD$cxD$\$0D$$!D$0)D$cxD$\$0;D$$D$0D$cc:D$*ك\$0D$$D$0D$cGxD$ك\$0D$$:D$0BD$c xD$H ك\$0D$$D$0D$cxD$\$0: D$cb xD$) ك\$0D$$jQD$0rD$c :D$P ك\$0D$$!D$0$D$c dxD$d ك\$0D$$mD$0D$c LxD$T$0 ؍D$$D$0D$cAxD$T$0 ؍D$$4D$0~!D$0 "D$0 r!D$06 T"D$06!D$0f !D$0H!D$0* !D$0 6!D$06@ !D$0I!D$0 d"D$0qF!D$0v, (!D$0Xa "D$0:b!D$0!D$0|!D$0g!D$0Nt"D$0V!D$08!D$0h6!D$0J!D$0,!D$0!D$0!D$0,!D$0mf!D$0H"D$0x *!D$0Z !D$0g@:.D$ D$D$>y$ a@:.D$ D$D$y$ڙ@:.t$D$$Nt$ D$D$z$藙 @:.D$ D$D$fy$e@:.D$ D$D$y$3@:.D$ D$ D$ $@:.D$ D$D$Cz$Ϙ4@:.D$ D$D$lz$蝘l@:.D$ D$D$z$k@:.t$D$$t$ D$D$z$(o@:.D$ D$D$y$!D$0@:.D$ D$D$Wz$谗5@:.D$ D$D$y$~@:.D$ D$D$y$L@:.D$ D$D$)z$@:.D$ D$D$y$]@:.t$D$$\t$ D$D$z$襖@:.D$ D$D${y$s@:.D$ D$D$z$A@:.D$ D$D$z$@:.D$ D$D$y$ݕ@:.t$D$$Qt$ D$D$z$蚕@:.t$D$$t$ D$D$z$W@:.D$ D$D$y$%ffD$1ffffffffffffffffffffffffffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS ]E81}8tmCC tvS(s$taD$D$$ЉƅtoC@8@4?E D$$tt$C($S$C [^]K$C C(1vиUED$ E D$D$E$]UVSEM t]X tVP$tOPtH;uDB-4?w7t-x:t&(r@1 w#EB?EEE@D$D$$]@UBu܉F0B??E E@}EmEE@N?EP B M}]؋u.t&.&.&Fǃu}M]؉uKwE*]ЍuFPFX LFTF\FG?} mmUԋE@H?}؃ U E܋]ȉX PUԉxu}~<}~@ỦT$lj$]\/ }ȋPU]ԋ@E؋Fߋuԃ(tftE@t E@ >)UUԋExD})щHDE@uFDF:?E@}W$tB}GDG;?uV$tB$uFЍt&(M9}U؋u.t&Fǃ9u}MU؉uffB " f= fuN9}U؉MuԋE).&.&s9u}EEUȋ]4EuFD]FH?.)W,WUUMЉ‰EE!MUЍ D89U\ uuUԉ}}|;v.&.&.&.&.&.&.&BEME!MMȍ MDM9 uu}؉U)11]؋uvFǃuu)ƋE@DCE@ E@ : t$EԉD$UB$]gUB)uuԅRuU؉]ԋE@$t]XE@t @ E@7?11U؋] MU؉]ԋUvm)E]艃{DE@M?UuMU؉]ԋ}EG<0EЍWu܉FE@Q?EuMU؉]ԋ}uVdFh ^`}mw EЍ E@ E@  t$EԉD$UB$]DfUB)uuԅRAE@G?} EEuFHUVLFK?fM9}]؋u7t&.&.&.&Fǃ9u'm)EU艂zD Eǀ@??N}MU؉uԸЋU!Ћ}GDGDU)]$}}M]؋u)&.&Fǃtu[}wr}M]؋u}M]؉uԋ]̉؋u)}G}G E@O?EpEE11]؋uh}]؉uԋu]^DF$tXVt ]C }G9?EEG}M]؉uԸЋu!]CHu)U[EЍzEPD@B?} EESz@EЍ{]܉CE@Q?EL}M]؉ut }1uF$t @0V EB))9EEЍW>tBO)ڋ]ڋ_ۉD$T$ $]b]CU܉B0S 1 EH];XEЍ|U܉BE@Q?EEE)N9'}U؉MuԋE4.&.&.&s9u{EЍO{]܉CE@Q?mmUE}ȉU؋uԋ}Q })EM9MBMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋u}~lbuu}؉UԋU}]Zf]m)uUT$UEԉD$uF$]`FUUQfU_EȋU;B4EE1}}!EED$ED$uF$]w`FEЍ{ ։u!މ Mt M9M]]}}؉EEF&puMu!MM΍ MtM9ou]}؉EKEXL@I?E@l@E?1N9{}U؉MuԋE6v.&.&.&s9'uv}ȉU؋uԋ}Q})E_]MU؋uԋUwHEЍQ&].&.&.&fDSt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]r{U܉BGQ?uE u5UEP$t EE@t @ E@6?11ɋU؋]E@ TfvPEfED$ED$uF$]p]FF7MM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)u}twruԉփRu=E@l@F?XdPhUuEcE@ y%E܋]ȉX ]XUԉ]؉XEUP<]X@E-UUEEyYEX(u@(D$D$$][uFfED$UT$$[FF5?11U؋]]]EEx@O?]Yf]^}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$] UM{]܉CGQ?pmEUB(uJJ(vLmEЍ'{-EfED$ED$uF$]ZFw9ȐruF1ɉNL$L$ $]aFU܉B0eF??1҉UAE]ԋEЍF|]}GpGTG\L$G\D$T$ GhD$GdƉt$$]V {U܉BGQ?;f tURGmm1EĉUeE@=?11ɋU؋]E@O?UVS]iu9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0t?t*U UMu[F [^_]=>?u>D$D$$^ML$M L$$t^9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ /EԋMM 9E܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$IExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffffffUWVSv uMx11D rt"E pt&.&fDU9ux.t&fG0UofxZUWVS4 }̉ÉEЋ@,E܋{t-Ek@^S,sutftߤEw uEH,@lu6^};s9sӅz}G8‰ىuFl؉Flv,)9_ʋ}?EE؋})EE@,u~89Edž3)ƃj'E@,uFl‹uF\l] Lus<9S} 5E19믺}O\)ȉ9ۋuVlv}4M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^t]FDVLfDPTT$D$$)dž% @9E,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS q EuE E]E}}}}U M$:18FV ~$h}uEMQ~HHtk_} U}KB/&} } M}W} }؉1MD$D$F($V ÅMF0@*x@H0x,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]MV$MV F(d V [^_]øCE`k-@F4$U ED$ED$D$D$D$ D$E D$E$j]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8 C,{@uv@ CL{DMqD-{uvueu^CMQ+QS $ | 0 E[^_]älfbft.t&eft&W(f.t&fu5AfY{8f3f+0f(-f%*$E1E%ffffffff薔 ,UWVS<| EċM uS}׃,]f.&.&2A3Ѓu߉׉MEEEE]č,UȉEuϋ1EԋM3OMЋU3WŰu3w u܋u3wu؃4E‹EE܋EE؋EU} U E34}Nj<1}}Nj<1}}Nj<1}Uȋ1EEUu} m Eu] 1}3؃uU3Q1к}3؃uU3Q1к}3؃uU3Q 1к}3؃uU3Q1ڸ}3ڃu߃ȋ]č,1UM 1ω32P3<H1ω32P3<H1ω32P3<H1ω32P3ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+ øU)9fGHOWGHOW)ULuuJE0,uTUU ھ])9 fOY_wWJOw)ًUML fu苜]u'ME;uMU]u+,Ɖ кu)f9OWrwWGpw )щfEDE\uΉ.Eu,E]؉E$]ˉ]ERD$U_NjFD$U$藎tE 8" [^_]1 [^_]UWVS d Ën}GtUD$UN_ƋGD$U$1t+4$艦=yarauE 0! [^_]É4$諣1 [^_]UWVS c n}GtUD$U^ƋGD$U$贍t+4$ =tciduE 0(! [^_]É4$.1 [^_]UWVSc ÑmED$E D$E$.tSEt4}D<$;^ƋED$<$!tE01[^_] [^_] [^_]UWVSb lED$E D$E$tJEtZ}D<$]ƋED$<$荌t54$=yarauE01[^_][^_]É4$[^_]UWVSa RlED$E D$E$tJEtZ}D<$\ƋED$<$t54$:=tciduE01[^_]L[^_]É4$R5[^_]UEU E MMM]GUEU E tcidMMM](UVS` jkE D$E$gwƉ$舣=tciduE0[^]1[^]UVS` kE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS L` jE$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]US_ gjE D$E$dvUT$$c@[]US_ .jE D$E$+vUT$$@[]US_ iE D$E$uUT$$A[]USG_ üiE D$E$uUT$$;A[]US_ ÃiE D$E$uUT$$oA[]US^ JiE D$E$GuUT$$xA[]US^ iE D$E$uUT$$A[]USc^ hE D$E$tUT$$A[]US*^ ßhE D$E$tUT$$PB[]US] fhE D$E$ctUT$$B[]US] -hE D$E$*tUT$$B[]US] gE D$E$sUT$$B[]USF] ûgE D$E$sUT$$B[]US ] ÂgE D$E$sUT$$B[]US\ IgE D$E$FsUT$$B[]US\ gE D$E$ sUT$$B[]USb\ fE D$E$rUT$$B[]US)\ ÞfE D$E$rUT$$B[]US[ efE D$E$brUT$$B[]US[ ,fE D$E$)rUT$$B[]UWVS |[ eE$D$9t,ƉD$E D$E$rlj4$7 [^_]1 [^_]UWVS [ ÎeE$D$09t,ƉD$E D$E$rlj4$Ԛ [^_]1 [^_]UWVS Z +eE$D$8t,ƉD$E D$E$qlj4$r [^_]1 [^_]UWVS TZ dE$D$l8t,ƉD$E D$E$Yqlj4$ [^_]1 [^_]UWVS Y gdEU$T$ 8t,ƉD$E D$E$plj4$讙 [^_]1 [^_]UWVS Y dE$D$7t,ƉD$E D$E$plj4$L [^_]1 [^_]UWVS .Y ãcE$D$E7t,ƉD$E D$E$2plj4$ [^_]1 [^_]UWVS X @cE$D$6t,ƉD$E D$E$olj4$膘 [^_]1 [^_]UWVS hX bE$D$6t,ƉD$E D$E$molj4$$ [^_]1 [^_]UWVS X {bEU$T$6t,ƉD$E D$E$ olj4$— [^_]1 [^_]UWVS W bE$D$6t,ƉD$E D$E$nlj4$^ [^_]1 [^_]UWVS @W õaE$D$5t,ƉD$E D$E$Cnlj4$ [^_]1 [^_]UWVS V QaE$D$=5t,ƉD$E D$E$mlj4$藖 [^_]1 [^_]UWVS yV `E$D$4t,ƉD$E D$E$}mlj4$4 [^_]1 [^_]UWVS V Ë`EU$T$x4t,ƉD$E D$E$mlj4$ҕ [^_]1 [^_]UWVS U )`E$D$4t,ƉD$E D$E$llj4$o [^_]1 [^_]UWVS QU _E$D$3t,ƉD$E D$E$Tllj4$ [^_]1 [^_]UWVS T b_E$D$M3t,ƉD$E D$E$klj4$觔 [^_]1 [^_]UWVS T ^E$D$2t,ƉD$E D$E$klj4$D [^_]1 [^_]UWVS &T Û^EU$T$2t,ƉD$E D$E$+klj4$ [^_]1 [^_]UVSS :^E D$E$7jƉ$X=gntst 1[^]É4$'tU[^]UWVS hS ]E$%%t,ƉD$E D$E$tjlj4$+ [^_]1 [^_]UWVS S Â]E$$t,ƉD$E D$E$jlj4$В [^_]1 [^_]UVSR (]E D$E$%iƉ$F=atadt 1[^]É4$kwtUEt 4$+wM[^]UWVS BR ÷\ED$E$iut,ƉD$E D$E$Gilj4$ [^_]1 [^_]UWVS Q U\ED$E$ut,ƉD$E D$E$hlj4$蜑 [^_]1 [^_]UWVS~Q [E D$E$gƉ$=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$ 1UVSP g[E D$E$dgƉ$腓=gntst 1[^]É4$=$tU[^]UWVS P [E$R"t,ƉD$E D$E$glj4$X [^_]1 [^_]UWVS :P ïZE$ "t,ƉD$E D$E$Fglj4$ [^_]1 [^_]UWVS O TZut*t$E D$E$flj4$謏 [^_]1 [^_]UVSO ZE D$E${Ɖ$"=loobt 1[^]É4$WzU[^]UWVS 6O ëYE$lyt,ƉD$E D$E$蝊lj4$ [^_]1 [^_]UWVSN OYE $yt%ƉD$E$Plj4$裎[^_]1[^_]USN XE D$E$sUT$$.[]USNN XE D$E$:UT$$I/[]USN ÊXE D$E$UT$$/[]USM QXE D$E$ȈUT$$/[]USM XE D$E$菈UT$$0[]USjM WE D$E$VUT$$ 0[]US1M æWE D$E$UT$$A0[]USL mWE D$E$UT$$0[]USL 4WE D$E$談UT$$0[]USL VE D$E$rUT$$1[]USML VE D$E$9UT$$"1[]USL ÉVE D$E$UT$$.1[]USK PVE D$E$džUT$$;1[]USK VE D$E$莆UT$$;1[]USiK UE D$E$UUT$$;1[]US0K åUE D$E$UT$$T1[]USJ lUE D$E$UT$$T1[]USJ 3UE D$E$誅UT$$`1[]USJ TE D$E$qUT$$m1[]USLJ TE D$E$8UT$$m1[]UWVS J ÆTE$D$((t,ƉD$E D$E$qlj4$̉ [^_]1 [^_]UWVSI #TE $D$'t%ƉD$E$lj4$p[^_]1[^_]UWVS RI SE$D$i't,ƉD$E D$E$貄lj4$ [^_]1 [^_]UWVSH dSE $D$'t%ƉD$E$^lj4$豈[^_]1[^_]UWVS H SE$D$&t,ƉD$E D$E$lj4$O [^_]1 [^_]UWVS1H æRE $D$I&t%ƉD$E$衄lj4$[^_]1[^_]UWVS G KRE$D$%t,ƉD$E D$E$7lj4$蒇 [^_]1 [^_]UWVStG QE $D$%t%ƉD$E$lj4$7[^_]1[^_]UWVS G ÎQEU$T$1%t,ƉD$E D$E$zlj4$Ն [^_]1 [^_]UWVSF ,QE U$T$$t%ƉD$E$'lj4$z[^_]1[^_]UWVS \F PE$D$t$t,ƉD$E D$E$轁lj4$ [^_]1 [^_]UWVSE oPE $D$$t%ƉD$E$jlj4$轅[^_]1[^_]UWVS E PE$D$#t,ƉD$E D$E$lj4$Z [^_]1 [^_]UWVS _IE$D$Kt,ƉD$E D$E$Jzlj4$~ [^_]1 [^_]UWVS> HE $D$t%ƉD$E$zlj4$I~[^_]1[^_]UWVS +> àHE$D$t,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS= vlj4$y[^_]1[^_]UVSt9 CE D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS 9 xCED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS 8 CED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVS?8 ôBED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS7 YBED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS7 AE D$E$urƉ$z=gntst 1[^_]É4$ P$UDžtڋUT$D$4$ t U:[^_]É<$1UVS6 rAE D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS 6 AE$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVSE6 ú@E $t%ƉD$E$rlj4$v[^_]1[^_]UWVS 5 f@E$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVS5 @E $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVSB5 ÷?u t#t$E$qlj4$u[^_]1[^_]UWVS 4 m?ut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVS4 ?E 0Ft%uFt$脵4$|1[^_]ÍM <$fFt<$W1[^_]Ét$ M ${<$3FUS4 Í>D$M $̝D$ M $1[]US3 E>EU 9t8J 9H u(Rt<@t-T$$[]1[]ø[]Í'ˍ'USa3 =E @tUT$$[]ÍL D$ D$D$tt $US3 {=E @tURtFtAD$$U5U [^_]K4$l [^_]1 [^_]Í'UWVS - Á7utJ 9u@~ G$营…t,Ft/D$$U~U [^_]1 [^_]Í'U, 7Et 9t1]Ë@ ]U, 6Et 9uP@tt ]1҉]Í']US/, ä6Et 9t1[]ËU tH Q9Ur@tD$E $}[]Í'U+ B6Et 9t1]@]UWVS+ 6}t; 9u1G $ƅtGt"D$4$<}[^_]1[^_]Í'U9+ ª5Et 9u @t ]1]vÍ']UWVS* m5ut 9t 1[^_]ËU tM 9uFtA F EP$UUDžtŋE HɋUtOFt@L$D$ D$T$<$ F~}~ t$ds'븍'UWVS4* é4ut 9t 1[^_]ËE FtE $8F EH $M茢…tFMtI} |$D$ D$L$$UFFUV}~ t$蜪o'믍|D$ D$D$;t $USL) 3Et 9t1[]ËM tM 9uL$$mUS) z3Et 9t1[]Ë@tU T$$[]Í'US( &3Et 9t1[]Ë@tU T$$[]Í'US]( 2EU tG 9u=t99 u5Rt@tT$$b[]Í'@uፃ'ٸfUS' h2Et. 9u$@tU T$$[]Í'fUWVS ' 2u~(Ft  [^_]D$ED$ D$D$4$tȋUBU$DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ 耟ƅt' D$4$PfFF FE 0 [^_]É<$蘧D$eD$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]US& }0'D$ $0M $[]US% ?00M $[]UWVS4% 0M EpAQAtp}D$ T$L$D$ uԉ4$D$|$E$Bqt2t$E$"nt|$E$7r4[^_]Í14[^_]ÉD$ T$ D$D$ uԉ4$ey D$ LD$D$< $:UVS$ /E 0t$LM $4$u1[^]USX$ .D$0M $ LD$LM $1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS# .ƍ'D$ $覐0M <$vt$LM E$Et $Eb<$JUЃ[^_]ÉE<$2$ śUt֍lD$ $MbMAFAFA<$t$E$Mt+$Egb<$ÌM $趣UЃ[^_]ÉL$ME$M9uE<$臌UЃ[^_]Í}D$ hD$D$M< $UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS'! Ü+utl9u4$`[^]1[^]UE@]UWVS Q+Et l9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YU ‰*Et l9t11]ËP@]U \*Et l9t11]ËP@]U /*Et l9t11]ËP@]U *Et l9t11]ËP@]UVS_ )Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS F)Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUSM ¾(Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE US Q(Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE Ut 'Et l9t1]ËHP@txE P]US1 ¢'Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UVS 1'Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS6 §&Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS &Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UB ³%Et l9t1]ËHP@txE P]U q%Et l9t1]ËPH9иrE ]U ,%Et l9t1]ËPH9иrE f]Uu $Et l9t1]ËP@uE ]U< ­$Et l9t1]ËP@uE ]U t$Et l9t1]@uP@xM A]ËP@M QU "$Et l9t1]ËP@uE ]Ux #Et l9t1]ËPH9иrE ]U3 ¤#Et l9t1]ËPH9иrE f]U ^#Et l9t1]ËP@uE ]U %#Et l9t1]@uP@xM A]ËP@M QUSZ "Et l9t1[]ËM tM 9uL$$\US Ë"EU Mt l9t1[]@t Xxx3P3H []US A"EU Mt l9t1[]@t Xxx3P3H []UVS !Eu ]t l9t1[^]ËPH@uxx11 [^]UVS5 ¦!Eu ]t l9t1[^]ËPH@uxx11 [^]UWVS$ R!uEEEEVt $[^_]À~(u~-+0u xZIE܉D$}|$F$ugEUщ¸9иeEF>t"D$ooD$4$VJE@U $[^_]E E܉D$ED$F$fEUE܉U}9EXV8"J&<8"0f,E܉D$|$F$ΙEU!Ѓt4MEFcD$ED$8"ut&4fffffffffffffUWVSP #<$Wf0vH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$c>_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS<7 ì4$cB BBB$BBB(B8OwuBfn'"H[v*B<DžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{BbJHJx"t_Mxaucxlu]xsuWxeuQHBzB(Jxru+xuu%xeuH̃BB(MP)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{^<$O1USEt&.&.& w u[]US  NE ;Et1 []ÉD$ED$E$9 []UWVS ]u}E E $谻VEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]%8?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]}D$ D$D$h $f)щN$x>qUWVS, EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$prvvxEpD$1}t$$t}(u GtLt51E${[^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVSx $Ghp$|tD$D$E$gǃxD$<$̙aEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$1^Ƌt0<$gd3D$L$d4$ollp ȋdE D$4$aNjtPD$T$l4$llT$4$-t$轃Ĭ[^_]1)<$ft$蓃1Ĭ[^_]D$D$D$D$ D$hD$l$ ]lthȋtGL$4$],t$1nUD$E$U]fffffUE 9E]UWVS % ƅtBD$$8~Et E$@ zDžMu% $n1\$@yDžtED$<$@D$G$lEG,w0G4G8G<[^_]US e \M $j[]US ? D$,$m\M $j[]US  D$\M $@jD$xM $$1[]USD ù ED$E $j[]US Ì ED$E $:[]US \ E$kE $k[]UWVS( & UM܋p4@,EEGEt@E<E tDMUD$E$菮UMtLօuE܅tE܉1([^_]ÍA}D$ p}D$ lD$D$ $KUWVS uFt09u&x<$WeƉ<$Fe[^_]ÍD$ D$D$ $ӰUWVS* ßƄt1XƅtptC[^_]ÉUx<$d1ɋU'ƅtpt<$d[^_]ÍD$ PD$D$ $8US E xt"D$ D$E$r[]Í~}D$ D$D$  $ѯUS* ßUB4tB4R,…t8$7[]Í}D$ D$D$ $m]}D$ D$D$ $CUWVS4 UM@8t 14[^_]ÉƉ׍PU$DcMDžt6pE$6EG4$67E$c4[^_]ÍD$,$6d\M <$aED$xM E؉$E܅$w6<$`V09V4E$X6N4~,UEE؋UЉMԃD$E$豥MԋUvA)D$E؉D$D$QEF,}܉8}xF4F<<$`E$HE܃,n}<}ܜ$~nEMD$ $F5UT$MA$GEM܉H<$_UT$U؉$kE܅$5<$l_E@,vu1<$/^0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$ D$4$~D$4$=4$<U܋T$4$P tEO49H1EgEq<$\D$4$ ?Ɖ0[^_]Ë}4$Z<E$5mID$4$9n}э D$ D$D$ $}E$5n 4$;EԉD$4$|=}D$ D$D$ $輧UVS ÉE 0t$xM $AF,v u0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃D$ D$D$$ 8D$ D$D$$UW Et,9u@]1]US' ÜEt ,9t1[]ËM tM 9uL$$US UEt ,9t1 []ËM9H uU tL$M L$@$} []UWVS u>t=~(u7Ft=D$ fT$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MPEtFVT$U$MUs9}D$mD$4$ $Et l9t1[]ËM tM 9uL$$fUVS uFt [^]À~(tD$ 0D$FD$F$Vu_D$ (D$FD$F$.tWAD$L$#AM 4$E 0[^]ÍAD$L$@M Ǎ`D$ D$D$$)fffffffUWVSq ƅtBD$$OEt E$@KDžMu% $/T1d$@KDžtED$E<$ED$G$}>EG,w0G4G8G<[^_]US E$o>E $a>[]UVSt Pt@9 u6p 9rt 9t%$c$Y [^_]ÉUMGE$4UNjE$3Ut$ M9t;E [^_]x~D$ LD$D$4$hA$衸MA8,uA1)UE]UWVS }9GE$;3G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$2UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS %ut 9t 1[^_]Í~<$\2v0<$Q2[^_]UWVS_ ut 9t 1[^_]Í~<$ 2v4<$2[^_]UWVS Ãut 9t 1[^_]Í~<$1E 9F0r<$1[^_]ɉUWVS u~<$l1Ɖ<$[1[^_]UWVSi u~<$/1F8uF8<$1[^_]UWVS* ßu~<$0v8փ<$0[^_]UWVS cut<9u2~<$0F49E s+F,U 4t"<$0[^_]1[^_]1ލ~D$ D$D$a4$|UWVS] ut 9t 1[^_]Í~<$ 0F8u`F4;E t\9E seE V,tUEE$N,UEF<U$<$/[^_]1UA܍~D$ D$D$4$({~D$ D$D$4$zUWVSU ut 9t 1[^_]Í~<$/U Ɖ<$.[^_]UWVS put 9t[^_]ÍFE$.~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$.E$[^_]ËE$-%~D$ D$D$4$zy~D$ D$D$4$PyUS Et 9t1[]ËM tM 9uL$$FUSb D$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]US jD$E$A[]US =D$E D$E$ []US D$E$[]fffUEU @]USN E$;t[]Í~D$ LD$D$p$wUWVS0 j$}`HtыpG$萍`tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$ Ku}DžPtҋ@w4$躌)T$$PtЉ4$~taNjPu냍~D$ 8D$D$$u~D$ 8D$D$$u~D$ D$D$$u~D$ D$D$$cu~D$ D$D$$9utыt$P~D$ D$D$$tUEt]1]UWVSD& Û$UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]Í<D$ D$D$#$rEEU D$E D$E$]UE]UE@]UVS W]C$$;[^]fffffffffffffffUWVS莺 ƀ8$gD9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$fP /.pl@istX@XXXXf@ X $;ƃtb|$D$4$(9v84$q$Ӫ1v8[^_]v?1[^_]PƄ$fى4$g^$lj$ׁ|$4$+D$$ v84${UWVS ouM ^t^F9tX^ [^_]ÉMD$$c5…FFM빍~D$ 0D$D$9`$n~D$ 0D$D$:`$nD$ 0D$D$;`$n1<&M䍙D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$Vuύ T$ T$D$#`$jt][^_]UVSŲ >]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍 T$ T$D$D`$iE >][^]UWVSر Q]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]Í T$ T$D$c`$dhD$/$9E >][^_]UWVS 荰 UyEx i} _$(ƅI$(+FFF E Ft.ED$4$ׄuG$114$0 [^_]Í < t~D$4$uD$ 4$tFu.D$4$tD$ 4$wpD$4$_DŽ^O)D$D$4$G)D$ 4$Ex 4$ 01 UWVS cED$E$;t>Ɖ$ \E lU4$/lU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVS ÉutFwyM MJ]ZMJ [^]$W&t|] X]XMH ]X뼍7D$ \D$D$A$dD$ \D$D$B$d1fUWVS ÎUu }t`t`tAtA}tA uutA} $-[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍D$ LD$D$Z$cUWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ Ɖ) ‰L$D$$_ f1 [^_]ÉM4$aM랹č#D$ D$D$>H$U@넍EUWVS輇 1Eh"l9}ptDžxAEEEEEE|(D$ut$$ D]E$D$t$$CDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$XD$4$ |$4$%D$04$c9D$hD$t$ D$ӤD$0$U,c4$,4C8D$t$0$tD$(D$$^BD$$D$$@BD$|$$4[^_]D$Ӥ$X[^_]Dž4cB,Dž4GD$(D$$AyD$(D$$}AD$$D$$_AUWVS@{ t$(D$T$L$,D$,t "|$GD$8UT$$\$(.uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$($D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(?"D$8D$D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(wD$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(H;"D$8D$D$8HL$L@L$8t$@|$D<*tXD$=E$/EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $)u֋U$U9t5EuEEEuU܅/EEUUыr/Eԅ0t3.t*E8:t"UED$ED$,$轹MA70E<-<+<::[B9FB 9F  E;u~#9E'xt3.0tE8:tD$W$7WE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$Ett p1pu-x//ED$ t$D$`H<$EED$ t$D$<$*t3.t$E8:tED$ED$T$7?*D$ D$D$aH$4Eԅd}؉:t0Ex pq yMMMyM؋E'xEEEЉpE $MЋtp+t)kExut3.8tE8:tt$$u70t3.E8:ED$$7qx:#EE9E:E MM؉:ŨE uЋE؉t3.t+E8:t#MED$$谵EЋMq1´7EЉE<-WK/ED$ T$UD$`<$EUu*D$ T$D$a<$t$ t$D$<$*D$ T$D$a<$ 'xt3.E8:t$$袴A *D$ t$D$a<$*[u x;UWVSb m} u*P uǃP |E ;M!8-pxP -'D$-E$ǃP --|$E$tAx:ǃP >u|[^_]ÍrP :u>u|t2E8:t*|$ D$LD$@:.$?[^_]ÀxF|'_|>uTx:tL|9M'E8:t=|$ D$T1P '|[^_]ÍD$ D$D$Rp$u?D$ D$D$Sp$E 4l:bUVS` wjutD$ D$4$H;[^]Í D$ D$D$/$UVS_ jutD$4$%e[^]ÍfD$ D$D$/$fffffUS3_ èiE$*1[]UWVS _ ÁiEtVu;U E} Uz BD$E@t$9s0E@ 1҃[^_]ËE@D$Mxe);u EE UD$9sNj]C 넋E EuGE@D$Ex gE UybE E%}D$ D$D$$gtD$ D$D$$=TUWVS] gUB Eu1ƃu}9}EE}B269r|])9ErGË}u sJu(u J J ZR9r [^_]ÉfftEË}u rucuk띉UGD$4$mƅt[UB)ǍD|$D$$U0MJB E2Xf넃@UWVS7\ ìfu} D$$$…0x@@ LD$D$qD$ D$D$$UDžt1D$$[^_]R1[^_];8U$T$J818US [ ÑeE D$ED$@:.X$C []USZ ZeED$ E D$ED$@:.X$C[]UWVSZ eu} t(ED$ 1D$|$4$Q[^_]Ín0D$ $D$D$4<$UVS4Z édut'D$ D$D$4$yQ[^]Ín0D$ D$D$A<$=UWVSY ;du} t)D$ 1D$|$4$Q[^_]Ín0D$ 0D$D$6`$UVSTY cut>D$D$ D$D$4$Kt [^]1[^]ÍD$ 8D$D$0$FUSX FcED$ D$ E D$E$ 9[]UWVSX cuttE D$4$~7F0u D$4$[^_]tF0uҿF0뻍n0D$ @D$D$/$R]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVS>W óaE0x$0tu[^_]1[^_]UWVSW vau tLEt>?t+fx f@UPp$MH,UP(UPDUP [^_]ÿUuy1UWVS V `}u$‹EE Bzr EBt.tpE tZE ΝEU>UtnMfH f@PM H$x,p(@D?P [^_]ÍΝE뭋M tE E딉UU$1UWVSU _UE trB0~4r,txM q J$tE D$ E 0xt$|$$[^_]ÉUD$ HD$D$<$4 UYn0D$ HD$D$;$ U US T ^ED$E D$E$辶 []USVT ^ED$ ED$E D$E$&[]UVST Ò^uf~ D$4$F0tN@9t $F0F0ǀǀ FFF t1FD$4$e1[^]ËFߍn0D$ PD$D$<$ I2 UWVS5S ê]EU tgP0~4p,tu ~r H$t} Lj $[M׉‹M y!1[^_]ÉET$ XT$D$9$ Edn0T$ XT$D$8$ E+UWVSAR ö\utFD$4$nx$P8D$4$[^_]É4$ڍn0D$ `D$D$74$+ US Q +\ED$E D$E$iH []USQ [ED$ ED$E D$E$F[]UWVS,KQ [Et8uj}ԉ ;$JFFF )t$|$$踲,[^_]ÉEԉ$E؍IEEu}w끋uUP ZEx9]Ë]Í]fUWVSTAP öZUE }} 9}7uցE0 tS9utOD$2@D$u4$4$PEt8UED$t$E$Uu-p4$PEuȋ}E+TЃT[^_]Ét$ %D$D$2u4$׺4$yP볅U@E 7t"ED$G$3ut$ 닺R}UD$ hD$D$$UEtT$ hT$D$$uE7M,ET$ hT$D$$E~fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSM ÃWut;F)F3E uF F[^]1[^]ÍD$ D$D$Y$$UWVSL Wu} Uts~F<FF DWPWPW P F F 1[^_]ÍBD$ D$D$v$$CU`U΃D$ D$D$w$$ U+UVSK Uut~u@~w:E [^]ÍBD$ hD$D$$$뺸UVS!K ÖUut~uAF u9<.w5[^]ÍBD$ PD$D$$$6빸UWVSJ -U}u t5u%G u<.w~9|D7[^_]1[^_]ÍBD$ 8D$D$$$UWVS9J îTu} t*~uPF uH<.wDx>9؃[^_]ÍBD$ D$D$$$<몸UEu E D]1]UWVSI T}utQEu@D69E r4E D$D$<$6GfGG[^_]1[^_]ÍD$ D$D$.$$UWVS I ~Su} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M$$뙸UWVS4yH RƉEԋE} 9uЋU1҅x%PލT$D$<$]wGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍOT$ T$D$h$$E܅ E܋]ԍZT$ T$D$i$$Em]wUVSF tQut~uEFu=:Fr6[^]ÍD$ D$D$$$뵸UWVSF Qu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ D$D$$$fffffffUWVSF vPƉׅtat1>t F9rF9s1[^_]ú䍃D$ D$D$p$뾍fD$ D$D$p$pUWVSUE Ot4ljփt3Rw0FGT$D$<$8[^_][^_]ÉUrD$ D$D$p$>UUSD ;OE x[]ÉET$ DT$D$Tp$E[]UWVShD Nu} Et,tYPσF)F 71[^_]ÍT$ 0T$D$bp$fEuET$ 0T$D$cp$2ErUWVSC #NEu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃D$ D$D$p$MÍBD$ D$D$p$M}]썃D$ D$D$p$L {P7f/UWVSA LEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍBD$ D$D$p$ME]荓T$ T$D$p$EjUWVSA@ öJu} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃BD$ D$D$p$LD$ D$D$p$VUWVS)? ÞIU} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]ÍBD$ D$D$Wp$UUD$ D$D$Xp$aUUUE ttuB]ø]UWVS$= -HEEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]UMi1ɉM]썃D$ D$D$p$MXMUEE썘\$ \$D$p$MUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUSM9 CD$D$ED$ ED$E D$E$[]fUWVSP8 sCƉЉ 9U1҅[ƅD$D$D$D$ T$D$4$Ct1U+<P[^_]Í1ɉ D rFDžDžD$ T$D$<$EuutjƅD$D$D$D$ t$GD$G$Cut$$tu<$Vt$Ct̓T$ XT$D$ۃ$jgUWVST+7 àAƉ 9E1 ƃP ƅD$D$D$D$ P D$|$4$AD$D$D$D$ L$|$4$A;DžDžDžDžDžVDžDžDžT$ D$D$$stjƅD$D$D$D$ t$GD$G$@ut$$thuGtLD$ D$D$$]$q1U+uXT[^_]Ë묋$qʍ̓D$ hD$D$ۃ$8GeUWVS4 +?ϋEE uE 9E1,VD$D$ D$D$<$DB4D$ D$D$$7t6D$ D$D$$zw $ɗD$$D$${$聗D$I$cG$M$?̅~f$N$ t$D$D$$荣U+Ą[^_]Í @$0/<$6!D$t$$豅 tD$t$<$ԆtƋtt$ɇ뉍D$$談hD$27$j뛍d$t$;rSUWVSl" Y-uEEEEEEEE 9E1MGUqEE fD$ D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$4_=EPt%D$T$ U $UUEML$ML$M $MƋE$c^E+l[^_]ÍD$ D$D$ۃ$MD$ D$D$ۃ$U D$ D$D$ۃ$dEe0D$ D$D$ۃ$/6$Q]D$D$r$WrQUD$ED$ED$ED$ ED$E D$E$f]UWVSlF û*uEEEEEEEE 9E1xMUEE fD$ D$D$ UЉ$UWEEEEEEM MEEML$ D$UT$$\E@t"D$D$ V $U<U3D$\$tM 9HtCED$ED$E$MEƋE$[E+9l[^_]Íu$bD$ ED$ED$E$ME 멍D$ D$D$iۃ$M^D$ D$D$jۃ$U4 D$ D$D$kۃ$kE 0D$ D$D$lۃ$6$XZD$D$r$^oNUD$ED$ED$ED$ ED$E D$E$ ]UWVSJ ÿ'}lE \EXE` 9@E1D$pH$FXp`DžLDžPpB.dB.DlD$ D$D$<$mD$ <$`bdh< Q< t< L .&< t< t t ~ u9P>uXp<+%<-q<@nL'PHD$ D$PD$r$my؉DžL<+<-w҉ht$`$jhyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$PxDžL<+F<@[hU\l K4$  u9F<@t$`$qU\l<+<-t$`$>qU\؉<+N<- t$`$A_Z<+<-DžLDžP.hHD$ `D$D$4$vhQ7F<@uhHD$ `D$D$4$v؋h]PFF'<@hHD$ `D$D$4$uhU\1PU\PF]<@UHD$ `D$D$4$u)F<@ DžLDžP11D$ xD$D$ۃ$ D$ xD$D$ۃ$X#D$ xD$D$ۃ$aFUWVS$ Ù M(E<} 98ƋE1f<!ǃP U@D$D$ D$DD$<$v@D$@ D$4$aD$PD$4$'"M4'0@@ $@@P T$$w@@$~D$4$ͅ,t$D$4$p?,|%=nP $ӟ4$u0$8E+[^_]þ뿍~D$?$…tE|[^_]1䍃^D$ hD$D$NA$ /UWVStd EUU 9M1ɅtBE}<$EhM L$ED$<$hED$<$RU+u:t[^_]ÉElL$ \L$D$hA $<EK/US4 E D$E$[]US E D$E$[]UVSjD$vD$pW 4$ED$ t$ED$$薍[^]UEȅyt ]%]]ffffffffffffffffffffffffUWVS0&E؋}u 9EԉËE1|$}܉<$]&1&.&.&.&.& F TFuF(}ԋE+uW0[^_]$)]uƅgы]؍8D$ D$D$Ft$ +],-UWVSEE u} 9U1ҍ$iD$@$_E E19xu}_D$D$$'_D$D$$L)׉ 9|KD$D$$^D$ D$$19 })׉ q0$d_0D$$%U+[^_]É裸0$_莸0t1D$ t$|$$՗b$^1농D$$tыptEU**UD$D$D$D$ E D$E$H]UWVSxWEUU 9M1ɅtBE}<$M L$ED$<$.ED$<$U+u:x[^_]ÉElL$ L$D$t $躱E)fffffUWVS*8]du 9<ËE1dENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ ]]Ћ~$|}ԋ^(x]؋~,t}܋^0p]^4H]~8D}v<@u식d3`s\s{ l{LȉEl1؋\!1؋`LyZ؋u\ɉT1`!1l yZTىˋ`MʉX1!1ыXP:yZω}ω}E1ȉ!ߋE1NjE0yZEȉ1!׉M1ωEMyZω9EEȉ1щ!1߉EMyZNjMu}ω}1ϋu!1׋MyZ߉Mɋ}u1!Nju1hyZ׉}ωM1!ߋM1ωuu1yZ]|ɉ1!1lj|]yZωxωxU1ډ!U1׋xyZljutʉ1!ω1߉t]yZ߉pʉU}1!NjU1׋Up2yZ׉4:u‹Hω1Љ!1ωuu0yZE]Dω1ߋ]!1׉EyZωE@ω}]1!]1߉EyZlj}X1u1u1Ƌ}1!ϋ]1߉u]yZ߉MT}1|1u1lj1!ljT1׉uUyZ׉ :X}1׋x1u1lj}1!ߋu1UT2yZUu1֋t1֋U1։‰1މX!1ƉUM yZΉTXMu1΋p1΋M1Ή11MnTƉXEh1NjE1NjM1ω׋X1ϋT1ωEn߉TE}1NjE1NjM1ωXT11En׉h|1NjE1NjM1ωT11߉MXnljh}x1ϋM1ϋM1lj11׉MTnω|t1׋U1׋U1ljh11lj|2n>Xxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVS%Ɗ]} 9EEGWEU?@)ƒw)ƒT$,D$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼnUE]UU ft1]ÁE ]fffL$$Yai qyD$A(tQS[(Rjj [1Ít&.&T$D$ Zbj rz $z(t RPS[jRj [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[CRjj [1Í&T$D$ Zbj rz $RPS[jRj [Xt@US `ED$E D$E$ []US/äD$ D$ED$$'[]USiD$ E D$ED$$-[]US躻/D$ E D$ED$$[]ffffffUWVS,quEEED$D$}|$ t$D$EE$@EE ED$D$|$ D$D$E$j@EEED$D$|$ D$D$E$@6EEED$D$|$ T$UD$E$?UEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$7?؃,[^_]bw8 u>ƆUN#D$ lD$D$<$qfffUWVSÓ} 9E1}D$D$HtHE$Vt=ED$D$<$Ą;Es1U+[^_]ø"㍅D$E$kNtt@D$E$1Nu[ED$cD$<$T;EsED$|$ H%D$`d$T$UuID$ tD$D$B$BpQUWVS ˷8D$W \$E$qƉ؅u [^_]Éku01UWVSpuU[ ut$$[ @B1NjEEE1UЋUME1EHt$$xx[ @B1Ƌ}E1NjExME1EH D$E$~u([ ]ٸ@B1E1؃p[^_]øp[^_]$'[ 8D$ D$D$H؆$nfffffffffffffffUWVSfD$zrD$E$谄uE04.".&.&.&@t&tD$E$u܉[^_]D$D$E$6t 1[^_]ËEpD$D$4$E@<-u?EPB.DPtEPD$ ED$$U9MU9p9g^My+th)ƍF߃1BD$ +D$4$XE@t<+ !M?!fffffU+œE?w04.t u]Ë u@u1]UYEP>w 04.]1]UWVS(贳)u}܉|$D$4$upxINE uG>wlh9EظE! EED$|$4$(p([^_]Ã>w2h9EظE EppUWVSauYoD$ to-D$D$[ <$My)[ C.t@[ [^_]ÍU T$ t$)‰T$$뵍27D$D$[ <$fffUWVS1æƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUT$ T$D$t$$^iEF!FUWVS˰@u] "<-EEEE}|$EԉD$$$~$E~D$|$$TElD$D$Ẻ$lMẺE0EUB.DPщMEE1Eh$KTU$U~9E~T$$lƋUfffffffffUWVST荛Eu}]E E bEEE;dE܅~ 0MU tEEGz;EGEEUEUEUEUEEEE EJE؋E$]G 8MЍD9E  0^EUM]L$\$ $T$]9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]VD$E D$E$9} T[^_]ÍEEEE2rEE'E7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]Mȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;E'EbEdEE Eg]U]EdEEUM]$CUЍD9E ỦUM܍_׉F u ,[^_]Ë]Uv]uNՃmu$],[^_]ÉUE$] UtÅT$D$ $M]LMD$ D$D$n$`Hn]D$ D$D$n$+H*uf~*u1f~*_lTODlmT*lJԇD$ D$D$n$>hTD$ D$D$n$A>XPTD$ D$D$n$>p TD$ D$D$n$=13=qdTCh/p@ @t`<$PG$`$Tk)؋`$TU)lT8UWVS规`hl΋}p} M\ 9dE1h!lKp{pfXlp1 9sYfPftf/u܅t0t&.&.&.&f@/f/u%9rdU+İ[^_]flpP`D$ D$D$on$;ԇD$ D$D$ln$s;l`D$ D$D$mn$5;p`D$ D$D$nn$:PXllftp‹hG t\SJKt*lfx/t|%=@=t`G\h;FX\D$|$ pD$L$$lh 1h1h C ukG @tKpD$$W([|%=@E9ll/(pD$$`D뫃=u`D$ D$D$Sn$X39 T$ T$D$pX$ 9``i>1҉l/UWVSDfӊÉ 9E1vHf~uQ@ ~ύff/P9uݸx0f"f*ffʃft>f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 FcT$ D$)L$pP$gf[!~ʉW-0$P…ZJD$D$ D$D$$T@7pf@!fH9"|$ t$D$n $2|$ D$D$ $2T$ D$D$n $i2T$ D$D$ $92T$ t$D$ $ 2|$ D$D$ $1rͩUWVS4{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃D$ (D$D$n$,MUQMU썃D$ (D$D$n$M,MU1NUWVS(s*~u} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍D$ 4D$D$n$*U} UhUWVSrÓ|EtXEPtF@u=@=~Ӊƍ'=[== >tD$o$ɱu@D$o$螱=@sD$o$s'@@HD$o$H>@UWVS8n_i 9U1ǃ,h ,h DŽ0h r捃,d r Lh D$ D$D$$KHh T$$D$\|$4$NA8t߉,h 8#mD$\|$4$bNt8t㉃0h D$\|$4$?Nt8t㉃4h D$\|$4$N8t߉8h ǃ@h ǃDh D$\|$4$Mt>8t$@h D$\|$4$Mt8t$Dh D$8h D$4$)EgD$\D$$AMƅ8tщ4$j uċܳtܳ >t|$$0 uቻ/,h [^_]Í#D$ D$D$ˈ$,BUVSX(cǃHh Lh t$o[^]Í~D$4$ULh u҉t$"s$.1USAXöbLh t$zǃLh []fffffffffffffUWVSPWfb}ƉUԉMEԅ}@EB.EEEÃ]}ԃEȍFE]|ЍL]DStEB.Eԉh EȉD$qD$Ẻ$sEԉh EȉD$PD$Ẻ$RsEԉh fEpxEfEbxEfEfxEfEoxEfEtxEE`ai E؉EEEčEEE4$0T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)v j 9u(Ƅ j [^_]Éր>/tJy( j ǃs$utǤƄ j [^_]ftt鍳$#fffffffUWVS6fAE$!}LtB.DBt;B.0fkfbfgfE@ E1ɉMQD$ ED$E$|Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZENE0US5@D$ E$胙[]ffffffUWVSa5?}?t<$D9uzf.&9ti8/t9t`sc~/t9u)=v n ׃rtftƄ n Ѓ[^_]øy(€8/t Ƹ봸$#US<4 ?EEEEEEEED$ẺD$$tEMt<[]ø<[]ffffffUWVS 4Æ>t4ƅu"t$Ut,E t: [^_]$^ [^_]Í$#$1E uD$D$$ ǃtD$$D$<$D$<$h<$褗[US23ç=Et=tU T$؉$͖[]UVS2\=utE D$D$4$D[^]ÍD$ TD$D$1`$붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[ô;@3 [Ḯ̀rS[Ô;@3 [ḭ̀rS[t;@3 [̀ffff̀ffff/̀ffff^̀rS[$;@3 [̀rS[;@3 [Ḥ̀rS[:@3 [<̀rS[:@3 [̀rS[ä:@3 [ḇ̀rS[Ä:@3 [̀rS[d:@3 [ḓ̀rS[D:@3 [̀rS[$:@3 [`̀rS[:@3 [R̀rS[9@3 [2̀rS[9@3 [ḩ̀rS[ä9@3 [P̀rS[Ä9@3 [ḷ̀rS[d9@3 [Ḷ̀rS[D9@3 [ḉ̀rS[$9@3 [̀rS[9@3 [Ḛ̀rS[8@3 [̀rS[8@3 [Ḩ̀rS[ä8@3 [1̀rS[Ä8@3 [Ḍ̀rS[d8@3 [òrS[D8@3 [ìrS[$8@3 [l̀rS[8@3 [t̀rS[7@3 [s̀rS[7@3 [r̀rS[ä7@3 [p̀rS[Ä7@3 [j̀rS[d7@3 [m̀rS[D7@3 [̀rS[$7@3 [Z̀rS[7@3 [ ̀rS[6@3 [!̀rS[6@3 [S[î6@3 [f.&*̀r׋L$Q1fffffỲrJ!QS[^6@3 [UWVS+@6 r r D$$Gr r +r r s$uu[^_]ä[^_]ft뻋r Pr D$D$D$D$ D$ D$$譅 r 11 r D$$lD$$覌$*Cf;USf*4r E)9 r t$M[]à T$$T[]US*Ó4D$$ r u $m[]fffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVS(!3EU1UE $MƉD$ED$M $Rt9} uˋUtE붋E8E[^_]1[^_]UWVS$/(ǜ2Ɖ 9E16B.ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $~Džtҋ0F D$<$xF$F(<$~떋WUWVSX'y1E؋}E }EEEE]ÐB.]wu8EX]E]܋DJ@u2<%uEUMYC\}IED$ED$4$ NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$UE UπUE댉E䍋L$ M܍ T$UD$E؉$REFEFD9v\D$4$舛E,[^_]ËF$觇\}Ef~ FFCFFD$4$.E,[^_]ÃUML$ T$D$E؉$荾EFHUE$~E UtRπMn0D$ D$D$?$5ZE(E9Ut'$M~E UtπUEEUVSiuD$4$V(4$F u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$蚙D$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$Q[D$D$D$4$$UVSB÷uD$4$ӘV(4$ЎF D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$uEUw0E[^]ËVPNTUMutt+FEU<TD$4$D$4$UWVSÅ }?ew t>Et[^_]Ft$ɃV tQFtB1ɉωMT:0$襃V T:($薃V D: $臃MV ;Nr$qF,t$bF4t -$NF8t$?4$7[^_]ÍD$ D$D$M$d?e[^_]ÍD$ D$D$K$&UVS" 4$kr D$E$y4$k[^]UVSh 4$^kr $x4$Hk[^]UWVS)Þ <$kr D$$}Ɖ<$k[^_]UWVSS uED$@$fED$E $g…t?t$U$ӯUt'zu Ńtt$$謯uUEHutU$蚋EUЃ[^_]Í#D$ D$D$<$p7UVSl  4$ir D$E$e4$i[^]UVS'  4$ir $ f4$i[^]UWVSs  <$iir D$$.fƉ<$Ji[^_]fffUWVS0!Ö UB.E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍՉD$ 4D$D$F$˵ULuԍE9s11UWVS 9î詹D$-D$@:.<$mE tED$E D$<$D$$ >RE$_US7虺UT$ U T$D$E$mffffffffffffUWVS quEEt.\u* [^_]M %L t. [^_]E } t=Q tME  [^_]ÍՉD$ T D$D$$ GD$ T D$D$$ٳE TB. } } U B.DPwM QɨE E nE 0<rMЈE} #EEE} ;c‹}Ǎl EEJEu}&dW09uus E} ?U  ЋM ME U B.DPE PEE ЋM}ljE_k EE TB.DE 0M EEu } \Et } %Et } &Et } =2ME E 0<cMЈdE TB.0+E P} ;U B.DPtOEE DЍPE} -} ^u!B.M DHE 0ME\ErEEEE E E pE _E NE =E,}MEu}9tedtH9tud1ɀcFdE P ZE PMuU{B.W0EEB.W E UWVS(OE܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]讲([^_]ÉxÍe6D$ H D$D$$U U ]܍*6D$ H D$D$$責U ]j  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]ÐUWVSu s n/>3)Ѝ)Ѝ:~ 9w$s ugP U$Ѓs DU4$Ѕt9w$D$ D$w4$[^_]É4$Duljw$t$ XD$D$ w4$:^E t1붋s t9U$("kNjU4$DY[^_]ËPǃs 뭋U tuGEǃs Dr hD$$=n s `ǃr 11UWVS!us o))Љ):~ 9w$s ug` U$Ѓs TU4$Ѕt9w$D$ D$w4$[^_]É4$Tuljw$t$ XD$D$ w4$T\E t1붋s t9U$(3)Ѝ)E:WɉM~4T$U4$nUuMG$U 1[^_]Ës u$PU$Ѓs UD$ t$$Ǻ4$H@G$됋s u$PU$Ѓs UU$(gNjUthP뀃s tr u/D$$=jEs ǃr ǃs 4$HtՋ@UWVSIu4$Džs EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$}UuMG$U 1[^_]Ës u$`U$Ѓs UD$ t$$ָ4$X@G$됋s u$`U$Ѓs UU$("eNjUthP뀃s tr u/D$$hEs ǃr ǃs 4$XtՋ@UWVSXUELtЋ s t'Ǎt$l9uǃ s ǃr s t'Ǎt$hl9uǃs ǃr ǃs EPE LEHED1[^_]øUWVSmUE\tЋs t'Ǎt$k9uǃs ǃr s t'Ǎt$}k9uǃs ǃr ǃs E`E \EXET1[^_]øffffffffffffffUWVScpUE  DžXEK/tBD$E $p-E $Ŗuv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $p:!%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pJDž`D$`p脔D=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p_?t9E DtX$pSg1Ĩ[^_]tN~uPf/tpڢ?pĢx貢zUWVS,}E ttrD$<$(xX[^_]Et$<$}+bDžMtAt$$h(ymt *8"tƉ<$Ce1[^_]1fffffffffffffffUWVSf}<$,s $p\(s ǃ$s 7tyB.E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]Ë(s t$dǃ(s ǃ,s ΍yU͠ UWVSGu} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]ÍfD$ D$D$@$o[D$ D$D$@$@UAUd]UWVS#u} to.&.&8u$ u|:9s :t|tu[^_]Í#D$ D$D$@$dbD$ D$D$@$3-1UWVSp'ƉE 9E1=m}! Mu0(s t |$$U$X UD$ D$D$E$|DžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$g\ lj99D$D$E$A^Ѐ txE<#=D$ $,#dDžD$=D$$yS<:uA)ljED$L$E$:=w!C:SDžDD$ |$D$$HD$D$ D$D$@$kD$D$@$?qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$k6L$t$<$U6 $[OދDžމ:DžD))))T$<$Wo<ljljÉtE$>)ȍP9rH8E+p[^_]ÉEDžD$$V됋,s $Q!(s D$<$*|70dƋYq0$Y\0DžƋ|$MYDž>rD$ D$D$@$Z~D$ D$D$ @$c#D$ D$D$ @$ޏ.fD$ D$D$@$譏tp@a$ XDžmE$C;;E$-;n땉Ƌ$W>$ŃD$ \$|$4$V Pu Dž$@H $NDž L$T$$14$V18Dž4$VDž鋝#D$ D$D$@$藍0<$V0$UtE$<9貒 M4$V薒 1ϋ$Uu%$oU됋E$8UVSCøEM ut.t^UD$t$$F[^]ÍT$ T$D$@$?M EuM E~T$ T$D$@$M ElM E#T$ T$D$@$NjM E1USIþ s t$^ǃ s ǃs ǃ$s ǃs 1[]UWVS0eME 9ƋE1Dž]s  s ǐB.~(s t$s uD$ s $ 8D0Dq@:#s ux|\u ǃs ׍:\tWut$ s $I7lDҀ|\tǃs ǃs  s $ECƋ s u$n\ǃ s s Ps @&L$$A s dǃs ǃ$s ǃs f:wu<:tAt<|uD$t$$}ƍ@E+0[^_]Ë s $ Buh s $:[ǃ s +s s 0~D$s $@ s 5 s t$Zǃ s ǃs ǃ$s ǃs ~D$ D$D$@$胇tD$ D$D$@$T7ǃ$s ǃs ǃ$s ǃs $Yǃ s UWVS~u} tPtz s t$Yǃ s ǃs ǃ$s ǃs } u[^_]D$ D$D$@$[u~D$ D$D$@$-WUWVS$(Eu} (TED$=|$4$ƅl$d]FDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]JljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]IEEM$[^_]Ë]뽸 y]䍃 D$ t D$D$@$ÍD$ t D$D$@$调]䍃fD$ t D$D$@${z1*E$]K<$]K]諈 UWVS(Eu} uE0D$=|$4$Dž$d]Cƅ<:d <:tCZtsu)Cd]D$4$]GUn‰ƹd<:uЉƍX)Ӎst4\$$U]GU@Љ)ӍsűE[^_]Ë]썃fD$ h D$D$#@$́E]썃 D$ h D$D$$@$蔁ÍD$ h D$D$"@$cZ]썃D$ h D$D$`@$1)D$4$]nFt-M14$]I։4$]{I]K UWVSS}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/`DžDž)S$K9>:hf  81Ƀ4uA )čD$Ӥpxr󥋵t$D$$'D$D$$%|$t$$x%D$D$$Z%#D$ 8D$D$E${udurPy(1y(rBvBDžqfzU u9D$E D$E$]UWVS?ô}U 9E1EtqMyu )čD$UPtMP}y:u}9T$D$<$%U+ue[^_]ø"fUSD$Џ$JPw D$ y$ILw []UWVSHAö}}ԋE E؋uu 9EЉƋE3D$l$-.Pw }M؉MufuUT$U܉T$ D$ UT$$Luu vU܋9El} u Lw tUԉ%9Pw t1MЋE+H[^_]Á} u Lw uD$D$ $4XƅtDEĉ4$"]AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UAnDžuED$UȃT$Ẻ$蟋;Es4$O[f % ЉD$D$ 5D$ED$Ẻ$*x ;Es1"B9EBf9EzJ Uȍ~|$D$ $MnKNMMčD19C9}rỦ׉΃s$tft1V4$rZDUuuB r EfUS_D$Ls \$ ED$EU $T$u؃[]1[]UVS<ÇM uEEEQEUAEt:EȉD$ED$E$zuEȋỦVE܃F1<[^]D$ED$E$^z<[^]ÅtEȉD$D$D$D$E$'zUS,8íEEEEE܍ED$E܉D$$^uE,[]US,YEEEEE܍ED$E܉D$$ uE,[]US萼EEEEEE$[]fffffff=̀rS[ô@3 [ḽ̀rS[Ô@3 [̀rS[t@3 [(̀rS[T@3 [L$S[:€4.[t'L$̀rS[€4.[ S[@3 [US gD$E D$E$xb []US 5êD$E D$E$r []USxD$ ED$E D$E$-b[]1UWVSº7}E 4ME0 9E1E(,hEED$E$$D$h8$$hdžPdžTdžXfDžD8H<$3g_-t$LFL$\=$|$(4t$4D$h$*2D$9L$\$D$LD$,1|$(D$$LD$ |$\L$8t$dX-t1+t,D$hD$L$0$qXL$0"D$\D$LD$\xOFF2D$49;|$\yȃ9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -UWVSq}D$<$2ED$ ED$E D$<$D$<$2[^_]UWVS蜝}D$<$-2ED$ E D$A.D$<$D$<$$2[^_]ffffUWVS 1æU J}7D$$U 1U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$>U  0Muωƃ}EEu2J0B0upH MHBD$$0E [^_]ÉU U fb ߋrEt9spE9-JUT$ U T$UT$V$Љƅu E[^]S0E[^]Í8 D$ \D$D$8l $M@U nA.D$E D$E$2]UVS@õE$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]R0E[^]Í D$ DD$D$pl $M@$U蕔A.D$ ED$E D$E$$]UVS`՞E$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í D$ ,D$D$yl $2L@(U赓.A.D$ ED$E D$E$$]UVS耓E$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í!D$ D$D$l $RK@4UՒNA.D$ ED$E D$E$$]UWVS(蟒uEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}O0E([^_]Ë$ 1ҍ}uU썃!D$ D$D$l $I@HU]EU썋d!L$ L$D$Jl $IEIUT$ T$D$}UT$ U T$UT$V$Љƅu E[^]M0E[^]Í!D$ D$D$l $0H@8U 賏,A.D$E D$E$2]UWVS脏KD$-D$@:.<$Et8ED$ED$<$w|$ D$D$I$5E $D$zxD$$pE$USڎOD$ ED$E D$E$[]fffffffUWVS0葎}u t$E$6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw"Nwq\E@VB.PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$tU@}ظ^DE@uS4$uV tQFvIE %Fv7 ,-}ԉ}؉xE7B.DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$ rF<gE\}؉xE^E?!} }fGH]&G @E}G(UċrDuG$]EЅEċ@hUZG(UċZDuu떅uEċ@뽅?~t&UWVS$gTr} EdD$,$VƅEF$~(EEt=}1҉Eu׉ $9sǃuEuw1ɍ'E‰EM@DEwE1}EBUE$UUQ…U@DEBBTBN(U?fUufBHEuBMEPUEo}}Ut E1ɋUt9xf@H F(EuNE$A}# $uE$F$4$1$[^_]Ã}uω$9sǃuu0UU~8#릋}|\1ɋUYxf@H F(hD$D$@y($qFN(D$ tD$D$$D$ dD$D$$1ɋU@f@H F(ZE4UWVS4dén}tH@JHDy$VDxpup$VDy4$wtv$uGt$G$G(t&<$1[^_]Ë@$$dG$ ƃtCG$뻍D$ (D$D$ $Ev EG$k<$ Eb UUUWVSbOm}57KW(?FLfFL;NHtlfv$zNDFLf;7tȍѐD$ D$D$$Affu@F83G N<3O FJ"Gt uƉv$uuGfFHPp$~DWF(VD{G(G$O(1[^_]ËGt+tEW(uƉv$LuuGGIG)t룃8N?wGGENQ(BI|/u‹E/N,QT$VTT$$7[^_]ÃD$ D$D$U$1ɉfFHG(uG$F,F(NTD$ML$G$wD$/M $at;9EP$U) @MD$UT$E$+MN,GFFF8V}F)uGHf fű~t$vu} EHDu@8/tF(tF[^_]ÉUD$D$@y($莿ǃUttF<$b<$ugFF)E@[^_]ÁN(fD$ D$D$1$F߿UWVSk[eutpǤ7u4E4$u(4$9E$臿[^_]ËF$$뿋F$$F$$F$$뵍D$ D$D$BL"$+aUS Z%eA.D$ D$D$E D$E$l$]]US lZdED$ D$D$E D$E$l$]]UWVS8,ZádƉ׉t,M=U= =T$E؉D$E܉D$ L$|$4$=ƒu܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1"ك8[^_]1UXwcA.U E]UMU E]fffff̀rS[4c@3 [̀rS[c@3 [ ̀rS[b@3 [UWVSaXbu} u !t9u[^_]1[^_]Í D$ D$D$*p"$kUWVSWibu} ttB|$4$[^_]ÍWD$ D$D$B"$ ubD$ D$D$C"$UWVSdWau} ttB|$4$[^_]ÍWD$ D$D$B"$yubD$ D$D$C"$KUWVS@VFat$(D$T$L$,D$,t "|$GD$8UT$$\$(9uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(芫D$$T$ D$0T$4D$T$ $D$1D$L$8D$9\$(["D$8D$E܍ 0MU‰T$UE$]U})ljEuUD$ D$D$E $]MAQt$|$E $@t~")Ɓwf]O 8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$]…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]D$ D$D$E $m$뫉EX@$]MA }E@@eBE $]RD$@E$_E |EMH ] ωu]:+D$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]uDG uNjUtG~uU܉$]}닋]썃D$ D$D$"$.$]\‹EE1]vUWVSJT}G $swt6$`uG[^_]UWVS7JìTu} t"tL D$ $N[^_]ÍD$ D$D$:"$BuD$ D$D$;"$UVS8ITut&== = ED$E܉D$E؉D$ T$E D$E$]=t3w Ef>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[R@3 [ffffffffUE]UWVS$(HÝRE։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]ÍEԋu؉0EȉEċEEȋE9E^Eĉ$]N1X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$];}~]ND$ LD$D$y#$ ÍZD$ LD$D$x#$k]ND$ DD$D$&#$]D$ DD$D$'#$wh]U;]FUT$LD$ ED$E D$E$]fffffffffffUWVS ;FEuVtG~^ЉUv.&.&tP1H1 uN9H u [^_]ËUU$]ϳt"N^HXNH UF [^_]ÃUWVS:bEu7uu[^_]*F$$Ȥ4$NjF$$賤[^_]UWVS:E}E wu v.t&6tk9uFVO9N uO1MO1 MtGD$ D$T$$|GWG1D$<$KtG9F [^_]ÍT$ \T$D$i@#$3E GffUWVS9&Du8F}9FiF FD$ D$D$$FVFD$F D$$FtotfxWFvthV uAzN)91F Ju M ]z u F MЃ[^_]1}81F u1UWVS8C}7t2G$$蒢D$<$ƋG$$u[^_]D$<$Ɖ[^_]UWVS 78ìBE70E@$$D$E$,ƅ@ ‹} 6@E@$$蝡ptiEM 1D$E$ƅt[P } uWuYu}8닋E@$$t= [^_]äDf9ft8}8E1E xIE xfff̀rS[ô@@3 [ḃ̀rS[Ô@@3 [UWVS$6v@utqEEE E8D$D$ED$ t$D$E$Jƃt 1$[^_]u8 uk81ፃ#D$ pD$D$<`#$`ffffffffffUWVS0-5?E̋]} 9E1u9 &t8u)؋U+0[^_]ÍM1D rE̍.&TЃutS؉].t&.&.&t\="t]W$]nI1B]dfffffffffffffUWVS3f>}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU e6D$ D$D$=#$U 끍*6D$ D$D$<#$U KfffUWVS3Æ=M} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$Ɖ[^_]ÉUMe6D$ D$D$A#$UMP*6D$ D$D$@#$UMUS2z<Ey \(9~)ML$„B.D$E $1[]ÉD$ D$ED$E $1[]UVS1<Ey \(;}.D$@„B.D$lw 4$U[^]ÉD$ D$D$@lw 4$K[^]UWVS1Å;u} taEtHB.EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]ÍWD$ D$D$?$$ubD$ D$D$@$$FfffffffK̀rS[Ô:@3 [UVS0z:ulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS/9]l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp4819u[^_]Ë]싃tpu޸UVSk.8L4$aulU4$D[^]ËE4$-[^]UWVS .Ã8} lE[LE$lttp)ЉȉB}H}wQǃǃǃGlhEG1E$qE [^_]1뜍Gƃ}?v8}}E?EG EElE艃hE=p)ЋM@G@EE띍&D$ D$D$Y@$$vE$fEEE3UWVS ,Ó6lEEẺEыE)ȉE䍃LE$ٕlUp)ȉAEplt)̋Ep1thE$>E [^_]1끍&D$ D$D$@$$bUWVS*]5L<$ޔƉ<$ϔ[^_]US *$5ED$E D$E$t []US~*4E$[]ffffUWVSQ*4}tHD$<$ƅt&tt$<$[^_]1[^_]Í#D$ D$D$Ax$$9UWVS)74uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]*"썃#D$ D$D$Vx$$kNfffUE U9r 9]ø]UU E9r 9]ø]UWVS(3w w uw 9E1ɍt-ωD$4$>t w PEu׉MD$D$4$ MtMljMuD$|$E$ w 8Ftt$E$ 4$ѨuMEw 9t$$賨ǃw ǃw [^_]Éw TD$D$$苳[^_]UWVST'1u} t%5D$4$tt=t1[^_]À=t[^_]UWVS&o1ut4t$<$ƅtD$<$ 4$ɧ[^_]Í8D$ D$D$$$UWVS&0}G$ƅtx @D$$~[^_]UVS2&ç0ut/t$$tU 9P [^]1[^]Í8D$ D$D$$$3UWVS %10U9E8s7i1}ƉUE D$ED$<$u E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVSv$ƍUjET]UWVShC 9E1D$<$}AEtFyL$$L$T9~L$ T$D$<$U+u h[^_]>f+̀ffffj̀rS[d@3 [ÒrS[D@3 [UWVS &}u t$<$u 1[^_]D$FD$<$ tۍFD$<$YtȍF D$<$FtD$D$D$ FD$t$<${zTD$ D$D$G$$:6 D$ D$D$H$$ffffffUWVS ]}E 0|$E$Ctp?9}raeto1Ɖ\$E$U]9suM9u+EE $] E E E8t 1[^_]ÅuUuCtD$$]bƋE 0i]D$$랃t.t&:똸vLE8qw .UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVS ^u 9E1V F\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …x^D$dD$ TD$XL$E$6 …x'hD$t$E$‹\f8tVE+oЁĸ[^_].֍F\DžTDžX\IP\p9{\hD$t$E$x\NP\6DžhhD$pt$E$Fx'q\D$ hD$D$4$d\D$`D$ TD$XD$E$ \88Jffh̀rS[ä@3 [UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS 3u}F9r+)F|$E D$F $a~  [^_]1 [^_]UWVS hu}F9r+)F|$F D$E $a~  [^_]1 [^_]US#EU ]t,HPP UP[]ÍlfUWVSF}u tgt$<$kt6tu*t$<$L[^_]ÍFD$<$诬u 1[^_]Ãt$<$蒬[^_]ÍD$ hD$D$%$菽jTD$ hD$D$%$`7UWVS[}u tnt>t$<$脲u[^_]D$ FD$t$<$腴[^_]ÍgD$ D$D$X%$Ѽ떍TD$ D$D$W%$襼cUWVS+à}u t$<$u 1[^_]ÍF D$<$褱tF t6u$FD$<$tăt$<$뵸[^_]ËFE }F[^_]TD$ |D$D$w%$ͻOD$ |D$D$x%$蛻 UWVS!Ö u} t tJD$|$4$葱[^_]ÍTD$ D$D$g%$.uD$ D$D$h%$UWVS }u tet$<$蝩u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$U뵍TD$ XD$D$%$QqD$ XD$D$%$BUWVS }u FFt 1[^_]Ét$<$藨tFD$<$ tӍFD$<$qtF D$<$^tt$<$K랍TD$ HD$D$%$NVBD$ HD$D$%$'UWVS }u -t8GunG toFF[^_]ÍÑL$ M썃8D$D$%%$U艸GUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ ,L$D$$E GFG F[^_]ÍCD$ 8D$D$$%$螷G EL$ L$D$ $uE   FFfffìrS[$ @3 [v̀rS[ @3 [VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVSVuM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1э}D$ D$D$:,%$pM E9M ёD$ D$D$;,%$5M fffUWVS(#ƉЉ 9U1҅OD$ |$D$$ċ<$脩@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ D$D$ $)g4t9um΃tft%D012 (T$ 0T$D$P%$]v/2T$ 0T$D$P%$"-D$ D$D$ $fuoN }L$$ te$>ff^N mF.t&*UWVSƉE 9E1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$Ї4$营9E{ED$t$$+1F5EDž*FfEMfD$ D$D$<$6c<$ؤ9EED$|$$sF<<p EED$D$D$D$ T$PD$$v~0wDžFȉсI<<9fE;|$ L$D$$U8<$]9Er8ED$|$$$mj$m~3LED$E$NDF <Džytt Eut2ED$ D$D$$st1ED$E$1C%UWVS<*uU EEMEE܋EE؋E E 9E8}1w~wF}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ D$L$M܋E$^M܅x9lEE܅t E؅aFfVT$D$ D$L$M܋E$^DžMn9fFfF fV ffuu҉T$D$ D$ȉM)D$4$-^Mx 9EtEc҉Uԋ}^UT1'E܍E؍xE̋E܉M܉u ET8ẺT$D$ E؉D$t$ $M]9M)ƃ9}u1hȃiviD$t$E$製1?FD$ EEEDEԋ}1'E܍E؍xEЋE܉M܉u E8EЉT$D$ E؉D$t$ $M\M9)ƃu1yMFD$ D$D$}<$D\<$M9L$|$E܉$腼MFUU܉D$ ߑD$ȉM)D$$[M9\D$T$ D$L$M܋E$[M UWVS@llj΋E 9EG uY$fto|$$gt9wuҋtD$G $謞u1ffh$}@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$t$ |$D$$gu8u Dž11fBUVS ut$F $eE $MUYF t [^]ÉE4$cE [^]ø̀rS[ä@3 [UWVSÆ}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$>qn8[^_]1[^_]UWVSfut7D$4$FftID$4$[^_]Ín0D$ |D$D$@t%$_띿ffffffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUS@õPtSt /[]PtfHuX uHuxuπt[]Pt#u[]@ tOEYD$ ED$4$05uEt8u x[^]ø[^]Í D$ LD$D$%$eqUWVS(`tƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJx x f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.;븍3UWVSUƉׅt5tet&u 1[^_]É $GuMT$ $T$D$%$םMuMT$ $T$D$%$裝MkM T$ $T$D$%$kM6UWVST`։ 9E1|DžDž%F F`FD$$D$ D$D$D$F D$FD$ D$D$<$lu G @u}D$D$ L$D$<$_O @,1ƒ $VD$D$ D$L$<$~QG KD$D$D$D$D$ T$L$<$負E+ȁT[^_]ËQu7Iffft#fFPЃ6tRr#D$ D$D$ %${Uߟ+t't܃t&u貟襟蘟UWVS(ƉЉ} 9U1҅t\D$t$ 5D$D$4$L=1U+([^_]É4$PPwstP|.ut$T$ D$D$4$eL댉#T$ T$D$ %$fOUWVS4q}ĉÉ 9EЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ]OUWVS6Ɖ׉MEOD$A M$3[…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftug΃D$ DD$D$%$=0D$ DD$D$%$f mUWVS&m@DϋE$E, 9ƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} u0(Dpf@fPff[PD 8Hx LD$ |$ T$L$$蚖…P @@ u+!<$菖f$R莏t,$ډL<$軌 LwdmPu .8tX<9 u拽4t t҉tH9Y PP1 UWVSpƉ 9NjE1>$H$H`11D r틅FFtGGFUCF薍胍1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$蟌8=.t&脌G au$1ҋybK;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$ZN$LNU+cp[^_]Ã){$M$M1녃1(@<tcE D$ D$D$$u|d@=1$1ҋ_/@ P$1ҋ|f8#D$ D$D$ %$較$1ҋR@uu*$HDPDE诈E$K茈1gUWVS hEdpPt%=~h讈Dž1E1 Dr]`1 DrV]pdMEE`]MEE$E]1 DrFdd<$hdU[^_]É<$hŇh.[^_]ÉЉ`6`fXh\G]1}`X D r틅hHOT`@pP0DXLHHX9HHD$ PD$D$L$h)dL$P T$ D$DD$l$:xq]1EDr틅lEEE!$\Xl$h9H9TX\d\$h萅EE؉E؉d<$hIdS|dMEEdMEE‹`MH@A‹@u@<$h軄UWVS` ljUMMME EEE 9E‹E1EE$Uu\WtUL&t89uML$MML$$OMt u܋E01}U+`[^_]ËG;t?OƅE$1ɋU "D@u듍ML$ME$1r;D$E$T4M<MMG;tƅE$1ɋUv.t&@uD$ 4D$D$%4$|EED$ XD$D$4$T|%uܸEvWt$D<$DuEaME뺋M#UfEw ]ÍU]UWVS5êut(vGt$D<$Du[^_]ÍD$ D$D$r%$={UWVS8EdE tEpMh 9lNjE1x1󫍵1҉D r퍍T11D r틽dpPu x x$9Dž hlE+[^_]ÍD$ tD$D$%$y t]DžDžDžDž|wHt;u Džx$tT+ l`XtGt`u\W9tCu+w9 t  | t1҃1҉ TL9G9}Gw9 uuttdx$tTLf.&9u`q@D$%d$e@gd$…^ d)xD$L$4$tPTP `pLH@D.t&.&vZ~u~ x G<_x$tTLt&.&9uiJTƅyx$1ɋtH`phG <t`V9&ut뎋x$+-Ls8vDž:@D$>6`ptu t Džx$y,vGt$5<$5ux$%,Dž|.Ix҉$+Dž>$58JD$ D$D$u%$=l>x$z+Džx$]+DžX`A{$0"DžDžt?G t,Gt&H?wB11  ?uNj<$7cD$ hD$D$c%$kG H닋Dž(D$h3Dž{vGt$93<$13u DžDžvXx.fǃx 4$1ɋt.GtuŋG@fuXHS$7*D$D$D$ L$D$ $6ȉQH9rs$P) xrHH9s $1GDžP`tp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$Xx$1ɋD$D$ $y|$L$$ ~D$|$$FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $7ctp D$ D$t$<$~')ʍ0&J9uB<$h.Xt;1AtF0 $<.Ft4$.X@FXVDž|1dH1׉D$ D$D$$蔢T$D$Ii $IwjNxa 7 $;-x$#5x$#DžFB0$,t2Buቅ߉UWVSp脫MEׅ M11D rEMEr EED$ E$]-HMt$E$]OoX@t\}}< < ߉ډt$$]t!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍD$ D$D$h %$a]D$ D$D$i %$taUWVSpouE$薐>FEu11D rE@tmEEEE<$UML$ML$D$ |$D$E$蒐twEЅUp[^_]øp[^_]É<$|UMML$UUT$D$ |$D$E$+t2E$)RUEetFE$(gMEԋAE܋A EAEAEAEAEEUԋEtEЉƋ@u{Ve!UWVS\ [б 9NjE1a:r D$ D$ D$ $3ƅ?8#D$4$D$4$x1҉< tv< tr׉ʋD$$ƅtbHT$$NGFt < t< uσxzT$$uЋAAA AAAADžD$ D$D$4$fU׉&.&t틍tڋ$~D$$}k1ҋE+Ё\ [^_]ËډD$ D$D$ %$\#D$ D$D$ %$S\\UWVS4ʣCEȋE8Hu11D rM̋]ȍ~D$$nEЉuЋM̉t(Ct&.&Ë@uM̉u؋EЅt $].EUt 4[^_]ø4[^_]UVSvuD$F $tP PH p[^]UWVSD赢*ljE 9EG ut$gt$$ctӋD$$lQtD$F $KQue$1O@=wI$ O‰@=wЋЉ=@1U+D[^_]Ë~D$<$Ptu狵1DžЍtftȍtftD$D$ GD$D$@$+9qt89FD$D$A$z<FL19\9PB 9=0t9$9uۉD$D$ $wuD$ D$D$$I(u9u Xu3fvfvB[UWVS͞B}utHt$F $=E $UF t[^_]ÉE4$E[^_]Í#D$ D$D$8'$VfffffUVSÉ13v.&.&.&.&.&.&   lLLLL9r[^]UWVSTNjEGEGEG EM],t&.&.&.&.&.&Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVSYut0FF#EgFFܺF vT2[^]ÍD$ DD$D$`'$NUWVSmEBU oP?ωMM1ÉPHUʉP@)|89]riڋu uwuoxEE);UEމ}E} ]7E@9r})uu Eu sItft[^_]äftX] E]DEvT$ 8T$D$`'$WMEU E|T$ 8T$D$`'$ME\f7u S,f$UWVS$NÞEE} 9E1WEEG?78)‰T$lD$<$cD$ED$<$LEyX1tftE+$[^_]úx)rD$ ,D$D$`'$KD$ ,D$D$`'$qKWZfPdUWVS$ޒK}ЋME E 9EƋE1B.ljEDGtXEE؉ƀ0xC1E 1҉uËutFt9}t`}׍Ty1ME+$[^_]Ã}u1ft* ta) 봻A8w믋u܀.u{E9twVË}DGt03Y؃PuuE @4E [^_]Ã댉U }OD$G$GDžUtf.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴,1EE<2w]EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVSjÊtljE 9E`M!t8\$_D$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,hhDžD$ D$D$$]j uit_atP%xrt& r; ut$D$$u f})\D$|$D$ D$D$$ g:t$$%t$$ H%88%$0D$ޓD$$t$E+Č[^_]}vL.& p;8u}vmgl.t& P;8udt$T$ D$D$$U$8<$\=!\$DuD$ D$D$$|$D$ D$D$ $uz|$D$ D$D$ 4$Iz|$D$ D$D$  $z|$ D$ D$D$ <$yy( D$D$ D$D$4$y}艽EЉT$UT$ D$'D$$0OB.9D$ED$$\)U frffXftD$D$$1?D7D$D$$9|҉ƋD$ D$D$<$1D8 DAu.L$$*9|ȋD$ D$D$$aD$$ 5 D$ D$D$. $0fuAD$ D$D$7$lD$ D$D$ $1?D7D$D$$9|҉ƋD$ D$D$<$91B.D8DBu.L$$<9|$,D$ZD$$UWVSakEĉED$ED$E $a>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,1`ẺEEfEEEfEEEfEEEfEEE`t3 u'^"lUonUt& x;uED$|$ `;.D$((D$E$?E`t eED$$;E`AED$ D$D$$~D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^;D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,7^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,g]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\aD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,/\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[=E`ek‹wt& puED$ t$D$E$:k‹w p8uED$ t$t$E$jWc& PJ8uED$ T$t$E$jWuf Wz?uED$ T$t$E$aE`t tED$$ ED$$1ɋuEzED$$ E]ED$$@E@ED$$E#Ef Ef Ef EĈ[^_]Í T$D$ D$D$<$=n D$D$ D$D$$UnU D$D$ D$D$4$m D$D$ D$D$$UmUP D$D$ D$D$4$]m<$~D$vD$E$nĈ[^_]ËED$ D$D$$ED$ D$D$$ED$ D$D$$uED$ D$D$$^ED$ D$D$$4QED$ D$D$$ ED$ D$D$$-ED$ D$D$$ED$$ jIUWVS$kWauE } 9U1D$L$ t$U‰T$$}xVD$t# $U+u#$[^_]$.19UED$ D$E D$E$]UWVSV`}ED$|$ ED$ED$E $x8Ɖ<$uH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$Uq`E 9E1D$|$ D$E D$E$&…tD$<$HE+u Ё$[^_]UWVSiU_}u Gu 4 Gt*D$4$uUt E[^_]ËEtE[^_]UWVSTm_uSd~M u7&.& ~t9uUt E[^_]Í L$D$ D$D$<$hEtËE[^_]UWVSST^u} cVu5f.& Vt!9>uMt Ev[^_]Í|$D$ D$D$4$hEtËE[^_]UVSS&^u cmglt& Bt ;2u[^]Ét$D$ D$D$ $gv Ɣ[^]Ét$ D$ D$D$ 4$Ng[^]UWVSRk]U} tfUBb~U f ~t;u[^_]Í T$D$ D$D$<$f[^_]ÍlUVSlR\uaL&.& Bt ;2u[^]Ét$D$ D$D$ $?fv Δ[^]Ét$D$ D$D$ 4$e[^]UWVSQ\}auwX w t& @B w- wi ue2@w, u8+5\u(Lu[<uB,1|$fD$ D$(D$4$d[^_]Ín<捳ލ֍΍ƍה뾍붍뮍G릍랍N떍뎍(UVSO_ZuE_D$(YD$4$_x#_Y[^]_t$ T$D$(Y$UWVSvOY}^nv.& rt;:u[^_]Í |$D$ D$D$4$Lc[^_]UWVSLNhY 9E1E <tmD$nD$ D$.D$M‰ $MbMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$M~UWVS4(NÝXEEEE$GE܍U}}؉HEU;EEU t 14[^_]ÃuuU<-1E<+u JMBB.DK+r1&.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF RGEuuESt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVSJ~TEU UHMHMHMXˁHɁ@ ='-E썇'E)ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)MEC$yEE-$yEE$yEÅU܋MXE^}d\$DD$@ED$<]\$8T$4]\$0]\$,]ĉ\$(t$$L$ ut$ut$uԉt$uЉt$ủt$ uȉt$X(D$u4${%E$Et $Et $EČ[^_]ú)‰U썇iEESEW- uVE; er@ror:@ unk@ nown@ LOC@ RR @vers@ionEČ[^_]ÍsEs}\$DD$@sD$*t<.tȅx%[^_]Åt<.1[^_]ÉMuT$ H T$D$($E[^_]UWVS0EPTE荰EEEE$WPlPHH8|$ x|$x|$@ D$L$T$ D$D$4$觰~ Eƀ0[^_]UWVSD^OuL Gt-D$4$u?E tE [^_]Ë?D$єD$4$aukVB.DPtM@D$ ED$4$讍ҋMyE8m1Ɂ]1VUWVSCnNulmg Gt-D$4$ u?E tE [^_]Ë?D$0D$4$qukVB.DPtMPD$ ED$4$辌)ҋMyE8m1Ɂ]1VUWVS C~Mu D$4$FFy ;F|/} t)P}D$4$[^_]Ét$E$sUSBMEM QQy ;Q|< tZ[]ÉL$$%[]UWVS@BõLEu E$jEEEEED$4$F0u ǀED$4$D$4$[^_]UWVSA+LPPƀ9uV@ttuF*V@uuOFuuFuFf~@t8D$4$Tlj4$kP[^_]ÉFu뺋F몉4$QfF@UVS@lKƀ9Fu t$@:.XD$ D$ED$4$'[^]UVS@Kƀ9Fu tE D$ D$ED$4$[^]UVSU@Jƀ9Fu ztED$ E D$ED$4$[^]UVS,@}Jƀ9Fu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$D,[^]ÉED$4${EUVSy?Iƀ9Fu t2ED$ED$ED$ E D$ED$4$37[^]ÉED$4$EU?I9U]U>bI9U]US>@IED$9$?[]UVS>Iƀ9Fu t$ED$ED$ E D$ED$4$[^]USJ>ÿH9$mO[]UVS#>ØHƀ9Fu Ht2ED$ED$ED$ E D$ED$4$=[^]ÉED$4$EUVS =%Hƀ9Fu t9ED$ED$ED$ED$ E D$ED$4$9 [^]ÉED$4$8EUS7=ìGED$ED$ E D$ED$9$D[]UVS<iGƀ9Fu t4$lM[^]D$$US<GD$  D$ED$9$9[]fffffffffffffffffffffffUWVS 1<æFE8tj׉ƅt|$4$Ot@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS;F}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$ET$ D$D$)$ <.EE룤u9sftuu_SfӋ]KUWVS0:EE׉΋UU܋U؋U$EM9L9MyE荃EEuuE9D$E$t4$ME*t4$MuuE$EtE؉Eu܉00[^_]ËuE$Etu)y9uΉE)T$ $T$D$)$E0[^_]1UWVS$8sC]Uϋu M MUL$T$ L$U‰T$$"EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂D$ D$D$)$ <.Eډ)؋ux$[^_]ÿ뛉댋]썃D$ $D$D$)$뷋]/EE}8UWVS(%7ÚA]}u ӍR9M)ÃM <.E썁EЉU u2D$ED$ D$D$E)$EJBs1([^_]É4$EIt+([^_]ËUU]UE([^_]UWVS+ 6~@E}E(M,u M0p 9tU1҉u$t|$$I:ƀ?YE4$kSDžU4T$|$E$-Eƅ9s9D$D$ D$D$)$ <.7)U4E$NjE$|$D$T4D$ D$dD$$HNj $‹>|$ $}wyEt}wvM 򋽤(t#t<.z<7|0.}u$%U$'D$T$t$D$ D$dD$4$nG‹$i9?xB.|f @)~ DžƋD$D$<$9u׋)lj4$}O<$xJ|$4$1ɺ0f; @|01x DNu.9uՋʋ)‹4$9gƋp)p9D$ $D$D$E)$J}+R"}$4$VD$t$ D$dD$<$D‹$$D$t$ D$dD$$nD‹ $eGD$t$ D$dD$4$D‹$9z9[D$|$ D$dD$$C$utE+-Ĥ+[^_]ÍE4$y(5tD$$1ɺ~l<8E4$3+D$D$$U &Ƌp)9D$ $D$D$%)$I}$ 4$VD$D$ D$dD$4$A‹<$4|$D$ $Dž- Ɖ$JH}u ;}$$|u$),D$t$ D$dD$$@‹ $ GGD$t$ D$dD$$R@‹ $IG$D$t$ D$dD$4$?‹$_wGo"D$|$ D$dD$$? $9u}3$J;x$ nG GGDž====Dž$`lj9-w\&79&&Gt1Gta$D$D$ D$dD$$~=‹ $uuO}$<$fOwG$$T$t$L$D$ŜD$ D$dD$$<‹ $$9 E$p}$4$V~NL$T$D$D$ D$dD$4$;‹$TD$ *@D$E$pt$<$C-Dž##?#J1>)0~0 $a09"$,‹ $#u|$D$ $U R<$J0|$T$ $ J9$sƉ9$)u}$@<}$D$t$ D$dD$$9‹ $GGD$t$ D$dD$$K9‹ $BGD$t$ D$dD$4$8‹$bGG<o"q"}4|$ t$D$$軳4$9s?D$D$ D$D$)$ <.։)׉}49)= $ݜS@u$D$ٜD$ D$dD$<$y7‹$t6c'92@Dž@DžDDžHDžL@)‰t19rE4D$ |$L$$賱<${9s3D$D$ D$D$)$ <.)U494$JPt$|$,ED$JD$ D$dD$4$5‹$@t$$4$A븃}$u$f}$v}4|$ t$D$$.4$9s?D$D$ D$D$)$ <.։)׉}4FD$D$ D$dD$<$n4‹$iF9|Dž1ٜpƀu2$BDž |$D$ D$dD$$3‹ $|OP9w|$D$ $U v<$JT|$T$$U Y%<$X)‰Ѓƍ@t$D$E$$+4$)D$D$$U r)j1-K:f.&.&.&.&.&.&.&9t؉4$QD$D$ D$dD$$$1‹ $u}$4$F$$D$t$|$D$ D$2D$@4$x0}$<$.G$ D$t$D$ D$2D$@4$ 0‹$q4$Mlj4$J$zlj$H$0lj<$]|$D$$U ^8%<$cG$UOWT$D$t$ӜD$ D$(D$4$8.‹$3E$p VUUU)ȃ= $ݜ[Ht$|$$U C4$Jz4$2~$bD$D$ D$dD$$ -‹ $o<$~$D$T$ D$dD$$,‹ $<$IfF $7 4$)D$|$D$D$ D$dD$4$,t$|$$U a4$JCF$~t 4$o4$dD$D$4$4$j9E4s3D$D$ D$D$)$ <.>D$D$$U v9p-F9Gt1Gta$bD$D$ D$dD$$5*‹ $,uOE$ VUUU)ȃ=F$ݜ>+}$e}4|$ t$D$$裤4$k9s?D$D$ D$D$)$ <.$}~F$B= g$ݜ}$+4$%VD$D$ D$dD$4$(‹<$}$ )ƍG GGG GG GGƅ=t9yG GGG Gƅ=fDž==fDž==Dž====W GGW GW GGW G$g<|$D$ D$dD$<$$‹$eD9D$|$ D$dD$$w$ $kuD$ @D$t$$Dž  J1F)0~0 $K09 <$譼‹$uD$ @D$E$D$$ J1F)0~0 $09Y <$‹$uJ}$4$lj$}|$XD$ D$dD$<$5"Nj$‹*T$ $1ɺyk$ \C4$Nj$u4t$D$<$9Dž9s3D$D$ D$D$)$ <.)u4t$$1ɺm_4$ f=$Nj 4$u4t$D$<$3Dž9s3D$D$ D$D$)$ <.)u4t$$1ɺgY4$q7$Nj4$u4t$D$<$-Dž9s3D$D$ D$D$)$ <.)u4t$$1ɺaS4$ z/$|4$u4t$|$$+9s3D$D$ D$D$)$ <.lj)Ɖu44$Mt$$1ɺ7)4$ }4|$ t$D$$$iH)$qT$ @t$L$$X…$ЉPzD$D$$U 9ȋ$r s}$ f<tu$5)0~0 $097$~‹ $uu$y(5<u덍D$D$$U R$'1$<|UWVS8m E  U8uy(E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$P8[^_]U^ M8E#ʬʰ]UWVS-â u}'|EtG9E r'Gf|t+E D$<$պy躽([^_]9} r+Ey;}uE,T$ %T$D$l*$E뵋E9E r1UWVSd EE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]~(UWVS}Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]07F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,bxM]`]P(UWVS TEu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cAN])](ffffffffUWVS E}]} 1E䍘L%;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃0u FH*${zMUWVSn}u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉEȝT$ %T$D$gH*$EEF, UWV0u, o^_]ø1 fffUWVS\qϋMM 9uM1t$D$ED$ D$2D$M $MaƃM9r,ML$$A7M)11}U+u\[^_]ø\ UWVS CEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: E E+Ju}: w) ]u$M EÉ$SrKE}~=Ut3}ƐB.njB.w\DAtu܋E Ƌ})x [^_]9u]䍃םD$ %D$D$el*$ [^_]ÍM U$WEM E$DtiEEM E$HEbt?EM EÉ$MM7tEMffUWVSu4$豚H9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} q(yUWVSnE 9E1D$|$E$tGD$T$${tT$<$4NU+u [^_]MfffffffUVS'EuUMx#L$ T$t$$Vx9s[^]ÉL$T$$[^]fffffffUWVS AöutcEt\E $)ljD$4$*u?|$4$Q&u%džt$|$E$# [^_]É4$%f謨UWVS $utcEt\E $(ljD$4$)*u?|$4$%u%džt$|$E$" [^_]É4$O%UWVS Ôu t\E$'ljD$4$)u?|$4$6%u%džt$|$E$! [^_]É4$$蓧UVS  uD$4$o!tD$E D$4$5 [^]D$E D$4$ [^]UWVS/äu} tAv-u3D$4$'tD$4$3(F1[^_]軦US8EU tttu P1[]vUWVSy}u t' td@t/tZv{Nw u6(D$<$&tD$<$R'71[^_]D$<$&tD$<$"'΅uʍ&UWVS4u} tPD$4$a&t͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈D\$8؉ȃD$xtD$xj݄$D$|&tru|$T݄$L$PtT$0D$4)‹D$|(Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|;ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|TH$$Lt$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـ\$8ـDRD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|(S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|SMD$`U|$p|$$N1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$|&D$4$.$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|9LD$`Z|$p|$$rM$%|$x==p$$\$|DD$h$DD$p$DD$H$DD$`$D$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaULA.U E]XUMU E]Fffff̀ffff̀rS[t@3 [̀rS[T@3 [̀rS[4@3 [̀rS[@3 [UWVSu Et"4$tEExu4EE[^_]ËED$t$<$utGt8Eu׍GEE[^_]ffffUWVSfu} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]Í*D$ X'D$D$e*$}*D$ X'D$D$f*$}UWVS"×u} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í+D$ t'D$D$C*$| +D$ t'D$D$D*$|D+D$ t'D$D$E*$|1sUS[E.T$ D$PT$$>[]USE$uE []1[]UWVS$fEpEEEEEE1ҹEEuxw88 w38&E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`US!ÖEU} ~\wEBu - t wJt Bx1[]ùr u-JuB-袀萀 UU1Ʉtt'4$nD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]US ÀUt/9E t*D$ 'D$D$ph+$dxE []US#M E%t.9t*D$ 'D$D$ph+$x[]UEtt]1} ]ËE ]USÆE ~>uTEtKD$ 'D$D$ph+$`w~Ewǀ[]ËEǀ[]US舿EU tt 1[]D}UWVSGü$ 7Etc@@|D$D$4$&|u E[^_]|84$?|81EUWVS趾+uthF~O9tHNM 1[^_]ÉU^|ED$|$E$U7|u=FUF맍D$ 'D$D$Z+$~vi|UWVSo}t;t-M tWt1$>;wr$><$>[^_]UWVS蜽}tJWt7E1U9}t#E4E D$4$lu߉[^_]1[^_]ÍD$ 'D$D$+$uUWVS ÀE@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(2D$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 D$D$4$Hff D$4$>[^]Ín0D$ (D$D$6L,$bUS茩ED$ E D$D$E$$>[]ffffffffffffffffUWS2çDžt)tYBfBfB B [_]ÉUe6D$ (D$D$Mp,$7aUuU*6D$ (D$D$Np,$aUrUWVS膨lj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]ÍD$ (D$D$`p,$-`U'D$ (D$D$ap,$_E+D$ (D$D$bp,$_UWVS\QǾÉEEE 9E1fjDž9E]qA D$.$(zB.8tGt3\_u<.uuy.u}fD$:$(tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $3R@)9x‰ ȉ@ ME4$'QL$D$t$LD$3D$ D$LD$$蕏A,Dž9E0a#D$ (D$D$Bp,$~[D$ D$D$$DTIf ugx.fcD$:$u$?fnUWVSlÆZ‹BcB $(ODžmDžDž r D$$DžtUpЉD$D$$<+Gt< tu򋽜$H@)49O)9y )ЉA V1ҍ;tftH<@ lj)9t?9rr ΃rj놉D004$L@9U$ @ E]Džl[^_]à f.&< t< t򉍼\D$4$j P8 t$$ N19<)׃ D$$4T848#Iu‹tft‰)‰DžNtftR :)9&44$J@9‹f&B0tP< t[< tW< <9s>z2D$4$ tpu׋)ʉ׃ (D$ $18f cFt$$]K'9Dž1Ct$$Kz90CD$ <(D$D$^p,$SwP$Df0x0k$Gtxf\>0N7L1UWVS`ÅE‰Eu 9E1FE D$ .u‰t$L$E$')}NEE4$FML$ML$D$ t$ED$ $肁‹Et]$XE@ U+`[^_]ÉM $ˀM<ʍAE`MUƋE$u눍D$ H(D$D$p,$Q$UWVS(薘 uE>FE苳 }tgUE<$EML$ML$D$ |$UT$4$J‹Et)$ E@ ([^_]Í뗋MUƋE$t([^_]Í $pt: ED$ ,(D$D$ p,$OqUWVShgܡ։} }}U 9E1} o0$( 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$4<))9yrtft1'$1U+ h[^_]y2z 7t$$l*D$t$ D$D$$BK@ 9N04$==3׉T9E>f t$$c9P }u,04$=tp9J90Љtftפ9P'$1;NjE$$;$[<|$t$D$ D$%D$$%6<$;=9D$ l(D$D$p,$F."D$ l(D$D$p,$qFD$D$ D$D$$&Hg@ 399x04$:=1Ɖ$}:P)9| At$ D$(D$$%r<$ :p)9L$L$<$X8f&($ЅwDž$ I1Ht$ D$D$ D$D$$EDž8@ ?9$8x9D$D$4$W>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $.Ulj$ FfDž 1DžD$D$4$T0։9^f 19s<04$CJ})σ (D$ $ljUWVS$資(u}6EGBEB $E+EDžD$ED$ED$ D$ED$<$R…F D$FD$FD$ D$|$E$MElEE$<$lEEt $[^_]ËF t:$[^_]øEE$<$E$[^_]ÍD$ x(D$D$p,$>E$7F 뮸xUWVS@~Mu 9‹E1kFB FBPƋv}ۉ\$D$ D$)D$<$~HNj9s4$@ D$ X(D$D$p,$:`4$/$@@ -$@@ t҃$S@2fJz UWVSo?ƋEtvF u>ED$ ED$ED$E $Elj4$?[^_]ËED$ ED$ED$E $EDžt뼍#D$ (D$D$p,$9[E1UWVS蛀>t@ËED$ ED$ED$E$ًU EƉ$>[^_]ËE1[^_]UWVS0ÔE}u  t=/10[^_]Ã} uyMMUUUUu|$M L$D$LD$D$ D$ D$E$skuE0[^_]Ã} t==a8t{bPWPtD@ 7 E #΃T$ (T$D$p,$97Ex{UWVSX~}E EЋEEEE 9E‹E1$(1r E؍EEȉMԉ}܉<$CD$D$ D$D$E܉$qDž E؉D$<$XƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$zPu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$)@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$(@9Er7‹}ԃrsSt}MԉM܋E$zE܉$oD9E1uU+X[^_]ÃỦϋU)׃E (D$$t 8E܋UEȉD$|$$79P@ EĉỦ $R9ŰEMEЋPEEE$E܉$zEaf{E̋EM8Mԉ $EE7ufiK1E܉EUSyS7D$D$@ D$ D$ ED$E D$E$[]US.yã6D$D$ @ D$ D$E${[]UWVSxY6'7tDÉt$ D$@ D$ $ًU EDƉ$07[^_]1[^_]UVSixނ tpǃ ǃ ǃ ǃ ǃ 5D$D$ @ D$ D$ $?Ɖ[^]Í $ t5ΐUWVS0w&ƅAqB.8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]Nȃ}u M 9E܉‹E1oNEEEE:FEEEE1E0)Eԉu։M|$Eԉ$_MԃLU) ЉEЃEExuMuȍ~EE9Effuą)u9~4}čDUM.&.& 9uM؋EEAEAEA W\),M؍*6MЉL$ D$D$J$U~,Mt2UW1/u܋U+H[^_]Ë}܋E+ʉH[^_]E9L1뽉|$) $MtM:fM؀9t‹}ȍGU9rUffMEE1W~:uFE؃:MЍe6ẺD$ \)D$ED$I,$Ub+MЅɋU؋EM؋ẺD$ D)D$D$$+M&tHD)M؋EЉD$ |$D$$*MEąE؉EEȉEmMԍe6D$ D)|$D$$U*U؋M댋}ȍEEfuM.]EȍxEE9IMԋUȉ1M*1XffffffffffffUWVS8q&|։ 9M1ɅUHL$HL$HL$D$ D$D$M $MU9ЋMs%T$L$4$/=U+8[^_].1މU؉E܍*6L$ t)L$D$i, $A)U؋EEU؉E܍e6L$ t)L$D$h, $)U؋EUWVSzpzEu} tM|]x 9EËE1t;l]./1}U+Đ[^_]ËE),]*6ED$ |$D$I$U0(UutEh)ED$ t$D$$]'U1 Dr틽tE.&ك Tu111M<<t9t0u}t E9|uӃ}E:Eþ}} ]9p}9P}9:E$E׉]U)MD$ ED$T$U<$]U97}Mfx]9o:뗋]E+mx|tĐ[^_]]e6D$ E)|$D$H,$U%|ҋUbtED$ ]h)D$D$$%,t;E@ fu+-dt2 ufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$E@0E@}Gfg D$<$1İ[^_]Q}Wf9xD$$3‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09FE E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$E 1[^_]ÃuEt$cE ԅtEuT$U$EM U_>D$ @*D$D$`H-$MTD$ @*D$D$^H-$U 2D$ @*D$D$_H-$@*D$$$UWVSRNX}u t'tQD$ t$t$<$ [^_]ÍTD$ 4*D$D$H-$Xu՞D$ 4*D$D$H-$*UWVSM(X}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃fD$ (*D$D$H-$XUpU썃LD$ (*D$D$H-$#UE1U썃ZD$ (*D$D$H-$UU썃TD$ (*D$D$H-$UUWVS6LëVuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$E 1[^_]Åt<$E냉<$E ωЃttkE녍2D$ *D$D$H-$TD$ *D$D$H-$dUD$$NjE 8Ut Eo*D$$ UWVSJUu} t tJD$(#|$4$4[^_]ÍTD$ *D$D$?H-$u2D$ *D$D$@H-$UWVSJ}Tu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍwD$ )D$D$XH-$BTD$ )D$D$WH-$k UWVSHfSu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]ÍvD$ )D$D$|H-$BTD$ )D$D${H-$T UWVSGORu} tt@} u[^_]TD$ )D$D$H-$uwD$ )D$D$H-$UWVSLGQu} tt@} u[^_]'TD$ )D$D$H-$cuvD$ )D$D$H-$5UWVSF3Qu} tt@} u[^_]TD$ )D$D$H-$uwD$ )D$D$H-$UWVS0FåPu} tt@} u[^_] TD$ )D$D$H-$GuvD$ )D$D$H-$ffffffffUVSEPuED$t$ ED$E D$E$E~>.t[^][^]US?EôOED$ED$ ED$E D$E$[]UWVSDsO}E D$E$St u)x[^_]9u|-D$ +D$D$-$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]USB*ME D$E$[]USBME D$E$[]US`BLE$r[]US=BòLE$@[]BL9U B}LE M¸7]UEf]UE]UEfU f]UEȋU ]UWVS$ALEE EEE0PE }썿L,}Uuu9E }9sux.tb@tx U9sS@}AnVUBc} 980]($[^_]uuG뒍V>[U|$M $jU:M)ȍ<FtOD$ $=t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\] ( [^_]ø!!"UWVS(6oAEEEE܋E9ErME 9EsEEH0}}]EEƒ@dt(]n(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]D$ 4+D$D$-$=EKuV]ڋ]9 }9;] }|>}uE~΃s/uuUE]Ex}܋EEH}uEU1Ã)@؍sL uʋE EEEEȋM EEEEEĀ}9EE;E+M؋ M È}?Ћ})E=?J2}ЁM؉M](M]t}ȋE9sȋu)=?EШEE<:<@uc}A,E@1PE9ЉϋutftUEEـ}E}9J‰ϋutftE}LEEEED$D$<$tE+uЁ$[^_]ú^UWVS$n.8E MU 9E1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]É@^US]E M9r 9s9su[][]UWVS~-7EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS,-7uE t*X?w#9r6 )ЍXt9Aхu)[^_]ÉT[^_]É=()[^_]UWVS8,6EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]s[^_]Ë]X(1[^_]UWVS Q+5u}E9E |2&6D$D$$umtF;Gt1 [^_]ø [^_]UWVS*[5U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]ÉO(;,?UWVS?*Ǭ4EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]É(F[^_]øUS)*4E D$E$( []UVS)3uD$D$$NtD$T$ tV[^]øffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS((F3}EU܉΅lt F"}uFEUT$$]@uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVS*}D$<$#|$ ED$E D$E$ND$<$[^_]US4é)D$D $*[]UVSx)7u4 [^]ÍKD$L$D $訋ƅu$SƅtD$D $\FFF US i(@U T$UT$$ []UWVS2ç(D$-D$@:.<$脎E t8ED$E D$<$|$ D$D$I$E$1D$zxD$$[^_]ffffUS'E D$E$[]USU'E D$E$z[]UWVS%Ú'E։ϋUt%T$ML$$Xx[^_]ÉD$4$藚ƅtU1UWVS.'u} GD$F$uD$$~[^_]UWVSn& l$^xD$ 4$mFE9L P ELh$~D$4$݌9dd h Džt`t\Os1Wp΋ t $蔜pP9uዽp$vGt$att ;h r`t4$7ǃh ǃd \ ` t\1tt:$Ft)NtF D$F$ыF9pt$g;` rtt$諛ǃ` ǃ\ Kd$˥h uAEUL P h$*l$LĤ[^_]ËW*T$ D$ D$d $UWVS,m$ 9U1DžDžDžDžDž$Jt3D$D$ ŸD$D$<$=~h$` \ \ T$ D$` T$$1U+;,[^_]D$<$zϟT$$rT$T$$Љt6t,$L$ D$T$$=;pt$Dž$Dž$t5tD$$ҋ;pt$vCHUWVS(*"u} tmNV$VFED$D$ ` D$\ D$E${1ti([^_]ÍD$ ,D$D$~,.$uie6D$ ,D$D$,.$C:델UWVS -!}SG<tmL$ D$D$$^GE-E썃gE荃jE+E$EE;GE4G0D$E$GD0t‹E$˂GD0tQt$讂GD0x#$葂GD0c4$tP$aGD0$ m [^_]Í'D$ ,D$D$,.$~UWVSÌU1h u;h vd <D$E$wu΋Ot5GEt1 t $評O9uu $薕GD$ ED$<$o1[^_]$ h d Et7d ύD$ ,D$D$,.$| UWVSlpU EIEj7EVT PT LE$sEEč*D$D$ h D$d D$Eĉ$w"HM@EEEEEU<ЋM E u D$<$/uuNVZED$L$E$ҋUBuM}#TuEMU9sE$l~E T ul[^_] E(4$_|X U .9PuMEAX X E4$|a}ED$D$ ` D$\ D$E$vtMPtFMMЋMMԋUT$D$ P T$@D$EЉ$utH P1EUM9EFD$TT$Xt$\L7k9)B)Ӊ))ʉ)щL$T\$Xȉ"D$TT$XL$\_u)Љ))щL$LD$H.D$ i)\i(\ËD$T)\QD$dFEUED$ ED$ED$<$ƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F.1'Xe]؉ E܋؉p }<$}؍4 1ƅ F(EUjUWVSA|$8ljD$T$\L$XE \$\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}Q)à u\$hT$P.׋T$h(.&.&.&)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 qL$@t$<;t$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9\$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 D$pT$t9#D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`6D$D$eЉ t$x|$|KD$pT$tD$xT$|D$pT$t D$pT$tD$pT$tD$xT$|É։D$hT$lD$xT$|D$pT$t9؉D$xT$|D$T$D$xT$|D$D$ ED$D$HD$D$X$D$\ЅtE D$xT$|e[^_]Ë\$8`TD$<=9Ћ|$$)D$xT$|$$$D$ ED$$D$D$X$D$\Ѕ$;$D$$9$;$$D$pt$0)$t$h|$() ‹$|$@D$`) $Ƌ|$4) 5T$<;$$$$t$x|$|$t$h$|$p$$|$@$$$$$$$D$$$$$w\$hL$piF\$p9hFdN-00dFD$xT$|L$hdF)ډ$$D$PD$ ED$D$@D$<$D$\ЅtcD$,;$uV$T$0)Ћ$L$() ‹$L$`) Ћ$L$4) uD$<;$u \$p9$t\$hL$p$$UWVSD \$ljT$( 9D$Ë$@1΃ ~G \$1D$D$D$?D$$D$E$T$(Bщ€|$?t>T$4L$8\$\$T$4L$8\$$@+nЉʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$[1ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0x$@L$ @D$ D$4L:f.&.&.&.&.&.&.&9t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Oщ€|$? D$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G 9t$ tG -t$\$49t$ \$|T\$a\$UWVSHb|$`ƉT$lL$4 9D$PNj$D1fB:/ t1P.tt!P.u.ux/ >|$p|$X40>D$HD$h$t$|$tȃ|$dw|$T8.&.&.&.&.&.&.&%1 ڃ9t$tuމ|$Ty\$pC\$hsK\$l\\$T\$l\\$L9D$Tt$hL$h\$lDT\$d߃D$pD$p\$t9D$Ht$D$l>71D$t":tD$l0>D$t9yD$@9|͸!9tx/aN?|$P$D+ e[^_]ËD$`D$84$\$`G,뷋볉D$0AL$<L$@lD$,/ \$X))D$8t$8D$ t$|$$\$`9|$t |$ DD$40|$8%|$x |$8G|Ft>8t$|$lG$D$\t$lD$dk XPD$T1$D$L\$hD$X$(D$TT$dT$t ;H Pl$ty1pYD$tT$pFP~L\$t9\\$p}3=H\$t\\$p\\$L ;N>VD$\9W\$hD$lP~7|$ldF$ _tft|$lGD$l@11D$h ؃ux\$T9؉ӋL$LT\$p|$lw|$ldFT$|$@u)D$lJD$ht$t|$hwT$xmD$`tD$lD$XGtt$TDD$Pt$p@dPdPltftߤ1ۅqD@|$p`Pp@D$LD$pf@D$`<EPHЅut&.&>u)׉|$HT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$tVtftt$l0e[^_]r1D$LD$`*t -~0 wNjT$`)׉|$HL$Hy|$8u|$X|9|$@ ,;T$|;D$d$|$$8,$|$ g8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d.D$Dt$<uVQ9L$X\$\{9L$TT$PL$XD$\tD$XT$\v9D$Tt$PI=D$XT$\_1ɋt$pD$dt9D$TD$P11D$L4D$x-D$|D$pD$TD$PD$px|$dt$xt$Tƍ>>>!.&.&9iFuD$pD؉D$X1T$p>4iF>kFuL$T\$X)ىL\u dFىL$X|$d9uD$T؋t$pdFdžhFD$|؉lFD$lpFƆqFfdžrFFD$pt$@p dN\$lډNjt$ttft|$l 8D8\$HډNjt$`sFtftt$H0|$xT$|p,g;^1fc뛨{2Oi)\= ףt$D4)L$X\$\9L$Tt$P|$t$CD$<D$DșD$XT$\D$D$0T$4T$4T$ D$pT$0TT$ Tp-\$T$T9Ӌ\$PT$ |9t$dt$<0>FD$<șt$9Ћt$L}D$(D$Dt$,D$XT$\D$XT$\poD$DD$(9}\L$T$$D$dL$T$ D$,3QL$dlD$,9Pt$pD$dN$]=uҿT[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]M1DžuAM荆dNdNt_9t:*~+uـZ@̓avÅ1t&wUVSu4 $/tu[^]1ɉ򍃼[^]迯87US褯7t̿$^[]øUSk}u[]Í̿$%[]UVS8í}u 1[^]Í̿4$4$[^]UWVSmEuM V~KhFhF1.t&.&.&P9u dN9ut [^_]Ë]rl1[^_]UWVS{UM Z~>dFdF&.&P9u09ut[^_]Ék[^_]UWVS(pEEM E3 mEE1u,(/ǃp 1}tME!}t,/ǃp Gp7>袼ul U1)Љ3 ([^_]Í3E؍3 E܉΋E؉$YNjE"D$<$EE3 ~|$E܉$[tm}tM썳̿4$4$MN([^_]ËWr觻y}D$ /D$<$HOGщ돾Bb0vUVS踤-Mu tE[^]ED$$E4 H[^]UVSIþMu tF tE[^]jED$$(E4 H[^]2UEt@ E]UWVS责)u} tF ED$$}4 H[^_]UVS4[ЭuD$FD$ FD$F D$FD$FD$F$D$,D$ D$(ED$$&D$$4 H4L$ xLL$L$ NL$NL$N L$NL$NL$ NL$$NL$(N L$,N$L$0N(4[^]UWVS]u } IXP& ;r B}y[^_]ÍIlP)׉[^_]UWVSÓ7̿$  3 D$tQ|$RXPL$u} &&.&.& ;p H}!yL$u} t1EU [^_]ËL$u} R|$lP)EU uύ̿$ 1L$D$D$ D$$ L$(3 t7D$oD$^L$PUWVSET$RuXP$M ]*&.&.& ;H p|yE U $\$,.&.&.& ;A yyƉ;u ]9u ] $\$,.&.&.& ;A qyƉ9u ]|M 1]1 ȃ[^_]ÉƉ;u ]}# $\$ ;A y}&yϋM 1]1 )ȃ[^_]Í [ulPƉ)똍 [ulPƉ)L [ulPƉ)RUlPE UvUWVS˞@7̿D$$} ƅ3 t<t`UM T$L$$Ɖ׋D$$9 [^_]D$D$ D$$&uu} 벾[0ffffUMU t"1&.&9t<u‰]ffffffUWVS豝&}u tSB..&.&t(TSNLKf9t)ȃ[^_]1[^_]ÍbD$ 0/D$D$BP.$U끍WD$ 0/D$D$AP.$WUNUSߜTT u#$P tЋE$>YUWVS蘜 e=t:F$V FtD$$]4$Yuƃ[^_]UWVS1æ}ƃT $tCƉxtD$<$\E FEF e1[^_]ÃUWVS軛0uE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍ D$ ]UZӞUT$UT$ A.D$E D$E$]UED$ED$ ED$E D$E$]UWVSaD$@:.FX$w(F`F`y ;Fp|4} t.FXPVX}D$FX$f([^_]ÍFXD$E$HUSgܝE@:.Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US ÄE D$ED$@:.X${ []USؒMED$ E D$ED$@:.X${[]UWVS蘒 M} }E EEEeD$E$&E@ E@U~5M19E}EtfEtME)‰UE$UE@몋U tE eMOTEfH @1[^_]ËUulj7wWU<$\UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $%E[^_]ÍD$ |/D$D$Q.$(Iln0D$ |/D$D$=.$HE)1u E MOuo U/D$ |/D$D$.$pHE@UUD$E$$EU)1u .fBefm7MyHMUS uED$E D$E$w []USDùED$ ED$E D$E$x[]UWVS EED$E $ƅwDžt}D$ED$E$9xY=?fGfw  G$ G,2 G( G Eu/[^_]É$CLfG 1[^_]D$ D$D$<$)[^_]ÍD$ /D$D$>8/$\FUWVSW}t6D$<$o"G ƃD$<$|"[^_]Ín0D$ /D$D$;X/$EUS gܗE9ErD$E D$E$ []蠽ffffUWVS!Öu F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9u/D$ /D$D$W|/$D+V9Vs4$u^4$qgn0D$ /D$D$<|/$ODI fffffffffffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS lUM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$ F0`UWVSL蹈.ljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw /t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$8011ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$PL$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$ !L$D$$9$L$D$$9$L$D$$9$L$D$$9$UUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$1HL$D$$98$+L$D$$9$L$D$$9$L$D$$9$L$D$$9$L$D$$9$UWVSH^s}$M$} |$8}|$<]\$@ 9D$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$5D$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$1⋼$<$$ "SG f A$fx/D$<M$$DŽ$DŽ$D$$$$SD$$8$$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$2 󥋔$\$l{$ [L$8L$ D$T$$4$$5FD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$1@$4$$RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pdM$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$0$$|$D$$4$$H2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$$$D$l@$3$"$T$p$$$ÉD$d4T$p$$D2 t$8t$$DD$ $D$$D$$<t$d$$h$$$ $$$x3$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$3/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$ $5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$ $4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$Sx$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$3DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$2 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$_PvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $D$ l3D$D$/$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$轡$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVS}ED$E D$EE$$©3E܋<\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$ܠD$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$T$B@Ɖe[^_]ËED$E D$K$@Ɖe[^_]ËED$E D$$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS,#}m|$D$%U <$Y!3m܋<|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$T$d=Ɖe[^_]ËED$E$D$K$2=Ɖe[^_]ËED$E$D$$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`HE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$X¿3፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$3$U:ue[^_]ø랸뗸1fffffUWVSpC96==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$Pأ܋D܃L݃TT$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$`(\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$`(D$D$PD$ D$`|$Nj} t$@ ;؋\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$T$6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0كDڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$`(D$X (.&t u)D$@L$$~YD$`D$؋tT$HL$H؃\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVS+u} G9F}uuFV|9s]B9EE)ׄtdD$D$$UhREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVS8$}<$ GD$t$rD$dDŽ$ݜ$DŽ$E$E}É$-wʋ$5牜$}D$p0E@D$0D$h/$D$xDŽ$15$DPЉ$K$C‰ǃ/ ˃9?~ыL$xDPЉD$xU tE u0e[^_]ÃL$t8et ED$PD$TL$hA$Et$LD$t1|$F$ߍN L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$D$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$(1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$*=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈DT$@$L݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـDD$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈lD$@ؠDTD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$ب\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$TxD$$4$$$D$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$(݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$(݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`L6D$h$$$ $$D$x$$G)‹$(݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$(fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(fE܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<fE 9Ex0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVS豌&uEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS0詋}u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS蠊EM]E TsCD9sf9r)؃L9s&)D$D$ $]][^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVS蹉*R0)ˉf.&.&.& u썊Xa)ˉ.&.& u썊A)ˉ.&.& u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVS蠇UBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS 1æǤ7} w., U4tfMt@ @.$0E $|ƅEFEFuFF [^_]øMEP$Uу, ‰)U= w$| @.$It @.$0xUWVSÈut"F w"Ǥ7u&, 4[^_]É4$[^_] @.$UN?, 4tU$[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8ւK} EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $MnMUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVSlu   @.Eut?t|$E$EE$`EtsEu7Eu?|$<$r‰EtUE$7Uu @.$u먋E[^_]D$6D$E$ E1[^_]7EuO$rDžt@q@ E @.$} @.$g u딋En @.$=1Xǃ Eu1>UWVS$yu EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVS|xutD$E $zDžD$D$4$(ptt ʃ9t*xD$4$ t|E%=`t`fx ttpu ffx fp@ P$ P,2 P( P Ĕ[^_]K51Ĕ[^_]ÍD$ 7D$D$E1$/514O1USvrE UD$T$ D$E$[]UWVSv7utFD$4$O nx$P8D$4$X [^_]É4$Tڍn0D$ 8D$D$=41$.UVS6vëut&nxP[^]É4$[^]Ín0D$ 7D$D$I41$@.ffffUWVSu6uT1$'- ffffffUWVStuf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $!F0F0$F0ǀǀD$4$FFF [^_]ÿF yF$i4$Lǐ8n0D$ 8D$D$8t1$+81 fffff̀rS[ä}@3 [UVSsÇ}ut8F0u ǀ4$uAnP[^]Ín0D$ (8D$D$;1$ +뜸fffffUVSr|ut#1V ҃ t[^]É4$[^]Ín0D$ 08D$D$;1$*UWVSrÍ|u!7FF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $oF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$ e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$QW8t6D$D$ V\$D$4$ ?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$AuwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS &iÛsEU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVShsƋ4D$D$4$-EtE$VGu͋$5tMtf~ 18t$9⋎t $?4$uu&E[^_]%U9%8}%]EUWVSgq]tCƉ$o[^_]þUWVSHgýqljUD$@$:ƋUu 1[^_]ËOD$M$…1]~˃Mt|tatOt=t+tt9EGX<^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ l$ ;F@tNO$跺4$P%81[^_]ËX@.NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$pX}EpFtD$D$$#F w8t<Jut(F( 8GvЃ<[^_]F(ǀF,}Qf3G !DGDE䋆fHD$|$$DD$ED$$軱DžUPuED$ 8E܉D$D$b(2E؉$GG 9=7EED$ M܉L$D$bU؉$WUMԋEDGDE䋆}MԋED$ M܉L$D$bU؉$uMtUMVE$Mƒ7MɋMEVUfVD$D$$ϲD$FD$$F[FV(VfxD$D$$ZD$|$$̯hP OfMEMfMMF,PfG fGTU䋆f@D$|$$覱UD$T$$Dž@=zD$ 8D$D$b(2$TEfEEM8FtM$F FMF(~UfVF(D$D$ED$D$ E D$L$4$‹E!@uxFЃ<[^_]ËE @ME$MU *‹MEfEE'D$|$$ApUD$D$$UOV(UVfeEfEN,MKOD$D$$ίD$GD$$EWfPM9uD$D$$}7}fEfEM/}fMfMMV(NfMHUUf9UǀxD$D$$D$|$$WfEV(ENfMfMMgJfMuljȉEMED$ E܉D$D$bE؉$EME܍L$ 8L$D$b(2 $WEEMfMN,MaOD$D$$D$GD$$WHwf9M9uE܉UL$ 8L$D$b(2 $E܋U뫃fU@ ) G OfPDWTUD$|$$D$UT$$iDž@=vU䍃D$ 8D$D$b(2$UMT9fQTP|D$D$$OD$|$$ɩ1҅c8@ tfUEfUME䍓T$ 8T$D$b(2$&EfUUVS*5uFt$菫F FF(U VUfVF([^]ffffUWVShA*ö4E EċEE 9EEEpFtD$D$$$F &}Et&}U+uh[^_]ËEċ@}O9E}9|$EĉD$4$tEEEEȉEEċ@EME@Eă9EЉE0} D$D$$諧DžnFfN @EW)‰UEċ@UB 9EGfVT$UEĉD$4$~fdžF fEE̋UF(h`Eċ@}O9ED$FD$$谦Dž$FfEEED$ |$EĉD$4$1D$|$$ӨGdžD$|$$裨ẺD$EĉD$4$KJ…Ezf}:}% EEEċPMQ GO)MJ9MsBED$T$UT$ML$ EĉD$|$4$> 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MUD$ 8D$D$b(2$ZMU.fEEfF fE~EUčD$ 8D$D$b(2$U'UMD$ 8D$D$b(2$UMSfffffffffffffffUWVS8 #-EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋L$ 8L$D$b(2 $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸8(2E܉U|$ L$D$bE܉$]UE@(EuU]䍻|$ 8L$MD$b(2E܉$rE9EM؋UB=VVU]䍻|$ 8L$D$b(2$UUfEED$E D$E$rUEH(EH(]䍻|$ 8L$D$b(2$U;U1҉T$t$E$]8UUWVS o&}u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0K%ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃D$ 8D$D$b(2$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃D$ 8D$D$b(2$UMUWVS@N"}EpFtD$D$$JF Tt:t@[^_]F(tڨ1EEE؍8EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b(2 $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃D$ 8D$D$b(2$7MTD$|$$ו럍D$ 8D$D$b(2$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfE}Ѝ8}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$b(2$MMԋUBHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍D$ 8D$D$b(2$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[Ô@3 [UVSwut5D$D$ D$ED$4$Ot6E[^]ÍD$ 8D$D$5t2$럸fffffffUWVSn UE pu 9lE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]Ëdr,9d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?hD$ 9D$D$X2$hMX\pD$E  D$\$n8 X9hƋ`,9d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS YEu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS 2 çl4$(sD$$D$F $3 [^]UWVS c}$ L$K#1$KD$$D$<$h3t$<$2 [^_]USwl$mr[]US,QEEVEEED$D$ED$ ED$D$E$薍t}u E,[]ø,[]USAl$q[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9t9t,EȋU+u0<[^_]D$$D$$.#ԃ $Zb(UWVS`:ïEE 9E1} w6}̉M UERE9t~9ue $aXM̉MG} EME9tX9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $Ia'UWVSD*ß 9EE1uUč}̉qMȉM}ǹU7UȋE9r}9t"9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $`U&UWVS8m 9>}}̉11҉EE9t9t)E+u18[^_]D$$D$$ ׃ $ `fx&UWVS<_U 9E1E x;Uȍ}̉/M UȉEFE9tK9t[E+ua<[^_]ÉUȍD$ 9D$D$<2$̭UD$$D$$ 륃 $E_%ffUWVS)ǖ }lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]PMUBfFF F D$t$$]u1[^_]ÃQʋ]C ^)fFfF] H@ L$J UL$ $]lOUBeD$B D$$]rtH D$D$$t&KUWVS$ }E΋x!fzfz:EF~ =(M9AfZfZۍ E@ EE@utN=$1EAfBB B D$T$E$]s$[^_]É=ft1MM\A4f9rM됉=w+f81&\F<f9rZUM]D$ X:D$D$b(2$蚪MU룉UE]L$ X:L$D$b(2 $_UZEUEME\$ X:\$D$b(2$UEMUM]D$ X:D$D$b(2$שMUU]D$ L:D$D$3$蜩UUWVSL/Ɣ u܉E։MM  fMEE=EffEFEfE=f}EfE111EEf}u։ʋME@ EǃtVE}TG:z Z]f;u]9fEA)fAfDY|$T$UȉM؉$]MKUԋM؃f}Ef;ErE EȃEȃ]f9]f9u}EE\E9E]9f9u9tMԉU؋]܍|D$ d:D$D$3$MԋU6E}TG:,E}TG:EE]TCE}}uL1ȋMfAE@(t 9Hf;UE f)8EEf;}ǍFEfEu}l&gEHEA ÃW)fW]fT_D$L$$]IIfEEf;uf;uu fEfEE@ EhEHEo}uLMU]܍|D$ d:D$D$3$蚥UMMIUѻEHE E4w(ufFMf9MuufFEL[^_]Ë]܍|D$ d:D$D$3$fEf;}'1뗉@f;ErfAf9stEMA]܍|D$ d:D$D$|3$菤9]܍D$ X:D$D$b(2$]8M ]K)fCa118a\t&Sv.&CUWVS ƉUMED$4$!YǍED$4$YÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS(E ƉUMED$4$UXEljEfGE}fyUzyAB A u.E B=f9mEU܋ED$$fEUMEABAfAEfAB A BtHUD$D$$hUU}HD$D$$jUED$E D$E$MU܉RE䋆U܉׋usOuCu1u9ut2U܋E$SjEU܉E]E([^_]äu9uuΉUftt֋E$iEE([^_]ËuBfF] fu]EvUM썃D$ X:D$D$b(2$UM%f] z>1D$ED$$`iFUWVSp! EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN y EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]ЍL$ X:L$D$b(2 $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]ЍD$ X:D$D$b(2$ϗM"M]ЍD$ X:D$D$b(2$藗MTME̋]ЍT$ X:T$D$b(2$\MEMUEEЍ\$ X:\$D$b(2$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]ЍD$ X:D$D$b(2$nEMċU6MU]ЍD$ X:D$D$b(2$'MUrM]ЍD$ X:D$D$b(2$MUԋ]ЍD$ p:D$D$q3$贕UűEԉE}EEqqqUWVS4 Á }G,EЉE؍|:ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$b(2$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oMD$ |:D$D$b(2$M:  GEu\uBMEt H(x)Z]fmfm sMM Z]IUWVS_ E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀ6ǣ |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVSÏ } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVSy } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVS迼4 MDžDž<< >z DM E5?x  D$D$D$D$ D$t$̢$(uVD$D$D$ 0D$T$4$UAt0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$@L0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$)$'3DžDžEDžDžDDžDžCDžDžBDžDž> DžDž DžD$D$D$ 0D$D$$>t0 DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$ߢ$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$h$$2D$D$D$D$ D$t$Y$#4D$D$D$D$ D$t$=$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$J$"3oiD$D$D$D$ D$t$$!D$D$D$D$ D$t$$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$8RPLDžDžDž D$D$D$ 0D$D$$$8D$D$ 04$T$ 1t&=S,vD$c$ `DžDžyD$D$D$D$ D$t$$D$D$D$D$ D$t$$7SfffffffffffffUSË \ []UWVSPo EEEE}|$EԉD$$Ẻ$1u} }ƋД u%1 uBfEʍ M MM9MMfJM^MHHu u p Puup0@1Ẻ$D$|$$P[^_]j̔ D$D$D$D$ D$D$$ ‰Д f@̔ fN9fE@EU tdM HUPMH Uup 녋uMHx0<@\ uM M  M310t ED$D$EЉD$ ̔ D$D$?$2u}u̔ tE E E~ vMiM DUWVS t <$t V6u,.j$Et+.t V6u<$E [^_]-t V6uD$<$<E [^_]US$Uʶ l t$[]EEED$D$ED$ l D$D$E$1tl uD$ ?D$D$A(3$$dl mfffffffffUWVS葫 E }0@DFƅtGFU M U9BFD$F D$ $GEUtRFE VJE}9OT$T T$$EFMAE1[^_]ËM!@]GF MtFuV]SF }WT$|$ MQT$D$E$ u>E]놋ED$ED$ GD$F D$E$LE!@F aD$ $'t̋EUBL$$'t}VWVUVS诩$ uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 8 E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$]&%Et͋]E0U=UWVS(@õ E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVSÓ }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[ԯ @3 [̀rS[ô @3 [US #Ø EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[> @3 [f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVSU tMƋuA~8t:F4@9s3`V8F4@9r$$F8[^_]ÉUWVSh E}}u 9ENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]F86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$] (NjUN8#UV4V0]QD$ D$`T$ $F4~81.& @rPu B8~8BX;F4rE,yF8$]"F8UȉȍB=]I_8 4U]0_UF8$F"_UF8$]F8tgD$`||$t|$ D$xD$E$&DžuUN8]^N]^{]UWVS@茠 EE M 9NjE1lI%;E" = ,9#ƅDƅdHD$$"8BƅC8 D$BD$d<$Ylv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $jt[U+ @[^_]Á},d`@ Džh1Dždd ׉<$D$`D$D$ t$D$$"f 9?QD$ D$`|$4$`d9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$[Ju"dhD$T$<$gFPp @?.T$Ge``697nV4P4~0x0~8x8NFwPRTP׉) tGPǰ9 fG`9u Yt&D$dD$ $gctIt70tfttG1VD$D$$&p8tD$D$ $Zbt"T7d$TCt18S4$D$BD$d<$bFttD$D$ $bat ,S"A!D$DD$ $ at$-B놋rD$D$ $`S$`G Nj@8@P1q`D$AHDž$`Af$ AjtStD$D$ $_zn4$@\tNj$@D$BD$d<$`tUWVSw <$E D$ ED$ED$E$MU E(Ɖ<$[^_]US 襒 EU BJ  D$T$$ []UVS QƜ utxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E EL3D$ ?D$D$ll3$>ND$ ?D$D$ml3$>U UT$dD$ ED$E D$E$9]ffffffUVS ҅G EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS(聅 ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$]ӋE111 ufEUD$ T$ED$FD$$]&;u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVSt Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$Åt@C؃[^_]ÉډSu1V룋KT UWVS袃 u xD$4$HE%=D$($Džtz@@&@9uE ED$D$ EЋUԉ$T$EČ[^_]@1Č[^_]UEU U U$]UVS詂 ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D @:.D$ D$%D$3$U D$E D$E$]UWVS讁# E HMPpt)rP@t6B E$~1[^_]ËxMt P@uʋMAUWVS4:ï }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$%U11MM1 MMEԋU؉D$ T$E܉D$AMD$$9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVS~" ut PtH J H $u4$~1[^]UWVSg~Ԉ uu2&.&[tCtډu[^_]Ë$[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS b}LJ U EtUM"t&.&.&.&t.ZYutD$D$ $ E [^]UWVS |J } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS({f E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]/E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍn0D$ ?D$D$G3$.u ]܍D$ ?D$D$H3$.bf%BBff+E XffE]F3G]33 4UWVS8uí utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]n0D$ @D$D$Z3$,[UWVSxt~ utWD$4$ F u#f~t(1D$4$ [^_]É4$2 5.4$E$Flj4$[^_]ffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSrV} u7tfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉FUZ1맋V0 t~@9t $=V0F FV덍n0D$ @D$D$<4$T*=fffffffUWVSq3| u}E FftRxT$$<xF0PV09t'Pt($ [^_]ÃT1݉UUPV0ǂT1UVSk3v u7u[^]ËF0$F0Tt$[^]ǀP8$F0UJku MU 7u]É]sUVS kÕu u7u[^]ËF0$F0U t XtTt/$[^]D$\$F0ǀP8$F0UVS8jt 9EEȉD$E$>U+u 8[^]f̀rS[ät @3 [UVSjÇt u tt$D$t,@E$[^]ÍD$ @D$D$9H4$$"UWVS4i"t D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"'D$ 'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]9&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍bD$ AD$D$K$ L$(=UD$ AD$D$M$E"UWVSagq EU uM] $\$M] ǀA.}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVSfq u} 9vtGFfuUT$|$$xFP^T[^_]ff [^_]ÍD$ 0AD$D$Cp4$s덍1D$ 0AD$D$Ap4$G9vV@D$ 0AD$D$Bp4$'UWVSep u} 9vF t5Fft\D$ D$D$$!Ѓt<F fF FfuUT$|$$[^_]ø"8F 뱍D$ $AD$D$Vp4$%D1D$ $AD$D$Tp4$9v @D$ $AD$D$Up4$?UVS@dõn u9vufFftEȋED$ E UD$T$ $QF !ӃtNPVTfF ȃ[^]ù뷀fF ȃ[^]Í@D$ AD$D$jp4$k1D$ AD$D$ip4$7UVSYcm utO9vuFfu$[^]Í@D$ AD$D$|p4$f붍1D$ AD$D${p4$:f6̀rS[4m @3 [USbm ED$E UD$T$ D$E$[]UWVS@nbl t$(D$T$L$,D$,t "|$GD$8UT$$\$( uL$8ǀ-[+nD$,L$8D$0T$4D$T$ $D$\$(ɻD$D$0T$4D$T$ $D$\D$ T$L$8D$$11҉D$8T$<0D$,9tmD$ \$$9D$8|$e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(OD$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 }1th|$ D$t$E D$L$T$ 7D$D$4$D$t$$ҩ'ljUED$ D$E D$E$4UWVS8GQ Eu} 9E1X>'T$ t$D$E D$D$|$ 7D$D$$Xu(u~E+8[^_]:|$D$ D$D$4$ND$t$$uXt JH󥋅D$ 27D$D$$`X:'ǃX$…X1A<+w,KuىDX9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVSwN#t t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVS<8DíN uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^]USCN ;UT$$L[]|CM -f̀ffff7̀rS[M @3 [>̀rS[äM @3 [USCÈM D$2 D$ ED$E D$E$[]USBEM ED$ ED$E D$E$[]ff&.&$D$4̀D$̀fffffffT̀rS[L @3 [PS[íL [USBÊL 7u p9[]&[]f̀rS[TL @3 [USA8L $1[]UVSAL t [^]É4$buF1f1ø11GAK \1øUWVS<(AÝK  }1fE9s't G9sD9rEtf E̋ E fE؋ EЋE D$D$(Ẻ$U<[^_]ÉUc>ƅUu't<uF=f t/tv=uF ދF ӋF ȋ t@ 9s0.&8u +P 9rt Iƃ Uȍt7D$ KD$D$P7$FU./D$ KD$D$P7$<=ƋUfffffffffffffUWVS?I D$0}|$hu }]\$8 9D$Ë$1M}D$hD$DD$,D$07\$MD$<%t,P D$,t$h\$D9s FD$h<%uԍWGD$CD$XD$<D$\HZwt$0KT$(D$$ D$l1D$X|$lD$Pt$P\$<9}L$,L$\  \$P\$HT$Ht6\$DT$h.&.&9s  sT$hD$\|$(1ۍHЍABHЃ v\$< T$(D$$D$\0|$8GT$`D$d|$8\$Xd$\t$`|$d D$X\$\\$4|$CD$HD$P$3D$Pt$P\$<9}L$,L$4t$hL$D9sL$Ct$h|$4L$X\$DL$h9s0sL$hr\$`T$d\$d|$Xxd$\D$C- t$`|$d9$D$4\$`t$d)щ1҉ىD$PT$T)iiƸ1҉D$HT$LD$HD$P0T$`D$dL$`\$dc19dÍxD$`0CD$4)D$HD$Pt$X9}t$Pt$H)t$XD$XPF\$\\$4|$C@D$\hD$Pt$P\$<9}L$,t$4L$D9L$hAt$hN0\$D9 L$$N^\$h|$4L$<\$P)ٍYt$DL$ht&9s0sL$h\$tD$$D$ D$D$D$ED$ED$ D$D$<$x ƅ u G$@ED$D$ t$L$<$jƅ,Gƒ @1u`$yED$D$ D$t$<$ƋG~U=2D$D$D$D$D$ T$t$<$ƅGD$<$E+NH[^_]ÅD$<$|ȋPu@fffuGtwp fHfHff$衵t$ɉL$ T$D$P8$qPtIthtRD$<$$+x"$xD$<$yD$<$gD$<$U4UWVS,M }U ME 9E1GED$ED$ L$T$8$pL$T$ 5D$D$$Co=E D$D$ED$ ED$T$<$qU+,[^_]Åx$腰=wttH|.uT$L$ D$D$$nU;D$T$8$oqD$<$9$3UWVS( E E 9‹EE@ pcA$M~T$$s-EB.D$ D$D$4$KS ,t&.&.&.&DA@tD$4$j.t&DJ@utSFNu tDJ@tEpt$|$<$调7$N$<1U+u ([^_]L1UWVSP0 u} E 9ËE1fD$4$^1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#^8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$HED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$AFDFD`DžDžD$4$虹,fffffUWVSl u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$TxƉt$E$踸EEFD$ $蠸U(fBMЉU(E,) X}|$}|$ D$t$E$д,Ɖt$$ 0FD$E$FD$$FD$$ U(fB )Ѕ9EMT$ MT$D$8$El[^_]ËE$訥EE$ߦML$D$ ED$`;.D$8$fU(E H E, 9(B B U(D$E$$U(BD$E$U(BD$$ U(BD$E $E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS Í U }E@4E)Ѓ FD$$)FD$E=s$VfFE@ uG1T$$ǵF D$$贵 G fffG )~ [^_]èu2밸9u1 [^_]Íg$jU *Uu$jU븸UWVSs M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$GD$u4$说W׋u$ssuXuQ}׉+u9~ED$4$V+E~[^_]äft9}u1[^_]urpU$HiUM 9}t8D$ MD$D$=8$SgMAyEtflffffffffffffUWVS(1æ ljUM܋EGkE8u䍃EE썃ҭE.t&< t< tD$ED$4$;D$ED$4$D$ ED$4$)D$D$4$ۢG~$g< t< vtu([^_]À>6F$~d ʈdGtD$$`띍F$蹃~GtD$í$}`iD$ D$4$tD$ ND$4$ܡuEO!F $=~GGD$ܭ$_D$nD$4$ytjD$D$4$[uXO@E܉D$ED$89$_O]L$T$9$t_zO TD$ D$4$t*D$ D$4$Ǡug OD$ЉT$L@$dLt׋$ˆL,D$ $OL <4,LTDD|$@$%d<mFV9xDw@ut;u㈕$<,t$$N<$TDLD 44 K}D$ D$4$!D$.4$2cD$D`$2Dǀtǀx|Dž0Dž(\9$4TDxD@DttD$4$}Mu덃i$S< tt< uDž0]L$,D$ $=MLtċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž0)@DDumuT>uvuYLpD$D$1ɉyffL LsUD$E$]UWVSX }u h3 l3 t;D$<$t  F FX[^_]Ë 9puttl|E9EtztIMD$D$ED$ D$D$t$kBt  F F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]ffffff̀rS[D @3 [UWVSd# .~D$t$^M@$TDžDžDžDžDžx@ N L$T$ VT$D$$]T$$=F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$=ut G74$͇@9 W ‹Atft‰)@0Dž'Ztftlj)@#tP4$@9r5‹zV$d@ $NZ#Džd[^_]‹)ʋ;Wf)f f{\#D$ MD$D$9$蝐$tc0P@~~ 9V)ȋ 9cVʉ)ȉA1҉=tftH<@ lj)99h΃r낋$ib@ $WŔ@ 4$@9:ƒ{tft‰)‰DžJtftR<lj)944$@9`‹wShf`f% PD$$VuKu2ifM/f릋$_@ XUVS 8t$J*[^]Í~D$t$5E[^]UVS7ì 8t$n_[^]U} Ut]UVS` ut$)[^]Í~D$t$D[^]UVS ut$^[^]UWVSm u}t5W¸t[^_]ËF [^_]ÍD$ MD$D$|9$eUWVSc }uENH NH~D$t$Cƅu!yH L$UT$@$mtEG D$GD$ GD$D$4$Su4$]G [^_]É4$][^_]ËG [^_]ÍD$ MD$D$9$UUWVS P EC98 lC.:)lj}싓 u2Eؗ ؗ D$ $边  [^_]Ívt$E$3t$ $3t{ t1= ;txED$D$E3uًED$D$ED$ D$:D$$Y [^_]Í9D$ED$ D$9D$$Y [^_]ÍD$ PND$D$9$ĈED$SUWVS 8í ''w}ė ȗ )ƉT$U$Mtnė ȗ UT$З $MtGЗ ԗ ė D̗ 1 [^_]ÿ'y qUWVS(k LJ LJ LJ ė zȗ З ԗ 11ҍ,TEU 5 )Ћԗ  ڍAw ND>ЉD>]T>ӉT>LVMHL>@CD> C dT։‹ xzt =w ;lNEt =w ;lN tH~k LJ yU) !ȉ UeUTv$  ULJ ȗ ė M싗ԗ 1ɍlN]MEUtwM<9ErMtu艷ԗ ȗ Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>LVS,U;D> rU=UsD>HL>PD>HL> HlU=Ëȗ ;̗ e,QHȗ Pԗ Hԗ HLJ lU MULJܗ D>UMD>ЉD>]T>LVS]ف9lN,QLJ 롋 LJ LJ D>ЉD>]T>LVoMUlC.E9E $µUMD$1ۀ} ËE)؉D$ D$9D$$SUMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@E싟ܗ ]X] Éܗ %LJܗ ,Qȗ lė mUUxz Mt ԗ ȗ ;̗ r tX,Qȗ Hȗ Pԗ Hԗ HlUЋ]!LJ Ů$:fffffffffffffffffffffUWVS0& EЋ u䋸 }9EZu؍,Y,Wu썰WuԍYu̍YEE]]Efó u $ E<}:t6t0  x HE$ ED0F F   [^_]UWVS葸  t`$ EtN$nEt9$ t)P P  [^_]UWVS€ uE vrx|uh|ua$0ӉU0ÅUtSx pp@x@@@(@,$ ؃[^_]1ۉ؃[^_]Í`;UWVS c U BE$/t[U tNjuru3u+DML$$t(@ [^_]äftf򍃌;[ PUVSʶ? u4$cD$4$<[^]蝶 x茶 { j Y UE Ux]U- U ]U U ]y Ue U ]UWVSڵG  u"$$ uމ4$6LJ LJxLJ$ LJ LJ LJ LJ LJ LJ 1[^_]US$Ù E$-[]USv E D$E$2[]US״L E$5[]øUS讴# D$ED$xD$ D$;D$$=[]UVSZϾ ut,D$4$Hff D$4$H[^]Ín0D$ D[D$D$5;$^lUVS ] EpFtD$D$$4F!u  [^]qUWVS uM5D$ ED$E D$E$yTl>LDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$WaDžH V€ʀ UTL@pD$ D$D$T$OM P!ЃLPoo0<$oT$7o01[^_]À Voxo0<$o  PxD$T$ GP^E E DžTED$D$ D$D$$_Džt HƁ Snn0En01 s G? GAG G !G G GD$D$L$/PLPP LЃHtfD$PD$L$1H  D$ $PP D$rm8LlPu  P-D$T$6PD ƒ@ u h ffffUWVSf }EpFtD$D$$/F P[  D$4$uc  t$un  T$U4$DžU9B(E kb1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$7.[^_]fffUWVSf EpFtD$D$$-FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$-UЃ[^_]ÉiUWVS$6 }9EUEEEE;E MmG$~4u݋M…tEL$D$<$G7UUD$ ED$}|$4$9uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$$c(t㉇UWVS({ uE䋆EMM܉;E E苷EHMU$H3ƃUtY9Euȋ})lj}苊U|$$'U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$a7u@EE9E 1([^_]D$ ED$ED$$%7l([^_]UWVS$f M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $Mp6}9} MUu1$[^_]Åt#UD$MD$<$64MU눁 $[^_]ÉT$$%Mt$[^_]UWVS(諧$ EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]G5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVSͦF EU EpLB< D ?ZU )ىL$D$$]f}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]jMU ̉EU ]썋(L$ [L$D$< $]EU QEU ]썋(L$ [L$D$< ${]EU U E]썋L$ x[L$D$b,< $=]U EUWVS轤2 D$T$$tV@D$T$U4$NjUuD$T$$%[^_]D$T$$o%UWVS 2ç }EpFtD$D$$.%Ft:ta [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSDm }wFtD$D$$l$F}  8GuD$4$D$ D$D$$%@ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$G;EtD[^_]ËMN$tD$ D$D$$T?Љ!ƒtL$D$$*u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$‹E؃9tD$<$]D[^_]UWVSs u~GtD$D$$!GD$4$C uUEu@t*$+u*4${^tME[^_]Ë$tE͋D$$E EUWVSÌ uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $U]C1[^_]Ë]C鍆D$D$ ED$T$4$ul}D$$M UtEdžU|$ $tU#DfffffffffffffUWVS 荞 EE,E}1EED$ED$$]ƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃D$ [D$D$b,<$UU]ZE}E9}twu})D$D$$]9utAFD$FD$$]OtVTP‹}u뙋u]RZ}8 [^_]ËEpE )}fG w [^_]fUWVS$AƦ uƉЉfMy} ~ϋX9U)ω\$D$M$]BEffEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]39E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]˯D$ [D$D$X<$ <Mt !EEfEE:M]ʯD$ [D$D$TX<$;MdUWVS$0å Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$oEu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$6B…t EME$EPEwD$ |$UDBD$4$A tʋ@f8 $dž ?UWVS,苁 uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$:UU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍(D$ \D$D$y<$7M UaM (D$ \D$D$<$7M VuM DOƃ=Fu (u䍳 \uDG)fET$UUT$7$%U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$<$5UED$ E܉D$D$<$5(D$ \D$D$<$5D$ \D$D$e<$h5E@E(D$ \D$D$k<$05گD$ \D$D$b<$4FE!UWVSx| EE @u E1OftsDPND$ t$D$E$]D<ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃(D$ \D$D$<$(3E@ M]f\Q=맃1fM1UWVS}z U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$9…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$lUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVSCy Eu} 'D$ D$DJD$4$]#9tDPfzuft,ˍ< fED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$UAEZUUT$L$$H#T$ $ GE$']]fff]D$ <D$D$<$4$ USk2v }xsn]f$ZUPKFAfff]2].t&%].&fffUVS(kÝu EEEEjuVjZ p uǃp D9tj'jj%jVjj'j>'UWVSEE] }3t>uɉj/VlZYtp@0&t0MPVZYMu}] EEAe[^_]Vh"hU"h:.cUWVS]u 6_h"VSX tfu7$D.ۋ=p3.)u$D.u%h"e?Zt$D.$D.""hjP D. @u5$D.hDŽ"j(hٖ*Xu4'hЄ"j(MUW6ZYMtUBk 3&u6h"j((VKSW(3&P)UWVS] 3h#jh#Su@@t h"p3.DPDE.ZuDE.~$1HE.TE. 5&5TE. 5&jjPHE. y 5DE. E.Ǘ E.=0-v@E.u h"jE'E.u#E.E."E. 5&E. 5&hD.HthRPmE. yQE.PhD.HthP5E.ңE. E. y5E.h&$j&D.D.hD.u/D.u8E.H{ã E.ujD.D5`D.8E.9ã E.táD.'D.t$E.D.=PE.u =LE.t{=E.u = E.t^hD.%h=`u; E. D.D. E. E.%D.RP5E.E.P hD.t ḧ"jhD.4Vhj`!h jT!1=DD.=HD.=LD.@D.hC0-P0-5hD.t'D.D.D.D.;pD.tD.ss 8E.$E. u158E.5$E.5HE.TE.P$lj uu150E.54E.RDE. rPPh&$};Y[@E.u9j51>Ph"h:.jE.E.=E.t t7h"Bt E.t+h",t=E.thG"E.p3.jWE.ZYu hn"|;R=E.u6=E.u-=E.t$=E.jWg[^11ɉ=E.u >=E.t =Cni ȉ=E. uh".XZQURPW x%uSh" ,URPWɅ ySh&$j-Phē"jjUWVShu E1E1ۃ}~F8-tEhԔ"T(_th"PZYu 8K.h"*(_th"PZYu h"Xjh"h"Ds!EPkuh"\0考E_t<1ɉMMMMMMBh "d%! 7Mt&t"Qu+ZYth+"jEhQ"WE)PE @}w}c}6t^%}4E뷋Edwy$<&}8tEKv_7Eh'"57tEXZnEbEVp3.p3.}uCp3.Eu_4>tj@uY[t}u U9sUPUxtă}uEE1ۋtPZ\tSAXzEt'U)RPSpSÃ~t C}u"h'"hP(%EEZYu ha"K}uEEuh4K.WuuEpEP-u yj=4K.y h|"}tLjuVjhSPy h"%XjVjh54K.Py h"%Xh'"EjuVjpSPjVjw54K.P,uI1ɉM̉MЉMԉM_1X<&H>v   DGu΍EPEPjW =8K.t}t.D1}tEܿjEP4X<& Gu褡Ey hkA#j Vh~f54K.Vh~fSUSMEm}u j u XZjkUE 0NjRUVSEU aJ @`.uc1E1ۋ4h>&Vh#޺uUm:.H:.Y^yh:.j XZ:.P:. Cu tm1e[^]ÍL$qUWVSQpq1t.x.....p...l.DžDžDž1h<"Vg @I&/0$>&S'$>&1=---r-cl.jP57ԕ :uy57h"/-p. \....|..14ݤ?&4ݠ?&h"蚸C uD.v.kx.=7j/WsY[ÅtC?t tp@tj/S2_ZDžtG;ttvp@tqtj/WZYtA?t(t3p@t.t9h"Ot.Ph`.hd.hh.hռ"57qAu7<t h"jC =h.h.Ph.Ph.h"57 A~!7<u..9sh"뉅.=7j/WY[t4PWs_Zu!%=@u7-Y7`~d..6--7.57.-[=~ PPh$"j  p3.)ˋ.=.t . . . x.tn=p.t t$h\"4t=.t=x.uh"=x.t=-uh"68nKu -n=\.DžtDžxjjVjjtS@t,YtjjVPjS@t=-=\.u4P5-r_Zu%=u \.p. . .1 .t1=.-=\.uRjhh`.PR -y'D8uh`.hҽ">h`.h"--`.-jPR謪- u5-hf#M[^ =\.tRPZY@u5-h"E̋UЉ1ۅuthRP5-h "]M̋]Љȉډ%1 .1h...... .nh.hrdAPn @uX5-h?"fh.hedA5-C@u-5-hQ";^_5-P-[ .1ۉ .ą.=.=Ѕ..ȅ..- .̅.?w=...!ȉډg ...tJthVP轨- @u=5.h&$`5-w- --j-~S艽d.Yu Sh`"j.11kt z.1}.ą..}t.t#h..d..`..DžDžjjVjjSd購d.Zu hN"j jjVPjSy5d.1d.X-j/S:E^_ޅtptj<7}4CrB?05.thՀ"Ptu '/]P#='/tLk#PV_tP X~5+u!zt~Kh-%WZYt W;u2t 6#ShP#MV._t8u%hP#4V.PvVZYt .#hP#V.PQVY_t .P#1=.tjhP#|_Z~Pv|j{K =.u&j dYu\jbdj=.t'/ .ujhP#XZjj ^_=p&/uh#5س-άY[uZ|~jhP#7j5p&/4Ztj..Bu@t㡤'/.6cu΃='/t${H~ 1'/='/u z.=l(/~jhQ#zj jY7jCUWVS]u 6IYt5\-h#j謹t PhĈ#j=;/u5\-E>Zu€=;/t8jj5ÈE͋‹ 3 9r(<,tuxG @/QRhō#SV7h#FI57uh#hت&hKh#肬1k$A/t!VPZYuÀA/(@/kGh##Vh&#[FjW7hL#hȪ&hq둃 @/'=p3.u) @/ uI~=$@/u,P8Y@u hl#jK|#I @/$@/Z!Ãt~&t%Ft!á$@/0Rh#E  s$@/0h#eEXZ s$@/0hŎ#LE_Xt Sh#7E[^jҀ uh#tth7# EjeVE uC#(<@/%=u50@/S[@u5,@/h\#@Q50@/[TY@u 5,@/h{#@/tP:TZ@u5@/h#jjRUWVS}u 1ۃ~^;-tp3.114<Dž8h#VWƌ 1҃i!8-t+:t!;B tBu 7BPr5σitot8DuFDž4뉅u 7zSh$h˜#@ bDž<SuRPdx1jSVDqCtjjj ǃuh&VhiP蠋 @u h#j艭WRY-7tvFtjNt^HuTSItBQ~FPZ.0QXɋ0u h#j T돃넃<tEQ8tW4t{TjPUWVS$u] 3:h#jr h#SVƊ Btb$&jj57E/E/E/E/E/E/E/sE/dE/UE/E/vBeR0G.f"$&H $Э&a$F/F/(F/G0F/1$F/,F/a,F/1$F/ F/?$F/1,F/10F/"(F/ F/1F/F/1= F/F/F/F/ F/p3.)Ӄ](F/=F/t*th#0F/ ,F/ $F/tihӢ#jt:Dž|=0F/u Dž|=,F/t=||)Dž|=$F/tDž| Dž|4ɲ4F/j=F/P2Cx<hSh-t=v Sh#h-蕐Y--X/u!-= -vx/uP-@ߣ-1hj$XZ=$F/t Ph- Ph- ZY@u躠8t%E%=@tkxtHZxM=F/P6 Y_@%=@t&/h-h)#jRDžx0Džx=(F/u1=F/x/lt$PHZPvЀ8/uj|Vyt 1pluv6h&$jޠlQh- ^Zh-ċCHfuFs iPshfE#3lDžpltW~Zu)wfush?#2Y[ftf tx)-C,--=~TSh-h\#2 o{DsC(huTxtClj/V&YZlt)xlhC#>PYZlhl>h)8/t z/t/Bс-vPh-h~#1 VPRlζl- -= -vx/uP-@ߋl=$F/xt Ph-i Ph- ^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-h#1CP@% =@B%=@t,M1@ush-hţ#1Jl΁@w `||t {DPSVZY+= F/(h-sh1"KK sH (F/ F/u&fNush#/Y^jSt蘀fuV58F/V8F/@F/Mh#h&h6kE%=@V踛Bfuk=F/u%8F/H8F/@F/y/hA#h&h?jRNZY+h,#CPph-BE^XshL#/Y[=(F/t'PRRV=(F/tPRUPSvO{8t h#j txp?1x=(F/t,F/ 0F/(P6_#x:DžxxUWVS|]u >j/WYZtxh%&W衋_Zu^h#VSy @uip3.)Ãu]p0pBZY@u jjMje;LtEPtIFu'|V0h#VSIy w~Ufw$ &1pV0pV0V01tV0dV0xV0tV01V0lV0thV0edV0Vp3.4)Ã=lV0t`V0-=|V0t,`V0=1=|V0=tV0uV01ɉ dV0ttm%V1ɋTP|=xV0xt)SWfYZuE%=u }SWXZt Wh&$j裙E%=@9t*T ÃSZ=dUWVSu 6/'h#j=_j踩ЉÁt1hh&c%VuGw tVmtDžhptc57M*Xu57hT#jؘhW(tWZ 딡p3.E%=@t x"st/$tSR@^Z@uStSZYy7h&$芮[^DžlOt?t7?ZY@)l;UWVSu] 3$h#j] h^#SV,u tUit)ft5huT8W0σvuC0W018/tj/WZYtPRd覃Y dv1Whc#'XZDžplt5>WjZD@PRhu1]u p p9UWVS@] 3"01:.Su ]Sjq0uEUEUSj^_SjL0ZYuEUEUSj¥^_Sj(0ZYuEUEUSj螥_XSj0Y^uEUEUSjzXZh #ΪH1411=81=<1=@141P]1E؍}ȹEĢ uVSjxVSj豑 x"}ujVj蘑 y}tVSj} xjVjj y}tVSjO xjVj< y{}tVSj$ xjVj yP}tEVSj y1jVjߐ yVSj͐ xy y贑h#0jO ^=-tUjhm%(7-[^y yh5#0jX1 #=-u=x-t @h#Yt8u`"V~ZÅt @|/tCPK,1_uh[#jX1ZYtlj؍P(1/hHW0Hh) j- t! ttBGuB@9=PW0t h#j輑=-u-茟t X1X1e[^_]UWVS]u 6=h#jKW 1h$VSto tLtPt9p3.th#肧_8/u|h#P7 Y^ukh#S& _ZuZPSY^@tHxPhm%_Z@t2|9u;xuM9 u;EtjjY^uj SDh:.\XZ:.@t h"jEj'4UWVS}] 3h#j V 1h#SW5n ft]/WPtwR)dD1벃vtbit6rtxu{$1<1181p1<181Z41K,1<(1-p3.9=<1Jzu8Quth#!Xt@1؋Ht ʉA?jd01[<1 81u t1=(1t =$1t@jPWfǃ uh>#C =<1t.u)WkXCHHf $p&PDs VPshfE#ja=<1tC ƒ?uts VPshfE#@1k=<1^KPSCcHjSWOpC 1ɉK +{uD{ u>=<1tCHSft\wlfucKPSCus辞Z=<1u&sh&$蝣@1Y[Rh2"8X=41usZuKC1tl=<1t8U֊8?GȊ8r4,1  1#1 1s2@X菊8t h#jȋWTh[\xVS4¡(1YYu3t>jTPShfE#@1_uEE%=@u"=D1uShN#@1Y[뱃=<1u=uE%=uS02ډ@uv=@uS=41u S{ZtXgt?=<1uSh&$輡gU8G8? 98u=,1S>X5@1>.1e[^_]UVS@jj'^X1EĉEȉEEjEPjN- E9u 軼9EE` 1j j.Y[h 1H h 1j d 1$#jOZYh#V-1ۉ]$h 1 ^Z41tt3Hu:P1." 1 111E 1P141t.U=-v= 1i`2O=41tEP:X101,1tA:-HyP-X-H J h-I-XE:EHm81 1= 1 1M5EPXu uzXZu u:Y[}um=-t,Eh#%^E=` 1u PEuE=-u}rEj^=-'7=` 1u59hX#;[u&jh#PjÃP$ Y|=V-uL=` 1uCEP$#0;Zu EPX8tEPu$4XE11ۀ=n-t$=1uEPX1n-u'j4& ^XC̈́RPAZY=n-=14-15P13*h?#,$-)+XUWVSpE 0>h#jLL1ۉ]t3. 1p3.] ;E9hs#W6ZYEW2t_9Euphy#Su6d tZftatDeuI렃gu=j57%*EZYz57h&$j豅^p3.E ]SuE\ZYy h#yEPhBt @utc y h#qX}Whht@uQc y h#NXEPht@u.c y h#+Xt$FvE 8uVEPuWSYgS^^1ɉMME 8URu VcdYZURV#]YZuURVXe^ZuoE 0B.DPt"VSUPS6VSm6E9jh#Vs uVS^EZYVh#roE E}tSju褲 y hB#j}t Whgtua y h#Xj'UWVSu 6h#jI81 xo<111ɉhdtlp11ۉ`jh-hV#VuW`Rtf(LtntMH1һ뮃PthtPdtXfuuDžl뇃vudDžds=7hDžpYMDžt@Džh1p3.M)tIu umpt$t*tt h_#j8 t)ˍ4D1@1>=<1tzj:WDYZt@0j.W]YZ`t!hD1W_Z@`u Bm>t0<#u30%[mD1hD1WZY@u ۉm8xPWZY@u Whn#j=<1tED1E@1jSVDZǃ tl`1h#>pu jSWed W_X CHHf wg$&s ?JPshfE#oDžl@=s JPshfE#EttDžl Džl@D1ht)KPt9Qu@1t;Au A<5@1RslЃ t"`tsh&$BY[ds\4Z~8t h#jV#UWVSu f8181 81 ʈ8181b81 ʈ818181%d1f8181h#ʕ[t-mh#趕Y&t7GtPSYSxTPZ9ujVjdTH h!A#V*LY_uVh&$XZ81e׋H󫋅LWtLDXtPmDžu VF[gh $J&h:.DD:.HD:.ZYyh@:.!FX@:.P@:.0t- t( D:.y h@:.E_@:.P@:.΃߃NP诪^ JP~=l91u l91 =p91u p91 Ph81Y[J8181Ph~=81X=81t 81i,h41h81h:.Џ5h1h81h:.h81"lZxd-h!A#v([_uvh&$jLr1JPhmdP\} h#jv^~WwYu Wh#{81eȺ81t jSR9 h81+kZIP}WUWVSjj]Sjjh&<@u hI $juur/YtjjSPjh&O<@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ ;MQh&$8#U1G맅u) :.yh:.j (XZ:.P:. 1e[^_]UWVS ƅ]-ƅ_1ۉ:1:1:115:1:1:11=:1:1:11h $u uS ycPtJTtgxPl$& p;1뫃 p;1q p;1 e p;1Y p;1M57&Ex;1Ye57>Vj:V7[Zuh $SH:1t)XV3dZYXu C[Ӊ:1=:1t h?"js7tuhd"1Ҁnuxou-h9%P^_t#:1趓֋=7u p;1i#7:1舓O~ph`&Ph $h:.m$j^]t;1蕓p;1t p;1t x;1p3.M Tu)tP1ۉXhU hGT 5x;1P›XRrRh#RLbZYTLSӘjjLRPV?9X}XTPT0VhPà uj/SDZYuSh"h %hS8VXXu"VXXu9SX^ty2LhVwà LVh&$juh"LRiaZYhZ $LRNaZYSh $jjhVjSlǃu Vh( $jph:1hzd@PN uWXP;1`PhedAWN @uVh9 $WV^H__9~VhW $(_^ZB1UB1j 7m%bjC1PhY$ B157h$V^ZYuB1h}$V^ZYuB1j $c^ B1B1jh$SB1B1j 7s#m(-Y=v Ph$jmPh$XZ= C1C1+B1 @1D1C1=7C1 C1B1E t== C1t)=C1u p3.U 4)u%Eh$X1E1̃=B1t1@1jjiZYHth jiYX=B1th jhXZh= jh]Y[1ۃ}=B1uPAPEXZ PEX}u6h"$VAYXE tKEPjW6_y6h2$萃XZ6EuzAUY9ËM}QZU܉9}u.MXDD1t؍e[^_]UWVS]1ɉpE 0@iPhؔ%P[ uH~>KE X@R1 57hc%oL1D^+=L1=L1=L1uu =HR1tjL>YL1t HR1t t Dž PPtVSE PE)P]tDžuh&h[$PV] @u h`$_t*HkttWP,XZuh&h`$GSKS./YXuVaZ@u h&hU$S7-Yuh&hV$jbVs=Zuh&h`$jb@ uh`$h&h*WSй%1󫍅Ph`$SDuh^$Sй_Xuzkhu %S軹ZYuh&h&hqPƍH_v󤍅PhiSc @uh`$yYS0jVZ th`$h&hihY$:ZVƹ󥍅Phui SOc@uha$Ujm;Zt h'jyaht hPR1:hPR1/; Uh-hdR1:hdR1:h1 htR1:h1 hlR1:htR1: hlR1:XUh`-hR1;:hR1i:h; hR1>:h9 hR1=:hR1w: hR1:XUh`-hR19h-hR19hR1:hR19hbA hR19 h; hR19hLA hR19hR19hR19hR19UVS8qy hDo$#wYh%=Zy h\o$ wXjhm$^t[^]u[jjshno$ t u=jh-o$tXY7o$u-o$jhɝ$hso$Ph"h$%j 7jSPT @t-Et Phwo$av^Xjhm$sZYtj \ho$s% |u>hs$WBZYu%FG{\u vhs$WhPFƒ NFjjLWv XP2| j\P-^_1u?h$jQi T\PdZYu \ӂF9|1hSWk^j/WtPRT?YTD9HH\PhedAWN/ @uWr_ 'WaS;?DZYax9}( j| H<1󫍝`4󫋅 =Y1u Y1tS=Y1=Y1P[^@=Y1Y1Y1r=Y1u;Y1Y1}hR @uh $PZY@uh$=Y1h0Và uVhfE#jHPh0PF tjhh`U1jSCyh`U1h2$/P@^_@tڋ%=`uh`U1hD$,=Y1jjh`U1 yh`U1hi$jPX"Y[uh`U1h|$jh`U1h"i6 eU1t#`U1VRW 7^ZtN xRjVh"6 u ƃrVW6YZuSh`U1h$j`FpY1u@pY1`RRPh`U1@uh`U1h'1=pY1lY1=Y1uY1 h$Ytg uuh`U1h$h$$S5ZYu&dY1uh$$S5^_t t Dž`U1?=dY1th"h}%S5Y[th"h`U1h'Džt'Y1RP5Y15Y1Y1Y15Y1=Y119|[<@ut Y1SQRP  5Y1=Y119| h$t5 Y1Y19sSQRPh$jJDÃtYtUY1Y1ȋ5Y1RP @u5Y15Y1h:$j D*"0Pu_Z@uhU$Z[^ 0Sh$jdW:j0PV y Vhs$jX?WP/ZYu1jZVP. uhF}$P/ZYjPS? u hw#j Z9iu RcPVh$j>hā$j >UWVSt] Z11h$u S @{Z2CDq$'Dž맋bL$'jP57Zf- :uPfXPh=$$Z1= Z13 Z1$jjjjj7#-Vjjhjh7<$Z1P57h}$jW=jjjjj7-#S Z1jjhjh7ރ$) Z1jjhjh7i9%Z1jjhjj7ׄ$Z1ujjjcjj7$-Tjjhjj7}$Z10Phjhj7$gZ1Z17Z18hl$DžvDžgp3.)Ӄ= Z1u  Z1Ktx1󫍵`4E <=Z1u Z11=$Z1u;Z1Z1}hPW @u Wh $SY[@u Wh$=$Z1jhh@Z1jWyh@Z1h2$S_Z@t=$Z1jjh@Z1> yh@Z1hi$VjP[^uh@Z1h|$-Dž@Z1jh@Z1h") u DžEZ1xnjVh") u ƃrVWK*ZYtVRW;*ZYuSh@Z1h$ 늍`PPjh@Z1f@uh@Z1h'>=Z1uZ1u h$jx9tX uuh@Z1h$u.hr%Pt)^_@Z1th"Wh@'j9@Z1t(Z11RP5Z15Z1Z1Z1Z15Z119|z<@u t#Z11RPg؉ Z1Z119| h$t0 Z1Z19sSQWRPh$j8tOtF Z1 Z1Z1%Z1RP @u5Z15Z1Wh:$j7*0PFY[@uWhU$NXZ  j;&1=h3=h3=h3= h3=h3=h3=h3h3E EĀ1EEEEjEPj'(h j%XZ19f2~hLf2jX}CY^h@f2jB}Xf2XZٞzt,-@f2݅(=Hf2ݝ01HLd=&ݝH104hLf2j|^_݅0zt -Lf2݅(=Tf2ܭ0ݝHf29f2}{݅H؞vlLf2(f2=&s=`-t#|h3tLf2(f2vܕHvo݅Hepf2h=& f2vݝh4f2Lf2T݅hܕHv݅Hr jݝhlh3EfEjhh3j7 @݅hu hS$] `=&ٽrfr fp٭p۝h٭rhPjEP ( F&8 hϔ"EEPURj5h35h35lh3 Xy3%8 hn$/>h:.`Y[ hLf2jzh3D`_Z~9XU8|h3L MuiPXhw$Z! X`)dDhh@;f2 hfXf2Hff9u `-f2Lf2f2=f2u=f2uf2󥡐f2\@f2|h31PT s)hPU@ EʉU1ɉMiE'%Uthp Uf2oݕPhf2hf2݅P`f2`f2h-ܝPv ݅Ph-݅Ppf2vpf2؉ffh3!@th3\f2Dž@ffh3f2@1҉\9XDpfufTPV@df2PЋX)t6(uRth3u|h3t@th3h$XDž\7th3 u|h3 t th3hǘ$RXh$ 뽃@uhhf@fXffX-)Jf~8|h3t1KQ@PRh$-|h3t 1ufX-|h3uY\uFDphfXfuyeTPV@dxDž\5$h3Fd9{|h3n h3)PDg2PhDP[ A9~hDg28DuC烽\uODxhf@f\fudTPW@dhDPDg2P+ h3ShL$ h3;$h3}+u h$_hDPh!$CY^Dž\`<$!'jdhMZh@<$!'h$ch$Yh$Ohܙ$Ehf@fPh$7h$h2$hJ$ hc$h}$h$h$h$h˚$h$h$Ph$jdh[_h5$Fdhk^1ɉPTDž\1ۉ@jdhZh@<t%w uhC$<uh$hT$Xhb$Ph$^_hHPh$.jdh[FhfPfh@fRPh՛$J jdh1Yh$jdh Zh$jdh_h@t <uh7$h!$^ PhU$Y[dh]jdhZDh@Phq$`dh^_jdh7[h$jdhYh$jdhZh$gjdh_hX%Djdh^ihÜ$!jdh[Fh؜$m3jdhWYhPh$8XZ|h3dhcDp`<wg<`x^FXsI\s)`h$XX)k`D`X) 뺍FX`xFv<9~< ZYup31uuu'h@#S Y[1ۅup3πhu$u W t[dw<$ "'Eσ=p3t 뾁북뮁EE돡p3.19tcM E1WtUPZZU<RXEtPVh>%VED>豑tj;Ph&$j}tVS茿h@#j} Džu(P衻_j$t8=p3tj jh@# Wh~$=p3t j jh@#Wh$jL8j jh@# tVWh$j$Wh$j h#h!"h$jjh#h!"h$ }uzjjjjjjjj jjjj jj8@u h$jjjZY@u48thΝ$=jX}uj_j j޻ZY@u8t+h$C.Y2 u h$覩Z WlXVS载h!$. 09jjyƒ #Bu^$SPh %jUWVSDu]  's3hD''SV v~jm cStITtbLus3뼃dw$#'s3s3s3s3zs3ks3\s3Ms3>p3.)ƍ蘈s3=s3tjjhg% s3 >Ejjj"ps3jURh@hPW @u hi%,Y=s3y h&jZ;u=s3! . WZ) '    ms / =s3t1ɉڸ1ɉMhjME؉Ehj;E܉Ehj)EȉEhjEĉE hjEEhjljEhjEMU ʃ} ʃ} у} хuu h8Q#E1҉s38gtj5s3,_X1ɉME#E#FEȅCEċS:-%BRUZH3U$h#'s3"0-s30-s30-s30- os3dYs3Js3;s30(  @uCEċSEP1ɸ uCEċSEP1ɸxuCEċSEP1ɸSuxCEċSEP1uXCEčM̋SEPECEu$CEċSEP1ɸzXs3uCEčU؋CEusuċs t^ps3hw$8$']1Rxs3Fs3:s3 .s3@"s3s3 hs3 @s3 s3 s3t `s3 ds3t1s3jjV1s Rs3uM̍EPULEuM̍EPUR&YuCht$&sX^Z=s3uh0$hE$h%褢 s3DHw*=s3uh]$hx$h%r 1ۉs3SEP1ɸY]ċus3Ã]uh$1];au uh$s3s3t]ȉ]thԢ$jEuąu}t }ċ]=s3uMEȉE 18E0 1҉p31atctguTEp3Eģp3p30t3@0t3p3s3p3p3`s3@s3p3tyUU9sHxt)Јs3tKU؊B<w r7ED T 9sJU L }؍W9sIH 8q3s3tM}tHpVWh8q31 =s3t =s3t8q3$=s3tKMtHxWQMVܩ =s3t =s3Mt$s3tKMtHxWQMV舩 =s3t =s3Mt$s3tKMtHxWQMV4 =s3t =s3Mt$As3tKMtHxWQMV =s3t =s3Mt&$s3 tKMtHxWQMV茨 =s3t =s3Mt3$p3f5p3=s3t!=s3u=s3tfp3=s3Vhp35s3譮 u( 87tw Phw$7Y^9~kPh$!XZuE 83u =s3tH0 8ts3 s3 s3 s3PSV 11ɉډe[^_]SWe[^_]UWVS }Dh$PZYƅh"u W t.at"t=Tw37Tw3þ뼡p3.)Džt>upTw3t&h3$S^_th$SxZYt2=Tw3u)U @w34ujOuSh$h:.\Sh$h:.Lj۬=dw3u.dw3h$u W t@UA3w$('z=dw3udw3먃=dw3udw3듃=dw3udw3{=dw3udw3c=dw3zdw3 GLw38`w3)\w3`w3 =dw3"dw3@`w3Dw3Hw3Xw357]@w3X=dw3dw3=dw3dw3j=Tw37Tw3h@s%PPw3/=dw3Fdw35dw3)p3.EU)tHt:t#u =Xw3=Lw3t =Hw3=Tw3tEt h3$W|YZt&h$WkYZth@s%WZ_ZE U @7@tCƀ5\w3jj5Xw35`w35@w3Le5\w3jj5Xw35`w35@w3>5@w3Sj ISh&$jC@w3;=Pw3jEPj @u h֩$EUuuh$[h`RP#h$kt SYE  1SQ%1RPh$+f1=Pw3tzTphs%V]_Zt)hR$VLZYtuSh*$ֱj ShU$DZjjUWVS u] 1h\$SV tRtfu2{3ֿϡp3.9td1ۉ`bXVSWZZYVxPVpnZY%=`h=@uvu^Ph_$襕[^Dž`ddPhSݖ FSh&$j0hٺuٺÅjhhy$hVl={3u Džp1$lPV蠀ZY8t Vh$L^X5{3SZY@Sh&$*`e[^_]UWVSd藘h#jXZE 0贏1ɉ Л354:^%54K^%1ۉ54$$ ^u$54G4G4G4G4G4G41ɉ @H4 lH4 G4ě31ۉ5454`H4dH4G415,>4(>41=$>4 >4>4 >41>4>4ԛ3543h$2Xt/hSh3{ =vj?$Sh$4y\3h#Z>4u >4`"h $_hy$PlY^u G4h%SO_Zu15G41ۉG4Qh$S,ZYu G44h@s%S^_uG4G4 Sh$CY[h9$P_ZuG415G4h$SY[u G4h>$ZG4t8u G4#=G4tG48uhH$躑X1G4h%_thN}#P [^1ۅfN:.ftP0YDH4pH4:.f:.ftPZt!@H4uKt lH41311Bh57h3G =v#j?$57hfE#j!54U Eh7$RP` SP̃D<$4)'541=G4=G48>4jP57 -t8{57h$ L3G4Y0>4J1ɉ G4=jNX57ZG3=31G41=G457k54$#P6ZYpH4:.754G41G4j P57 4~857h$뮋57j hV#W 57]_h9%P}ZYt"8u57h$GujPW@ @蘽XqG4b1G457XDž>1=@H4=lH4+@H4lH457YH357h$D37?u:.T1Ph$芍XZ:.6b57h$Ph$+jjj5pH4 3Ep3.)ЉEE E 1T3G4G4G4tq154DžDžh54RjVAxt& u0sPw_PVh^$1ɉ 3 3hX#q^t8t P$Z3/u PȜXu;P/Xt߃=3uF t8t P_36Y3=3uy3uh%Z3ghPh3/ =v&j?$53h|$辋 3hht$h3 =w=3tj $ h$P j hOt$V h$@X񸰸$h$'X#$hø$ X#ø$hθ$Y#θ$ɗhڸ$_#ڸ$譗h$XՀ"@$著h$X $o#uh$X#$Yh$cX#$=V貹jUXZh(j֣Y^h(jȣ_Xhj躣XZhj謣Y^h1j螣_XEt7U ESRPZà Л3uS:jj]_XjbXE j:0[^t*E 0YuU ERPXXZGjhH4y^_uhij^_hj XZE 8j@W蘹Y[ƅt @hPSo E @1ۉG4t1ɉ 8>4 G4EQ@PeXZG4=G4u u >4ujVW~ =G4t 1ۉ>471҉@3Ph$5pH49 5>4/Y=G4\뿃jhH4xXZhij趡Y[hj 訡^_+e[^_]UWVS}u hm"PvZYtWhh"SeZYthg"STZYuU4)~3ltXnuzh$VWB duU4׃Vt1PσwB0-뾃cu3U4U4h+'hn#h:.j萘h+'hn#h:.She$h:.֥jep3.9u#=U4t 1#M1 ;u5U4UWVSu 6h#j 1ɉ |h4 1hD$Vu) ua`Gt+It2EtHa<$t,' ,h4먁%,h4뜡7u#|h4p4z8h4k4h457u$57Ph?#W<71' ,h47u#|h41҉p4jjjh:.+hu$/0h4jjjh:.*h$ X|PPh$h:.ãjRp3.4 4h4ut U>ttl1`j5U4h:.. t h"j5p4ԕUWVSP}1ɉMM1h$u W t3gt!utGu.7E7;u7E85p3.9t3SߓZt@E%UMM@uSh$j1}1ɉM}t EE1}t6h9%EPwYZt"8tu h$jGDʋE 465Z@u6h&$jhm%9Y@ttEPWg_Z@uh$}tuY@u h$jtuQZ@uhܔ$FtVRPnvh&$jQh#Xu$%jh$SSSh&$j UWVS] 414(44r%14h]£4a1X/'lt2Ft&V =h4uRhh4Y_ RvPg |44444h%Z1u"h:.ha%jGDuG4hc%SuD tsmtW~ԃptXrth:.ha%ujђft$Cuh4h4ha%57&뚡7Q뎋574wBcuxPh*c%Y[_uUu;EE|Ch@c%Y1t:SgZt@ <uOtSXu 1hjhT=$h$ DžhP6tt(65,7r5,7rjjSP襊 4uh:.hSc%t5454Y[5 4Hhh[jJh[j>hj2 5,7E5hh`4hXEj@蒦j@艦ǃZRjIP _1XZt1x|1Ex'Qx|uuSx|1Exڸm%Putx|ڸnc%Px|uj:HXjVpZY؋pQ lJl9ujjjjjjjjj jVpjd?l4@t!jlIWl4l3@pl1ltY9t}&t4]t4OtXZS?W9jGà tPj8jShS#膛4jG4j"G4[^uT2ht2=4t jY jj4XZ[rXq41e[^_]UWVS(}E 0tx1ۉ555555^Dž111h;%u W @p&ab$`H'zFjhjj57hG$苷Bu7jhjjj57h0%L55556755'p3.9\t&jjSčǃ y Sh&$jYt \1uV趂t#8t h#`0P^-@~ Vh[%Sڗ , dh1ۅ Ӄdh1ۅu,u(PPp3.u 4 d%1҅u3u/ Qjp3.u 49 gPjj @8th|K'hƣ%XZg@uw_8Ghף%HG8/9dh9 Ӄdh%1҅hh%zG[^@u!8th%h|K'h%e hh %EGZY@u!8th %h|K'h%0 0S30^t&uSh|K'h%SPh/%hU%1cd%@1Yҍ0uF(Pjh0jK@u hI&o,\(UShj\蓴@uh|K'h%EXZ@uh|K'hl%cnt$u/[MPhw%蕿 hkA#Sh+h%`hh(\,Shj\س@h|K'h%膿^Xh@S.[tPh|K'h%W ?dh% u =uHRd1ۅuLuH%1҅uu p3.u 1QP0PO @uh|K'h%dhӃ %u#ӃDž%u Dž#%1҅uu p3.U %VPh[&f0S @uh|K'hʤ%p1҉h[P6+ZY@u hݤ%XShj/@uh|K'h%^Xu/dh@1ۅuu dhVP0P}1҅uHh|K'h%4Pf$Y[u64h%U[^$P$9x uً4h%‹t x td@Ah uh<%Vɻ0Pؕd%1҃ uuhV%貼Yt{ tjjM UNXZ[ލV0SVS1d%@1҃utS@Xt"{ tS) X[ڋdh@1ۅ1ۅut% t$y tIヽuc11ۅut@1ۅu2u. uh}%R60PE 0t,%@1҅ut0PhgVjW0PH8[^ tWhijjȲՋd%@1҅uu hv%S[u u0P衃 yh%dhÁ@1Ydh0Phjj0@+0Phj 4@P辵$ZYy1h|K'h%Ĺ[^j1ɉ$ 1Dž$d%1҅ҍ0uuS蟁Z@uh|K'h%nY^PS譽XZt;t HptqrP P藺XR諕1ɉ^WSq _ZtPҟ^}rSaS8Sw;@".tP7[hӃ@tRt \tBh%Bh@Yu&j$RPu @uh|K'h%PXZ襹l輔h:.$觔$ht(P1h|K'h%&h|K'h%e[^_]ÍL$qUWVSQ,Y1P951󫺌95108@<4h%S,9 H0"$Pj'Z7%Z757f951Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f95F누0f95%1ɉLj LP57c[ƉP 8u!78tL8u ;Ph%kj LP57 7 ~:t L9t Rh%:5 Z7@st8h:%jE Z7jh:.]1|&.&.&.XZ#7@ Z7j LP57L&.7 :t L9t RhZ%j@=Rhn%塬7< Z7 8LP57H7_X:tL8t Rv)ݝ Y݅ t,j蛘Ph%=&v Rh%EٽFfF fD٭D߽ ٭F $5|&.=&.߭ \=&٭D۝ ٭F &.xy57h% uh%a&.^ Z7[ht h%j LP5747 4x8tL:Ph%'0%Z7 Z7 Z7 Z7 75B.tDFu h6%4B卅(R$R RRRRR RRRRRRRRPh $Q ƃH1Ʌ~ )1Z7hQ$zY18:5@9u919~8:5Ph((#zGXZj y Z7t1DžtDžxDž|Dž:hh:7Vj57[JtPIPh_%h:7pH0:7P,:7PI Z7@Yj LP57=&.7 x:t L9t Rhz%=hh%Z7% - Z7zZ7%Z7% Z7RLP57C95XZL8u 57h֕$@LP57C95^_L8u57h%p3.,)HtN:4Z7j.V芍Y[Åu V輸Z)?wSVPƄ t@B.t B.fA۹1󫍅P$tKjKPPtSVPqtPdP}v$TVh%j Hd`hSVj S;XZ7t=&. h%\Xt1DžtDžxDž|Dž:hh:7RjV?GtPFPh&$jh:7HtΉ5$:5pu hD%HL:7p pp;(:7 y h&GZ7@t"5,:7h0:7PM t h%@1DžDžDž:PtPj@PFtPEP@hW%jxtZ7t hz%ZXppj0j)5(:7 t h%YjEXZ7tVDžjSj'j)5(:7 t h%jSj(j)5(:7 t h%iPC^P8Z7^_Шu h% u0&.1҃‰950@s Dž@0 1ɉ 95&.@o,Zu h%Rtd :5:51:5:5DždZ7@t8jdPjh5(:7@9s0:5@Dž@=T:7u(jPj j)5(:7F@u h-%(:70t/҉jRj*j)P @u7hA%YDžjRj+j)P@u h^%,Z7%u) t DžDž j Sjj:5(:7ky h{%Z7t-DžjSj&j)5(:75t h%=&.t188tb VY~_u h%T955951҃8t4P 1 C)C.C,ރ 9s11ۃ<t/8<\y8BYu19595@,9ffffUSk hW u=ƃhW C.tvstA)v[]ËP PDlW UWVS  EuFN 910u$Xx}xWx U 9s?uɉtE艘r ur u쉰r Eƀ r  [^_]ÉtE艘r ur u쉰r 1 [^_]UVS/ u4$'kD$4$jt$l $Wj[^]USt t[]E D$D$ED$ D$D$L5$ant} tǃ []Ë$Ë$Ë$Ë<$Ë $Ë4$UPps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%ubusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260130235106Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluCould not find index %dDetails for index %d: StartType: %s (%s) None (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?] %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addresspltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260115NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: ND options: DHCPv6 options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %snd_dhcp6_unknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completemulticastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s%s%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist